1OLXB

Roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
341
structure length
335
Chain Sequence
AHFTFQEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYASQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of His291-Alpha and His146-Beta' in the Reductive Acylation Reaction Catalyzed by Human Branched-Chain Alpha-Ketoacid Dehydrogenase: Refined Phosphorylation Loop Structure in the Active Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
total genus 124
structure length 335
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2003-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1olxB01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1olxB02
4KXVA 3EY9A 2O1XA 2E6KA 3AHDA 1T9CA 1X80B 2YICA 2NXWA 2PGOA 4QQ8A 1W85B 2VK8A 4K9LA 2JGDA 4JU8A 1TRKA 1TKBA 5I5EA 1Z8NA 1ZPDA 3M49A 3IAFA 2JLCA 1WCIA 1T9AA 1RP7A 1OZFA 4QPZA 2C3OA 2BEUA 2IHVA 5HHTA 2PANA 4JUCA 2UZAA 1YNOA 1UM9B 4MPPA 3ZHVA 1X7WA 1W88B 3UPTA 3HYLA 2JI9A 2OZLA 2UZ1A 2WVGA 3DV0A 1ITZA 3LQ4A 4QELA 1NI4A 2JIBA 3EXHC 4K9PA 1JSCA 5HYVA 4GP9A 4MPJA 2R5NA 2C3PA 5ERXA 1T9BA 2BFBA 1V5EA 2V3WA 1UPBA 1X80A 2EZTA 2IHTA 2BFEB 2JLAA 5HJEA 1X7XA 2VK4A 1W85A 4K9QA 3EXFB 3F6EX 2C3UA 4KXWA 4JUFA 1Q6ZA 3ZHRA 1YI0A 3ZHSA 3AHIA 1V1MB 2R8PA 4GM4A 3EYAA 1GPUA 4XEUA 1T9DA 2Q5QA 2J9FB 3EXIB 2R8OA 2BEVA 3DUFA 2EZUA 1V1RB 5K6TA 3FSJX 1V5FA 1TKCA 1YHYA 1DTWA 1X7YB 2OZLB 3DV0B 1KEKA 2UZ1B 2O1SA 2YIDA 3AHGA 3EXHB 3F6BX 3HWWA 1UMCB 1NI4B 1NGSA 2PDAA 2EZ8A 2BEWB 4GM1A 4JUAA 1UPCA 5K3SA 5AHKA 4MPRA 5DEIA 3OOYA 4JU9A 5EJ7A 2Q28A 3IAEA 2BFEA 3FLMA 1X7XB 1AY0A 4Q9DA 1V11B 2IHUA 5EJMA 1MCZA 3D7KA 4GPEA 1YI1A 4K9OA 1OZGA 5FEMA 1YHZA 1V16B 1U5BA 1YBHA 4RJKA 3AHEA 1R9JA 1V1MA 3AHCA 3DVAB 2X7JA 4ZP1A 5C4IA 5ESDA 1OZHA 2Q27A 5K2OA 1PO7A 3LQ1A 2QTAA 3AHHA 3ZHTA 3AHJA 2XTAA 1UMBB 3UK1A 5EJ6A 3JU3A 2VBGA 2WVAA 1DTWB 1UM9A 4JUDX 5DGDA 2BFDA 3ZHQA 4C7XA 3EXHA 1OLSB 2BEWA 2BFCA 1V5GA 1POWA 1B0PA 2C42A 3EA4A 2BFBB 4KGDA 5EJ9A 5DGTA 1PVDA 4D5EA 3EXG2 2BP7B 1V11A 5ERYA 4JD5A 4K9MA 5EJ5A 2C31A 5I5GA 3EXFA 3M7IA 3AI7A 1OLUA 3DVAA 4COKA 1X7ZA 1UMDA 1POXA 2JI6A 5K6RA 2VBIA 2BEVB 1L8AA 1QPBA 2G25A 3DUFB 1UPAA 2Q29A 2Y0PA 3EXIA 4FEEA 1PI3A 2Q5JA 4GG1A 2JGDB 5HGXA 4C7VA 2BFDB 1X7YA 3M34A 1QS0B 2G67A 5I4IA 1OLSA 3LPLA 2JI7A 2VBFA 2BFCB 3LQ2A 2EZ9A 1WCIB 3MOSA 4MZXA 1Y9DA 2Q5LA 5IMSA 3KOMA 3M6LA 2JI8A 1N0HA 2PGNA 2BEUB 2XT6A 2FWNA 2BP7A 3EXG1 2BFFA 1OLXB 1PYDA 1QGDA 3EXEA 2AG0A 3FZNA 1IK6A 2IEAA 1U5BB 1V16A 3AHFA 4KXYA 4WBXC 1X7ZB 1UMDB 4FEGA 3ZHUA 2G28A 4D5GA 2AG1A 1OVMA 2FN3A 2Q5OA 4JUBA 1UMBA 4KXUA 5EXDA 2DJIA 4KXXA 5EXEA 4K9NA 3E9YA 3RIMA 4K9KA 1QS0A 2VJYA 4RJJA 2XT9A 2VK1A 5I51A 2C3MA 2EZ4A 2J9FA 3HWX1 1TKAA 1YD7A 2C3YA 1V1RA 3OE1A 3L84A 1BFDA 2BFFB 2W93A 1OLXA 3EXEB 1X7WB 1W88A 2WVHA 5EJ4A 4RJIA 5EJ8A 4GM0A 1UMCA 2QTCA 4MQ5A 5EJAA 1OLUB
chains in the Genus database with same CATH superfamily
1SCNE 3P96A 4PTZA 5ITZB 1GV0A 2RHDA 1XN4A 1GGNA 3JRXA 3RK0A 5CLJA 3EIWA 1V6CA 4G5OA 1YKFA 4D92A 4LF6B 1E4VA 4IBOA 5LMCA 2R79A 3L0YA 1XMVA 1ODJA 3AR3A 5A6SA 1QF7A 3G68A 4QOEA 4QOGA 2UV8A 2UUCB 2VPPA 1DFIA 3AERB 1OZFA 2CV2A 3O31A 1WV0A 4IFEA 3GCDA 4WBNF 3RUDA 5BWOA 4X54A 1O94C 3EGWA 4CM6A 2XGOA 3IKTA 3AMVA 1HV8A 3I9FA 2Y6VA 4BBAA 3KYCB 2V3WA 1A9OA 4NENA 3ZD6A 2CXNA 3A6JA 1P3DA 1I2AA 4I3GA 4QRDA 2BWJA 1M0EA 5C53B 1N2EA 1OXSC 3I9V6 1BROA 2IS6A 3TRHA 1WLSA 3UJ9A 4G89A 1X1RA 1I7PA 3E05A 4JA0A 4HAOA 5BN4B 5JJBA 1ZCZA 3EDCA 4UVGA 2TMYA 4RD6A 4H6XA 4WCFB 3HA3A 3LQKA 3WWZA 1U7XA 3AONB 4ARSA 4TKVA 1NN0A 2P4HX 2QRZA 1ZIDA 5KOIA 3VJLA 4A2QA 2D5BA 3R2JA 2VRBA 3M9XA 4I8IA 2IDMA 3A0UA 3GRAA 3MT0A 1DUSA 2ETVA 1L4BA 4GOLD 2CXOA 1KO1A 5DX8A 1GRQA 2YRXA 1E4OA 4FOPA 2F1KA 2HF8A 4Z8XA 5FFFA 3X2EA 3S8MA 2HTFA 3COZA 3GGDA 5KC8A 4D79A 2DJ5A 1OI7A 5LQUA 1QO7A 2PFSA 5DSTA 4NDZA 3ECSA 1R15A 4MKGA 1VA4A 2F1HA 2UYYA 5JBNA 4UBNA 4BTEA 5KYYB 1Q57A 1XDZA 2FR1A 2IP2A 1AQYA 3NJ8A 4B2YA 4UATA 1U8CB 3L6RA 4WLVA 1Z5GA 4C4XA 1XMOB 1K86A 4JVLA 2C4VA 3G9ZA 4B7UA 2GKGA 1P0FA 5AOAA 5EPOA 3ACCA 4R98A 4I14A 2P6OA 5L4LA 1ZN8A 4MS1A 3TW6A 3L8FA 3WYBA 3QOFA 4AT1A 1I33A 1DZ3A 1FP1D 3C1AA 3KCNA 3IR5A 3IAM1 3O03A 2VAPA 4GOOD 4J43A 4KJXA 1SKAA 2OR3A 1UJNA 4JT9A 1TU4A 1YQGA 2FGKA 5K0TA 4G9BA 3AFGA 2KBFA 3R5HA 1MGPA 4JXZA 3K5WA 1DZIA 2Q2VA 2PBFA 4H7KA 4DSZA 4F12A 4R68A 3K5HA 2TYSB 4G9EA 2V7PA 1UBUS 1YR6A 2J3DA 1J2TA 2W2MA 3DM9B 4LDQA 3SR4A 4C0HA 3C3PA 2D3TA 5E3JA 4BLRA 2C20A 4RTQA 1LLQA 2YS6A 3IULA 4LZWA 3B60A 3T06B 4F3RA 3QVMA 3UT5B 4KFCA 1CULC 1V9LA 4ERNA 1R4NA 3O8OB 5IS2A 4B4KA 4ZJYA 1S3IA 1ZUHA 3UWMA 4YP9A 3QF7A 1IDN1 1YVPA 2ZSBA 4B4OA 3OY2A 1SBYA 5J5CA 1EX9A 3HKCA 4MKRA 3OOSA 4XUGB 2OHVA 4RHXA 4EUFA 4QUDA 1KS2A 3DUWA 4QIHA 4RTJA 3KZ1E 4BFXA 1YS2X 3HJTA 4RVHA 4RKFA 2J3JA 4LOIA 4WXEA 4I9NA 4BU0A 3R75A 1KY2A 1Q11A 4CR8A 4OQXA 3GDHA 3QNWA 1RP7A 1WMSA 3BJZA 2Y71A 4IIVA 4L5AA 1K6JA 3CEAA 4OEHA 2X9NA 4ZC8A 5JDCA 2UZ4A 5F76A 1VSTA 3I52A 5EIOA 1H5QA 1P9RA 2KHZA 1X3SA 4U6QA 2DHQA 3N1UA 5LP6A 2GAFA 5DH9A 3VXKA 5EHXA 4IZHA 1HNXB 1UQUA 1E6KA 1XVIA 2HCRA 1PJ3A 2GCIA 2VK4A 3EZ7A 3WZ2A 4D8XA 3AKZA 3HPRA 3ICCA 3L77A 3PUWA 4GXQA 4RZUA 3W6UA 5AKXA 3D3WA 4Z8YA 4PHHA 2BRUC 1WXEA 4KNYA 4EAQA 3AB8A 1AKNA 1NL3A 2GM5A 2J0UB 1RWBA 2X41A 1GPWB 1PNQA 4IDEA 4MS3B 2VJDA 3WJ1A 4WEOA 4MVXA 1QC5B 3OCYA 4TL6A 3X1XA 5CT4A 3VPFA 1ILEA 3R0JA 2IRWA 3H8VA 2P5YA 5EXPA 1KAHA 2GASA 3IJEB 2J08A 2Z30A 3EQ6A 5ER9A 5BSWA 5HTOA 5KKCA 3SZRA 5JATA 1PVVA 3CH5A 4WBNB 4IV5A 3Q6IA 4JP2A 3GLGA 2P9GA 3VAYA 2R6R1 4WZBB 1F6BA 4B79A 3VR0A 4CWAA 1KDPA 1KPIA 3LQ1A 4P4LA 4AUKA 5EKSA 3TPFA 4WMLA 4QDTA 4I6JA 3T7DA 4D9GA 1AMOA 3IDOA 5JRJA 1RIIA 3G2NA 1DAKA 4NU6A 5C8YA 4LXUA 3G7SA 2Q62A 3KU4A 2QJTA 1POWA 1AU9A 3WB0A 4KWEA 4GLBA 5JAIA 4HYEA 4MW7A 3S81A 2C59A 2BP7B 1L4KA 1V11A 3QP9A 3GLHA 3HNPA 2QSYA 4NYIQ 4O29A 2R1TB 3W6PA 3HU5A 3H2ZA 4RE5A 4B7XA 5M7EA 1B73A 3CRW1 7GPBA 1BYUA 4IOKA 3RTCA 1ORHA 4HDSA 1KSJA 1NF8A 3GYGA 4FR2A 1PV4A 1KMHA 1VPEA 3JATA 2R6HA 4HNQA 1GCOA 3C3AA 2HJHA 1QCYA 2ZPAA 3MYRA 1JSLA 4L5BA 4OQZA 4JWTA 3T9FA 4D41A 3TZLA 2W2NA 2R7MA 2PK3A 3I2GA 5KCZA 3QW2A 4OSOA 4TXJA 3CWCA 4DBVO 1ONSA 1SUSA 4YV1A 4TWIA 4D57A 3AB3A 1SCKA 1TT7A 2IOQA 4L78A 5ISMA 4RTMA 1Y8QA 1R16A 3O83A 3R9XB 1B00A 2LZ0A 4O4HA 2MJLA 2BGMA 2X77A 4GGMX 2WNSA 1MMFB 3LP5A 3OMLA 4PLZA 4CKBB 1JLSA 1E2UA 5F5NA 2QX8A 3ZWAA 4CQNA 1XCLA 3FWHA 3TG8A 1EIWA 3IVRA 3G2JA 2P2YA 4G5SA 3A1UA 1E5DA 3T1VA 1A72A 1TKAA 1XF9A 5LYJB 1JNXX 3AUYA 4RFSB 3QHQA 5FOUA 4PYJA 2QN7A 3RVJA 4AYWA 4CTKA 3L6EA 2ZJ4A 3ZDAA 1JLMA 1Y6FA 1H2YA 4R2JA 1ZM4A 4CM9A 1DCKA 1GP2A 2FP4B 2HA2A 1X15A 3EPJA 4B84A 1HG0A 1Z4IA 1OI2A 1MDBA 4QC2A 5LD2B 4DC0A 1EBBA 1Z07A 2C9MA 4RHFA 4XD2A 1P6UA 4H6VA 1KZ1A 1WQ1R 3DCJA 1QG2A 2E4UA 3I2IA 3ZTTA 1Z5NA 3FVWA 2C3OA 4B71A 3TRDA 3FKJA 3HCDA 3ZDBA 4YY3B 4BB9A 5FD8A 1U3DA 2I6FA 3CKYA 3PWZA 3FPCA 3KTFA 4MARA 3VDRA 2JFHA 4ENQA 1UPUA 4LJLA 3LRPA 1GQRA 4B6SA 1F48A 3N7TA 4M0MA 1GTVA 1O6GA 2QLNA 1NR5A 4R0VA 4CCSA 1BAPA 4CIDA 3GEBA 4Y6LA 1RWPA 2XQKA 2BGIA 1JFFB 4DFDA 4DNOA 1R3DA 5DO9A 1E61A 2YJ4A 1XVLA 3GD7A 5H02A 5KSPA 1DCTA 1FBTA 4AZSA 4TYWA 5D5HA 2NZWA 2R7NA 4B0PA 3TGPA 4D42A 3TKAA 2HPHA 4PC1A 4G67A 5E4TA 4FOTA 1HDIA 3WNZA 3OQVA 1V8DA 2RGRA 3IIEA 1OH6A 1CF9A 4PSCA 4QT4A 5KOHB 4FI3C 1W2WB 2DY1A 1KJWA 1NNSA 3HJAA 1WRBA 4ZP1A 3IEIA 1ADFA 2GJ9A 2L2QA 3TNYA 4GI5A 5BN3B 4ZICA 2H4JA 4C7JA 4EFLA 1PU2A 2OV4A 2W6ID 4GNRA 4EHLA 2YV2A 1PZFA 1JJVA 2VS1A 3DD1A 3GT0A 4KTTE 2ADMA 3RUCA 3T1HB 4EFMA 4AP6A 4D8UA 1V48A 3EARA 5G41A 3NATA 4PQEA 4QXRA 1CDDA 5ENZA 3TUJC 1WB5A 4TVOA 2QE7A 1YIOA 3L4JA 4YV0A 3DBLB 2N0SA 2WJ6A 4HYQA 3LZ6A 4S12A 3A6EA 1TADA 1GRVA 2ZZKA 4IUBS 3OQOA 5CVCA 2Z2YA 2O3QA 2Q1UA 5FNVA 2ACEA 3EWNA 2CNLA 4Z4CA 2B98A 4K6FA 2W8ZA 4BP9A 1HLGA 1YS1X 3H1PA 3K1JA 3K6JA 3MTGA 3O74A 4MA5A 2PRJA 4FD2A 5L3RA 1X42A 4M22A 5GZ3A 4E4YA 3KV3O 3UAYA 1Q44A 1J7KA 1UODA 4MVJH 5E8RA 4QUBA 4K6CA 1Y1PA 1YB4A 2IEZA 2OMKA 3DBOB 3AU9A 5AKHA 5AKLA 4OH1A 5C3UA 1WCXA 1GDDA 4WZBA 3IVXA 3ESBA 2QRPA 3WP1B 2ARKA 3UJ6A 4FYHA 2VP3A 3BAZA 4X1OA 1IEQA 3NTXA 5BNTA 1QUFA 1JSXA 3A25A 5FRDA 5IG2A 2IA5A 5JXWA 2PX8A 3KQMA 1DTEA 4DZTA 3UPDA 5CG1A 3FOFC 2NO4A 2VNIA 2CV0A 2YC4C 1P3JA 3HLTA 2YXLA 3E5NA 5P8WA 1OVGA 1V1RA 3BICA 4PINA 3ZEAA 2ODAA 3OAAA 1R0LA 4ZT6A 1CUDA 1Q0UA 2Q9CA 3DOFA 1P7CA 2V98A 4LDJA 3TDMA 1P4AA 3EUFA 5FWAA 3ZWYA 3RQSA 3U4QA 3AX6A 3EZNA 4BY9E 2X3YA 4OMUA 5DW3A 5JYCA 4C03A 1DQZA 3OO0A 4M0PA 2M1ZA 2IOFK 5ALSA 4NOMA 3TVYA 1LDBA 1LI7A 4NATA 3OFVA 3TL6A 2EFHB 3PX3A 1GEEA 3DNFA 3H2IA 4L5IA 1QJ4A 4FHGA 4QPZA 4UQOA 4KO2S 4MJXA 4ND7A 2OBMA 5ARDA 4X8LA 3E5MA 3SEAA 3IIJA 2ZJAA 4BNXA 2ZKLA 5D8DA 5HKLA 1D7OA 4ACBA 3UMCA 1YAJA 1NI4A 1Z0ZA 2A1UA 2JKZA 4OHPA 4Z4EA 3LNTA 1YTLA 3GRVA 4UE3S 3C43A 1E98A 2GBIA 2ZUFA 1EHIA 1VIDA 1WP4A 2IT1A 3ETEA 2J4FA 3K2EA 3WGLA 3ZCQA 4DEVA 1KEPA 3S2SA 2IDKA 3F6EX 3L2OB 4WAUA 1RRMA 3I04M 2D2IA 1K4MA 2OMEA 4IJKA 3SSAA 1GVHA 5THQA 3WLRA 4LFAB 3FTDA 1SULA 2WWXA 1I1HA 1XF1A 1VJTA 3K94A 4PTYA 1D2GA 4JLMA 4UTPA 3V9PA 1Y1KE 3KJXA 5HW0A 3QUAA 3G8YA 2BHLA 1L8XA 2AKEA 4PXAA 2ZS8A 2XBUA 3LMKA 4UFPA 1JAZA 1OILA 2I66A 2JVKA 1EM8B 1CUBA 1I6WA 3C1TA 3KOXA 3PQ2A 5D51S 4BQNA 2L0XA 4KQ1A 3J81k 3V8MA 4ODIA 1AUOA 2WIJA 5J23A 1G2PA 2HFJA 1EIZA 1D0SA 1THMA 3CXUA 3NAMA 2FZ4A 1FLNA 1H05A 1O5OA 2Z5VA 4UUBA 1H65A 3O8LA 5ALLA 1FJ2A 1JKJB 3MNFA 2QV0A 2L17A 3HJCA 1HO3A 1XD9A 3N2LA 4UMFA 4DCJA 3L6BA 3ZHOA 1A8HA 4F3NA 5JZBA 3WL3A 1CRLA 3NUZA 4BMPB 2O06A 2HPZA 3DZFA 5BVHB 1YV9A 4X63A 1AMNA 4Y9RA 2AKAB 3UGKA 4C4RA 1SPBS 3MT9A 1Z4PX 1MXHA 3KYJB 1AK2A 2XNHA 3R7NA 6ABPA 3E48A 4HN2A 2WU0A 3MMPA 4FOOA 4PTLA 5C8ZA 5DTQA 2H2GA 1AN0A 3N2ZB 1UIMA 4NS1A 2G25A 3N6RA 1K92A 4R2IA 3H7IA 2J5KA 2ODBA 4XM2A 2A5YB 1QAOA 1UJ2A 5F35A 1QO9A 3S27A 3ZG6A 2NPIA 3U61B 2BFCB 2OAQ1 4BJ3A 1W93A 4X45A 4Y2HA 3VOAA 1E3WB 1FX0A 2GVZC 4B09A 1CUGA 1R9MA 3ESCA 4M1ZA 3EN0A 2ZRJA 4Z2YA 3SQNA 5JO0A 2DFNA 4NBVA 5TARA 3NYQA 2G04A 4O1MA 1S89A 2AHOA 2HZBA 4W5WA 4LZJA 3ZD8A 1EXDA 3TCNA 2I9KA 5A0VA 3DMHA 4X41A 1PFUA 2X1VA 2NU9B 2IHZA 5F78A 5FIUA 1EXNA 3IB6A 3KT0A 2HSDA 1H23A 2H1OA 3PUZA 3V42A 2G9UA 1L8QA 1W47A 1WHTB 4AJ2A 4TQ9A 2ZJ7A 4F3CA 2LXNA 1ZINA 2J8ZA 3QLTA 3OE1A 4LZNA 1KTVA 1VCMA 1DFGA 2PWPA 4MI1A 1Z36A 3A3PA 3VGJA 2ZRAA 1E58A 4CTNA 4KMSA 1WTCA 4HEA1 1Q0ZA 3NBAA 3K71B 1Z2EA 4FGWA 1FVOA 3TZ6A 1U8ZA 4FUTA 1ZBDA 3K0CC 2O8FA 1VE7A 3L1JA 3I28A 4QFCA 4RLQA 3ZLUA 4EZIA 5K3FA 4ALIA 1YTUA 5DISB 2BFWA 2Q46A 1GEGA 2P2GA 1JBQA 2V58A 3EIFA 3GK3A 4FJ0A 4HF7A 4HADA 1T3LA 2C0PA 1BQ3A 1YVDA 3E84A 3GG2A 3IAS1 5I7VA 2B8NA 3IV9A 1Z0FA 3W5UA 1RYZA 4DIEA 2IHJA 4MR7A 4B6OA 4EYQA 4S1PA 2W0SA 2P9HA 3STHA 5NULA 3T5BA 4KW7A 3OZCA 3KSRA 1JHVA 1TEVA 2OC4A 3CZQA 1Q7BA 1M6VA 4L08A 4S0ZA 5IDVA 4D97A 3B52X 2P9YA 4OLBA 4R05A 1BDIA 2VRNA 4FMPA 4IDQA 3OZIA 4CLRB 1F6DA 4EF5A 4D80A 3SX4A 1DRVA 1PTJC 3E61A 3DZ8A 4EPXA 5K0ZA 3I32A 5TVGA 2KBEA 2OD7A 1H66A 4ZARA 1V9CA 5BYKA 2C1EA 5BXYA 1Z25A 5EQFA 2ZOSA 1UPCA 1NW7A 3I37X 1T5BA 5EQTA 4V02A 4QTXA 2OBYA 4OREX 4UJ5A 3WJ7A 4OA8A 4RA6A 1NQXA 1VQ1A 1YNSA 4TVBA 3C3XA 3B53X 1Q22A 2FK8A 2L19A 3CW2A 2HK7A 2IYWA 3DEJA 3KYDA 3L41A 3QKWA 4IEFB 4Q21A 4E5SA 1V1MA 5K2OA 1IXSB 2X5XA 5IUKC 1OF1A 4KLAA 4RQAA 4X62B 3V7YA 4FGUA 3ZV5A 2Y4OA 4MRMA 3M3PA 3Q15C 4BVBA 3OD1A 3M8KA 1NTRA 3R6GA 3GLFB 3H2BA 2Q6TA 3U9SA 3W90A 2IYQA 2DVMA 2VQ6A 4L95C 4ZYYA 2J0VA 1FW6A 1ZJ4A 4JS0A 4PC7A 2NZ2A 2EQ5A 1J7JA 2VL7A 3P9ZA 4V38A 4OJNA 4RLFA 1A7UA 5IAAA 1GNPA 4NZYA 1JLLB 2FN8A 4RVSA 3HDVA 1KQNA 3NETA 1YOBA 3EB9A 5TLSA 3PC2A 3TOSA 2RHMA 5BNIA 1C3LA 4XFKA 3WWYA 4FKZA 5DM2A 1U1GA 3TSAA 4Z7JA 4EJ0A 5A7FA 2JS7A 2DCMA 3G7UA 3GNTA 3R0QA 2LGJA 4R8RA 4ZD6A 2YIMA 3EFEA 3F5DA 4XKJA 3HCCA 2K6GA 2ZKIA 2Q5LA 1N0HA 5IK2A 5IYZA 3VDQA 1EFAA 5E38A 5TMDA 2I65A 4DQXA 1Q6YA 2A67A 3NO4A 4ZCQA 1XTJA 3TLJA 2PUBA 3QKRA 2M6KA 4M87A 4S1WA 3BFKA 1PEDA 1ZONA 3LL7A 4RZSA 1BD3A 4MW6A 2NUAB 1WE2A 1T1IA 4YROA 3NT4A 1GAXA 4FTWA 1G8JA 1BX3A 2NT4A 3X2SA 4C06A 1GTZA 2A78A 4BYGA 2PUAA 4BXOA 5JC1A 3WK9A 4NEHB 4EA9A 3LW8A 1VB3A 2NTEA 2W8BA 4DW8A 3X2FA 3ZU4A 1CUJA 4Q12A 3D3JA 4J0FA 4AROA 1JSRA 1BE0A 3LDHA 1KNQA 4PX2A 5AHXA 1YACA 4HZIA 2VP9A 2WB2A 1V2GA 2P41A 2WTXA 4DSNA 2CXUA 3NIBA 3GEMA 1XZHA 2YXNA 2IS1A 3P8ZA 3TLMA 4BQPA 3CVXA 3WZLA 4FMBB 3N8DA 3DLHA 1C0KA 4PRKA 4UOEA 4C7BA 4GOJA 3HUUA 5JNTA 1VSUA 4DMGA 3AOGA 1N5DA 4XQGA 3FPHA 3A0RB 1HQCA 5DFAA 5AW4A 1UBFA 3HYCA 3PT5A 2XZDA 3TF5A 3FCCA 2WSYB 4G5HA 2JFOA 2PR7A 1ODFA 1DPFA 4Y7CA 1ZI8A 5J5VA 4JSYA 1RYMA 1E6WA 3DVSX 4LUCA 1W9MA 5TY0A 3VISA 4HO1X 1R3UA 2FN4A 4RA6B 4ESEA 4GXTA 3FUUA 3WIBA 4U2DA 1YDFA 4F6RB 5A02A 3EPHA 1AKRA 3PCTA 3ZE2B 5FX2A 1KK3A 4RCYA 1FY2A 4V3CA 4HTFB 1JLHA 1MBZA 1OI3A 4YHHB 4EVRA 3P0HA 1ZP6A 1RM0A 1IY8A 3HV2A 3LW7A 3R3HA 4ME6A 1F6WA 4YH1A 1F2DA 2CEKA 4YAWA 2O8CB 1U6IA 4NECA 4IDDA 2OV2A 5FBLB 2H7YA 3V1TC 3U37A 3HCEA 2D00A 3D8NA 3O3CA 2QQFA 3NWPA 4FYYA 3H9CA 4IQGA 4H2DA 3PRJA 4DJDC 3DAFA 1O96A 2SKDA 4YGYA 1VLQA 3RRBA 4GOMD 4DVGA 3O8DA 1TYAE 4AMBA 2D7JA 1Y6ZA 2JC3A 3KVOA 2IH5A 2Q27A 4KR6A 1EVLA 1M1UA 2HI0A 4O4IF 1Y3HA 3OA0A 4RH1A 3SHOA 3E53A 3QPBA 4UPDA 4F2WA 1MOPA 4WX2B 4YRFA 2B83A 5KPJA 1PSZA 2ATVA 5HS6A 2UVQA 1D2HA 4J1TC 3SFTA 3V8EA 1L3CA 4MV4A 3K5IA 4Y9SA 2C4KA 4KQ6A 1ZJ5A 4A0RA 4HB3A 5JJCA 2BMWA 2JIRA 2L18A 1Z0AA 4LXGA 4PYNA 3PGA1 2VRCA 3Q3HA 3TB4A 1RI5A 4G5GA 1P7YA 3QNMA 3BL5A 2KE5A 2ATEA 5E0OA 2RB5A 4N5NA 2P0AA 3DZDA 5DT2A 4KIJA 4L73A 3UOGA 4AD8A 4KR3A 4KWHA 3URKA 3I5AA 1BQEA 3FVRA 3WRXA 2VJNA 1P4SA 2BM1A 3FCEA 1R50A 1USWA 5EIBC 3GZNB 1HNZB 4KE6A 3NT5A 1U65A 2AMVA 1YH3A 3CZ4A 2Q5CA 4P80A 2O2ZA 4DLUA 4L4SA 1Y5IA 4Y6PA 4EGQA 2IOYA 1DDOA 1E3DA 1NXWA 4CEJB 1GQQA 3L01A 3RIMA 3D7MA 1QPGA 5FUWA 5DSXA 5JS6A 2WJZB 3RSSA 5BRJA 4AWXA 4YK7A 4MRRA 4PLTA 3HYNA 4N5DA 1O4VA 1U2EA 3AP2A 2AMYA 3EXEB 4B46A 2H7CA 2GD2A 4Q1AA 2Q2QA 2BZSA 4DYHA 2P5SA 4IRUB 4IZOA 1K8YB 3OZDA 1U0TA 1CIPA 3W2FA 4ZZ3A 2YRFA 4QQ8A 2MSDB 1WSAA 4NMWA 1C1YA 5HKOA 1XALA 2OZEA 4PX3A 2GYVA 3O95A 1RRGA 1WZEA 3O4IA 4CKYA 4AS1A 1E2NA 1JILA 3HHPA 3RVDA 3QPDA 2O8DA 1KQFA 2F1OA 4JB0A 5KNBA 4RETA 1MIOB 3KFLA 3LHDA 5A4KA 3K0SA 1E92A 3UHFA 4GL2A 1W0KD 1XCOA 2IIQA 4NOKA 1ZWLA 5JG7A 3JWEA 2NSLA 3ZLTA 3NHWA 3B9QA 1DAEA 4DV7B 1J9ZA 2YR0A 4NHEA 1UPBA 2BRUA 2RSLA 3SC2B 1UXHA 2V4ZA 3NS7A 1F9EA 3ZGZA 1AS2A 1LSUA 5DT9A 1VB5A 4K9DA 4LSGA 3GOQA 1HT2E 2HADA 2GZDA 4M7RA 4GM4A 1KYQA 5FWXB 4RDIA 2A0YA 4ND2A 4Y9TA 3GLIB 3LPAA 1C81A 3TK1A 2HHLA 1ACJA 3IO3A 2RONA 2ZBUA 3TM5A 4YJFA 5HKKA 2F9MA 4RD1A 4DLNA 4F84A 5GOZA 2JFYA 5F1PA 3HKCB 5EEHA 3ZW9A 4FZJA 4RGBA 1RD4A 3GRUA 4WEQA 1DEHA 5DEIA 3FMGA 5AW8A 1EFTA 3AV3A 1CJCA 4C1NA 2VP2A 5GJVC 1MFPA 1F38A 2KM1A 4AP5A 3EF1A 4XYLA 3PC8C 5CFOA 5JNLA 3EQZA 1QQBA 1KP3A 1OYYA 2G82A 1C3EA 2GZSA 4RPCA 2WD7A 1E4YA 3NTVA 5CH5A 5CFQA 5C9ZA 1P72A 2IYFA 1HNWB 2FG6C 1KFKB 2XE7A 3QITA 2IE0A 2PG3A 1O5IA 4ILEA 4TMFA 1OUMA 4YX9A 2QN8A 5KUTA 2P78A 3OKCA 1EBFA 3SM9A 2GFQA 2VUSA 4GI1A 2W70A 1YRHA 4BTVA 2XDYA 4PONA 3ZVMA 1VGRA 5CK4A 2B4AA 4GLFA 2RE8A 2LKDA 1XYGA 3MJHA 4KPFC 3AI7A 1KQ3A 5LVAA 3CRQA 2O4CA 2HQ1A 4M6WB 4CV1A 1YA6A 3H0EA 2FRDA 4JCCA 2PSEA 3H6GA 3LDGA 3JXEA 3CUEF 1PFGA 4UFNA 3CF4G 2XGJA 2E89A 2JI7A 3RIHA 3WNDA 2OYSA 3QOXA 4C5BA 1A4XA 2JRCA 2VJAA 1QO0D 1SCUB 1LVHA 4L5JA 3CT6A 4NNPA 1BE6A 4IOMA 5KYVA 4MRVA 3WGMA 3EJ6A 3WK5A 4EJMA 2DUJA 3ADKA 1LCIA 2CFIA 2Y99A 4FJ2A 2JG3A 4I9UA 1ZMTA 1GU7A 4G9GA 5GQSA 1PGOA 4MGKR 1RZUA 2PUHA 3W9YA 5ALWA 3WGQA 4H7EA 1H9CA 4C2TA 2PNJA 2BKEA 4NU0A 3S8EA 1UEXC 1U31A 1U63A 1DHTA 3KELA 3ND7A 1HDOA 1U2DA 4R2LA 4XX0A 2A9VA 2PS3A 4KUHA 2ABWA 2IPAB 4DV5B 2QRGA 3DF9A 1HL3A 4V39A 1U11A 4YMSA 1E4EB 5K3EA 2OM6A 2WAOA 1GSOA 4M49A 5I4BA 1H1LB 2B94A 1NI5A 1FPQA 1OLUB 1Z47A 5I48A 1SCBA 1QM5A 5I6DA 3IHLA 3OJCA 2NU9A 3FNEA 2GHTA 4G41A 2FDCA 1KJNA 2EP7A 4K9LA 4OTZA 4BMVA 1H42A 3LD9A 3TTUA 4EHIA 1RFGE 2WDZA 3ZWQA 1GM5A 3WKAA 1F8GA 4H27A 1RXYA 4P3XA 4UREA 1A0OA 4CHTA 3GPLA 2I78A 3UCEA 4N8SA 4ENUA 1T1RA 3HXLA 4LWPA 3TXYA 4D0GA 2BGWA 4FE7A 1Z45A 2XITA 1L1FA 1K89A 4O3MA 1UJ6A 3CNLA 4TXLA 2NO0A 1P91A 4O0LA 4BV8A 4BE4A 1NJGA 3ESYA 3RLIA 3OE7A 1I6MA 1PK9A 1XLVA 2MWMA 4EGCB 4AG3A 1NG1A 3B3JA 2B1JA 4RSMA 5JWOA 2FSFA 3DEKA 2YJ3A 3H5NA 5JALA 9GPBA 5AHOA 4KX5A 3GGJA 2E49A 5ADUS 1YRQA 3R3XA 4KO8A 4BRWA 3CLUC 5CB8A 2O59A 3ND8A 4FX5A 1Q95A 3JQAD 1Q1BA 1WULS 4CZ2A 4EB3A 3PXCX 2ZQ5A 3SWWA 4MV1A 4QU0A 1XJ5A 2IU4A 2DKNA 3JYLA 1MOSA 2J6HA 3FSRA 1C5KA 1UBTS 2X0KA 1DKRA 1M1ZA 4OIMA 2V7QD 1HTWA 5J58A 3FYUC 4OHOA 4X61A 3HH8A 4Q9LA 1IFXA 3MOGA 5GZ1A 2WF5A 2AG5A 1W76A 4BASA 3KDAA 3VR5D 3HN2A 2PT7A 3VI3B 4M9XA 1H4QA 1M2JA 2Q0XA 5ETJA 1GZ7A 1K68A 1QNFA 2X6TA 2QXUA 4PRLA 4PU0A 5AK5A 5ESDA 3ROKA 3TQOA 1SEPA 4PM4A 4ETMA 5I3ZA 3RIEA 4P84A 4Z4QA 1EJ2A 1WW2A 1VPTA 2FSVA 2PUWA 4HJXA 4QECA 1EQ2A 5DYTA 4KDFA 1W9HA 3WBKA 3HWRA 3AEQA 1Y1SA 3ZJYA 2BC9A 4AKEA 4GMKA 1RXIA 4U3JB 2ANCA 2I7XA 3GG9A 1KDVA 3DH0A 3D8SA 4AF6A 4Z4IA 4FFOA 3GEIA 2O7QA 3K4HA 1HMPA 1L4UA 1YCFA 5KINB 1TEZA 3GVIA 3GEPA 1XCGB 3EEFA 1QZ3A 3P4YA 3RKUA 2YNMD 2Y0PA 1AXEA 2I7DA 1FTSA 2G9NA 4CR6A 1O9BA 2D0IA 2Z57A 3TB6A 4CKCB 1CEXA 4GBED 1GUBA 4N47A 3BMCA 4C0LA 2C7BA 5TF0A 2JLWA 1YR3A 5EHIA 1I3OA 3JQRA 1LPPA 2XA9A 4ID9A 2D7DA 2DH6A 1I0LA 1MX5A 2C9OA 3AHFA 5BWBA 4YUVA 3L0ZA 4UDOA 2ZAMA 4BQQA 5EUMA 3K2IA 3LUAA 4BFLA 4ARBA 2GZ2A 1IZ0A 4GYKA 1HY3A 3F4LA 3FCOA 3ZGXA 1KEEB 6NULA 2PAFA 3PIDA 3RS9A 3KEMA 4FBLA 2PFKA 4B7CA 2EKZA 4HNAA 5CA1B 5IVPA 3L0IB 2VT3A 5TRTA 4I9GA 3EA5A 1GPAA 1V37A 4XIJA 4QBFA 4DRZA 5H7XA 4E1BA 1WNFA 1Z4NA 3B3FA 4XDHA 4GM0A 4C4SA 4GH5A 1GR1A 5TV2A 4CQLB 2YZMA 4A27A 3QUQA 1YB1A 4D26A 4I5DA 1SCIA 3C3BA 3FDJA 4KR0A 3VDMA 5CDFA 2XMDA 2ZCUA 3TSYA 4CDNA 4X3OA 1CVIA 1R10A 2IPLA 1BX0A 2LNDA 4FGLA 3UB2A 2YJZA 2NOAA 4KLCA 1VI2A 4FGZA 1AZTA 5JDIA 1Y5LA 3BHMA 1BFKA 4ADSG 4RDXA 3EQ2A 5AVXA 2X8AA 4GZ5A 5HFNA 4U7GA 5CT5A 2G83A 1XPJA 2I8LA 2WPNA 2FSUA 3W1WA 3ESQA 1HYBA 1AVTA 3DOOA 2B34A 3ANLA 2FFAA 2ZB3A 3G1UA 4E2ZA 2CKMA 2VPXA 4B40A 4F2PA 4X1KA 3L7AA 1JBEA 2F3RA 2ZVQX 5HQTA 3DBLA 2G6TA 1RQRA 3GAAA 1E1RD 1VYVA 1E77A 1JDSA 3IVGA 4WZZA 4EPWA 1NSFA 2HV9A 2NACA 2QMUA 2J33A 2RG7A 3EMDA 4U9HS 4XD7A 5DBIA 3H1GA 3W2TA 3M6XA 1E5VA 2HC9A 3FWYA 3N87A 4PVDA 5IPFA 4N41A 4JB3A 3AINA 2QMEA 2RC6A 1U8TA 4Y6OA 3ZVLA 3DW3X 1OIVA 3OLYA 3ENZA 3TMKA 4CLOA 4CF7A 2FX3A 3NAGA 2I4OA 4MO2A 4TUYA 5FTKA 3IIIA 2HWXA 2O57A 2WFLA 2F48A 3GJZA 3HJHA 5JSYA 3M1YA 1W96A 2PEZA 3LPMA 4RXMA 4AJKA 3DVAB 3C5HA 1J8VA 1YR2A 1PZNA 3PCXA 4TTJA 3FJOA 3UMRA 1A7KA 1T4CA 1OY1A 3BXEA 2CLKB 3R09A 1YB2A 3EF3A 3TS1A 3QENA 3WQSB 1J2JA 4M53A 4Q82A 1E2DA 5DHAA 3ZCSA 3LF1A 5C1BA 2WAMA 4N7MA 3RCBA 2W43A 2WI8A 1AHPA 3ZTYA 3R9WA 2JFVA 2QJFA 4EG5A 4MLPA 4K9MA 5EXTA 5M29A 2D6FA 1Z6AA 4P7GA 5HMLA 2W2LD 1K9VF 3R7DA 1IY1A 4NMLA 4XB1A 4ZU1X 1ZCJA 2I4MA 4MYDA 1AGPA 3V9AA 2GPAA 3JZIA 2VBIA 2VLBA 4KO3S 2MCFA 4LYDA 4BNNA 3S2IA 3TINA 2VDWB 2GN4A 2LBPA 3CN7A 1VPVA 4F5YA 3I9OA 3WK4A 1NP7A 1KR2A 1OKKD 3BK1A 4G8DA 4CN9A 3D4OA 3I12A 2OBLA 4R0NA 4QOHA 3IELA 1B2RA 4UCQA 4IRXA 2P3QA 1DMRA 3PPVA 4CM8A 4DUYB 3CNNA 1AKUA 2ZANA 3U3JA 5JDCC 1SQ5A 3WO0A 5IM4A 3PNQA 3KKQA 4I46A 1H2WA 3E5RA 1OU4A 1E9DA 2W6MA 2CDNA 3AF0A 5C3MA 1JMVA 2R1UA 2O2IA 4M0DA 5K0JA 2PKYX 4G0PA 1PNOA 2PXAA 2PXHA 4LCEA 4KBFA 4PZZA 1K66A 3RO7A 1I1NA 4X6XA 2IUEA 3W9UA 3QMVA 3OD5A 3RBZA 3SC6A 5HOEA 4FEYA 4UPEA 1DKOA 4PHTA 2WUVA 2LKCA 1JTFA 3W6OA 4W99A 5BN5A 3EEYA 1P1CA 3F9IA 3DP7A 5TQVA 1TX4B 2KPOA 4M83A 4IMIB 3THYA 2XE4A 3QU9A 2EFCB 1IN1A 3ONVA 1UMCA 2ZWVA 4G8JA 1VKOA 4BO1A 3WLPA 2J3EA 4DJJA 1DIOB 5DCLA 4M88A 4OXXA 3PCRB 4EI7A 3TZQA 3UUWA 2JKVA 1W0CA 3PFGA 2FSIA 1J24A 2ZFUA 1EM8A 4KL8S 1Y1RA 2EW8A 2FB9A 3X1JA 1Q17A 1D0IA 1P4GA 2WE7A 5IVDA 4A5SA 4UVDA 1K0FA 2FDRA 4MVJE 5TNXA 4B2PA 1OX4B 3SC4A 1LDYA 1J0CA 3CZ9A 1ETHA 1K08A 4XUDA 1I4EB 1YNOA 3SE0A 3K0EA 4PNPA 4WBSA 1ECFA 5FI1B 3U6KA 3BSSA 2WHPB 3HDQA 3DL7A 1I4OA 4HAYA 5HYVA 4Q4CA 4WCFC 3G6WA 2XA1A 3DLCA 3GFGA 1IBLB 4UHEA 3OTHA 1QDEA 1C8BA 3EXFB 3I05A 3P2IA 5FB3A 2D0DA 4GI3A 1G9SA 4MW4A 5EFZA 3UANA 4TTTS 3DNMA 4OHWA 5J2TF 1TK3A 1SB9A 3TIFA 2R65A 3OTWA 4R84A 4G81A 1V1RB 3WWPA 2Z2ZA 5UKDA 4NNJA 2BMEA 2H5IA 3FW1A 2XODA 4NK5A 2XB9A 3E23A 1E5LA 4JUAA 4ZT2A 2P6RA 3U4CA 3LIIA 4QQFA 4B9EA 1Y7PA 2BI8A 3DFKA 3HMKA 5SYNA 3NHSA 3AO0B 1P44A 1NZJA 4YP1A 3IO5A 4QGAA 1CIJA 1F4VA 3NKFA 4CM1A 4EZEA 1YI1A 1H2HA 1KIMA 4FFSA 1UKYA 5L3ZA 1ZOSA 3SHVA 3WVNA 1UL1X 4D0SA 3C45A 3WMFA 2CMKA 2RHWA 2WPDA 4XE5A 3I6IA 1UWVA 1VHLA 1ADBA 4BO5A 5JBIA 1LX7A 2YASA 3UICA 1E2MA 2LRHA 1J99A 2D1SA 3OICA 1Z6QA 5TMEA 4EKGA 3A7EA 4F97A 1GG9A 4KYTA 1P2UA 1JA0A 1B42A 1LW6E 1RWVA 1XEWY 2NUPA 2PV0A 2WLSA 2Q4RA 2Q3EA 3HEBA 4L0CA 3KR9A 2EKPA 2VKQA 4DG5A 4EHJA 2CYBA 1G9TA 2QXYA 1Z4MA 1HI9A 3H87A 2RDMA 4KO4S 4QLAA 4BLTA 4P86A 1WDTA 2JBHA 3KUXA 4I4TA 5KJ1A 4O1IA 2F4VB 1R5BA 3SAJA 2Y76A 3LO5A 3DUFB 2PH3A 3CLHA 4MP8A 4NZNA 4HPWA 2O8FB 1KOFA 4IXWA 5AVZA 2OV3A 1EFVB 2XZPA 3C7TA 3RBXA 1IN6A 4KQHA 4WXMA 3ESAA 4WZAA 5FCDA 3T7RA 4CRWB 1E60A 2I6GA 1I2ZA 4HWOA 2XCRB 1OFIA 3B9RA 3D7RA 4I1UA 1PR4A 1FF9A 3P9RA 3ZXIA 5ALOA 1DELA 3KSUA 2F62A 2ZJBA 3R5SA 1ZOIA 5ALJA 2P67A 4RDHA 1QGOA 3D7SA 4TQUS 4JVNA 3DD5A 2OA0A 2QUZA 4QUJA 3MCWA 2P9JA 3CX4A 2FKAA 1DBWA 2PU7A 3A9VA 3OHMA 2PKWA 5FOWA 3E9YA 2XV1A 2NSYA 4DAOA 2GEFA 1GGMA 4ZCMA 5C2JB 2V96A 2QXTA 4PS1A 1R6AA 5I7FA 3UA3A 1RPNA 3DZGA 4TTQA 3O2QB 3CO5A 5CB4F 4ZMBA 5F1KA 2JLVA 1TC1A 1U3WA 1PJ8A 4IFTA 2X0JA 3VMFA 1HKUA 3L0BA 5IAKA 5JTTA 1FB5A 1PE0A 2QPAA 4MKHA 4X00A 3RVSA 1A2QA 4L2IB 3E18A 4FZRA 4IP0A 2CN1A 5BV8A 3IBFA 4ONEA 1Y8CA 4JJEA 1W94A 5F51A 2A9QA 4W1RA 3UXEA 2D06A 2W11A 4EB6A 5D6NA 4HVCA 5HDQA 1Z5WA 3EY4A 1FDIA 3A8TA 3NGXA 4JLAA 3VYRB 3WKCA 3L7OA 3FHCB 4M0CA 4CV3A 1WDLA 2HT6A 2JLSA 2ZUEA 4CGZA 3OPYA 1E8DA 3R9XA 2C07A 3EX7C 3ADPA 3LUDA 1PQ4A 4GHWA 5JS8A 1JWLA 1HK7A 4NJMA 3FI0A 1RLUA 3KJFA 1NBOA 1CFZA 2OCLA 2O2XA 4ZTUB 2AVNA 2PXXA 1M54A 3DCYA 4JL6A 3NVAA 4MVWA 4P8RA 4F9FA 1BG6A 1SELA 5K01A 4UXJA 5DHQA 2X4LA 3ZNNA 4R54A 5BSRA 3COPA 4I19A 2ATXA 2YIDA 1G5PA 5DLQC 2R6GA 1TTTA 2I33A 4OKIA 4P81A 3G1WA 3URMA 3WQHA 1JDVA 4NR0A 2TECE 1C8VB 4F3KA 1PSWA 4DLBA 1T15A 3X0DA 3Q2KA 3MZ0A 1QK4A 1S2OA 2GRAA 1CF4A 2EBUA 2J09A 2XJ4A 1T26A 4LJKA 2WFMA 3QF4B 4UUMA 2R00C 4UUQA 3LC1O 9LDTA 1AN9A 2FN9A 4DWJA 3VNAA 5KYTA 3JR7A 3BRWA 1ZM7A 4KOAA 1VGQA 3VR4H 3P9IA 4KG7A 2GEVA 1RR6A 4Q4AB 4C0SA 4MGIR 4X90A 3VU8A 3F3KA 4K2HA 2BL4A 5AUPB 1IYZA 3QI7A 4LMRA 3PD0A 5DGTA 2ZR0A 3ZBUA 3BXGA 1E2GA 3CZMA 3L8YA 4M98A 3P4UA 3VR4A 2AR0A 5EIXA 5AI8A 1M73E 1IRXA 4TM8A 1LS6A 3A31A 3FUXA 1EBUA 3OU2A 1TZKA 5LQSA 4I99A 1W44A 4X3CA 4UHDA 4LYGA 4TL8A 3CEPB 2Z4SA 5JVDB 3E9QA 2FWPA 4K26A 3ZDFA 4LEIA 5EYPA 1VRVA 3P19A 2AWNA 4GGOA 4KE7A 4AN1A 2DLCX 1OAOA 3L0DA 1XTIA 4QHSA 3VNQA 4XTRA 3J81A 1XK6A 4JENA 2OOKA 1DQSA 4KV9A 2QTFA 2B99A 3HM2A 1CU1A 1OXMA 5FYQA 3TL3A 2BFFA 4JP5A 1EFRD 3LCJA 4MVJI 3U5ZB 2DUUA 4HGYA 2VAMA 4MEAA 4YMIA 4ENPA 1LLCA 2WQ7A 1G7SA 2WYHA 3OLCX 1UXOA 5HF8A 1ZGGA 4IKPA 1PK7A 3R0IA 1MVOA 3H11B 2Y2VA 4OJMX 4DLVA 4F4UA 2BE9A 3LM8A 3IKMB 3T99A 1AO0A 2YKGA 1O9GA 3TLZA 3GOHA 3U1VA 3EE6A 1ZOLA 1BN7A 1NT4A 3M6MD 1R0WA 3NX4A 5ELLA 4RK7A 2QX7A 4Q00A 1N6IA 1BW9A 1PJ2A 1USUA 2H57A 1L7MA 1U2RA 2IXFA 2XVMA 3D64A 3LA8A 1E1QA 1O2DA 4H9GA 4QXQA 1TQ4A 4EF6A 4ZOBA 1HX7A 2AFVA 1KU0A 4A92A 4CFSA 1FP6A 2OWEA 4K05A 4R1NA 2FZEA 4XVRA 1YAHA 1KI3A 3RS8A 3VDNB 5LQAA 2HQBA 4NK4A 1USIA 1ULUA 4JI4B 2ZSKA 4I55A 2A9PA 4O8ZA 1T1GA 5CA0A 1UDWA 2JLCA 1D1QA 2X9LA 1P0MA 1RQNA 3VAAA 2VDJA 3MJDA 2BV3A 1XVVA 3GJ7A 1JZSA 3IMGA 1A7AA 4XR9A 3ZGNA 2AJDA 4B76A 2XTMA 3UH1A 1RHQA 3GN1A 4DA6A 3VTKA 3LY7A 2I1VB 3GBPA 3TYXA 1OFGA 2VDNB 4CLDA 2WP8J 2LWIA 5KYWB 3B51X 3HO8A 4G23A 1U0BB 2IEBA 3JQ8B 4E5DA 5BUQA 1RXCA 2YTZA 3AKDA 1E2FA 5EE9A 5H82A 3WLKX 3UKJA 4GE0A 5BOSB 1V6SA 2C29D 1G8GA 3ND6A 1W0KA 4AZ3A 2BUBA 1M6YA 5EKTA 2IEYA 1VHTA 1WD5A 1YDWA 1VL8A 5BVGA 3D6UA 3HA5A 2VATA 4OQEA 3KQQA 5KDOA 3R44A 3WR5A 2IITA 2FEKA 3ABRB 3CM0A 3EZFA 4V0RA 2OFFA 3VA7A 2I6XA 3CPSA 3SZMA 1YS9A 1QORA 4FQ8A 4BNLA 2DSTA 3A9WA 4LISA 2BDTA 2Q9BA 3DXZA 3LUBA 2HX1A 4UAGA 1ODKA 2ZU0C 4N4AA 5EJ6A 4YYEA 4LRWA 3DT6A 1DC5A 1MGOA 3H9UA 4OBXA 5FR1A 3I6ZA 3V2IA 2A88A 3FZEA 3BWXA 3AHHA 2QMYA 1UF9A 3UK1A 4WUTA 2XB8A 3NQ41 1RXSA 5FKJA 1UBKS 5KYNA 2B5WA 1QQ6A 1L2TA 3NTUA 3QBDA 2BEWA 4UTRA 1T6BY 3BSYA 2DQYA 1MT3A 5KNBD 1T0BA 4KQCA 1IJKA 2RJOA 2ZYHA 3QGMA 2WSSA 5G1NA 3X1DA 4YRIA 4XOIA 5LP6F 1M8GA 1T6XA 2NWQA 4RSRA 3OF3A 2EFGA 1IHOA 4RX1A 3R7AA 1AHIA 4CEIB 2QRJA 1CNFA 1LPMA 4EO4A 2JI6A 4DLTA 1KJYA 2HBZA 5KWIA 2ZB7A 1NBMA 1RAEA 2H5JA 2I2AA 4LXIA 3EAQA 1E2BA 4RPHA 3PFHA 1Q0SA 3D1JA 5KQGA 4K1LA 3QEJA 3TAHA 3O4VA 3VR3A 3ZH9B 2ODNA 1WHTA 4PG4A 1EEHA 1MC4A 4P0TA 2X5JO 2ONJA 3Q87B 1X8JA 2CCJA 1H22A 2PPLA 4URHA 1RIFA 3WGJA 3WNVA 3ZN2A 5HQ3B 3MGKA 4NH0A 2PE5A 1DI0A 2NU8B 2G9QA 2CHGA 2EEPA 2PMCA 3GFVA 3IQDB 3U44B 3QX3A 4C14A 3WIOA 4MV6A 1KDRA 1H0HA 3PEVA 2A5FA 5HIKA 5K3DA 4QUGA 3ZVKA 4QOIA 3RJTA 2I71A 2IPMA 2JGLA 3L40A 1UZUA 3E1KA 2YXEA 3NHFA 4G5YA 3BGVA 5ALPA 3SIPA 1H2BA 3TJMA 2O8EA 5LBUA 1JNYA 2WBLC 2EJUA 4J2OA 1ARZA 1XRNA 3BM5A 3HADA 3LT1A 1MEEA 1OSNA 4PY2A 1JG7A 5AKIA 4M7PA 1Y80A 5D3QA 4RVUA 4NPAA 5ES3A 3NM4A 4IKEA 3E9ZA 4W9NC 3KHKA 1NFQA 1NVXQ 1YZGA 1U1DA 4P7FA 2A5LA 2PL5A 1NV8A 5F5XA 3TQCA 2V4MA 3HA2A 4XI9A 3L4KA 5KYXB 2I2FA 1SCUA 4Y0AA 2YMLA 5FTJA 5FL7D 3RLFA 4UZFA 4YCAA 5J9FA 3ZUPA 3LTNC 4AI6A 1NVGA 2OZLA 2OGUA 3CVYA 4A6PA 2BTQA 3AETA 1N36B 1D09A 2PMEA 5GONA 3AW9A 1YB6A 4JMPA 1NLZA 1LEHA 1UDAA 2VWQA 1T5IA 3EPPA 3ES9A 3RVBA 2CHEA 2ODPA 1CUVA 2OQIA 5DNCA 2B3TA 2I03A 3AEZA 1NXPA 2B9EA 3JARB 2ADFA 1RW4A 5DYYA 1EFHA 3B70A 4G1VA 2R8ZA 1BS1A 5EIAA 4CM3A 1O97D 4YRSA 4EHAA 4EJFA 4MW9A 3FYUA 4TTVA 4GXNA 5LUAA 3L0OA 2OCAA 1VKNA 2O1SA 2Z6AA 1HE1C 1KERA 2FE4A 2X0IA 4YIKA 2BEWB 2J9ZB 4F1JA 5I7RA 5LOVB 5ILOA 2HMSA 5JQWA 1DX4A 1XZFA 2DT5A 2V0NA 1CHNA 3GPDG 5EN4A 5IKPA 3FZQA 2B7BA 4XGNA 4AUMA 3IQZA 2FOXA 4N7BA 5CT6A 3CR3C 4Y9DA 5E6SB 3USZA 3WJ2A 3Q5DA 1AC5A 1D1SA 2R85A 3SX2A 2FUNB 1H2ZA 3V7FA 4GOKA 4ZREA 2B1GA 5KQPA 5K1ZA 1RJGA 2OTCA 3K6SA 1FDWA 1KHHA 1CIVA 2GJKA 2QJRA 5FWYB 4QM7A 1ZICA 1VGVA 4JJIA 1BJRE 3EA4A 3WSWA 3PSHA 2G8LA 1Z0SA 1QV9A 2HA3A 1QGAA 2ZUTA 3EQ7A 2ZB8A 1GG5A 1H6BA 2AFRA 3AG5A 3ZWXA 4AWAA 2AB0A 2F90A 3GLGB 3KQHA 5JNUA 1CY8A 4NMHA 2LW7A 3FDZA 2EP5A 2CZGA 5T4HA 3G0IA 1YBMA 1Q2UA 1NXVA 1YZLA 4H60A 3BZWA 1EGAA 1P1RA 2GFIA 3D6FA 3MWLA 4JJ6A 1WU8A 3NHYA 5ULLA 5C8DA 3QHAA 3T3NA 4WNAA 3O8BA 2O5VA 4C3OB 3D2LA 1SZDA 2BFMA 4I66A 2DLNA 1IQUA 2QAJA 4RF5A 4B5LA 1KKUA 2XRMA 4FUQA 4RD2A 2CSXA 5AJYA 1P5ZB 1I36A 3IV6A 2IX9A 3AJ8A 3DCNA 2L42A 4ZO9A 1HDGO 1NR1A 2JGKA 2H16A 2DULA 4HLQB 5JIBA 3C16C 1ZAYA 1LFDB 2SNIE 3P0RA 3QVUA 3RQIA 4CMIB 4D8YA 4YRAA 4YIHA 4AMVA 1K5DA 4TQAA 3NALA 2XBMA 1MO4A 1OVMA 3C7KA 1GPYA 1G18A 1RP1A 4KFTA 4OH7A 2XTZA 3DMTA 1AH2A 4OQPA 1BQ4A 4JUDX 1AKQA 3HYSA 5KX5A 1RHRA 5HEKA 3I45A 3GLIA 4MVJP 4GLLA 3NDBB 5LQKA 4WOBA 3K1AA 3GUYA 4MIYA 5BSEA 1LB1B 2OCDA 4UJ3A 4Z7OB 2ZT7A 4Z0PA 5AP9A 1FP7A 1Z6ZA 4ND3A 3IIKA 1CY4A 4ZA2A 1KRXA 3NC4A 4NJOA 1DAPA 1WMAA 2XHEA 4UCFA 4TWJA 2YFKA 2ON6A 1B1AA 3MTAA 4MUJA 5TT0A 3RRXA 3W77A 4PG5A 1YBAA 2HA7A 3A2MA 4AJNA 4EG6A 5ALZA 3ADOA 5A2QA 3TVDA 2ZBQA 1GFSA 4RANA 3DBVO 3GJ0A 1W36B 1C9NA 3SF0A 2ZJ3A 5EMMA 2I7TA 4EOGA 1XYVA 1GUFA 2GJ4A 4E6EA 5B4VA 2CFCA 3RADC 1P60A 1TFRA 1XZNA 3OCZA 1RACA 1D2RA 1JG3A 4WKBA 4QHYA 3U44A 4ZI7A 4EVQA 5A3SA 3EHDA 4RC9A 2H08A 2VCEA 1EH5A 1QYIA 2QRHA 3BWVA 4BFVA 2YHBA 1ETUA 4BFCA 4QT0A 5EFOA 4AW9A 1M6HA 3RKSA 2OHHA 3TAUA 4H1HA 1OR8A 3UK6A 1U7WA 4J75A 1WXWA 5FNVB 4ZQGA 3GA7A 3HMQA 4D2IA 1GZVA 3DV0B 1GRNA 3A2LA 1VC2A 4NCIA 1XTUA 2QPTA 2C03A 2EZ8A 1LNZA 3E3AA 1G6KA 1T4GA 1ZS9A 4MWEA 1BCSB 2XOKD 4PO3X 1Y9JA 3QX8A 3WYGA 1C9KA 3IAEA 4XWKA 1DXHA 1KC3A 3T0GA 3ZLJA 4HFJA 4DJAA 1Q5PA 2D1QA 3UC9A 1R6UA 3UFXB 4DA7A 3EBOA 5IDWA 3K9FC 1E1RA 2CXRA 4KLZA 4NEQA 3LHIA 3I3SR 5A6SB 3LK6A 3UMSA 2XKJE 3KBBA 2RK6A 4BCCA 5T6BA 1SXQA 3IBCA 4DOMA 3OX1A 2O3RA 1I5RA 4ARZA 1XQ1A 3W5DA 2OBXA 1XTKA 1KJQA 2K2WA 3FUWA 1ZA1A 4ZV7A 3VUEA 4YHBA 3RSFA 4HDKA 4A0QA 4AJEA 1I5OA 3NCTA 5DE3A 4Q3KA 3B1YA 2J30A 4UHFA 2FZKA 3HNOA 3ZHBA 2YDXA 1TAUA 1T5HX 2PZMA 1KL7A 1OTYA 2Z4RA 3BJEA 3I1IA 5L3SB 3TW4A 5A2GA 2J5QA 4E5PA 5JYDA 2GK3A 3ABQB 3OEHD 1JJIA 1WIWA 1ODIA 3BULA 2R6CA 4MVJM 4EA8A 3EXIA 1QOZA 5A5DA 1R6XA 3ND5A 4P08A 5JV5A 5KC9A 2W6IA 3BA6A 2P1ZA 1NMZA 5AJHA 1TJPB 1OJ7A 4ARUA 4CLXA 1WKBA 4BE7B 5K09A 1XRJA 4K88A 1WXGA 5FPYA 3AP1A 4I4TF 3LI2A 3VTFA 3PEWA 2E7ZA 4RJLA 3ZZMA 1E2LA 3O1JC 3O3MB 3LFUA 3OQBA 4KXLA 3HVUA 5E95A 4GE3A 1NVVQ 1QH8B 4QWWA 3QVVA 5JBQA 4JI2B 4OHRA 4BJ5A 5AK4A 2AYYA 4K7JA 5IJ0A 2CJWB 4POAA 5IUJC 3KTAB 1MQSA 4ZI5A 2I29A 2OCGA 3HCAA 1NONA 3OPVA 4XXHA 4WSOA 1EJBA 1K8ZB 1DC6A 4I1YA 4H0FA 3SBDA 1ZUNB 1U99A 4RJJA 3EGCA 4OGKA 2GZRA 5H9WA 3IPYA 1IU9A 3WIUA 1C80A 5FUVA 4BL5A 1E7YA 3PICA 1JLRA 2D4AA 4BNGA 5L53A 1SCAA 2ZWMA 4ZV9A 1ESEA 5BMVF 2C9DA 3KM0A 3TW8B 4KAJA 2JD0A 2PLRA 3HTXA 1IOLA 4KWIA 1YKSA 4C89A 5I7OA 4S24A 4YEDA 2Y1OA 4I8XA 2MSKA 1MD9A 5EPUA 3L07A 1QFYA 4Z1MA 4B3XA 4MV9A 3ZHYA 4I0WB 3W5AA 3C8DA 5E4FA 5GPBA 1PEAA 3JV7A 3JPWA 4BUCA 4BVAA 2JGFA 1XCBA 2F8TA 1L5KA 4CM8B 2Q4EA 4RYLA 1DAIA 3L4SO 3C14C 3ANYB 3DV0A 4RF3A 5LZ7A 2P69A 4ESHA 1PR2A 1TQHA 3A2KA 1ZVJA 4WW0A 4GS5A 1V71A 5HK8A 1KZ7B 3EEIA 5SY4A 2X9QA 4LSMA 3ZGVA 3TLXA 2IHTA 1S7CA 2QVYX 2E82A 4C04A 3QNUA 5CDYA 2V7EA 2WILA 1UFRA 3F2IA 3C6ZA 3NANA 1U81A 3MLBA 1U1FA 4DM7A 3IP8A 3A1WA 3JWGA 3HVJA 3KQWA 1YHYA 1DTWA 2IYVA 5DMXA 1D1TA 1PGJA 1UR5A 1ZQ9A 2PLFA 5H3HA 4BKQA 4LK2A 2CVPA 1FVFA 1DOZA 1JXOA 4JB2A 2V6FA 3LECA 1E3JA 1FMTA 2RH8A 2RI0A 4NONA 2CUTA 4TX1A 2COUA 2JLRA 3SJCA 3HJRA 4HHEA 4QFBA 1FMJA 4BLVA 2YV3A 1SVOA 3EBLA 1NBHA 3HUTA 2VVTA 1IXZA 2OXTA 2QP4A 3SPXA 3MPUA 4TKZA 3IRVA 2AN1A 2PV7A 5DHPA 4C20A 1I94B 1G6OA 3QKIA 1RMTA 1V26A 1M1NB 4IXTA 4C7XA 1YJAA 3E3MA 4JXJA 1J2UA 5FOTA 3L1UA 3RYCA 5A5EA 1VMIA 4AYTA 3N2KB 3ND9A 4FHDA 4IXDA 4M0UA 2CXXA 1IBRA 1CP2A 4QEDA 5CW1A 5LYJF 1XU7A 1NVVR 2HFKA 5IKXA 4YV7A 3BXFA 2HQSA 4QO7A 1NAIA 1X0XA 1GGJA 2NUTA 1MAVA 4WDRA 2H2IA 4OCZA 1WX1A 1H1TA 4I08A 4LZZA 1CJTC 1IM5A 2DR0A 2VF2A 4E1VA 1GQSA 1LPOA 4JX8A 4DY6A 1CS0A 3GLRA 2X0EA 5E8JA 2PUJA 5C35A 1MHPA 3OA2A 3SLGA 5HZGA 4AU1A 2YJNA 2K4MA 4BNFA 1OWLA 2O07A 2VPIA 4RD4A 1IK6A 2ZRGA 1Z26A 2QW8A 1Y6GA 3E81A 1X7ZB 4PZYA 1PUIA 1MLDA 1KAOA 3ONEA 1XZEA 3N2NA 4YRQA 2BR4A 5ALHA 4O6VA 4A1OA 4ENSA 1E32A 3UA4A 8LDHA 2OYCA 4O4JF 4F91B 2A57A 3A6HA 5F7JA 1I7NA 1A8IA 4ON9A 4ER7A 2NXCA 4M1YA 3EOBI 2WTEA 3FGNA 3QKSB 4OBBA 2PVCA 1KK0A 2I6TA 3EGIA 1WW8A 1T8TA 1ZH8A 3WLEA 5DK6A 1XQWA 2WVHA 1ID1A 5D1NA 1LJLA 4ZVRA 2TMDA 4OO3A 3T3GA 3UMVA 2Q3FA 1EFCA 5F98A 3SSNA 1ID8A 1Q0LA 3A36A 3ADCA 2LDBA 1KMIY 3W8RA 4ZEOA 1AGYA 2AKYA 3ZCUA 4FMCB 2O5RA 4E88A 3LCRA 1EHCA 4II2A 3H2GA 2PA3A 2Z1NA 3AJRA 5EMJA 4C2AA 4URVR 5BSVA 3F1KA 1TYBE 4KQXA 4PO1A 4KR7A 3ZDYB 3ZC3A 1CUAA 2ATIA 2IUUA 2I54A 3JYQA 3DDSA 3OEWA 3FIJA 4Q66C 1JHMA 1RWOA 1RTKA 2ISCA 2RGNA 4E08A 2HLDA 2PIDA 4MXDA 3IPCA 3SZUA 2PWZA 4M46A 3ZE9A 4FDTA 3IB3A 5DVZA 1ZIXA 2RCYA 3TXXA 4BNIA 3RSOA 5CPFA 1RQPA 4BCDA 3KPUA 1EG7A 4E7OA 5HJEA 2PUEA 4HXYA 3WFJA 1KZGB 1FFAA 3AVPA 3DGFC 4OK3A 3PIIA 4FNMA 5LYYA 4AY5A 2DPMA 3LOUA 5AKZA 3ZYCA 1U3FA 3DC7A 1HRKA 2CB9A 2Q3DA 5FI3A 5LLSA 5JH7B 4Q4LA 2OZLB 3GH3A 2XJ9A 4IDHA 3WX0A 3W5VA 3F6BX 1UMCB 1F17A 3PV0A 4J0EA 1QXSA 4HGRA 1VL2A 1D2EA 2VRWA 3E0XA 5FLYA 3RV3A 3WLTA 4XLZA 5DSZA 3ZIDA 1M66A 2O4UX 2PR2A 4DA0A 3AKEA 5CLIA 3GGCA 1M3SA 1ULAA 3CCCA 3M9LA 1SUCA 4GPEA 1YHZA 3H3JA 1F2UB 3IKVA 3LUKA 4JEUA 4V3BA 3UJPA 2BMFA 5IJXA 1PJZA 4XDZA 3ZJ4A 5TS2A 4OXQA 1L6RA 2P68A 5CXUA 4KXMA 1YQDA 1NPTO 1JV2B 2O7NA 4LHZA 2NU6A 4NY1A 4F2DA 2HHJA 1WY7A 5F2EA 3SKYA 3N2GA 4U5QA 1Q21A 2HNBA 1COWD 1GSAA 3RWOA 1SUBA 3DMYA 1PVDA 2BFAA 4JD5A 1A96A 2WNHA 3EXFA 3GLIE 4N18A 2OHOA 5DI3A 4EEZA 4LDZA 1GQYA 1WB6A 4MZDA 4AVYA 2BDUA 2AFHA 1U9JA 1J42A 3OP4A 2AJ8A 2XYHA 3GLSA 5FOQA 4MRPA 5IJWA 3PX7A 1O6FA 3DEAA 5LNK6 2OXIA 1YL6A 1RYBA 2XIJA 3BN3A 5SY9A 4D9HA 2W2VA 4C4PA 3GLFA 2Y67A 1PSDA 2BYTA 3DE1X 1HE3A 5SZIA 5JJ5A 1EK1A 3EG9B 1GL6A 3JQBA 1NP6A 2ZBGA 3VPDA 1HQYE 3L46A 4E5YA 1U9IC 1K8RA 2OQ2A 3LPDA 1K6EA 5TIIA 4JFRA 3PRHA 5FOSA 4I1IA 4MWCA 4O2BB 4QRIA 4B3MB 1FSFA 4G0XA 4G1BA 4B2LA 1R4MB 4J1SA 5C5CA 1B76A 1J0EA 1S2LA 1WPXA 1C9EA 3AF3A 3OQJA 4Q4AA 5CBPB 4RYDA 3FB4A 4EY3A 4MR9A 1E5XA 3NHZA 4GRIA 3WL6A 5EWJA 5B36A 3HWX1 1G1MA 1PFKA 1I7SB 3HO1A 1IBSA 3R6LA 4N0MA 1BRMA 1F4PA 1S96A 1VLLA 5JJIA 3R8CA 1MABA 4UHHA 4DIDA 4UEQA 5AVKA 3NHLA 3D7KA 4PZ0A 3Q4GA 2I1WA 4MWGA 5G0WA 2PZ8A 4IWYA 3SJUA 4DYVA 1QVZA 5KQRA 2VPZA 1Z7BA 3VKGA 3IR7A 5IKEA 4W8HA 1NZFA 3O26A 3NIGB 3UXMA 3WGYA 4DA9A 1PLLA 2GVDC 1MRNA 5C8XA 1DAFA 1AKTA 1G42A 4QATA 3V1NA 4UBIA 3ZOZA 1X8KA 3O0DA 1AURA 1MC1A 3R24A 2QU7A 4G09A 3HL4A 3RYTC 1TZMA 2QSUA 2QZJA 1G8AA 4X65B 4KVGA 1S1CA 3ETNA 1Y1LA 3SOPA 3WK8A 1N4AA 4E0BA 4ZVQA 1J90A 1UKCA 1S2IA 1G6HA 2P4QA 4GW3A 5KNCH 1LVUA 4UU0A 4G5FA 1A8QA 1HFKA 3NPMA 4S1NA 2IW3A 1BS9A 4TROA 3QKTA 5FHQA 5L7YA 3GO4A 1RCTE 2J9XB 4CF3A 5MN5A 4ZZ0A 2IXAA 3Q0TA 4ZKDA 2P65A 1RS0A 5DMHA 3RH0A 2IU3A 4PAWA 1SHKA 1JHDA 2B3DA 2W5UA 4K6MA 4N0PA 1T5TA 4K2AA 4IR7A 1YZFA 1JTVA 3ID6C 3OHPA 4XGQA 5LIPA 1DV1A 4ARCA 3PGVA 1F7UA 2QVCA 3B1JA 4OAOA 1HLDA 1CY2A 1SG6A 3OZGA 3OX4A 3VJKA 4YCCA 1TTHA 3MD9A 2BKLA 3V2HA 4UD6A 3QUBA 3WRYC 1OBOA 3MXTA 3E70C 4KLNA 3H17A 2BD0A 3U39A 3RSCA 1S8OA 2R6FA 2Y0CA 2N46A 4BEVA 2Z4TA 4LE2A 1U0FA 1TCCA 5BW6B 3GPIA 3HCPA 3K7EA 4XARA 5AVVA 3JQDA 1FP2A 2O48X 1C1XA 4R31A 2JCXA 1N8NA 1U8FO 2ERYA 2QAGC 5TJHA 3SR0A 1L5WA 3NTRA 5I7SA 5J2TB 4FDMA 4F8JA 2GX6A 2GUGA 4MQLA 3DS8A 2NO9A 2QA5A 3E2IA 3ZI7A 1BMFA 4EABA 5EI5A 2CNWA 4BLUA 5JSUA 2WKSA 5LR6A 3DP9A 2X8LA 4IYRA 1EXVA 4RUKA 2C77A 4GPTA 3PQ5A 1MORA 3DSRA 2C5FA 1E62A 2FPOA 3D2CA 4FOSA 4N6NA 2IIPA 3TAXA 3D9QX 4RVGA 5B6PA 5J59A 5FUYA 3GJRA 3QQPA 1SD5A 3A4IA 3DV9A 3G5TA 4E6PA 4LC1A 4JI8B 2A5JA 8AT1A 1ZU4A 1H9BA 2VH2A 5DTEA 5AFSA 3L8EA 5DM1A 5CB0A 5DN6D 1U7ZA 2F3PA 3UJDA 4LXYA 4FFRA 2PKQO 5DULA 4DR6B 2WK1A 1GADO 4DQVA 3THXB 3K0AA 4NCNA 2HF2A 1HT0A 1Y82A 3ZV6A 4KQMA 5LFAA 2EAUA 4WT7A 3KWLA 1R6TA 1QHGA 3TOCA 3I8XA 3HN7A 4P1ZA 4JLDA 1EFPA 2QI9F 2NXNA 1MJFA 4RD3A 1U7HA 3VBEA 2XUPA 3ZQUA 2PJUA 1XQXA 2BGRA 1PJBA 1AZWA 1XOIA 2F67A 3V8BA 3PUKA 1H85A 3WKDA 4F72A 4I1OA 4BO8A 5T57A 3V4RA 1GR0A 2JJQA 3FNFA 3DDZX 1H2FA 4X85A 4YDRA 5AT1A 4GSYA 4IGKA 3WQBA 1B14A 2C3YA 3Q8WA 4FSHA 1BFDA 4R81A 4DREA 3OJLA 3IVAA 1XDDA 1IM8A 4TMTA 4BC0A 3H1EA 2VWHA 4JP8A 3VBCA 4QDXA 1PN3A 4R7ZA 1SQFA 4W1SA 4ZKEA 3OBBA 2F3UA 2W0MA 5CJPA 1ODCA 1KZ6A 4LJ7A 1OGYA 5HFAA 2CDBA 3ESDA 1RCUA 1WCYA 2GWRA 4PZLA 2FTKE 3R6TA 1VXOA 4ER0A 3A28A 2IY7A 1IQRA 3WRYA 3NBFA 3BWYA 4PAQA 2QKYA 3EG9A 5KTMA 4C0WA 2P3SA 2ZR8A 4G0QA 4F8YA 3RF7A 2IP1A 2Q5EA 3EGEA 1ZESA 3CPHA 1RADA 4UPVA 4LNHA 1PWXA 1LVGA 1NQUA 1UUFA 2CD9A 1K75A 2PKXA 3VHQA 4HJRA 4AWBA 7AT1A 1X0VA 1MTZA 1XLUA 3FHJA 4LPKA 3WLLA 4JLSA 2GK6A 2Y77A 5AQEA 1KMCA 2ZI3A 1BA2A 2HDOA 3CW9A 3QX7A 4P2GA 1GPNA 1AQIA 3RUAA 1QR6A 4EFKA 3H4VA 1VYHA 4HQOA 5EXXA 1HE8B 5ALXA 1V6AA 2IDJA 3IDAA 1ZNWA 2YIJA 4O2AB 4HN9A 2OENG 2QZPA 4O0MA 4XEUA 4IQ8A 3MBIA 2IYXA 4FONA 3WNBA 3FSJX 1TMOA 4RD0A 5EERA 3EUAA 4U9IS 1ZYUA 2DQSA 4LE0A 4RHEA 4PYMA 3LVQE 3VVMA 3RC1A 5E9WA 2C2KA 5DNDA 2VJQA 2HRDA 4S3MA 4RF4A 2XUDA 3QXGA 1MF7A 2EKLA 4IXMA 1NYTA 2OV8A 5LB4A 4Z0TA 3GJ3A 2FAXA 4M1TA 2Z3VA 1RMQA 1WQ3A 1NBAA 2EG9A 5FWXA 3RF6A 2HCBA 2FPUA 3Q7EA 4O4LF 3VKFA 1RC0A 1DJNA 2HO5A 3ANXA 4OSPA 1ZMRA 5A71A 1Y63A 1ZK4A 4LQCA 3FGZA 4C4ZA 3OECA 4ER6A 3TSOA 4QBTA 4BQRA 1CX9B 4TL7A 4FWIB 2NZUG 2ZE5A 4QBIA 4RJTA 2GBGA 1Z6GA 1BDHA 4L57A 5CNIA 1CDZA 5JWHA 1DX6A 1ZX1A 1PNRA 3I30X 4IAOA 4L9SA 2ICAA 1OLUA 3OQPA 4P3NA 3W8DA 3W8FA 3OCWA 5BSGA 5CCEA 1YIAA 1Y33E 1PHRA 5K8VA 1JF8A 3HGMA 3K9GA 5AOVA 3EC1A 1PL7A 4H7IA 3M6IA 4EJ2A 4MINA 2R6ZA 1K5HA 1SU8A 5TGZA 3WWCA 2P6UA 3H86A 1OASA 2G3YA 1KOJA 5H9VA 1O6ZA 4LJAA 2ZQYA 3KDSE 1VZ3A 2KX7A 3EXEA 3IBGA 1WV1A 4A91A 4PGGA 4RY0A 4ALKA 4TPKA 1SBTA 2VDKB 4PWZA 4B33A 1F4LA 3BKXA 3NJ4A 3SVZA 2DBRA 5JYBA 3WOVA 3HC7A 4MRMB 5FV4A 4HDMA 3ROXA 4NE2A 1VCHA 4ZEXA 5TT1A 4LRSB 3VKWA 4RAQA 1IXKA 5FAKA 1OA0A 2B25A 2GBLA 4JBYA 2EZ4A 1NULA 1V5WA 2C4WA 3GIWA 3VJMA 2CLOB 4EHHA 2OB2A 5FUQA 1GTL1 4ZJPA 1MEOA 4W6QA 5T64A 5FBVB 2XNDA 1MB0A 1K7CA 4E22A 1UZAA 1G8SA 1U2GA 5JARA 4AS2A 4ML3A 3CNQS 3VH1A 1J06A 1X94A 2O2GA 1AKYA 4N7RA 4NP6A 3R0ZA 4EG1A 1EQUA 1G21B 1T8YA 1HQDA 1SHJA 4DCUA 4A6DA 1R66A 2Z6QA 3F6YA 5BQXA 4CR7A 1OHHA 2HK8A 4YRJA 2GN0A 1QRAA 2Z9CA 3A3YA 4LE1A 1TZJA 4LDPA 1KSFX 3L7JA 3RS7A 3VR6H 3GLUA 4QSHA 2JARA 2VUIB 4MSUA 2B82A 4S2UA 3ABIA 3O90A 1H1LA 1Q83A 3OFNA 1Z0JA 4I4IA 4X20B 1MJNA 1XVUA 1J39A 3SQOA 4XYBA 5IU6A 1IN4A 3T3PB 1ORIA 3O4JA 2DPLA 5IANA 1TO2E 5JS2A 2QTVA 2PPVA 2WHRA 4PX9A 4E30A 2SBTA 2RHBA 3ZJUA 4UCWA 1OQAA 3RYFB 3ILYA 4HWSA 1TA9A 2R9VA 3CUSA 3CVJA 3S55A 1GPUA 1NY5A 3D5TA 4E21A 1B8PA 4MGYR 1I0IA 4KVZA 3DAYA 5KSOA 4YLGA 3SKVA 4DF3A 2O0HA 4G1EB 3VR2D 3CG4A 2ZUUA 1IRIA 3E8XA 1E1YA 2C7PA 3K3PA 2W2PA 4HDAA 5IARA 3KEQA 1T5LA 2ZWPA 1KK2A 4IDAA 3K32A 3R3WA 3MQFA 1X7XB 1II8A 4HGOA 1ZGJA 5DK4A 4TN1A 1YZTA 3AFIA 3FYHA 5B7QA 2IYLD 1OZ0A 3H42B 4OM8A 2AQKA 2FLVA 3FR7A 2PYIA 3HRHA 5TPWA 4RO0A 3FHLA 4UDYX 1SH7A 4X7MA 1XZ8A 5K0SA 4GWKA 3PU6A 3T35A 2BCEA 5A0TA 3I0NA 1OZAA 1VJ5A 1DTWB 4ZCTA 3H99A 4P36A 4P34A 5JXHA 3OQMA 3BAFA 4O4HF 1JPJA 1PD1A 4D8TA 3GVCA 2C82A 2QROA 1B26A 3DBRA 1R4NB 3O8OA 4EMSA 4ZGBA 3TJZA 4R9NA 4RZHA 4OQFA 2ZI5A 2NU7A 2KB0A 1MUUA 3MIZA 5J63A 5DGXA 2OHXA 5BQ5A 4JQCA 2JD2A 3UK7A 2MSLA 1LBSA 2VYND 4DARA 3W5CA 1M5RA 4G65A 4PC3A 1P39A 1TUIA 3G2LA 5FBRB 3PLNA 2ZRCA 5JI3E 1PEKE 2OHIA 2RHHA 1QS0B 4CBVA 2BH9A 1GZHB 3TZHA 4LN1A 3E9EA 3KSMA 2WD9A 2Y1EA 1JH8A 1MN6A 2AOWA 3L7KA 2AC2A 2IPNA 4FWTA 3DPSA 1QGDA 1RRVA 4WKGA 5B58T 3P2KA 2XE8A 2P0EA 2WC1A 4ZRDA 4ZAYA 5K0GA 4KIWA 4WBXC 4JCOA 3L43A 3AR4A 2GXSA 3KXKA 3PI6A 1KH3A 1UADA 1J09A 1N75A 2JB9A 2OAGA 2YN0A 4M0FA 4XM0A 4LDAA 3FTQA 4CN8A 2C5HA 5KNCD 4Q4JB 3DO6A 4EAAA 3HXOA 2B5VA 2JKYA 3NC1C 5K0CA 3R3UA 4W7IA 4NU8X 4J76A 4U6SA 4J29A 5G4KB 4D3FA 2J9FA 4KX3A 3TW0A 3F46A 4R41A 1YD7A 3QWBA 4AF8A 4YQFA 4WOCA 2EQBA 1RLIA 4N54A 3SIXA 1BXGA 221PA 2OVFA 4QQRA 3BSWA 5EUCA 3D5QA 4CT4B 3QEAZ 2N42A 4XPIA 2CHUA 2WKQA 2XDQB 1EVZA 1E59A 4R7TA 4CIWA 1GA1A 1OGIA 3AHDA 3KT3A 3E7WA 1JYSA 4M8KA 3ZWVA 1YBFA 4FZ5A 4I6GA 4Q9KA 4A8JB 3FX2A 2OVBA 2FW8A 3P9QA 4XCXA 5C7YA 3RFUA 3BGSA 4PLVA 4CKXA 3VYUB 2PKEA 4LRXA 3VTZA 2J6BA 3TDNA 2XXAB 3TVTA 4BVGA 3N70A 5EMHA 3KXDA 1QRTA 4Z9YA 1Z5ZA 2X0NA 4DC1A 3GL9A 1FDVA 2QGNA 5JHGB 4M8IA 2F43B 2A1TS 3K31A 2RHCA 1W0JA 2ERXA 3MCTA 3WL4A 5JAMA 3W3AH 2E4AA 1XQ6A 1N5JA 2G76A 1A8PA 4JN6B 1Y89A 2NVOA 4C4AA 4DKXA 3E7PA 1H8HA 2NQ8A 1IUOA 1CNEA 2GRJA 3ONNA 4XIGS 1QSGA 4CCWA 4DZZA 3EXHB 5KKNB 1F2VA 1GZDA 4OXNA 1KA9H 1O08A 1PKXA 2ENWA 3OZ7A 5K3SA 5HK9A 1T5OA 2WHXA 5DCUA 3U13A 2FFQA 1GA4A 1C1DB 1GNRA 3LGSA 3PGMA 1A69A 2P2SA 3JQ9A 3WLFA 3ER9A 3P7MA 2CE2X 2HYDA 1P61B 1E6LA 1NHGA 4E14A 3K9QO 4OGWA 3A1DA 4LK3A 1EI9A 4PNHA 4B6QA 3ZHUA 3DEYX 2YVKA 2BEKA 4PSAA 4C5CA 1SBCA 1YE5A 5TQ0B 1OPXA 4KPUB 9MHTA 1SNYA 2ZUCA 1QOPB 4HEHA 5F52A 1KIFA 1N3BA 4WLUA 1K8QA 4TLAA 1ORRA 2RAVA 4YRPA 1H2XA 1YU9A 3DAHA 5IM5A 3QE0A 1IUKA 2BFOA 3KKLA 2GHIA 4I4LA 3T4XA 2XMBA 5CFZA 5WRFA 4M9CA 4KIUA 1L5OA 4IWNA 4ER5A 2O8VA 3H04A 4LRYA 3GDOA 4IW3B 2PX5A 3AH8A 1N9GA 3COYA 1ISSA 3KUCA 2WM8A 4JNKA 3P9NA 2O2DA 2G1JA 3X1KA 1A9ZA 3PNMA 1N8KA 3I1FA 1RHKA 3H9BA 5A4FS 5HX7A 1NV9A 2Q29A 3LUPA 1J33A 1XMJA 2DT8A 2FWRA 2XPCA 1ZM9A 1B0UA 1DT5A 1JT2A 4XSGA 3QEMB 1CWUA 1NQ5A 2RIPA 3LQ2A 3P71T 3LL4A 3BRQA 3GX1A 4JC5A 4EPVA 3CX6A 2V3VA 2XMSA 3LT2A 2GCNA 3GARA 2G9RA 2GKSA 3DKVA 3FHOA 4QAQA 3UCFA 1N0IA 1SHZA 4TRRA 4L16A 2D1YA 4B47A 4CKZA 3A1VA 3ROTA 1EDEA 2XDQA 1H2EA 1KH1A 3TR0A 1ULSA 1NLMA 4L28A 4Q3AA 4YJ3F 1ISIA 4UEWA 3P20A 4AZ0B 4ZDIA 5KVCA 4QEZA 4KJZA 4LJ5A 3HXKA 1ZGCA 4O63O 4S1VA 3ROMA 1AMUA 1OV6A 1R6VA 4JJ4A 2CVOA 4F8EA 2QTLA 4BO6A 1MHTA 1OT5A 2ZYTX 4PG8A 3HP4A 3OZAA 2VQSA 5MN4A 1F14A 4UXHA 3RYCB 3RVRA 3A9SA 2QUHA 2ZQZA 3L84A 4KEAA 4WY2A 1G4UR 4UAJA 1H3FA 4FMCF 2V7VA 3PUJA 2OUIA 3QPVA 4H1VA 5CCDA 4YMLA 3JYHA 4HQFA 1PS9A 3O4GA 2CLEB 1SJ9A 1YDGA 5JE8A 1L5NA 4A10A 4YDHB 4EM6A 1QRUA 3AP3A 3FOWA 4NENB 1O4WA 1WW3A 1L5SA 2NUTB 2BUCA 4HDCA 4JOCA 4TTSA 3QV1A 4KN5A 4RPIA 5E7MA 4MVJG 5T8KC 8ADHA 3T3IA 2RB4A 3FNQA 3B3AA 1PQUA 2E0IA 4BXOB 3HBAA 4FFMA 3JARA 4TTIA 4OQDA 2J48A 3MJVA 1B41A 3IKLA 2CNOA 1YC5A 1EFDN 2TMKA 1QIJA 2HM7A 2H0RA 3DOUA 1YFKA 5BNFA 1XFAA 5FADA 2H7XA 1N1MA 2RC5A 3L7DA 5CJJA 2JLUA 4G37A 2A7XA 2ZU6A 4R3NA 3UH0A 4RACA 2WUFA 4HX2A 3DEHA 1VJCA 4GKBA 4HNUA 1RAIA 2QUKA 3ADDA 5KHLB 1FXUA 2ILTA 2IYPA 3DT9A 3RTBA 1PR0A 3EGXA 1ABBA 3EODA 3QJYA 5AM1A 3SBOA 3IXQA 1DEXA 1G20B 3I42A 3NBXX 1YVUA 2ZK7A 2HLDD 4WFIA 3W8NA 3ZS8A 2V6BA 4B17A 3O4RA 1FJXA 1BE8A 5CDTA 2DBQA 2IOFA 5AW5A 2O7RA 3Q9UA 1TE2A 3W79A 1MPTA 2OD9A 1QFSA 3ETGA 1PKEA 4DANA 1QVVA 1MC5A 1YZUA 2PY6A 4HG2A 2MOKA 4LOHA 4Q9IA 4LFCB 3B7GA 2HSGA 1KSGA 4DJEC 4ZDJA 2FRVA