1OM3H

Fab 2g12 unliganded
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody domain exchange is an immunological solution to carbohydrate cluster recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB 2G12, light chain
total genus 41
structure length 224
sequence length 224
chains with identical sequence K
ec nomenclature
pdb deposition date 2003-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1om3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1om3H01
3QUXB 1AGFA 1F6AA 1JPSH 4TOYH 4N5ED 2PETA 5J3HD 3MGOA 2IQAB 4NO2B 3UBXG 1R0AH 1KN2L 1OARH 2GFBB 3BQUC 4OUUA 4YDVB 4GT7A 5TH2A 5H2BB 4TRPL 3HRZA 4K94L 5JHDE 1RZJC 5ANMB 3CLFL 3QPQC 4ZUSB 1ZVYA 4ZD3L 4AIOA 4N0RA 3LS5L 5EBLB 3N50A 1A6WL 4H88L 2VXUH 1LO2H 3BH9B 1NJ9B 3IAGC 4GAJL 4LPTA 3FFDB 4L8SA 2FRGP 4KZDL 3EO9L 1R3HA 1X5FA 3I6KB 5BRZD 3UJIL 4LMQI 3CXDH 5LGKA 2C4FU 3QJHA 5ETUA 3MQIA 5IW3A 2X1QA 5SWQB 3RVWC 3SDAC 3HE7B 4UT6L 1CICA 1RZKC 4X6CE 3AMLA 2HH0H 3A6CH 4P3CL 4OCSH 4OZHB 1W72B 5GGRY 35C8H 1B4JL 5IBUB 3EO1B 2CKNA 2VDNL 1WFUA 5EA0H 4JRXB 4LQFH 5DJ2A 1DL7L 4JM2F 3DIFB 3MRRB 1TVBA 2ZUVA 1JBJA 1GGYA 3O3AA 2CSPA 4XX1E 1H8SA 3SE8L 1SYSA 5KSAD 7CGTA 4M43H 3D2UD 3HI5L 4QRPD 5D1QD 5JO5B 1GZPA 1Z9SA 3MUZ1 4OD3H 5IFAL 1HE7A 1AGEA 1F3DJ 4XP9H 1ZWIB 4GKNB 3U36B 4NN5C 2Q8AL 4XCYB 3GM8A 2B8OT 3KPQB 5T3ZE 3WKMH 3CXHJ 2R2CA 5GISH 1JNHA 5HGHB 3CFDA 3D69B 1EHLH 2N1KA 1JTOA 3QI9B 1DFBL 3LH2L 4D9QD 3DXAE 1SM3H 4WI6A 4G6ML 4AJ0A 4XBGA 3OKLA 3TBVA 3VXNA 2ICES 4UTBL 1T7WA 3HG1B 1EO5A 1UH4A 3EDDA 2CIIA 3D18A 3G5YA 3T1FA 2QQLH 3UJTL 3B9AA 1MVFA 3QUMA 5IFHL 3B43A 4ZS7H 3KXFA 3LV3A 2XG5A 2A1WL 3K2UH 1OLZA 4OLZH 4RGNC 4GH7B 5EZLB 3S35X 4W81A 3HMWL 2C3XA 1XF4A 1UKSA 2R29L 2V5YA 4YLQT 2IQAA 3NH7L 1FNEB 3G6DL 5ACZB 1E28A 1FVDB 3FRUA 3X17A 3FB5B 5IOPB 4YUEL 1UM6H 4DW2H 3HA0A 1I7UA 2VQUA 3KJ4B 5M95B 1W72L 1FYTB 2Z91A 3GI8H 4K9EL 4JKPL 5GRUH 4FOMA 3AAZA 1KELL 1DEEB 2HFGH 1SBSL 3Q6GL 3QEUB 3M17B 4IOSD 5EFIA 1JGEA 3IJHA 1KPRB 3SY0A 3V6FA 1R3JB 3QDJA 4ETQA 3AUVA 1CT8A 4G8EB 4Q74A 4J3XA 1AQKH 4LSSL 5F9WC 3WLWD 1NCWH 2AERT 3QZWG 5JQ6L 2BSRB 3QIUA 5F7EH 1FPTH 4NM8H 1KCRL 4P3DB 1WWAX 4OZFH 1RUKH 2XTJE 1JPGA 3KYKL 4FFYH 1LK3H 1FYTA 3SGKA 2WLZA 3OG6B 3W0WD 4L9LA 1MCWM 4MAUL 3TT3H 1NBQA 3VH8A 1HQRB 1F3JA 5IM7B 3ARGC 5GRWA 3MODH 2EDQA 3HI6L 1MIEL 4D94A 3P4NB 1BJ1H 1MFDH 1A1OB 1PDKA 4KV5F 4OZHE 3SO5A 1HKLL 3BN9D 4KJPC 3MJGX 4G8IA 1WC7A 3NIFF 2FEEL 1IBGL 4NZTH 4HIJB 4MXQC 1N5YL 4LKXA 5D1QA 4GBXA 5HYJA 1BQSA 3LEXA 5BV7L 4NN6C 1X5XA 3C8HA 4PGDA 5IV2B 1XGRA 1BQLL 1WLHA 3L7EB 3U9UA 1G0YR 3T0ED 5HHMB 3IVKA 3MACL 1IM3B 4HAGA 5C0CB 2P7TB 4K3EL 3NCYS 1NC2D 1DQDL 1I8LC 1UCTA 2DICA 1KPUB 4AM0A 4NO3A 2R69L 5EH1A 4IRSD 1KIPA 4JZJC 3OJ2C 2MQ0A 1TVHA 1CL7I 4XP5H 1AQKL 4K7PY 4OCMC 3WLWC 3OF6A 4DTGL 1CK0H 2DRUA 1PQZB 3OX8A 3WDHA 3BO8B 3WO3B 1M7XA 3O11B 2FL5B 4NO0B 4NC2B 4F7CA 4GAGH 2VQTA 1B0RB 3RGHA 1A3RH 2H1PL 1C16A 4ODWB 3WNPA 4HIEB 3VFUB 4XPAL 3H2WA 2DM4A 3HUJE 1INDH 2D7TH 4ERSH 2AK1L 4PYHA 1PEWA 4NN7C 4FZEH 4D3CH 4GBXC 5I9QC 3P4NA 4JZOA 4MD4A 1Z0MA 4QHNB 5D96B 4U6VL 4XP1H 3QDMD 2AP2A 1A0QH 1RJZA 3OJDB 3QB7C 4WU7B 2DQHL 4LHUG 4OGZA 5GS0C 4HKBB 1FL6A 1XF5B 2HWZH 4HJ0D 4HUNB 5TDPA 3VI3E 1D5MA 4U1IB 5HBBA 4PJFF 3O3UN 2EXYC 3HZYA 1S5HB 1YC7A 4N0YH 5GHWH 2FGWH 2GQHA 1IGCH 1SM3L 4UUJB 4O5LH 5INDA 2IH1B 3DARA 4IRJA 3JWDH 4LSQL 2WWMD 5DK2A 5FFLA 4UAOB 2BFVH 3TZVD 5ID1A 4K23L 3EYUL 2VLKD 4NHUA 3RNKB 4R8WH 3ILQC 4WUKH 4CMMB 3LKPA 1LO3H 4HT1H 3OXRA 4Q9QH 5TH2B 1P1ZB 2QSVA 4P2OC 1A3LH 2CO7B 2I24N 4D9RE 3EOAB 1KPRA 3V0AC 3LN5A 5GGSY 4LAQL 4MAYB 1SJHA 4K9EC 5E8NB 1I3GH 1ADQH 3RUGF 2OR9H 2D31A 2A6DB 3VXMD 5HHQA 1A47A 3CFBA 2VAAA 1KJMB 1Q94B 1XH3B 2OL3H 4OCWL 2NX5D 4PJAB 4M62L 3MJ6A 3O3EB 3WSQH 3O2WH 5HYSB 1TQBC 2ESVD 1J1XH 4PJ7B 2FLBT 5LJYH 3RFZC 4Z7NF 3FT4A 1MHEA 5DLMH 5EPMB 3RWDA 4RQQA 5DMGD 2YKLH 3M8OH 4DN4L 1P7QA 2H45A 3ETBF 1FVDA 3SE3A 4PGBA 3PHOB 1SVCP 3TC9A 3C6LC 5EDXA 1QBLH 1AO7B 3S96B 2FDBP 2ID5A 1DQLL 2FECI 1NFKA 2YN3A 4WUUA 2AAVA 3HAEH 4RA3A 3E6FA 3FN0L 5JR1L 2M1KA 3TP4A 2OI9C 3GSNA 1D5ZB 3C6SB 3MSPA 3CU1A 4LCIH 4M3JA 5IB5A 1T03L 1KEMH 5MP6H 1NBZB 5E99L 4EEEA 3O11A 2VDLL 3VWJC 1N64L 4MSWA 1ZHLB 4HUXB 3ZKSD 3V5KB 1FFRA 3W81A 4WWKB 5I8CB 4U31A 4NRZB 5ISZD 1YYML 2P8LB 3BAEH 2PR4L 5DJ0A 2PXYD 1RZIB 4S2SB 2EYRB 2LU7A 5DMYA 2YRZA 3WNMA 1XF2A 3L9RA 1ZS8A 2D0FA 5I1GL 4MGXA 2DIAA 4IS6A 1OD7A 4PB0L 1F90L 3OG4B 3U4BL 4Y8DC 5DTFA 5DJ2B 2EDRA 2R4SL 1WICA 1Z3GH 1MCJA 4J8RA 2RFXA 2VDQH 3CMGA 4NKOA 3QO0B 3DX7B 3PNWA 4FFWD 5E08H 4NRZA 4JPKL 2DM2A 1GJIA 2IPTL 5C6TL 4PS4H 3TV3H 5AZ2H 2DI9A 2L7JA 4G9FA 4UINH 5E00A 3I6LD 1EEZA 3DWTA 2VABB 1XT5A 5DDHB 5KN5A 4PIRF 4XPGH 3WJJA 2EE9A 3Q3GA 1RZJH 3KPLB 5IVZB 2FX9H 4PLNC 4P0DA 4PJCB 3W5NA 3H9SB 3MYJB 4GKSA 1IM3A 5IBTL 1KNOA 2R23B 1L0QA 3VFMB 3J7HA 3TO4D 4KMTH 5D8JH 1F6LL 1JPGB 3VFPA 2PTVA 4OZIB 3SJVE 1W8NA 1I3VA 4PJXB 5C9KA 2B39A 3UTZB 4FMKA 1S5IL 1UXSA 4CN1A 2X1XR 3SDCD 2DS4A 1OGTB 3KPRE 2I9LA 4POZD 4JZNB 3LIZL 2X40A 4NNXA 4FQQB 1P7QB 4HEPG 3DVGA 3DUUA 3TNMB 3KR3L 3RUGB 5JIIA 4LSVH 3QUXA 2YA2A 5AEAA 4I0PC 4PRNA 2QSCH 5FAAA 4Z7NE 5F7UA 4UT9L 4LVOB 2NTFA 3GMOA 4D0BB 1MJ7L 4U1GB 4U6VH 3NPZB 4XP1L 1A6ZB 1FNGB 1JPST 1BREA 1U3HD 3G6JA 3GJFH 4R9HA 3I3EA 3QWRD 3IDXH 1VFBB 4TN9A 4BJLA 1REIA 8CGTA 3CFIC 5DMKA 2HJKB 4LLQB 2KL6A 3AB0B 3ROLB 5DQDL 3WHXB 1QFUL 4XAKD 1EO8H 4PV8A 3C8DA 2L0DA 1FYHB 3QUKA 1JRHH 5BW7C 4G8EA 5L2KD 1IGFH 2D7PA 3I2CH 4JQVA 4CRPA 2DKUA 4CADB 2AJUH 4P49A 2D2OA 5DK2B 2EE6A 5C0JB 4U1MA 3CLFH 1LD9A 4JLRB 2AV7B 3LPWA 3VWJA 2NY0C 2C3HA 4WHTB 2VN4A 2D7QA 3PWNB 4ODXB 1QA9A 3TZVC 1ES0B 2VIRB 4ZYKA 1S7UB 3MV8D 2E7CA 4LKCA 4G6AC 4KK6C 4OM0H 5DR5L 5HHPB 1OP3K 3RDTB 1JNHB 2PKDA 4NHCH 5HGHA 4BK4A 5DD6A 1EMTL 3TO2B 4LLUB 3C6LA 4FQHA 3ULUH 3ZHDA 2CUMA 2EC9U 5EN2A 3GNMH 3MACH 1G7IB 1Y0LA 1LP9A 1YUHB 5I1DB 3KYAA 2XZZA 3L6FB 2BRQA 3VE0A 5EZLA 1AR2A 3BGFC 4LIQL 4YBHA 4BFIB 1AXSA 3TH3T 1QLFB 3KJ6H 3VG0H 1H3VA 1DVFA 1NAKH 2NY5H 3DX7A 5FDWB 4P57A 3QBTB 1FDLL 1CDCA 4JHWH 4LSRH 1A0QL 3CFJA 4HWBL 4KKCD 3UAJD 3JWOL 2J7LA 4H1LB 4XMLL 3UAJC 3FKUS 1T66C 5FYJL 4X0KA 3WLBA 3BKMH 4N0YL 5ALBL 5J6GB 2IMNA 1PY9A 1S9YA 3TBYB 1BWMA 5DZOA 3MV9D 4XNXL 2F5BL 1WZMA 3D85B 1YNTB 4PJGB 4I4WB 2MQ3A 15C8L 5CEZL 3VXMA 3U36A 5I6XC 1DJSA 2ITCA 2UVFA 4F3FA 4L3EA 3PP4L 4APQD 4IJ3C 3LKOA 1A7OL 2B2XH 2PO6B 1LO4L 3QNYA 3BQUB 2H2SD 4J3SA 4OIBA 5FHBH 1A7NH 5I17A 4MJ4A 2DQEH 3MPCA 4FQLL 1Z9LA 4WHYG 5LVEA 4FQ2L 2AV7A 4JFPA 5F9DC 1NC4B 3ULVL 1PAMA 5BJTA 1DDHB 2J8UB 2AEIT 2YPVL 3NA9H 3PP3K 5CLWA 2YPLB 3TPKA 1FSKB 4HFUH 4JANA 4R2GB 5CWSA 3MLZH 3QIWA 4Y1AD 1ONQB 1ZA6B 3LPFA 3HC0A 4WU5B 5E94B 5BZWA 2N4IA 5F6HJ 4KHTH 4Z0XA 3PQYA 4G9DB 4NQED 4YHNB 1M05A 1PKOA 2X4OB 1ZT1B 1S9VB 2G2RB 1LD9B 4HS8H 1I1YA 3RZCA 1QQDB 4E0RB 2X9WA 1RHHB 3BP7B 5TQ0H 3ZZ1A 5B8CC 1A6UL 5I16B 3DUUB 4OFPA 3G04A 1YDPB 1NAML 5D1ZC 2VXVL 4KQ3H 2C5DC 3SJVB 3DOSA 2Z35A 1GHFL 2AK4E 4PRIA 1NUFA 2W60B 1C08B 2HLFC 3NABH 3HPJA 4NC1E 4PY8I 3U6RB 3QIBC 3C5SB 1I1YB 4E0RA 3LEVL 2VDRL 3HPLA 3D87B 4HZLA 4HMDA 3U2SB 5LBSH 4FQLH 5SX5H 1ZT1A 1JI2A 1VB9A 2MCPH 3OWEA 1I7UB 4I2XB 1FH5H 4HPOH 3VWKC 3WD5H 3ZT7A 4LCYA 1X7QB 4PJCA 1IGFL 1ETZA 3I2CL 3BHBA 3ZKQD 3FB5A 5D96C 3PL6B 4L4TA 4Q9RH 3SE8H 3VXUE 3RL2B 2VZUA 4NBYB 1T2XA 2SEBA 3B8YA 4LLDA 2COQA 5T1MA 5JORA 3C60B 3P9WB 4HH9A 2HLAA 1YNLL 4JO3H 1NLDH 4FN0A 2HTKD 2LFGA 3HMXA 1ACYL 5CZVH 4RNRB 3V6BR 1O5DT 5IJKA 4U1NB 4TSCL 4OCSL 1JMXA 3EJZC 4P2RD 3VFNA 4TUOB 4LARL 4EUPH 3MXWL 1MREL 1U93A 4LQ1A 4NPYA 1DBBL 4ONFL 1DLHB 3A6BL 4QXGH 4TUJA 3S34H 3WNOA 4D9LH 5IFHH 2BC4A 1PYWA 4WW1A 5GRVK 3S36X 4APQA 1NGZB 4L9LC 5K9OB 4GS7B 2EDXA 1ZMYA 5BRZA 1Y6MR 5HHXL 2EH8L 1RZIA 5FA3B 4NQEB 3OB8A 1IZJA 4TTDC 3QG7L 5ITFB 4XBPB 5AWNL 5J89A 5E8PB 3D2UA 3O45A 4J1UA 2VH5H 4I4WA 1J0HA 3ARBA 4OM0L 5DR5H 3OJMB 3IXAB 3RAJH 1XGQA 2BCKA 1AGCB 1U8MA 3MA9L 2DWDA 4HF5L 1X5AA 1NFDA 4E42B 2MTPA 1PG7W 1X6NA 4JY4A 4NQCD 1RZJL 1OLLA 3LN4B 4PJ7F 2ADJA 2W0PA 4JN1L 2E9WA 4BQ8A 4CW1B 4E41D 4HUUA 2AW2A 3IFOA 2A74B 4I9WD 2OQJA 4Q58C 2IALA 3GKWL 1AFVL 4OTXH 1XCQA 5C2BL 3CDGA 3QULB 4RIRA 4XHQA 5EN2B 4JFED 3DYOA 2WUBH 5FO9B 3VXSE 5D72H 4D0BA 1FRGL 1NMBL 1MFCH 2HA1A 3B5TA 3KPMA 4XVUC 1FJ1A 1MJ7H 1VACA 1QBAA 2ILLA 3HC0B 4PV9A 5ESQB 1RUPL 5FYKL 1QBMH 1MQKL 4KVCL 2XN9A 1EEYB 4HMEA 3C6SA 4LSUH 4CUCA 1WZ1H 5IQ9B 3BESR 5L8LB 4IRZL 5C0BB 4EUPG 5FKPB 3IDYB 4YHIB 1LDSA 4RMVA 3FHQA 2V17H 1L0YA 5JLZA 1CL7L 1N4XH 1A6WH 4NO2A 5A2FA 2PYFA 4OV5B 2PW2B 3JTTB 2X4TA 1WZ1L 2VXSH 3HCVB 3SDXA 1H15A 1VGKA 1T1WA 3TN0B 1KB5A 4XZUA 4I3RL 4F7TA 1DQQB 1NANH 1ZE3C 1U8MB 1DBMH 5JMOC 4IRJB 1MLCA 1S7XA 2BMKB 2EDTA 3PV7A 1IJ9A 2NTFB 1KACB 3GMOB 2YPLE 5E95B 1JV5B 3WJLA 4WUUE 1BZ7B 1EEUA 3LZFL 4KPHH 1RZ8A 2DI7A 2Z93B 5C6TH 4JRYE 5J06A 1WBXB 4NQDA 5GRZA 3P9LB 4M8QB 1C8PA 1TJIL 3O41B 3D6GA 4NNXB 5FHAH 3ARED 1YQ2A 4GAYB 2I9LB 3KLAB 2FX9L 1BLNA 3VFWA 4A6YA 1ZEAH 4QRPA 2H3NB 3QEQE 4U6HA 1DBJH 3BGMA 5E9DD 3UTPE 3QQNA 3NVQA 4RGMB 4MB4A 3QXWA 1LEKB 1FORH 1G7LB 3QJFA 4JAMA 4ZODA 3FTGB 3KHOA 4R0LA 3QUZA 1G7IA 5MEQA 2R39A 4ZUTB 5GS2D 1VFAA 3QXTA 4L3AA 1MJUL 5J12C 1W0WA 5CIPH 1JVKA 3U30C 3QG7H 1AFVH 1QLRA 3AMKA 4OCYL 2GAZB 3D39A 1F97A 2V2WA 1T2QL 3U82B 5CS7A 5F3BA 3Q48A 3QQ4A 1HILA 4PJBE 4QTHB 1S7WB 3QJFB 4JAMB 1IGYA 2WLYA 3F6LA 4KHXL 1CD1A 4EN3B 5GZND 2CDFA 5ILTL 5ITBH 1NGYA 1BEYL 1KB5B 4XVUD 1F6FB 3RZCD 3OKYA 1F5WA 5IP4A 3MRGA 3T0EA 1YN7B 5ABDE 1U3ZA 4DCQA 3FT3A 4L5FL 1DE4A 2J4WL 3PDGA 4GBXB 3W11D 5HYJB 5E7FA 3REVB 3ET9F 1G1YA 4I0KA 4PR5A 3U0PB 2NPLX 2XA8L 4IRSA 1YMMD 4XVTH 3SKJH 4LLWA 2UY6A 4IHOA 4Y2DA 4X99A 3VXUD 1G7JA 3PGCA 1JV5A 2XN9D 2XQBL 5FA4A 1JL8A 1FFQA 1J86A 1CD0A 1G1CA 5IVXA 1Z5LA 3LKSB 3RBSA 4HGWA 3DRQB 1JWSA 1NAMH 4ONFH 3JBG7 2VLLA 1RUPH 3KLHD 5B3NA 3LY6A 4PD4K 3VMPA 4OCRH 3MJ9A 4ZUUB 4OZGE 4U33A 2DQDH 2FBJH 1OTUC 2PW2A 2QQNL 3QA3B 4WHTA 5KVDL 1UEMA 2P49B 1UEYA 3IDGB 1Q0YH 4YHPB 1IAKB 4TTDD 1ZLWK 1T89C 1J1XL 1IGJA 2JJTA 1YEGL 1INDL 4XNUH 2EIBA 3SDAA 4MQTB 1TETH 5IQ9A 4JDVA 1MPAH 2FB4H 3EDKA 3KPOA 3EAKA 3CX5J 4OKVA 2Q6WA 4Q9RL 1JF5A 1N59B 4NQUA 2ZNXA 1QRNB 2I60H 5INDB 2OR9L 5J1TC 4NC1C 3TT3L 3C5ZC 4DTGH 3P4MB 3QNZA 5KN5B 1DQMH 5T1KD 3NFNA 4NQEE 5I17B 1WT5C 2XWBA 3RBGA 3IFPB 1U8IA 3L5HA 3T0AA 5AAWA 3WUWB 2F54E 1ZT4B 5KSUA 1XCQB 4H26A 4GW1B 3TESA 4KY1H 3MLRH 3ARRA 1M6OB 4APQB 5F7DA 3I6GB 1UC6A 1IC5H 1IT9L 1NBYA 4OM1H 5EZOH 1R3JA 2R9HD 5EZIL 1H3XA 2E7BA 2IQ9L 4NQCA 1XZ0A 2OR8A 1N7MH 3UTZA 5J0BA 2NX5A 4JFQB 4BKLB 2E7HA 1EJ6A 2C1OA 4HC1A 3QWOB 3FZUD 2QSTA 3DI2B 3R06A 2Z92B 1FGVH 4RGNE 1C7TA 1PJ9A 3V95A 3OKDA 3QZWB 2DWEA 2V7NB 4WWKA 2W9EL 3OHXA 2VDMH 2DLTA 2D7TL 2NR6C 3BUYA 3JWOH 4OFYD 4QNPE 1OGAA 3OKMA 2YUVA 3AC0A 1S7QA 4JFEA 4OF8A 2IPUK 4QOKA 1OTUD 4CU8A 5CIPB 4X4ZA 3EOTH 4NWUH 4O4YL 5KSBB 1UACH 3F7QA 1U3HB 4M61B 3WIHA 2IC2A 5JDSB 4NUGH 1JHLH 3LKNB 4PRPB 2MKLC 4X6BA 1G7LA 1MHHB 3MV8E 1U8OB 2IWGA 3ZE0F 1Z0NA 4PJIB 1IILE 3P9MB 1A21A 1T83C 4ODTL 3MLVL 3DIFA 3MRRA 3BIBX 4P23C 2NY3C 3O3DA 3PWPA 2Y06H 2XFXB 1FDLH 2GYSA 5ADPH 1NKOA 3O41A 1WISA 4EN3D 1T0MB 4A6YL 4EBQL 3T8XB 3NPSB 4U1GC 1B3JA 3SDCB 1DBAH 1OP5H 1XGPA 1CF8H 2VLRD 2J8HA 3DX9A 12E8H 3RA7H 3WXVH 1BZ7A 3QEQB 3VDCA 1Q0YL 1P2CB 2APTA 4X4MA 2Z93A 3K4ZA 3FAXA 1TZGH 4NQSB 4Z77A 2H9GA 5I8CA 1CXEA 5DJXB 4J2XA 1MPAL 3K2MC 1KTDB 5DGRA 3V2AR 2D9QB 4Y4FC 4AQOA 2B0SL 5DS8B 4Q9CA 2OZ4L 3FFCD 2XQBH 2EDKA 1NMCB 4ELME 2JJWA 1NBYB 1BOGB 1A7RL 4MJ5A 4FQXD 3WFEL 5D1XA 1GIGL 4OCLC 1J12A 4UI2A 4KROB 2EXWD 3TCXA 5CMAB 2P8PB 2DTSA 5GGVY 2FX7H 1EZVX 1IGJB 2QSCL 5SWZB 1FQ9C 4G43A 4ZSOB 1S7TA 2HG5A 3RI5F 4WFHE 3NZHL 1EGJA 3VFVA 1P4BH 4CVZB 4JFDE 3X13A 5I1EL 3O6KL 1T80A 3WKML 1P7KA 1SVZA 1AO7E 1D5MB 4F7MA 1LGVA 5DURB 1J1OL 2FD6L 3SGJC 2DMCA 5F7YC 3KLSA 5DDHA 4JVUA 4LGSB 4DQOH 2R1YB 5IFJB 3ZL4H 1MY5A 1MCHA 1OAUH 4TUKH 1ZANL 2QQQA 4YR6A 2VR9A 3RJQB 4DGIH 4ZPVB 4R96B 1WSST 4X8JA 1I9JL 3VRLF 2PUQT 4S1DC 2X41A 4Z7QF 1T2JA 1A2YA 4I9WE 4YXHL 1OSZB 2I60L 2VLRE 1CVSC 3RY4A 4I77H 1JRHL 1INEH 4NQTA 3F5WA 5IB1B 1T0NA 5EFIB 4OCXH 2C9AA 2QADD 1J88A 4XMLH 2X7LA 3VXQB 3CFDB 1D5XB 5CP7B 5L2KA 4NKDB 1KN4H 3STLA 5K9JL 3BN3B 3FMGH 4NO5A 5KSVB 4HGWB 4EOWH 4QGYA 4CVXB 1XGQB 2EEBA 1CN4A 1YUHA 5IVXE 2PTUA 4OTXL 2AXFB 2R0ZH 1S5HA 4XTRC 5C92A 4OCRL 1GZPB 4WW2C 3UBXB 5EIIB 5CEZD 5T1LB 4NRYA 1WIPA 3GMRB 1H5BC 3WS3B 3P73B 4PP1D 3LZFH 4RBPH 3P0VL 2Q3AA 4LLVA 4QRRB 4JREC 1W0YT 3RWEB 4HS3A 1S3KH 5DRNA 3WL9B 2CR3A 3TYFA 1NCNA 2BC4B 2IGFH 3U7WL 3VFNB 4TNVK 1YN7A 3NCEB 4IOFC 1DL7H 3SE9L 3VDAA 1Q9KA 4L4VD 4K55A 5D2LF 1S5IH 2X4PB 4GRMA 2NY7L 2A73B 3AM8A 3N06B 2AJUL 3O3BA 3P4LA 1QSFA 2Y7QB 4HK3N 2UY7A 4IDLA 1H5BA 5C0BD 1BD2E 4KMTL 4N5UA 4YGVA 2XZQH 3ZSSA 3FQTA 2WINB 2X4SB 5AZ2L 4RISL 5IHBA 3KYOB 5HXMA 5E2UH 4WENB 5T1MB 1WITA 4MYWB 3CMOH 3RWCA 3O9WC 1GAFH 1HSBA 5CD5D 3VCLB 5JHLL 3TV3L 4I3SH 5EU4B 2H26B 1YEDA 1KLUB 3F12B 1T7XA 2B4CC 2VWEE 4YC2B 4QF1B 3T0VA 4IEFB 1CLYL 4H88H 2FATH 4EN3C 3MCG1 3U4BH 1SEQH 4IRZH 2OYPA 5MENB 2Z35B 3X11A 5J7CC 4NGHL 2DF3A 4G6KL 3LN5B 5IB1A 4M4RA 2FJGB 3HE6C 3SE9H 3NFSH 1I9JH 1P1ZA 5J3HC 2JLLA 1T6VN 4WRLA 5CKAA 5C0IA 1VKXB 5C09E 4GW4B 3BE1L 2YPKA 2OTWA 5EU7E 4WCYL 4JRWA 4OSUH 3X3FL 5H8DA 4HCRH 5DA0B 1YPZF 4AENB 2XWBB 1CF8L 3GBNL 4FXKB 3MUGA 4RCAA 5GZOD 4LHQB 3IF1A 5DMIH 3LMJL 5D6DC 2VDRH 2QADB 5ESAB 1FNEA 1FIEA 5ACZA 4IMLA 3HE7C 3WEXB 4NZDA 4M1DL 5FUZH 1VEOA 1XIWC 4PTUB 5B8CB 2CRIA 1P6AB 2WINA 4HPYH 4TULH 2HVJB 2PYEB 1RIHL 1XGUA 2ERJB 4WI2A 4YGVB 4U1JB 4MHHI 1R3LB 3KDMA 2HJFA 1K8IA 5JXEA 3QHZL 3VFPB 4U2YA 2P48B 2IBBA 2VDKH 1QOKA 2RB8A 4GW5B 4QYOA 3RKDD 4H1LG 4ELMF 3WCYA 1KXTB 3RWJB 4LCWE 1LEGA 3NN8A 1P4LA 5T1LD 5C07A 2YD9A 32C2B 1QFOA 2VQ1B 1F6AB 4M93B 4GJTB 4YEEA 4JFEE 1K3IA 1NCBH 3BPOB 1T1XA 1DR9A 4M62H 1FJ1B 3MOAL 5D1ZA 5C0AA 3ARFD 5FYJE 3TBSB 3QHFH 4MZ3A 3MLYH 1MCWW 4J3TA 2D4DA 4EI5D 1UWGL 4BFGA 4DGVL 3BYTA 5EC2A 1MWAL 5I73B 1KIUA 4CVXA 1T5WA 4HS6B 1D5BB 4U1HB 2AGJL 2YPVH 3NA9L 2DD8L 3O3AB 1UH3A 3QUYB 4WI4A 4LP5A 1P9MA 3V8OA 3BDYL 1C1EH 4X7DC 5CP7A 2NY4C 1KEML 2MCPL 2VJXA 4PJBA 1NLDL 1T20B 4L8SC 4Y5XB 2FO1A 2Q8BL 2WM0A 1I1FB 1J1OH 2FD6H 5T33L 3MV9A 1A3LL 1FNSH 4EI6B 1CFQB 4JPWH 5JW3H 1CGVA 5TQ2L 5DA4A 5FHBL 5EU3B 5JTWA 3UC0L 2VDOH 2X4RB 1BD2B 1XFPA 1AXSB 5E2TH 3UCRA 4GRWF 5JA8B 3S9DB 1DQDH 4K8RH 4ZOEA 5JHDA 2CLRB 3SPVB 2ADGA 4LCCA 1K4CB 4I8DA 3X12B 2R1YA 1EFXD 3KG5A 1JZ3A 1J87A 1MCDA 1OGAB 4XC1L 4Y5YB 4H20H 1JK8B 3NCBB 1V7MH 3MJ8A 1KYOJ 5TPWL 1N26A 2EDBA 1IQWL 4RBPK 1UT9A 4JFOA 2WIMA 4KTYA 1A6AA 4IOIA 5FXCH 2RBLA 1KJMA 3U7YH 2EXYD 3BGMB 3C5ZA 3V6OC 1E4WH 2ZUQC 4ZAKB 4JKMA 3CVHL 2OL3B 3CDCA 5E70A 2AQ1A 4MHHG 3U6RA 4ERSL 2A6KB 3WN5C 2ZWLT 3S96A 3TA3D 5C9JB 4N0UE 3MLZL 1H8NA 4KH2A 3OKNA 1PSKL 3LRHA 3V6ZB 4GQ9L 1YDPA 4HG4J 3RWFA 5FGRA 3V0VB 4LFHD 1X5HA 4HXBL 5C3TA 4A6YH 4EBQH 2IPKB 3PG2A 4WNQA 4LSTH 3M17A 4X7FC 2EDOA 5T3XD 4EDWH 4MS8C 1FAIH 3LOWA 4H26B 2GUOA 4XVTL 4UUJA 3OJVC 1OWRM 4PJFA 4JPVH 4ODTH 3RP1A 3EYVA 2DL9A 3QG6A 3RTQA 4DEPB 5BS0D 2VRAA 5C07B 1G9NH 2O93L 4Z6AT 4JFDB 4GG8B 1DBKL 1WEJH 5F1OB 4N0FA 2BP3A 4ELKA 2RHEA 1U3HC 1GC1C 4XP4L 5EBWB 4JDVB 4OB5L 4RWHA 4WTZG 1XGUB 3FFCE 2OX5A 1UXSB 3IDNA 4NHUB 5HYQB 1YN6B 2BSSA 3RVVD 5DJAB 2G9HA 3JUZA 1F8TL 3T0EC 1U6AH 3IU3B 43C9A 1CWVA 2WV3A 3GMQB 3G5XB 5LG1A 4ZUUA 2VWEC 3PGFL 4Y1AB 5FUCE 2GCYA 3PQYB 4OF3A 2IFGA 4NM4L 3QO1B 1AXTH 1OSPH 4HIXH 3PV6A 4ZUVB 4RX4D 3I3BA 1UVQB 4KUCF 3V0WH 2APBA 4MA3B 1WWCA 3H6JA 4XCNB 3ECBA 2AJVL 3WE6A 4GRWE 4FXLA 5GGVL 3IU4H 5E1AB 5M7QA 2BNRD 2EXWC 1AI1L 4WFEE 1HHJA 2BNUB 4I0PA 5CEYB 1N5AB 2AK4B 5IJVA 4MJIA 2XTJC 4K9EH 1NMAH 5GRUL 3ALWA 5DI8A 2NY6B 3JUYA 4WHCA 4KPHL 3WJLC 2LAAA 1VGEL 4QRRE 4HLZG 5J9PA 3F12A 1MVUA 3REWB 3UDWC 4OZIE 5EOCH 2J5LC 5EC2B 1N0LA 1RIUL 3D0LA 3TBWA 5DHVH 4TVPH 2EC8A 5JNYB 5J12B 3U79A 3VD7A 3H7BB 4IDJH 4L3EB 1PD6A 1IEAB 3LMJH 2AJZB 1FFNA 1O7VA 1TZHA 4DN3L 4M6MH 1SEBB 3ESUF 4E5XB 1GOGA 3PHSA 5IB5B 5J1AB 1U8IB 5TFSL 2R0LH 5C0CA 4HKXA 1BVLB 3GSNL 5E4EC 4IIQA 4PBWD 4RMTA 4NT6B 5IF0B 1FORL 1ZOXA 4QHMB 4H25B 3BP5B 2OP4H 3BPLC 5AAMA 1E6JL 5F7LB 5T1DL 8FABA 4PJ9A 3DGGA 3GFUA 1JZ4A 3PWJA 1EHXA 1MEXL 3ZDYE 2CLZA 4JKWA 1CTNA 4NM8L 4U6HB 2VISA 1HOCB 1J0IA 1X4ZA 1I8KA 4D8PA 2GJ6E 1W0VB 5D70H 5ELIA 2CO6B 5JW3L 1JWMA 1UZ8A 3VFGH 4DOHE 3V6FB 4LASH 3WS3A 3BOVA 3CH1B 4WGVB 5CZXD 4KDVA 2IH3B 3ES6A 1KJ2L 4M6OL 3PIQA 1T03H 1K8DA 5IQ7H 4LCYB 4NSKA 2VLLB 4LKCB 1I7TB 1F4XL 3MLUH 4PJAA 4ZO7A 1MCRA 2OXGA 3IGAB 5DD1L 1FNGA 5B4MC 3ZO0A 2A0LC 2BHUA 4WV1C 2JIXB 2IADA 3K8LA 3RGVB 3VXQA 2DQIL 2FZ3B 2YSSA 4H0IA 4MAYA 2E6PA 4XCFH 2P8PA 4Y4HB 2V6HA 5D2NC 1J1PH 4G5ZH 4JKKA 4IRSB 4R7DB 4LSDA 3SJVA 5K9QI 3S37H 1J11A 5SWSB 4K94H 4TRPH 5LAXB 4AEHL 3K8MA 2XKNA 3ZYIA 5GS0L 3GZKA 4KRMB 4I48B 1XIWA 3FQRB 4UQ2A 1X5KA 4NZJA 2P5WB 4JCLA 3VD5A 3O2DH 3OB0K 3TFKC 3FB8B 3OAUH 5H37G 1BZ9A 5IF0A 1WFTA 1EDQA 2YWYA 4X80H 2FYYA 5BOPA 1QFUH 1MJJA 4XC3H 2Z8SA 1KFAH 2ZSWB 4JDTH 4I77L 4S11A 5J1AA 1T7ZA 5BXFB 4DKAA 1FZMB 1T7YA 2OK0H 3VWKD 3UZQA 1AD9A 1NMAL 5K9QG 5J8OA 4Z7VF 1UZ8B 1KT2B 2XY2A 4D8PB 3C2AH 4LHJB 3RRQA 4UT9H 3ZL4L 1KB9K 4L3CA 4PY7A 3S35L 1HDMB 5MP6L 1AD0A 4HSQA 4KKLC 5JPMA 4GMSH 1IGMH 1NC4A 1DTUA 4Y8AA 3WUWG 4DUWA 3B6SA 2KZ1B 3N1PC 3FOMA 4HQQL 1FFOA 3LDBB 5I1HH 2ICWB 6FABH 1S3KL 2GIYA 3S37X 3L3JB 1RSFA 5D5ME 2O5YH 2GY7B 2VLJB 2Z8WC 4KFZC 4OZGB 4XCNA 1X9QA 2OP4L 1HHIB 4PLKC 4XAWL 1F4HA 3RIFF 2Z31A 4ZO8A 3VFGL 2VZ1A 3F62A 3D39B 3CC5A 3E6HB 1TVHB 3ROOA 1P53A 3K3QA 5F9JA 2BVYA 3QO0A 1SYSB 2WK2A 2FGZA 2ARJQ 2NX5B 4ODVH 5DI8B 3AGVA 1TTUA 4XVSH 32C2A 4KZDH 3CUPB 3HMXH 2YXMA 3CJJA 1JPTL 4HKJA 4M3KB 2BSSB 5EOCL 1U93B 3LD8B 4YX2L 3WFEH 3FCTA 3BX7C 1TXKA 2XWJA 1ADQL 3CDFA 3GSNH 3VFWB 3ECBB 5GJTL 2JELL 1Q1JL 1KT2A 3O6MH 25C8L 4JGMA 5CIPA 2BK8A 3BFOA 3HG1D 5KOVC 1FL5B 3MCLL 4RAHA 1J8HA 3OZ9L 4HCRA 3UPCA 4LOUC 4NQDB 3RWIA 4JFXB 4KI1A 4PRHA 4ZNEE 1AGFB 5AWNH 4FXGB 4V1DA 2A38A 4ZFGL 3Q5TA 2HT2C 4JE4B 5FM5M 4Q7DA 5F6HI 4YHLH 1L7TH 4J4PC 1X5IA 3BN9C 4UTAH 1J10A 3ARWA 5MERB 2P5WA 3F65A 3B2UD 4Y19E 4KK9C 2F19H 5IB2A 2FX8H 4BQ6A 1K5NA 2VXQL 4LASL 5KOMC 3DRTB 4LARH 4HUVB 3I6GA 1RZ7H 4RZCA 4J3VA 4YNYA 1U8JA 2ZOKB 3LKPB 4I0PD 4OZ4B 1R5IB 1EXUA 2G75B 2YMXH 3CXHK 1NSNL 3PUCA 1XR9B 4O2CA 4DZ8B 3EYVB 1MCPH 2BOCB 5BMFL 5L6YL 2FZ3A 4Y4FA 2BNQB 2BXZA 4X6EB 4YHYC 5EU4A 3LKRB 3UJJH 1TZGL 3BKYL 1HI6A 1CXKA 4F58L 5C6PB 3SKNB 4M1GH 1HH9A 4UZGA 3V4UH 1T04B 3EYSL 1QRNA 2W0KA 3QIWC 1U8KB 5IHLB 4OZ4A 2DI8A 2X44D 4PRAA 1NCWL 2W0LA 2DLFH 2XT1B 4BH7A 4BSWA 3ARBD 3L95B 5DSCA 2CLRA 4M7ZC 2YUWA 1PKQB 3QFJB 3GK8L 1BFVL 4HULB 2NXZB 3EZJB 3MBEA 3VH8G 4W6YB 3T0EB 1HHHA 1MCOH 2N7BA 4K7FB 5F3HA 1IAKA 2CK0H 3MRKA 4PJXF 1BBJB 1FO0H 1VHPA 4HK0A 3D69A 3VD4A 3FB6B 4U1NA 3U46B 2N7AA 4NUGL 4E41A 2DQEL 1RK0B 1P4IL 5I6XB 3MROA 4LEOB 1D5BA 2WQRA 4FXGA 1A7OH 1DVFC 2B2XL 3DETD 3HE6B 3SKUD 3MXVH 4RAUB 3BUYB 3AB0C 3LAFA 4QNPF 5HD8C 1RURH 3T65A 5EIIA 4MNQD 25C8H 4AEEA 4N90E 2AJYH 5GRJL 1CIUA 2ITCB 2VKXA 1HHIA 2LV4A 2OMNA 4HS8L 4PP1C 1I8IB 1N6QH 4MJIB 2FHFA 3LHPH 2BVTA 3HMXL 3PWVB 3NN8B 1OD9A 5B39G 4JG1L 3IDUA 2FO4A 4XRCB 2NW3A 4FQCL 4IIQC 4GQPH 3PWPE 1AR1C 4HC1H 1KCRH 2GTWB 5GGSB 3HI6H 5T3XH 4HX1B 5KJRH 3DECA 1NFIA 5ID0B 4EJ1C 1Q0XH 1H8OA 4LOUD 1ACZA 1MY7A 4MAUH 3ARDB 4HGKC 2NY1C 3MR9B 4I18C 5ETUB 4D0DA 4PJ9C 4DVRH 2VE6B 5FO8A 4IMLB 1MLCB 4MQXD 3JWNC 4PB9L 5HVGB 2IMMA 3DYPA 3EOTL 3B9EA 3W39A 4MQSB 2ADFL 5H94B 1KXQE 4O02L 3O6FD 1I1AB 5KVGH 3NIGE 5D9SA 3T4AA 5I2IB 3U0WL 4U3XA 4XWGL 3BMVA 5DK3A 1K8IB 2DMKA 2E6JA 2FB4L 2QLVB 3QDJE 3BPLB 4TPRH 3AREA 4XWOD 1XGYL 3LRSB 5I8KL 2HH0L 3GSUB 2HFGL 1FV1A 3QYCA 3BH8B 1HNGA 2DQCH 4JPIB 1RMFL 4JG0H 4MJ5B 4QGTA 4AYFA 1MCKA 5HGAA 5A2JH 3DO7A 4LSPL 3QXUA 2GFBA 1IC7H 2MJWA 5A2LH 5HVHC 3RTQB 2F5AH 4O2FB 2BVPB 4MD5B 1QQDA 4XPTH 2XPGA 1TNMA 2JIXA 3G6DH 5IVXB 1GZQA 4NYLA 1S78C 1DBJL 5FA4B 4KI5E 3KYMB 4WO4A 5JZ7C 4NQSA 2VZVA 2X4NB 2BOCA 3FAWA 2B1AL 2H41A 4NFCA 3CNKA 3ILQD 2Q3ZA 3VMOA 2IPUG 3C2SA 4HX1A 4Y16D 4O2FA 4X6DB 2QJDA 3FQRA 1Q72H 3NGBB 4UQ2B 4Y2DC 1YMHB 4KKAC 3MLTA 3Q0HA 5HGAB 5D7SH 1HHGB 4Y5YC 5C09A 1BMGA 1KPVA 2DTML 3O8XB 3BZDA 5FUCC 4UDTB 1Q38A 1JN6A 1WV7T 2WUCL 5CLTA 2BXYA 4D2NA 2Q87A 3RNQB 1NBVH 3SCMB 3NCFB 4G6KH 4YXKL 4ESKA 5E7BA 1NCCL 5KSBF 1IVLA 4X9BA 4PJBF 2VDLH 3MUHL 3QWRA 4LDLB 4CMHC 4KDTC 5EZJA 5E6ZA 5FO9A 3L5IA 2ZOLB 2FBJL 3MJ8B 4JM4L 3BE1H 1I7RA 4YIQB 4XC3L 1A4KB 5F70A 1JPTH 2JCCA 4O2EB 3U4EB 1DANU 4P4KA 4MMXC 2ZUQB 2YR3A 2OK0L 1PYWB 2XACC 2FNBA 1IE5A 5F7KC 1TPXC 3KAAA 3OAUL 4LSUL 2P5EB 3H9HA 2Y36H 3EO9H 4LVOC 3CPLB 1G6RH 4YHKH 2ED9A 3KS0J 2HLFD 1MSPA 4EI5C 2NW2B 2P5WD 3QISA 5EU3A 3RKPA 3E8UL 1RIVH 5FK9B 3ARFC 1WIUA 2DB8A 2HLAB 4BSWB 1U92B 4UT7H 4P57B 4PV8B 4PJDF 3FZUC 2SEBB 1U8NB 2F58L 4PJGE 4PPTA 4AIZA 1YNKL 3O6KH 1FFNB 4U7SA 3SE4C 4UILL 1UVQA 4N0CC 5FM8A 1KIRA 3GJEB 2LU4A 1QPXA 1HN1A 5E8DL 2R15A 3MRQA 3TN0A 4FFZH 4QXTA 3TA3B 4JFZH 4HWZB 5IROA 2UUDK 1R24B 4O9HL 3HUJA 1RK0A 3BPCA 3D48R 2V7HB 2XXCB 3UX9B 3VFSA 1C7SA 1QRND 1O0VA 3TCLB 3DMMC 3PDOA 2WAHA 4FQIH 3PGDA 4PJHF 4LCCC 1VPOH 4GS7C 1KOAA 1VADB 1RJYB 4CNIB 3MGTA 5CCKL 3MJ9H 1ZLVK 3MLWH 4GRLC 4L1DA 4PS4L 1CQYA 3O9WD 4KROC 1CLCA 2WMPA 3C5ZD 1R3LA 5T3ZH 1FZOB 2WBKA 3WNKA 4PD4J 1VDGA 4KKAD 1T1YB 1IC7L 3VFSB 1OAYH 1BECA 3QPXH 4WHYH 2VDQL 3UO1L 1FZMA 4BH7B 1CFBA 1YMMB 2EDHA 4Z95H 2CUIA 2FCBA 3B5GA 4HXAH 4NQDE 5LXGH 1MJ8H 3FT4B 4QHUA 3MXWH 3ARXA 3Q2CA 1ZANH 2C26A 2ARWA 5C0GA 4DEPC 4POYA 3CDGB 3U2SA 1GZQB 2H2PD 4NYLB 2OL3L 5C09D 4JO3L 4LRNH 4P3DA 5ISZA 4CN4A 2X09A 4YO0B 2X9XA 3RUGE 4BH8A 3Q1SH 3I9GH 3G6JF 5SWSA 4GUPB 1BF8A 4OBRA 3IDJB 4HUVA 1RHHA 3BP7A 3GIVA 3MV8A 1KTLB 2A6JB 1J0JA 3SDYL 3F6IA 4HWZA 3PWPD 1IKFL 3C5JA 4MXWH 5IW6B 5EU6A 5I1KL 1JE6A 5IGXH 5MERA 4P4KD 2PF6A 1BM3L 3VFMA 3AXLB 2EYRA 1KIRB 4OGXL 1P9MC 2DOCA 5DUPL 2ZPKH 4PB9H 1FGVL 5I66A 4OJFH 2C1PA 4U4BA 5EO0A 5E03A 4WI7A 5DK0B 3RVTC 4EIZC 4FS0A 1ZA6A 1M1SA 1GGBH 3VA6A 4TVPL 4WTWA 3I3DA 4S1DD 5AUMA 1N3NB 2FH8A 1HXYB 4JZJA 5IKCB 4DKDC 4OD2A 4OIIL 4ZXBC 2JB6A 3SCMA 1I8LA 3FMGL 4ZOBA 3FB6A 5JPMB 2AJYL 3K1KC 2XOTA 2PO6C 4X7TA 3EOBB 5KANG 5TPWH 3QH3A 1YEFL 1UCBL 4Y5XA 1N6QL 3G5ZA 4S0SD 4OF0A 4L3ED 1C16B 1PG7L 4EUPA 4P4KB 3QR2A 2ENYA 4ZQKA 1ORQA 3O81A 4LLAA 2HAZA 1XCTA 4H5SB 1UQSA 3E6HA 3DSFH 2IG2L 4MJ6A 4TPRL 4NWUL 3T0XA 3HZVB 5ANME 4JFFA 5JQ6H 5J6GA 4YE4H 1QVOB 5CSBA 2FSEA 1BIIA 5I1AB 2GSGA 1YEGH 2P7TA 4EDWL 2DDQH 4YPGA 3SGKC 3BZFA 3EYSH 1OAXH 4POZC 3E1F1 4RMWA 5TDOB 3DVFA 4FQPA 1CE6B 3GSUA 3CLEL 1LP9F 1IMHC 2IAND 1JGLH 2HJKA 4LLQA 4NJAL 3WFCH 4Z7OF 1JUFA 1KENH 3GSWA 1OL0A 3BD4A 3UYRH 1A02N 4PGCB 1D3CA 5DSCB 1UWXH 5TF1L 3STBA 3WFDH 2B0SH 1MRCL 1DSFL 3QIWD 1Z6JT 3O0RL 1YEEH 1P7KB 5ACLA 2YN5A 4OZFA 1WWWX 4NJAH 4L4JA 3QIBA 1LK2A 4PLJD 4JRXE 5B39B 2GY5A 3O4LA 3FOLA 5D1QC 1KCLA 2UUDH 4PJ5E 1I8KB 5I71B 2K1MA 1CLZH 3VRIA 4M00A 1U2HA 4Z7OE 5TE7H 4QHNA 1G7PA 5L2JB 4XWOC 1XF3A 1DN0A 1E27B 1RHFA 4HJJH 2GHWB 3GSRB 2H32A 1BVKA 2A83B 3TH2T 5EO1B 2FJGA 5DS8A 5IK3A 4MCZA 1EX0A 3BPCB 4NUJB 5CKGA 3O6LH 2ZJSH 4BZ1H 2ORBL 3G08B 4BQCA 5H94A 3VGAC 3MMEB 3H9SE 3ULVC 5D7LD 3MYZA 2CJUH 3FO0H 3MRLB 4WVRA 3QDHA 1UXWA 1N8ZA 3BO8A 3LD8C 4OIIH 4H1LH 2VLMD 5CUSH 1U3YA 3STZA 2DM3A 2AGJH 4WI5A 4XHJD 1G7JB 2GJ6D 1RUAL 3KVQA 2ATPA 4XXCA 4R4BA 1Y18A 5IMKB 3TBYA 4QRSB 1JF6A 4UOJA 4RGOL 4FP8L 4PJ8C 5I30H 5C08E 1ORQB 5K9OA 5ALBH 2W65B 3GHBL 5FDYA 4HBCH 1SMAA 5TQ2H 4WEMB 4P3CH 2PXYB 3X11B 4QRPE 5JW4Q 1QFHA 4XNZB 1JZ8A 5IMLA 3KPNA 3P9MA 3WE6B 1EFXB 4F7PA 5AG9A 4S2SA 1WCBB 2GJJA 3GBLA 3LKNA 4PRPA 4FTVB 4F8TA 5BW7A 3WIIL 2OR7A 1G7MB 3B9KC 3Q1SL 5AUMB 2EC9T 3BZ4B 4LIQE 3MOBL 1JGVL 2NXYB 5ALCH 4GMSL 2JB5L 3E0GA 3T2NL 1CCZA 2X4SA 3Q6FA 4H0HB 3SDYH 3QUZB 4JO2H 4JRYD 1LE5A 2Z92A 1AGDB 2G5RA 4EIGB 1OT1A 3EDJA 3H9ZA 4NKOB 5BQ7B 1OTSC 3V7AE 3IDNB 5HYQA 4JGUA 1A64A 2A77L 1M4KA 3VW3L 3TYGL 2A6JA 3CFCH 2NY2B 1L7IL 1IGML 5D7LE 2WBJD 4UAOC 4M9PA 1GGUA 4U1LA 5F7DB 2DAVA 1A1NA 3SO3B 4GMTL 3JV6A 1H3PL 1HQ4A 3MLWL 3WFBL 1EJOL 1VSCA 1EEQA 3QDGB 3T4YA 4R4BB 1VFBA 1KCVL 4GXVH 5IBLC 4PJ7A 3K2UL 4LF3A 4NFDA 4WFGE 4KAQH 5KVDH 1AD9B 5EORH 5JPNB 3O3EA 3OAYH 3M07A 4WY7H 5HHOA 2Q76B 5I9QB 5LGJA 2ICWJ 1A8JH 3X13B 3BH8A 1PW3A 2ITDB 3NCMA 1LQSR 1OGTA 3U9PL 1A7PH 1JUFB 3VXME 5EBLA 5GS0H 4UOW1 5EC1A 4MA7H 4YHPA 2X42A 2VDNH 1UA6H 3GSXB 3OGOE 2R8SH 3RAJL 4IOIB 4JGJA 2GK0A 1V5JA 3R1GL 3NZ8B 3UYOD 4JY4B 4XBGB 1KJ3H 5IUSA 3MNZB 4G80B 3QIBB 5FYJU 5CD3A 3W39B 1MRDL 2Q76A 2ZG3A 3HUJB 1V8HA 3O6FC 4DUXA 4OAWA 4IIQB 1S8DB 3MRQB 2V2TA 4XPGL 4HWUA 5CBAB 4R90L 4XI5D 4S1SL 5DT1L 1BFSA 2AV1A 5F7MC 3GSWB 4PJGF 2A6DA 3MRNB 2APXA 5TE6L 5JW4R 1WZKA 1X5YA 4AEIH 3IFOB 3RY5A 1U8NA 2NY1B 2NXZC 3IFNH 4MJIE 3AREC 1M71A 3QDAA 1CE6A 2EIZB 3TH4T 3MUY1 2WP3O 4NPYB 3LV3B 3CDYA 3AVEA 1U95B 3OL2A 1UZ6F 3RDTC 2J6EA 5CJQH 4OCXL 2GEEA 5EOTB 4C58B 4JRYB 1BQHB 1AIFB 4KJPD 4F7EB 1U58B 1IGIL 3WJJC 1FBIH 1OAKH 3ISWA 1D6VL 1QLFA 3K80A 1A9EA 4DQOL 5BQ7A 3BD5A 5KVEL 3AS2A 3CCHA 2YHGA 1Z9OA 5FHAL 1EA9C 5TDPB 1RUQL 3BT2L 1AI1H 3KYOA 4JB9H 2VB5A 3MRBA 1U8QB 4YDKH 2VZOA 2QV2A 3T2OA 3QDGD 2IFFH 1GGIL 2Y06L 5KSBE 4UDUB 5DYOB 5F89B 5I75B 2CGRH 1T5XA 3EYFA 4UINL 3VWJB 2PYEE 3C5JB 1WCBA 3RNQA 3UMTA 1TQBB 3AFLA 1K6QH 4FNLL 3VFUA 1B0WA 2O61B 2D7NA 5FCSH 3ARSA 3RWEA 4DK6A 2DMBA 2R4SH 4PJBB 3MREA 3TM6A 2CDEB 5E1AA 4OUUB 4CMHB 2JJTC 4NRYB 4YO0A 3O8XD 1W2KT 3RZCB 2C7UB 3P9LA 4M8QA 3HC3L 1SHMA 5I0DA 1GRWA 2ATPB 4Y4HD 4P3WA 3UZEA 2Y5TA 3O2WL 2B20A 2YA1A 5BOZG 3WFCL 1QKZH 2C3WA 3VW3H 3RPIA 1YYMH 3BAEL 2VSDA 2EIEA 5ADOL 3ORJA 4Z7WF 2ZNWA 3HLAB 4JKLA 4QCIB 4A2LA 3FFDA 4YHZL 3S98A 4BZ2H 5JOPE 1DN2A 3MRFA 3MNZA 1BAFH 1H15B 1VGKB 5GRYA 4FQQA 4XWGH 4KRLB 4WGWB 5JW4N 1GC1L 1JGVH 3VFRB 4XP6L 3P0GB 1BVKB 1XMWA 3NTCL 5HI4C 3MA7B 1TCRA 3QCTH 1I4FA 3QDJD 4GLRH 5AYQA 1VFUA 4TQEH 2AXGB 4DAGL 2HVJA 3QA3A 5D71H 5LGHL 4QXTB 3O4LB 4QHUB 4AY0A 5L9DH 1OSPL 5GHWL 4EZMA 5E0QA 1KEGL 1EPFA 2FBOJ 4OLWH 2DQFB 5A16A 3ULUC 1PEZA 3CH1A 3F8UB 3X14A 3T08A 1NEZG 3W0WA 2GSIB 4KMLB 4HIHB 2Q86B 5CWSB 3BMWA 5K59E 4XPFH 2YA0A 1TCRB 3P30L 3BRFA 1MI5B 4GW4A 1K9TA 2R56L 2BNRB 1DDHA 2J8UA 4G6JL 4TSBH 2Z4QA 3HC4H 1NC2B 4LLMA 3DGGB 1LE9B 1A22B 1JHKL 3HUJF 3K1DA 1VGEH 3TA3C 1QNZH 1HHJB 2BNUA 4K7PX 1AQDA 2QHLA 4OFYA 2ZUYA 3SEPA 4FFYL 2PYED 3LDBC 2EDWA 1EMTH 4KMQA 4QRQB 4UV4H 2VOTA 1HNFA 1OAZH 4HKZA 5F96H 2ICEA 5ADPL 1FPTL 4N68A 2Y5TB 4H20L 1CGSL 3FQXB 4JM2B 3X3GL 1LP9B 2GJ6B 3DHJA 1KUMA 4LMQE 5C0BE 5T33H 5L9DL 4PJEA 1TJGH 4AEFA 3U7AA 1KGCE 1C12A 4WEBL 4OQ1A 3I02B 4UV4L 4TNVF 5D5MF 4XNZC 2DD8H 3OR6A 1F2QA 3QH3B 3KYNA 1KC5H 3I9GL 4KKBC 4FQ2H 1TJGL 1I9RH 5INCA 3KPSB 1MOEA 3KLHC 3IDMA 5I71C 3T3PE 3O8XA 3K4DA 4MDJA 4R7NB 1MF2L 2FHCA 4R96A 4G7YL 3ULVE 5D7JC 3NH7H 1QSEB 4FFVD 4KY1L 3T09A 1TCMA 3IB4A 4R26H 1A4JB 1J18A 2NYYC 2V9QA 4TVSa 4Z18A 4FQHB 4R2GC 1EH9A 5TQ0L 1WBZB 1WQVT 3QHZH 3QNXA 1G0DA 4MX7A 3FFCA 2HT3D 1XR8B 3MUGB 1BFOB 2GTZA 3QAZB 5LGHH 2GUOB 1NPUA 1QRKA 1J0KA 5DEGB 3VWKA 4TQEL 4OLZL 1QSVA 4HUWB 4HUKB 4U2ZA 4NQVA 4LSTL 1FZJB 5E8NA 4NUJA 2R2HA 3JZ7A 1CS6A 2BY3A 4LIQH 2PCPB 1FZKB 2YXFA 1MAMH 5DUMH 2HJFB 4XPHL 1FHGA 3OSKA 4MVBC 5F1NA 3ZMRA 1H3TA 5IIEA 2Y07L 4KHXH 2OI9B 3BIKA 4J23A 3B2VH 1IL1B 4L8DA 1I7TA 1DBML 2VXTL 3WUWA 2G2RA 1TETL 2I07A 3VGHA 1FNSL 1R3HB 4N8VA 1HH6A 4C83B 1RK1A 4HD9A 3DBXA 2B7DT 1Q9OB 3VGGA 2BVPA 2XKUA 4MD5A 2OMBA 4BELD 4KKCC 4KK8D 5D2NB 1QLEH 3IFLL 5ICXB 2EDFA 2EH7H 1CGWA 3HCVA 3SDXB 1G6RB 3E8UH 1I85C 4GRLA 4MLIA 3IJSB 4CVZA 2X70B 2OTWB 1RVFL 4POUB 1K2DA 5C0EB 3OPZH 5C71A 3IDMB 5F1NB 1NFIB 2EYSA 5I8EA 1T21A 1CE1H 4ONGH 4APQC 3JTSB 1UKQA 4BFBD 1RJYA 2FIKA 1KTKE 5IROC 4XNMB 4WV1A 1NFDF 1V7NH 3R4DA 1BOGA 3IFNL 1T3FA 3HR5B 3L3OA 2XN9B 2VXUL 4H0GA 1HCVA 3VG9B 2WUBL 3BGAA 4KK5C 4CJ0A 4ZNCD 1XF2B 2W91A 5GXBB 2MOVA 3EO0B 1ND0A 5JHLH 3T1WA 1L9NA 1I1AD 5EB9A 1BVZA 3MGAA 2QSQA 2O5YL 5TJWK 1GSMA 1LWRA 3GGWB 1K4CA 5GRXG 4F37K 3MBXL 1FLRL 5DZNA 5JR1H 1W72H 5KTEH 1JWUA 3WHE0 4FZ8H 4OZIF 4BKLA 2RFXB 3WIHL 3FQTB 5FUZL 3QHFL 4HUUB 2VQ1A 4P9HC 4ELMA 4XH2B 3KLDA 1T3FB 3M45A 3UDWA 5IMMA 4LU5L 1FLRH 3TZVA 2V17L 2R0ZL 4LQFL 1BBJA 3GBNH 5D6CA 4U0RB 1W72A 2JELH 2FIRT 1CGTA 4UT7L 3RU8L 4LKXB 3ARPA 5E56A 3H42L 3B9KD 5INCB 4QHKI 4ZSOE 4YX2H 1IGYB 4FA8A 5TE6H 4NN5B 1FLTX 1X5GA 5I8OL 3ARBB 4PGEA 2ZSVB 4M61A 5FYKE 2GAZA 4YBQC 1N3NA 5GGQL 3WV0A 1CFSB 4RA0C 1TNNA 3O4LE 3T65B 4JPKH 4MNGA 5FF6B 1E4KC 3X14B 4QEGA 2DQIH 1F00I 5D72L 4ODSL 2JCCE 2ZOLA 3VH8B 2PR4H 2FJHA 4NRXB 1D9KA 5E8EB 3L3KB 2ESVE 2ESVA 3U1SL 1Q9LB 5JQHC 2AXGA 3GSXA 1TDQA 1JFQL 4PB0H 5IIEB 1P7QD 3X3FH 3C09C 5H2BA 4J6RH 4G8GD 2MPAL 2QADC 1GVIA 3QUKB 4LCUB 3TO4A 1PVHA 3MBEB 1C08A 4I2XE 4N0FB 2LAGB 1DQJB 4WFHD 3ULUF 4UDTA 2PTTB 3F7YB 1IM9A 4PTTB 2CIKA 4PGBB 5DD1H 2X1OA 3TNNB 3ZTJG 4A2MA 2FGWL 4IM8A 3UTSB 3EDEA 2A0LD 1EUUA 3DJ9A 1X5LA 5DFVC 5M94B 4GW1A 1KJ2H 4CBPA 2XYCA 3E3QE 4PG9B 3PF2A 5BS0E 2DIJA 3V5DA 4N8PA 5DJXA 2YK1H 4K71B 1I8MA 3L3DB 1UGNA 5JMRA 4YDLB 3K74B 1JYVA 5F88A 5F7FA 5MEOB 4ZS6C 3CK0H 4JQVC 4KQ4L 4B5EA 2OTUA 5TE4L 3ES6B 4FQ1L 3B3IB 3HKFA 5CHNB 4NKQB 3P11H 3QQ9D 4HWNA 3GMNA 1KCUH 4IDJL 2A9NH 4MDIA 4JFYA 1KCSH 4WHDA 3LRSA 3BYYA 4OCWH 5E08L 4JN1H 1MFCL 4GG6E 2DQTH 5I73C 2Z8RA 5DQ9A 1LEIB 5E5MA 1I3GL 3IFLH 3B9KB 2KQMA 5D9SB 3T4AB 3TJEH 3LRGA 3TBVB 2WBJB 1PZUB 4MNGE 4EI5A 4XXDB 1T5XB 3EYFB 4P5TB 1JZ7A 1J5OH 3MXVL 3U0TB 1F90H 3W9DA 3P4OA 2H6PB 4KTEL 1BBDH 4M9OA 2I9TA 4Z0XB 5T1LA 2EEAA 5KVGL 4XCCL 3KPLA 4HJJL 3E2HB 5CUSL 1URLA 3MJ7B 2FH6A 5FYLE 1TZHB 2E7LC 2ADFH 1FIGH 1F4WL 1ZVSA 1IGCL 4IJ3B 5DFVD 4NO3B 4R4FH 3U30B 5IT2H 5JNYA 1IEHA 1QYGL 4QRTB 1G7HB 3KNBB 2ORBH 3K7UA 2A74A 2B5IC 1IC4H 4MZ2A 5KW9L 4QLRA 1YEHH 1AIFA 4F7EA 4L4VE 3BEVB 4JHAH 4JFQA 1GHFH 4ZFFB 2UWEB 3RQ3A 3RVXD 5F1IA 5F8RC 4JDZA 1U95A 2R0WH 3N85H 1MFAL 1ZSDB 4OD1H 2ZCLH 1B0RA 4DCQB 3WIIH 1INEL 2NY0B 3O6FB 4G3YH 4X7CC 4H8WC 3QQ9C 4YHYB 4OZHA 4FP8H 4RGOH 2EZ0D 3OPZL 4P9HL 1INQA 4UDUA 2A9ML 3MRNA 5I1CL 2ADIA 3O0RH 4OAWB 3CFEB 1J05A 3BVNB 4ZXBD 1YC8A 3U0WH 3L5XL 5BVJB 4HLZH 2FEDC 2A83A 2WWMC 2VLJD 2RIKA 4JRYA 5D5MB 3GB7B 5DJAA 5KW9H 3QCVL 2VDPH 4OLXL 1CR9L 1NCAL 7FABL 5DJYA 4LBEA 4X9HA 3QEGL 2HN7B 4NKMA 4YK4C 2DN7A 1B2WL 1AO7A 2CDGB 2KQNA 4YDVA 5ICXA 1NDMA 4XAKE 3HNVL 2VDPL 5FKAB 4Z7VB 1KSRA 3QRGH 3VI4F 3IF1B 5JPNA 4R8WL 2BRRL 3SE3C 4J3WA 4LLUA 2PNDA 1VFMA 3DSFL 3QPQD 4AQ1B 4MS8D 3CVIH 3HE7D 1DUYA 5J13B 2WIIA 1I1AC 1WTGT 2HT4C 2WWKT 4V2CB 5FB8B 1WAAF 4JFDD 4M5YH 1A6UH 1QHPA 1CLZL 5SWZA 4ZFOL 2GK2A 4X98B 1CU4L 4YDIH 4I0CC 3JV6B 2E9BA 1EHAA 5GSVA 3SHSA 4F9PC 4NJ9H 2W60A 1IZKA 2H2PC 5JDJA 4P5TD 3B83A 4P9HH 2Q6WB 1OF2B 3LH2H 2F8VA 5TDOA 5BS0A 3GKZA 1DVFD 2PW1B 3CX2A 5CINL 2Q1EA 1H3UA 2J2ZA 3TIDA 3ZTNL 2VDML 4KUZL 3MRIA 3BEWA 3QHTC 4P5MA 1JNJA 2LVCA 1MHPL 8FABB 1A6VH 5IB2B 5L88H 3DVNB 5FB8A 4XAWH 5E8PA 43CAA 3GNML 4DAGH 1HINL 4P46C 1G9NL 4LDOB 1JRHI 1EK3A 4P46D 3D9AL 3FRUB 2XKSA 1ORSA 1J8HB 2P44B 2WSKA 1QLRB 3QDME 4OF5A 5JXEC 2PN5A 2XRAH 4JY6B 3UTTA 4ZNEA 4XNXH 1Q8MA 4YFLF 4KDWA 4QXUH 3SPVA 3MLYL 3ULVF 3D85D 1JGUL 5DJYB 2XQYK 2HTLC 3TGXA 3PP4H 5EUOA 4NQCB 4XNUL 3ZKMD 1T1ZA 3GSQA 1MHHA 1P6FA 1Q1JH 4QRPB 2LE9A 1JP5A 3BEVA 2AKRA 1ZLWH 4NT6A 1CDBA 3LEYH 1MHCA 5DJ6A 1AY1H 2OJZL 1I8IA 3EDFA 4HK3J 3MBEC 2CLVA 4QTIL 4OI8A 4Z9KB 4JM2A 4JREB 3TEUA 4G9FB 1EAJA 4M7ZB 3HMWH 3VXMB 3VXPB 3B4NA 1UXWB 5J1SC 2G60H 4LDEB 3D2UB 3O45B 1RAMA 2K9UA 4R2GD 5CILL 4ENEC 4KQ4H 3EJYD 2VLJA 1YEHL 3LS5H 3GEWB 1MNUL 4Y5VC 3BP6B 4JO4L 1YECL 3T77B 4WFED 3A6OA 1G7MA 3W9DB 4AEIL 5F7HA 2CLVB 2MFNA 4FNLH 3K0WA 2G5BB 2X1WL 4LP4A 1QFWI 1KF9B 1NJ9A 3NCJH 5TF0A 5E8DH 1QFWH 1NFDE 1N59A 2QL1A 5T5FL 2NMSA 5FECA 2AKRB 1DLHA 1M7DA 4BUHA 1HSAA 2H32B 5C7XH 2P5EA 1BM3H 3VRLE 3MZGB 4YDKL 1YEIL 4U1KA 3UTTB 3BPNB 3HE7A 3DUSA 4Z7WB 3WIFA 4RDQG 4GSDL 1Q9WA 3DV4B 2RJMA 1I75A 3IJSA 3ARGA 4J6RL 5SV3A 3B3IA 3CU7A 3RY6A 1OGAD 5GZOC 1FNLA 2R2EB 1JMZA 1JF1A 4XMPH 3VXSA 1IGIH 4G8FA 2CRZA 5HI5C 1MELA 1S7UA 2CMRH 4Z7VA 1Z5LB 3LKSA 3LKRA 2YUXA 3GSVA 1OW0A 5JIPA 4ODSH 2NYYD 3HAEB 4BQ9A 3SKOB 3EGSB 3DVNA 5DO2D 1B4JH 5D7JD 1B0GB 3HE6D 2IBZX 4WFGD 4P2YA 4CNIA 2Y25A 3TIEA 2X4TB 3MJ9L 3NFPA 1KG0A 5IK3B 1OCWL 4ISVB 4U1LB 4LL9A 5EWIH 5K93A 1JNLL 1E27A 3LN4A 5HGDA 4KXZI 4GXVL 2ZUUA 1FFPA 1MRFL 3L5WB 1SMOA 1C5BL 3GUTB 5CD5C 2NY3B 3N9GH 4K94C 3MLXL 3VGEA 2AJSH 3V5DB 3QQ4B 1XCTB 3VRJB 4PRNB 3S36L 4IHOB 1ZLUH 3D85A 3ARQA 2Y23A 2FEDD 2NY2D 1T2QH 3OXSA 2VYRE 5EBMB 3DVGB 3MRJB 4OLVL 4YFDB 4TNWF 5E9DB 1NBVL 3ARGB 4M7KH 1AC6A 1A14L 3OKEA 4M6OH 3UYPA 3A67H 1H5BB 3IT8D 5HI4D 4NKMB 5F21B 2YPLA 5IMLB 5D2LE 4I5BB 4CMMA 1B4RA 4PJ9D 5D70L 2OXHA 4TUOA 3GBMH 3VD9A 2B4CL 1A6AB 1DP0A 4JM2D 1H9VA 2EZ0C 2BSED 2JJVA 3MA9H 1EHNA 2IH1A 2W07A 1JNNL 1YECH 3DI3B 2XI9A 4RAVB 3THMH 1CFVH 3A6BH 4QXGL 4D9LL 1HEZA 5MEPB 1QBML 2BNRE 5K9JH 3PHQB 1EEZB 3QUYC 5CJ8A 4PRHE 3BGFB 5C08D 2APVA 2FWOA 1CG9B 4J7RA 3U48A 3EUUA 1LILA 5ITFA 1ETZB 4PUBL 4X9IA 2NR6D 4Y0GA 1YNLH 2OJZH 4AM0B 3QXDB 1JTPA 3VXRE 5B4MD 3CMOL 3S34L 1TVBB 2W9LA 5E5MB 5CBEA 5I19L 1MVUB 4JVPA 4F57L 4GAJH 1JZ5A 4GO6B 4MAYD 1MREH 4XNMA 1QSZA 4AT6A 1FE8L 1TQCC 1DQLH 3IRZA 1AJ7L 4Z7QE 1BIHA 4ACPA 2FX7L 2YC1B 1QG3A 3UZVB 3SO3C 2OTUB 4G8IB 4XP5L 3QJHB 3JWDL 2E8ZA 3OKKA 1MNUH 2XNAB 3BXNA 1ZVSB 2J8UE 1ERNA 2VERN 2VH5L 2DTMH 3GRWA 5D7LA 5I30L 2DLHA 1EGJL 1II4E 1YMMA 4KVCH 4ZXBB 4FXKA 3DX8A 4O5LL 4X7SL 1JF1B 4WU5A 3TT1H 2EE3A 3GMQA 1KLGA 1MCIA 1TTGA 5EU6B 1B9ZA 2AABH 4GW5A 1ZVHA 3RIAK 4F8QA 4JO4H 5DQ9B 4FZEL 2AK4D 3DUSB 3GHBH 5HPMA 2MCG1 3BW9B 3QFDB 4PJXA 3P3YA 2YD6A 4IRJD 5C0BA 1RURL 2M26A 3KPRB 4UOW0 1MRCH 2NTSP 2ZJSL 1F42A 3SOBH 4LVNB 1CDYA 1BJMA 3INUL 1D5IL 5GS3A 4GAGL 4QKXB 4JN2A 1JGEB 3S88H 2XRAL 5IEHB 1JWSB 4GFTB 5D93C 2RCSL 1RK1B 1DEEA 5BCAA 2W92A 3ULSA 3HFMH 3KPTA 5JXAH 1DQTA 3ZT6A 4PBVC 1SQ2N 1XGTA 1YPZB 4HFWA 3ZKMC 1P4IH 2VAAB 3SDDA 2F74A 4KRPC 4YAQA 1P2CA 5DJ8B 2XZCL 4N1CA 2DLFL 1IAII 2DM7A 2IAMB 3F7YA 1DSFH 2BSRA 4WFFE 5ESVB 2NY3D 3PJSA 1UENA 3EFDH 1ZHBB 2A6IA 5FO7B 4Z76A 4NM4H 2YD2A 4QT5B 1CI5A 3MV9E 5L0QB 2D0HA 4XNYL 3ZE0E 4YC2C 2QKIB 5CJBA 4WDIB 3LHPL 5DXWA 2FSEB 3MBED 5C8JA 3QEUA 3S3JA 4RNRA 1G9MC 5FOJA 1U91B 3UEZA 5MHSE 1DZBA 1MHPH 3QUML 3B5HA 4WO4D 2XA3A 1NGWA 1CZ8L 3GGWA 2AXHA 2RAMA 4LEXH 5L7XL 3CSYA 3R8QA 3GMRA 4XP4H 2CKBL 1J8HD 3LKOB 1OM3L 3BP4B 3WHE1 3WXWL 4JHWL 4LSRL 1RJZB 3OJDA 4YHML 1YJDC 3FN9A 3C8KA 3QRGL 4ZS7L 5IBLD 4V1DD 5D2NE 4HKZB 5I1IL 1X4YA 4YHOH 5I1LA 5JXED 1F4WH 3TBTB 4GRMB 4BQBA 4OT1L 1UZ6E 5D6CB 3UP1A 5C8JB 4WEUD 4KJYB 5I8EB 5LBSL 2IBZY 4NP4L 4K8RL 5E2VL 1KYOK 3B8SA 3VXUA 4Z8FH 1PKQA 3QFJA 2W0FB 1AE6L 1HXYA 4KK5D 1CFTA 3G04B 2FL5A 4U1HA 3CPLA 4G7VH 1J5OL 3SDDB 1SBSH 1MFDL 3Q6GH 1LDPL 5I74B 2OS7A 1SJEB 4HCRL 4Y4KB 5D71L 4ORZC 2R1XB 4F58H 4HFWB 5F97E 4HIIB 3IDYC 4FMFA 4PLOB 4NHCL 5A16B 3H3KA 3G08A 3DO7B 3P4MA 1NBZA 4LCWD 2Q7NA 3C9NB 1GPOL 1HWHB 1SY6H 3B6SB 5IESL 4DGYH 3O2VH 1D9KD 1MFAH 2QQNH 5FKPA 3B9KA 4U1JA 4LSSH 3VJ6A 4ZUSA 4HWBH 5CP3A 4HUWA 2YD8A 1OT2A 1B6DA 4X7SH 4MWFB 1QKZL 1HZHH 1RPQA 5T5NG 3LQMA 3THML 4FQXA 2QQLL 3UJTH 5B39A 2NXYC 3DX8B 1TZIA 4X6DA 2AEQH 3PHOA 1IC5L 1F2XK 5IR1A 1KJ2A 4G6MH 4JKPH 3PXJA 2I07B 3JSSA 5LGJB 1FO0B 3MNVB 5K9KA 2DQJH 2ZUSA 4K3HA 1YEKH 2ADIB 1QEWA 1T7VA 4F3FB 1JZ6A 4NCC1 4LGPB 1UA6L 2F8XC 3FB8A 5DMIL 4JFHD 5KS9F 2EKJA 2IPKA 3WN5B 4JFZL 5LXGL 5BO1L 3LIZH 3I75A 1T4KB 2K3TA 1PFCA 3OGCB 3S36H 5DHYA 1R0AL 1I85A 2BZDA 1D6EA 4GKOA 2DQUL 1FZKA 4UBDD 3PE9A 4PJ7E 4LHUB 5A3IC 4XVJH 4UQ3B 1FAKT 1IEBA 3C2AL 2IADB 4X6BB 3RGVA 2LU3A 4FQ1H 5E5UB 4WJ5A 3OF6D 5DVMA 1RD6A 5HGGS 4ALAL 5JUEH 3L6FA 1WBZA 4AEHH 1KB5H 4ODUA 1EERB 1AKJA 4P2OB 3EYQC 4N9GA 5BRZB 4X80L 1EO8L 4NBXB 2GI7A 5F72S 3L3JA 1TLKA 3CSYB 4MNGB 5FF6A 3KWWA 4QO1A 1FNAA 3ZHLA 1QACA 4HK0B 1NCDH 1QSFB 2Y7QA 4UU9A 4FQIL 4FTVA 1ZGLP 1HOCA 2DKMA 4H1LA 3LB6D 4WI9A 1HYSD 4OZFG 4K7FA 3ILPB 1BD2A 4MDJB 1U8OA 4JJHA 2FJFB 5IQ7L 3MV9B 5DJZB 3EJZD 3U83A 3C60A 3P0YH 4LPYA 5IMMB 4XXCC 4HAFA 4LNRB 3LB6C 5D7JB 1V3JA 4IS6B 4RFOL 4XNQB 5EU6E 3SKNA 4NNPL 2F53D 3G9AB 4UB0H 3OXSB 1BGXH 2ZSWA 5MHSD 2DWEB 2V7NA 2CXKA 5HYJE 5GRVL 3WFZA 5D7IE 3IFPA 5C0FA 5EOCJ 5CFHA 2LQRA 4U6YB 1DCLA 5J9PB 2ICEB 4XMKL 5TDNB 1XH3A 5EU5B 3RUGA 3O9WA 4AIXA 1R5IA 4NDMA 1OSZA 5HGDB 5HDQH 4Y16A 4J3UA 4TSAL 2PTTA 1G0XA 4ONGL 5IWLC 5JLZB 2VN7A 1U8LB 4GMTH 1ED3B 5BV7C 4MQ7A 3T3ME 1CICB 5F9OL 1GGCH 5KS9E 5SX5K 5L2JA 3GSVB 5DD3L 3ZSTA 5B8CA 4PRAB 3ZYZA 3V4PL 3SKOA 4KI5D 3ULSB 4NOFA 5CGTA 3WKNA 4Y1AA 5AYUL 4K3GA 1OAUL 2JF1A 3GSOA 5SWSD 4KK9D 1JWMB 2M2DA 3EW3B 1ITCA 3KPRD 3PNWB 5HHQB 2NZ9D 4HF5H 1V3KA 4YNYB 1RJCA 5HVFB 2DLIA 5L8KB 4YDJA 4PJHB 3RGVC 4NKIH 2ADJB 4FHBD 1E6JH 4AG4L 4Q97A 1A1MB 4L4VA 1CFNA 3GJFB 2E8YA 2NXZD 3BZFB 4M48H 3H9SA 3MYJA 4MCYB 2D9CA 4NOBA 4K8RD 1NGQL 3SCMC 5TDNA 4NFBA 5DLML 4QOKE 3VXPA 3IDIA 3KPSD 2HJLA 1ACYH 3AAZB 1QHOA 2DIBA 4FG6D 3T04D 5F7WC 3VCLA 4X99B 3PGFH 3QNXB 5EU6D 4DOHB 2Z31B 3CLEH 2IQ9H 4MSWB 2OSLB 3LQZB 1BD2D 1NAMA 2YEZB 3IAQA 1MFBL 1CFTB 1OY3B 4J8RB 4UIMB 1YY8B 5IESH 1N64H 4WEBH 4GXUN 4FABH 1BPVA 1T1ZB 4LCWA 2OL3A 4O02H 1KXVC 2B1HL 1CGSH 1NGYB 3JTSA 1KULA 1Q9KB 2VXTH 2I5YL 5HHNA 5DC4B 4G9FD 4M93C 1DUZB 2I26N 4HWBA 5CP3H 4G42A 4ONHB 2PXYC 4P2RA 2P8LA 1FC2D 5DJ0B 4EDXA 1KV3A 4Y5YA 5FYLL 2W9DH 1A1OA 3V79C 1LO0H 4YIQA 5E2WL 4XGZA 5F9JB 2DJUA 2E27L 3MRPA 1MHEB 5ICYA 5C0DB 2H6PA 1E4XH 4PP2A 4CVWA 1OP9A 43C9B 4C83A 2EO9A 2ENSA 2OZ4H 3CFKA 4G42B 4LPWA 4AMKH 3QWOA 5GGRB 3ZHKA 1EFXA 5DF0A 5LCVH 4F7PB 1YEEL 3DMMA 1FVEB 1JN6B 4XPBH 5HHXH 4UBDC 3TIDB 4LLYA 5ANMA 4QTIH 4GRLD 3TJHC 4NWTH 3PWLB 4P59H 1EV2E 3BSZH 2V9TA 1GGBL 4I18B 5EO9A 3FJTA 5IMOB 4KKNA 4WUUD 5DJ8A 1T22B 5DRZA 3RWDB 4W6WB 4YFLI 1IQWH 4U0RC 5DJCB 3IXTA 5KVFH 4MD0A 3FQNA 1EAPA 3UC0H 1I8MB 4KRPD 3OR7A 1IAIH 4L8BA 4ZTPL 4QXUL 2NY4D 3PIQB 4M48L 4Y4FB 5DGQA 3ARGD 3MUJA 4F7TB 4G80A 4UNUA 1BJ8A 2IG2H 2UYLB 3WDJA 3JVGC 1AGBB 2R0KL 4HUMB 1L7TL 3QXVA 2DQHH 2GT9B 4KDTA 15C8H 3DRTA 3QIWB 1QNZL 3TO4B 1BEYH 1U9KA 2ZCHL 3T2QA 4KGJA 3HTLX 2HN7A 1UJ3C 4U3CA 4NWTL 1HKFA 4JRXD 1IQDA 2ITDA 3HG1A 5TF1H 4FABL 1LO4H 3U7YL 4P9ML 3QQ3A 5DD0H 1F4YL 2UYLA 1EEYA 2GITB 4E41E 1NFDB 4HXBH 4E42A 3MV11 4KXZH 3RKDC 2AI0L 3BKJL 1RULH 4C59B 2F19L 4OFKA 1NAKL 2NY5L 5ERWB 4HHAB 3UO1H 5F9WB 1N6UA 2FECL 5C0FB 4HJ0C 2W59A 3KPQA 4OLWL 4JJ5A 2F8OA 2J8UF 2R1WB 3IJYA 4Q6IA 1IRAY 3TPUB 5H35B 5JHDB 3EZ8A 2NY6D 5IB3B 3MLRL 5IVOA 4LF3B 4HPYL 4TULL 1M7IB 4AIZB 4K71C 2BHYA 1T66D 4QRQA 1BOYA 3H3PH 2ZPKL 4M5ZH 1NGZA 1U0QA 2AQ2A 5A1AA 2R69H 2FX8L 4NC0B 5B38G 4ORGB 5IHZB 1UM4L 2HKFH 5F1IB 5HY9B 3FOMB 4BUGA 3KXFB 5DD5H 4UTAL 4EVNA 5MENA 3PWPB 2XA8H 2FJFA 2O5XH 1N0XL 1KTRL 2ZCKH 3MO1A 1ZTXH 5IEKA 3H0TB 3V8CA 1BIIB 1AJ7H 1DFBH 4PJEF 1LK3L 9CGTA 3ULUL 2VTFA 4BK5A 2YD4A 5HYIA 5HPOA 3IJYB 3L5JA 3L3GA 5GS1B 1FP5A 1F3RB 2EDYA 1TITA 5J56B 5KZCB 1S7WA 2I9TB 5CEXA 2RGSA 5D1ZB 1ORSB 3OKMB 1SEBA 4IOFD 5HDQL 4Z78B 3RVUD 1L6ZA 1F3JB 4EI5B 5HJ3B 1D6VH 2FYYB 1UWEL 2Y72A 1VFAB 3A6CL 3C87A 3E2HC 3L3GB 1YEJH 1D7FA 2DKSA 2YPLD 4F37F 5GJSL 1MJUH 2A9NL 1HHKA 4UNTA 1IEBB 5C3LD 5DZLA 2KKQA 1T21B 4XTRD 1CDHA 2O26U 2XKNB 1TJHH 4ZFZB 5ICZB 2J5LB 5JORB 4L1HA 4WWKD 3KLAA 1JJUA 1T89A 3WN5A 4N9GB 3RTQD 5F6IC 1MJJB 4L5FH 1QYGH 4EXPX 1GAFL 4KI5F 5E4EB 1KLFA 2WW8A 4N0UB 2IGFL 2VC2L 3V9FA 1RIHH 1J1PL 1S7XB 4HZLB 4OI7A 2WANA 3QNZB 1CTOA 1EHLL 3DTXB 2P42B 5FGSA 3S5LB 5I15H 4I18A 1GGIH 2BVOA 5CD3B 4XZUB 3JV4B 4KTEH 2YBRB 1VFOA 1YNKH 2WNGA 2GITA 4X7EC 4FQXB 4QWWC 5EG6C 4YH6A 4OKVB 1A2YB 1AR1D 4XBEH 4Y16B 3MTRA 5EA0L 1MWAB 3QEHB 4D9RD 2CIIB 3D18B 3DLQR 3G5YB 4LBEB 3T1FB 2V5TA 2A6KA 1S9WA 2P4AB 6CGTA 4F2MB 3VWKB 1D9KC 5I76B 3ARDC 3SJVD 1GCFA 1MCLA 4ODHL 3NIGF 1ZGLM 2X9YA 5IW1B 1BFOA 2GTZB 4XMKH 3ZDXF 1QEWB 3H7LA 1KBGH 3OMZA 5EIVA 5T3ZL 1H3PH 4G5ZL 3G6AB 2VMFA 1KNOB 4LPXA 3RVTD 3NOIA 1S9KC 5CAYB 2DQUH 3CX5K 1KB5L 5CSZB 1FL6B 4PJDA 4E5XA 2QBWA 1OGAE 3FO1A 4N8VG 3CK0L 3VI3F 5HI5D 1JI1A 2QEJA 4FFWC 3PL6C 1S7VA 3PL6D 1NCTA 4MD0B 1R5WA 1ED3A 4PGEB 4RWYH 5IJKC 4RIRB 1BF2A 3DO3A 3PWJB 2HRPH 3OKNB 4M6ML 1Z2KA 5DFWH 3GB7A 1HIML 3OAYK 4N8CH 4EKXA 1HYSC 4XBEL 4HJGA 4EI6A 1H0DB 3TYFB 2UZIH 3B2UC 1TENA 3Q5YA 4RMRA 4Y7MA 4DVBB 2DWDB 5IB4B 2HRPL 3VXRB 4TYUA 4BM7A 3R1GH 4OQTH 1QO3B 1M7IA 4C56E 1NDGA 1OWWA 3SDDD 4MXVE 3H7BA 4ENED 5KANI 2D03H 1UM4H 2OZ4A 4EUPB 1TJHL 4NQEA 5L2KB 1S8DA 2Z31C 2P24A 5DRXA 4JM2C 4YQXH 5HHVL 1C5DA 1WBYA 3IVKB 1JPSL 4TOYL 5HTSA 3V4VL 2VUOA 5FV2A 2XFXA 4LPUA 2EH8H 3EOBA 2ED7A 5EBGA 1D5ZA 3F7PC 4FQJH 5C0JA 4XI5C 4JQXA 4HWEL 3T0EE 1YN6A 4ODBD 1T4KA 4CL7A 1NMBH 1OW0C 3O2VL 3BD3A 1WWBX 3MRKB 4YXHH 2PYEA 4WTXA 3NPSC 1JGDB 5FYLD 3NIFE 5JDSA 3QT2A 4MXQD 4YHMH 2J1KA 4Z5RA 4MJ2A 5KSBA 4M6NL 1YEJL 5JA9A 4KV5E 4OZHF 4WFFD 5IFJA 5DQJB 4G7VL 3N1FC 4Q9QL 1FG9C 2BVUA 2WUCH 4E9LA 1WAAA 2OSLA 3LQZA 5I1JH 2QHRH 2F74B 1YYLH 2E5EA 2Z0BA 4J4PA 3KGRA 5LQBL 3G5XA 4KVNH 4Q9BA 3VRJA 2ZCHH 3KYMA 1FNHA 2M8XA 2X89D 3R06B 3TBSA 5CSGA 2AEQL 3GRWL 4Q0XH 1F4XH 2C1OB 4PJC