1OM9A

Structure of the gga1-appendage in complex with the p56 binding peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
142
structure length
142
Chain Sequence
ASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Structural basis for binding of accessory proteins by the appendage domain of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, signaling protein
total genus 16
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1om9A00
1QTSA 2DWYA 1KYFA 1QTPA 1KYDA 2A7BA 1NA8A 1KY6A 1GYUA 5CN1A 4BCXA 1OM9A 1KY7A 1GYVA 1B9KA 2DWXA 2VJ0A 1GYWA 1P4UA 1W80A 3ZY7A 3MNMA 1KYUA 5CN2A 1IU1A 2YMTA 2E9GA 3HS8A 3ZHFA
chains in the Genus database with same CATH superfamily
1I8LA 4EVNA 5JHLL 5FKPB 4JFXB 4HSQA 1S7QB 2JIXD 4PVBA 2OZ4H 1ZRUA 4G3YL 5SWZD 4N4YB 2YBRB 4JN1H 3NCYP 2WZPA 3STLB 3HG3A 5MHSD 3VXUD 2YS4A 1W72H 4NRXA 4JGMA 2P8MA 3WJJA 2AJYL 3R06A 3VFMA 2N4IA 4AQAA 4C4KT 2V3DA 5IJVA 5IKCB 3QUXA 1I8KB 1G9NC 4PWIA 5JHMA 1ILUA 5AZ2L 4Z0XA 5LB1A 4J3OF 3JXAA 3RZCB 5DRNB 2ATKB 1TVBB 5E08H 1IKFL 1AC0A 3IKCB 4D7BA 2IDQA 2AK4B 4L18A 4FQJH 4ZQTA 4FFZA 3L4CA 1YZZA 4OZFB 1OT4A 5DLMH 3GXTA 1JYWA 1UADC 3DRTA 5EZOH 1FVCB 1E7VA 4HK0B 1RFDH 2PTUA 2VDOL 1WFJA 3EZJB 1A6VH 4IYKA 1ZXQA 4OIIH 5IEHA 1IEBA 1CD1A 2DV6A 1J8HA 4YGVB 5BXFB 5SWSA 4QMEA 3QCVH 4F7TB 4RDQG 4PS3A 4LVHC 2JJUA 2ZYRA 1GZPB 5I1IL 5J56B 1AGFA 2R9HC 5JQ6H 4MHHG 3BWAB 1U95A 2HUHA 3HR5B 2JE8A 5JOPD 1AANA 5D1XD 1EJ8A 5ESAA 3U2IA 1XGTB 1J0ZA 4XBEH 4HULB 3LRSB 4KC3B 4KHTH 3QNZB 4LRIC 3TL5A 3H9SE 4ONHB 4TQIA 4P4KA 1C12B 1CTMA 4HS8H 3V0EA 1MEXL 2I07A 1JNLH 1T1YB 3O2DA 4P0DA 5HHOE 3UX9B 1BG1A 1J9TA 4EI5D 4HIPA 5ICZB 2J88H 3RJQB 3PHQB 4JKMA 3MRPB 2YLHA 4UDTA 3NK3A 2DYPA 4KUZL 4CVUA 2QVMA 4NT6A 3RG1C 2OSXA 3S2CA 2WW8A 2VDOB 4GSXA 1Z9OA 2QGBA 3LXCA 4FZEH 4NQUA 3EJRA 3WTUA 3CVHL 3QJUB 1JK8B 4G9FE 4RGNC 3AUWB 5IP4A 4PBXA 1NGQL 1L9OA 1LO2H 1WWAX 2ZXQA 4XVJL 4M93B 4Z7VF 5AYUL 3HPJA 4LU5L 4C56B 3ARZA 1JZ7A 1J1OL 3CTTA 2FECI 3N1FC 2XWEA 1Q1PA 4F7MA 3CFIC 3QDJD 2WBKA 4DGIL 2CO6B 4JFZH 5CLYA 3GSXA 1H3GA 1A7OL 2VLRA 1YMHB 1AGEA 4X8JB 3KL3A 2JCWA 5C3LD 2CIIB 1RIVL 2Y1YA 4V11A 2DTMH 1UWGL 2R9HD 3IM1A 5C0DB 3DK2A 2IPUG 4PJDF 3OPUA 1L5GA 2J8UE 4GRLA 2VAAA 1H19A 3VI3E 4A7UA 4JY6B 4M4PA 4KRPC 4A7TA 4X4YB 3WE6A 4IK6A 4AI7A 2DWTA 1PMYA 3FS9A 3CVHB 3PL6A 1Y0LA 5DD6A 4IOSD 4Z7UA 3BLBA 3ESUF 2EE9A 7FABH 2V5MA 3G04A 3VG9C 2X44D 4WKZB 2A77H 4PJHA 2I69A 3KWTA 3GC3A 5KYXB 2EZ0C 3U7WH 1S3KH 3CLEL 3O6MH 3CIQA 1M7UA 1QWUA 4MJ6B 3PGCB 3WEXB 3HN3A 3WENA 3PWPD 3V8OA 2Q7YB 5T1DL 4CSZA 1HZHL 4MCYB 2XQBH 4UV7L 4Z7OF 1DLFL 1ROWA 4ACPA 2FD6L 5HDBE 1ZA3A 3FONA 3UTQA 3AXIA 5PAZA 2YJQA 4S2SA 4RGND 4UIKH 3TN0B 2C1OB 1JPFB 5I73C 1EDQA 1WIPA 2HZHA 8FABA 4ZG1A 3ATDA 5IQ7L 4X5QA 3VXME 4KMLB 5CSZB 3ZUCA 1I8IB 4U6VL 3N91A 3L5WA 4R7DB 3BD4A 2VZ3A 4HSCX 3HE7B 2QVKA 4OCXL 4ZT1A 1NEUA 3QO1B 4TRPH 2DI8A 3JWDL 5FUZH 4EIUA 1V27A 4W93A 3VX0A 2WHVA 3ZKXC 3FO1B 3MCG1 2OLDA 5AVZB 5DURD 4IEFB 1A7PH 1GTFA 4I9XA 2JELH 5CJ8A 3T2NH 3U4KA 4G5ZL 4KRPD 1XAUA 4LSSL 1KJ2H 3QIBB 4NNPL 4I1RA 4HS3A 3GTVA 4NKQB 4KH9A 5BRZE 4U1SB 1CLCA 4L9LC 3EKCA 1KB5A 1WZMA 3IRPX 3JV6A 2WLIA 4DP5X 1BEYL 2EZ0D 6PAZA 4NQSA 3WTXA 3VGDA 1HI6A 1QVOA 3BP6A 5CLTA 5AW5B 5TDPB 3V5DB 4AE1A 3SDDA 1XMWA 3Q01A 2CLVB 3FRPB 3MV11 5CD3A 5MEND 4HK3J 2B7DT 2XZQL 3B5HA 3MN8A 3LV3A 4MNHA 5IBUG 3G5ZA 2CKNA 3Q1SH 3UZEA 3H9HB 2A99A 4JGJA 2OJEB 4RBPH 3VM5A 1ZGLM 3HFML 2SODB 1RUPL 4L3CB 1IKNA 4PBVC 3SBRA 3T2OA 3H7BA 3V6ZB 1S7XB 3VH8G 2H3XC 4BK4A 5C1MB 5CF3A 2WKLA 3MJ9A 3MRHB 3A6OA 2YD9A 4MMZB 2AJVL 3IPEA 2VMJA 3QZOA 1BG9A 3UACA 3BSGA 3B7YA 3LN4A 2J43A 3D3VB 1X5HA 4WUKH 5DDHB 5EPMA 2LFEA 3PV6A 4GAJL 3L3OB 2X4QA 3EBIA 1VHPA 3QUML 3ALXA 2GT9B 2VQTA 4Y2DC 5IT2H 1R3HA 1TZHA 32C2B 5I6NA 1F18A 3A6CL 3GMPB 3VFOA 3MXVL 2K8QA 1INEH 3O0LA 3WIIL 3NCEB 5EBWA 3ULVD 4FMKA 4JNXA 3G6JA 2ZUWA 4CBZA 1AP2A 4K94L 4KJYA 1TQSA 4KVPA 3SJVB 3TX4A 1KBGL 4BQBA 3I74A 4OLUL 3D85A 4G8GB 3ELAT 4YC2C 1ZLSL 4N6RA 2HT2C 3TEUA 1FORL 4PRBA 4N9OB 3CFCL 4XCEB 3FTXA 1DEEA 2Z91A 1OAZL 1ADQH 4BFIA 1UTDA 4JUSA 5KSAA 5I16A 4N86A 4TXVB 5FA4A 5AW2B 4NQCD 4O2CB 4Q8BA 5FYJH 3KBHE 2R0KL 3VE0B 1SYSB 1NAKL 1U3HA 3FDWA 3A6BL 2W9DH 3QUMB 4KNUA 3HZ3A 3PDDA 3SGKC 2EQDA 1A6UL 1B0RB 1V3LA 4YSAA 3FF7A 3BAKA 1MFBH 3B34A 3C8KA 3IJHB 4U1JA 5H8DA 3WD5L 3WJLC 3GI8L 3HI5L 1QTYT 1F86A 1QLRA 5JORB 4DAGL 2H32B 5K9OA 4BFKA 1UD3A 1ZTXE 1YN7A 4Y9EA 4N87A 2EUVA 1SJHB 2ED7A 4MZ3A 3C6SA 1UA6L 1QSFD 4W9CC 3X2QB 4IBWA 1TPXC 5DYOB 5ELIA 3DIFB 3MCLH 2Q6WB 4HU8A 1P5UA 3BAEL 3MROA 1YMMB 1MDTA 4XH2A 1HKLH 4LHQB 4OAWA 1TT6A 5HHPB 3W0WB 3DVIA 3KGUA 3US9A 3WFEL 3ARFD 1ZLDA 1OSEA 3T4YB 2CA3A 2I26N 3L6FB 3RBSA 5B7MA 5FYKE 2F15A 5BS0A 4NUQA 1W8EA 3WEMA 1V7MH 3WIHA 4OT1H 2NDGA 2Q76B 3PAZA 2HT2D 3RGVB 3GMMB 2DKSA 2VLKE 3HI6H 5ADPH 1NCGA 3WTSA 1WJ3A 3CNKA 1LWHA 2A0LC 2VUYA 1KV3A 2P24B 3ABLB 3FBKA 3N55A 4LFHD 5L2JB 2JLPA 2AQSA 4NNXA 4P2CG 3MLUL 3LKPB 3O0RH 1WS7A 5AZUA 2V5SA 2ZYIA 1X5ZA 3HNTH 2K6YA 4KKBD 5CCHE 2ICWA 2GUOA 3N3EA 4JPVH 2GHZA 4NGHH 3TT1L 4DKEH 1YQVH 2WYZA 2V2XB 3EJSA 4IJTA 1FV1B 3AB0B 1DBML 2EIKB 3QIUB 3OAZH 1UXWA 4PI2A 4S11A 3AVEA 5A43C 3RKPA 4ELMB 1ZTXH 2CBTA 5K9KB 2EKSB 5TGBA 4NIKB 4AQ8A 3DO7A 2A6JB 4OZIE 4TTDC 2FIKA 4HETA 3VJ6A 1NCIA 4RAUB 5D1ZI 1CFQB 5IFHL 4XNZB 3ATBA 2NDFA 5AW7B 4W81A 5TK4A 3B6SA 5EU6A 5F3HB 2NNXA 5GGTA 1RULL 1IL1A 3J8F7 2DQDL 2YFNA 3EYVB 1UWEH 1OB1B 1N2RB 1PF3A 4AG4H 1R5VB 3PXLA 4Z8FL 1XR9A 4FQ2L 5GZNA 4GO9A 4LE8A 3U46A 3AS2A 3GMRB 3KPRA 4ORGB 5E8NA 5HJGA 1K9TA 4D9RE 3RZCD 5HJ3A 3PCYA 4PY7A 4OIBA 3CMOH 2BVUA 3ILEA 2AK4D 5A2AA 3FTGB 5IGXH 1P4BL 2N59A 4NQEA 4ZPVA 3EFDH 1BVNP 3KS0J 1IJNA 4X8CA 1BJ8A 4HPYL 2BOBB 3G6AA 2JCCF 2X38A 3L81A 3WNOA 4RWYL 3QHTC 4F7CB 5C08B 4LMQE 2A0LD 3FU6A 2BMKB 1MNNA 1QHQA 3KLQA 4BFGA 1SXCA 2PF6A 5CIPB 5IHZA 3FCSB 5T33H 2XIBA 1G87A 3D25B 1DJZA 2YXVA 2C3XA 4AEHH 2ZUQB 4W1TA 1N7ML 2JXMA 3ZGIA 4PV9A 3QUZC 4BK5C 3BIBX 4XN8A 4ZFZA 2E7BA 3FT4B 3MA7B 4Z7NB 3B1UA 4YMPA 3S5LB 1QQDA 4IRSA 1KCSL 4EZLA 1REIA 1I9RL 2IPUK 2J6EA 3MMEA 1CFSA 1HDMA 2QQNH 3VYNA 5BUGA 3CUPA 4TTDD 2CJTA 2UWEF 4K5LA 1FG2B 2ZKYA 3ARYA 5CWSB 3LKSA 3CZSA 3OLGA 3PREA 5C0EB 2R2EB 2W07B 1QFHA 4PW3A 3IJEA 3RVXC 1DANT 2XZAH 3KM1A 2DEXX 4OFYD 3TNMA 1K4DB 2DEYX 5BV7C 1J8HE 3QCUL 2AK1H 2O6DA 2VXVH 3M46A 5INCA 3RNKB 4KKPA 3ZR6A 5L6YH 3K2MC 1CJYA 1IBYA 2QSCL 2QELA 4JREB 3TN0C 1ULVA 4ZX4A 4XVSH 1OGAD 5I5RA 5AAWA 3FQWA 3JVGC 1V3JA 1GOFA 2F68X 4Y2LA 1FCCA 3MLWH 1F6LL 5D4IA 4C56D 3TVMA 5GPRA 1ND0B 1XIWB 2WTRA 2DQTH 4KRNA 4CJ0A 4G7YH 3DVGB 3UG5A 4OJYA 4WHYH 4K8RH 3SDAB 5LQBH 1OPGL 1MQ8A 2OS7A 4L29B 1RZ8B 3ZR5A 1O9WA 2GBTA 4QXGH 3TBWB 3CPUA 4OI8A 1LEKA 1MRFL 3WE1A 2XWBB 4JFWA 2WZAA 3IDMA 3JTBA 5IBTH 4S0HA 3QEQB 3X1GA 4RBPK 1MIML 5KOMC 3V0DA 2DIJA 1INQB 5D72L 1G9MC 2OJ1A 3QUZD 4P07A 4PVMA 3BSZH 4GXVL 4PJ6A 5F88B 4QNPE 5JHDA 3QIBC 3TS8A 2XKSA 1DQLH 1TETL 3MJGX 1KC5L 1N64H 1OXYA 3M1CA 4MA1C 5CKGA 1M6OB 5F96H 1I8MB 1XGYL 2V2WB 3MYJA 3TXAA 4BSJA 3OAWA 2BNQB 5D7HA 1MWAL 1HHIB 3X11B 3MRKB 5DZLA 1DLHB 4MB4A 3S37H 3RX9A 3QQ3A 1ZVSA 4OH2A 3FULA 3UTZA 4ODHL 3RVXD 2CBPA 5GRXG 3NCWA 5FDYA 1DYZA 3AROA 3HG1B 2F7QA 5FHAL 3BJLA 1G0DA 3BIAX 3MOAL 2DQEH 4LHUB 3N40P 5AW8B 4AEFA 3ORJA 4WFHE 2VLRE 4DGYL 1UWXH 2NNAA 4NQXA 3TN0D 1NDTA 4EN3B 5TE7L 5I6KA 3QZMA 3LNHA 1O75A 4K3GA 3FT1A 3ATEA 3D18A 4MCZA 3VXRA 3SKMB 3O2DH 1A7NL 3O11B 2G2NA 3IMSA 3RILA 4BKTC 4BSWB 2BWQA 5BVPL 4KHXL 4K55A 2J1XA 3GPSA 1I7RB 4KXZH 4AUUA 3ALWA 1QTSA 4HWBA 4Z7UE 1PNDA 4X7TA 4K7FA 3VXSD 3AWEA 3HG5A 1IMHC 3MBEC 4YL9A 3PHAA 1MWAB 1JTTA 3P77B 5IHUH 4DQAA 5J13B 1RP9A 4AGQA 3FO9B 5K1VA 1T89C 1W6LA 3CCHA 5GRUH 4EPSA 3TH4T 2O61A 2B9AA 3QWNA 2E8ZA 2W8CA 4WV1A 2BHZA 4MSWB 1ZS8A 2L8AA 2OMXB 4QGTA 4CSPA 2X4TB 4JG9A 1MFAL 3D39E 4I0PA 3F8UB 7TAAA 4BFFA 3QIBD 3APDA 2V7HB 3QQDB 4XHJC 1K5WA 1WITA 1QLEH 1G7QA 2ZF8A 1Z66A 1RZJL 3ARBC 3O2WL 4FAAB 1DBBH 1EDYA 1JJUA 1XH0A 4ZMLA 1M3IA 4GSDH 4EDWH 4JFEB 2XUWA 4HT1H 2VIRA 1OM3L 3D4CA 4MMYB 3SY0A 1DE4B 4E42B 2APVA 3D08A 1DDHB 3HZMA 2YPKB 3GBML 3QT2A 5L4IA 5AD0A 2X6VA 5GS0C 2WQUA 3DOIA 3BRGC 1BQLL 4DPAX 2AV7B 4P3DA 3W3BA 1DJGA 1M53A 1GIGH 1WYJA 3KGTA 5MI0C 4GKLA 2PTVA 5CN2A 2V33A 2AQ1A 1AHMA 4PJBB 3MUJA 4DTGL 1CN4A 1A2YA 3U1SL 2HWZH 5DI8A 3WXWH 1KLGB 1QWNA 4NN6B 3IN2A 2MRYA 5DWUL 2MKWA 2BVEA 4HKXA 3QUYC 3N5AA 3QDGB 4PRID 2C9RA 5E1QA 5F9OH 3V6OE 3DX6A 2JJSA 5D7EA 4DUVA 4K94C 4MAUL 1CQYA 1IARB 3ARGC 2EH7L 3I6KB 5DFAA 1JNHA 4UB0L 5EU7C 4A7SA 3D3VD 5KANI 4YAQB 4G1EA 1ED3B 1NCDH 1OAXH 4XPAH 1WFOA 1MCCA 1QKZL 3SGJA 4FLQA 5FCUH 4NOFA 3AW5A 3ZHNA 1E2VA 4LSQH 1A8JH 3FQ4A 3PNWA 3VFSB 1D5BA 3X14B 4MBOA 2OTUB 3GJFK 5DRZB 4WHTA 3FAXA 1G0YR 1VDGA 1WWCA 4NHUB 3SJVD 4X5RA 2FX9L 4KJQC 2BVTA 2KPWA 4XHJD 4N0CD 1HSBA 4ZO6A 5AWNH 5F0JB 2XXGA 1LO0L 1LILA 3PGDA 3ARBD 4HXBH 3UTPD 2CCVA 2Y1AA 2WBJA 3ZSSA 3RGVC 4MXQC 2Z9TA 2IANA 5DD1H 4UAHA 2VDQB 3MJWA 4XP5L 3WKML 7CGTA 4WWKA 3V0VB 3NK4A 3NVQA 4YQXL 3P4MA 4UM8B 1YEIL 4UTAH 2DQIH 4OLEA 4P2QD 5GS0D 2QQLL 5GSRB 2ID5A 4H8VA 4UMSA 2Y6SC 2DQGH 5IHHA 1IQWH 3H2WA 2FSDA 4LCWA 2QPUA 1HQRB 1EGJA 1DJHA 3LKRA 4R4FH 1SUHA 3QIUC 1F2QA 1JXKA 2OR7A 4Z3GA 3M1BA 1KGWA 2OK0L 4GKZB 4QTIH 1KB5H 1SN2A 2FX7L 3DLQR 3G6JE 3LHPH 2BS9A 1WBZA 4XNZC 3ARGD 2XQ0A 1LP9B 3GHPA 4Y9FA 3GBDA 2B2XH 4WJ5B 5DRWB 4PRHD 3ZHKA 2V2TB 5ICYB 4UUJA 3NEOA 4P5TB 1VAHA 2VJXA 5IF0A 4ZS7L 2A9BA 3X3GL 3WFCH 4QCIB 3RUGF 1MI5E 3C60C 2HG0A 1CG9A 3DHJA 3LZRA 1ZT4A 4HJGB 1AR2A 2O6PA 3W0WD 3EAKA 3TA3C 4JDTL 2P80A 3NRPA 3T0BA 1U6AL 5I76A 5KVEL 4C8XA 3I9GL 3KR3L 4KJQD 2W80C 3RDJA 1K8DB 4P5KB 3II2A 3U0WH 3NSXA 2KMWA 1HEZA 4POUB 2K70A 3RGVD 4GG8A 4MXQD 4QYOB 5JYMA 4PJIA 1Q0YL 5F7YC 4CC4A 1YC8A 4NZRL 5BZXA 1NMAH 5IG7A 3L4VA 4ODSL 5I23A 5IFAH 2L3BA 3DNKA 4DPCX 1CWVA 2C9UA 5D8JL 1CXEA 5C0CB 3ZW3A 5IK3B 1OP5H 2HUEA 3SODB 3KH4A 2ZUQC 3MV9B 3S7GA 2Y6SD 2IWFA 2WV3A 5JW5B 2ODIA 4JHZA 3FT2B 2Z1PA 3SKJH 3BP7B 4OCSL 1GZHC 1GMEA 2ZX9A 3QIUD 4AMKH 4ZI8A 1UASA 4A7QA 3HG4A 3O3AB 3KPNA 4ODVL 2MJWA 2CMRL 2BJMH 2DM2A 3QIWA 3IDGA 3H3KA 3ZT5A 4C58B 3QFGA 3A24A 1AKJA 4HBCL 2YN3A 2GW5A 4AQ1B 2JJTA 2XIDA 3FH7A 2IQAB 2P5WA 4AL8H 2BFVL 2VDKL 5I5JA 3IXAA 4Q6IA 1MRDL 2PYFA 3IN0A 4G7RB 4BFOA 4ZMNA 3UCQA 4X6CF 5TF1H 3ZZLA 1IEHA 4GJTB 1UGNA 4LB8A 4CNIA 1F3JB 1GPOL 5C0JB 4JREC 4NYLB 1YNLH 1WHOA 1DVUA 2PYEB 4FNUA 3TA3D 3NSYA 3SKNA 1IC5L 3IDXL 1CGSL 3AM8A 1U3JA 3WNKA 2WWKT 4N2AA 1EFXD 3VXTA 2QKIA 3H6AA 4KY1H 1JVLA 4MTMA 4DGVL 3IE9A 1KMGA 2VCOA 2WO3B 4LSUL 4XNBA 3IJ9A 1U8QA 2WUBL 5DLLA 4FABL 1K2DB 4HKZB 1U2CA 2Y3NA 4P9MH 5D7SL 5C08D 1CFNA 1VGKB 2RBLA 1B9KA 3EOBB 3NABH 3NH7L 3RKDD 3V4VL 3VNYA 3L3DB 1M9SA 4F7PA 2R2BB 4PD4K 5E2JA 3CMGA 3ZIMA 5EU6E 5EEXA 2P45B 1Y1UA 1IGML 1MY7A 5H37A 4I89A 2Q8BL 2Z8VC 4KMQA 2VDKB 2HKHH 4MD4A 1BVLB 2X2JA 1G4MA 2DKMA 2DWYA 4JMNA 3KPRE 1J5HA 1ODUA 2FWUA 3HOGA 4OD1L 2F54A 2XOTA 1X6NA 2P5EB 1KPUB 5LAXA 2GK0A 4RX4A 2X4UA 3IS1X 4FC3E 2Y7MA 1NCAL 5DJ8B 3V2AR 4EOWL 2FYYB 4HXAL 1PZ2A 1XGPB 5D7KE 3PWVA 2QHRH 2RTTA 4LNRA 1USQA 4FYSA 4PSRA 2LLLA 3HCVB 3EYSH 3ULUC 1Q90A 4XCCH 5DEFB 3ECWA 3V4VB 1PZDA 2IPTL 2OMVA 2YRPA 1E9PB 3DIVA 1KN4H 4HFWA 2DQFB 4IDJL 4CKQA 1IGCL 1JNNH 3MLRL 4MZRA 2VDRH 1XIWD 3OJVC 4Y2OA 3RX5A 3T8XB 1KCLA 5IIEB 5I5IA 2XFGB 2JF1A 2AQPA 5DZNA 4E0RA 3LQZB 1I75A 2QADB 3H3BC 1W8NA 4YL4A 3S96A 3HIZA 1WCBB 5IB5A 3NSCA 3U7YL 3SBQA 2CJUL 1A6TA 1C1EH 3SDYL 1AMXA 3RTQA 3KPMA 5J13C 5D4HA 3QEQD 3HC2A 2K9FB 4JDVA 4QRSB 3D9AH 4LSRL 4LQFH 5I75C 2A4EA 4KK9C 3T3PF 2MHAB 1ZLWK 1WTGT 5GZOA 4NKDA 5DTFB 5EUKB 4N9GA 4XPBL 2FUTA 2CH8A 4LIQE 3NIGB 4FP8L 1C5CH 2AEQH 3MRLA 4FXKA 1HL8A 4O02H 3KLLA 1IAKB 2R0LL 5E94A 4ZODA 3B8SA 2BNQD 3VO0A 1C7TA 4WEEA 5HYJD 3BPCB 3LVEA 2LGNA 1XGRB 4F1SA 4EUPG 1BZEA 4NCDA 3HKFA 2DWDA 2GG1A 3M17B 3ZDYE 2F7OA 3K71B 4YHOL 4OZHA 5CS7A 4BHUI 3W56A 3GXMA 2EDQA 3CC5B 4HIHB 3EBAA 5L9DL 1IGYB 4NWUH 3MRCB 4Z7IA 4TPRH 1BIHA 4JJHA 4ZJ9A 4L0YA 3ULUD 1AZNA 1BQHA 2PTTA 4PJEF 2IWKA 4EN3D 3NMEA 2GTZA 4UI2A 2AC0A 4LCCB 4L3AA 2OCFD 5AW0B 3MV8A 1HKFA 3L3HA 5D2LF 1OANA 1I1AA 5L8LB 5I1AA 1FZMA 3CLFH 3BRFA 5BOJA 2WNWA 4LAQL 5JHDE 4PJ7A 4QRTA 5FFLA 2PWDA 3P3SA 4U3XA 1BZ7A 3SY6A 4K9EC 3EH5B 3GXUB 1RZJC 1J12A 4NQDB 3RWDB 2VYRE 3CZNA 3CX5K 4LL4A 5DA4A 4LIQH 4JN2A 3BEVA 4I13B 1ID5I 1QR1A 1RHHA 5DC4B 4EUPH 4LGRB 4Q89A 4KK9D 3BD5A 4JANB 4P06A 3QZLA 3S3DB 2BS8A 3LQMA 3ZZQA 2WINB 4I7ZC 1AZZC 2BSSA 1G6VK 1NGXA 2WAHA 1OGTA 1TQVA 3DGCR 3SKOB 2AEOA 1U4FA 3QJRB 3VXRE 4JFED 1FC2D 3C5ZA 4NUGL 3ZRCC 4IGBC 1OWRM 1S8DB 2CKBH 4XO4A 4ZXBB 2X0WA 3RA7H 3NJKA 2OZ4L 3OB0H 1TLKA 3RVUD 4QLRA 5EFIA 4KI5C 4JN1L 1EFQA 2ITCB 4HCFA 5HHVH 1O7DE 1QFWI 1RK1B 4OCYH 4U1MB 1JGVH 4FQPA 1HYRC 1DFBH 1W72L 1KPRB 4N2GA 4XC3H 1A4KB 1OIOA 5DJAA 3LVTA 1NOLA 4V2CB 5KVGH 2YKKA 3QDGD 1A1MA 1T1WB 3WKNA 3DC0A 3O4OC 4YSQA 1LE5B 1P5VB 1RLWA 1DBAH 4XB7A 1M2OA 1Z9SA 2X70A 3O3UN 1B2YA 5E08L 1O7VA 2UVEA 4HD5A 4HCGA 4FQJL 5DLML 5JA9A 1BZDA 5EZOL 3TIDB 1Q9OA 2XACC 1RFDL 3QJQB 3L7FB 1QLFA 2VDLH 3MLZH 4P5TC 3NRQA 3HFFA 4QHNB 3TTSA 2IG2H 4YZFE 5BW7C 2O6CA 4OIIL 4PS4H 4KDTA 3S8FB 2MQ0A 4IU3B 3ZE2F 3QCVL 3CFUA 4NNYB 3TIEA 4OQ1A 2RFXA 4FADA 4YDNA 4OLVH 5JQ6L 1OHQA 5EBLA 1WBYA 3CD4A 3QQXA 4G6AC 3V6FB 4ZFFB 3BUYA 4WUUE 1YY8B 4NBXB 4OV5B 3LN9A 1W72B 4XBEL 1U8MA 2H5UA 3K4DA 4KHTL 5HTSA 1PPIA 4I9WD 1B2WH 1CGUA 1Z5HA 4JE4B 3KLHC 2BXYA 5DJZB 4HS8L 4IGBD 4ZX5A 4YHNB 5I5MA 4M5ZH 1JNLL 4ZUUA 5HGBB 2GUYA 4R9HA 4HOWA 3ME0A 3ZO0A 4HK3N 5C0RL 2NW2B 1GGTA 1I3RA 2JB5H 4Z77A 1CMOA 2J88L 1HQ4B 4KI5D 2VXQH 4NUMA 2VUOA 3L4WA 5B38A 3NN8B 3D69B 1P2CB 3QAZB 1CL7L 2FQFA 4ENEC 5EC2A 4C55A 4FZEL 2YEZA 3L7EA 1E3ZA 1MRCH 3JT2A 3NRFA 3HUJB 4DP9X 4N2CA 3B8YA 3FYIB 2CRZA 3ZVVA 1RU9H 3MYZA 4Z3EA 2NQCA 5IVNA 4AJVA 3MRDB 4EI6B 4JLRA 3WNJA 2ZG2A 1MCHA 5C8JA 2FR4B 1LO2L 4AQ1C 1V7NH 4BQ6A 1FFOB 4J8RA 4ES8A 5MEPA 4NC1C 5KYYA 4ZFOA 4M8UA 2VO8A 1JTPA 2IANE 2X9WA 4P5TD 4LBEB 3WNLA 1RHFA 4B27A 2ROXA 4XNXL 4JFZL 5ITFB 2E8YA 3EYOB 5CGBA 1E27A 4GI9A 4NS0A 2CGZA 2H2PC 2DTML 2BM3A 4UNTA 5EU4B 3MUUA 2BZCA 4ICXA 4LCWE 1YEHL 1LVEA 2NUPB 3FXIC 4G6AD 4NZUH 2F8XC 2YHGA 2D0HA 3WS3A 2YAPA 3FL7A 1F2XK 1DUZA 1H3WM 1MFMA 1OV8A 4NFDA 3V0WH 4ODXB 3MLXH 5GGRB 1NC4A 3KLHD 1G7LA 1D5MA 2B08A 3MU3A 1ZLVH 3BFWA 1T20B 7FABL 4Q2ZA 4FFVC 4U7KA 3RU8H 5C0CD 2A77L 1LO3L 1WD9A 3U7WL 3MV9D 1S3KL 2GBUA 2A9ML 4FYRA 2ENYA 4U7MA 5E1HB 3UGUA 2G3ZA 1I7TA 3PWUA 1U8NA 1UB5A 2AJ3A 4YHIA 3EUUA 4ENED 3Q43A 4E2OA 2A83B 1TVDA 3QJXA 2ADYA 1K3ZA 2BSCA 4D0CA 2FWOA 3I3DA 3FMGH 4UIKL 4S1SH 1XT5A 1AIFA 4A2HA 1JWUA 1NGZA 2LE9A 2QLVB 2ZP9A 3KLAA 2NTSP 3L1EA 3QS3A 3SPJA 2WTOA 3EO1B 1WPCA 5FUCE 4PJIE 4H26A 2PPAA 5KSUA 1R1CA 1NLBH 4LRNH 2GJRA 4NQTA 5DFWH 5D1QE 4TRPL 1R5WB 5FUZL 3BWSA 1NGYB 3U0PA 3ZY7A 1E43A 4GEJA 3TO2A 3C9NB 4UDUA 2H2PD 3QNYB 5BQDA 1MLBA 1A7PL 1LE9A 2ZT9C 3KYNA 1T22B 1RJZB 4ZX6A 4QHKI 1NQBA 3FUKA 2H41A 3MX0A 4HGWA 5FIEA 4PJ9A 3U83A 2JELL 2XNAA 3ZTCC 4G83A 2IVFC 1WF5A 1BBDH 2ZPKH 3T2NL 1A3LL 3OKNB 3ZT6A 1BJ1J 2QADC 4OLYH 1NBCA 1KJ2L 4FFWD 4I2XB 5K93A 1GH7A 1DQQB 2GQHA 3T09A 3V7MA 1VPOH 5E0QA 1IUZA 4GSRA 3WLWC 2CO3A 3HPLA 3IPBA 4WO4A 1FAKT 5I9QB 4XB3A 2CM5A 4UT9H 1X9RA 2P5WE 1F4AA 1O6SB 3ES6B 3B2VH 4QPEA 4WK2B 5HYIA 4KVNH 4MJ2A 1A6ZB 3FB7A 1X44A 5DUBA 4HG4J 3OJ2C 1MCSA 1HXMA 1S7UA 3KLKA 4HEME 5IEKB 4PJGF 3RWCA 4GUPA 2X4RA 2VABB 3H3PH 4JRYD 1KBKA 4HZLA 4NPKA 2I9LA 3MGTA 2P5ED 3DO3A 1DQMH 2Z65C 3ZO9A 1WLHA 2W0FA 3WEAA 5M95B 4LQ1A 1IBGH 3POCA 3U6XA 5J12B 2NXYC 2UY7B 1FJ1B 2LVEA 1FIEA 3ZK0A 5AAPA 5IB4B 4DOHE 4CN6A 1KJ2B 4GEIA 4WUKL 1T2QH 1XH3B 2OMWB 1S9VA 1IFHH 3ZKNC 1J9QA 4FFYA 2UXTA 1J9RA 1PZBA 3GHBH 1MQKH 1DVFC 2OMNA 4LCCC 4Z7WA 4OCWH 4JFHE 1YDPA 2PR9A 3HNVH 5EA0H 5KBDA 2CU9A 5BOPA 1YEJH 2GSIB 2LU4A 1INEL 2JJVA 1YJDH 4L1TA 5H37G 5DHYA 2OMZA 2WLLB 2WVUA 1DUYA 4HJJH 1G6RA 1AGDA 4ZW6A 4H8QA 2XTJB 2QADD 2AQTA 4NO3B 3VXMB 1W9XA 4AT6B 5J11C 4QKTA 1TSHA 2F54E 2X28A 5FO7A 3WLWD 1UHVA 1OAKH 1V10A 5E1IA 2GFBB 1ADQL 1EUTA 1QHPA 2YAQA 1D5ZA 1UXLA 3TBSA 4LCIH 2JIXA 5TD4A 3WN5B 5FYJL 2EEBA 4HLZH 5SWZA 3TYGL 4LVOB 4BH7B 5F1IA 2X88A 1FL3B 1NPUA 3V4PH 2W9DL 3VXUA 2IADB 2X9ZA 4A2GA 2OCCB 2VE6A 5FUOH 2A74A 2B4CH 4AIZB 1MFBL 5ILTH 2YUVA 1J0YA 4U31A 2MCG1 5ACZA 5CJXA 4ZXBC 2NXYD 3AWFA 4NO5A 3BKYH 1AQHA 2GCYB 1AZVA 5AOKA 1C08B 1L9QA 2ENSA 2VMEA 5C0AA 5EDSA 3D0VA 4X5WB 3ZKND 1ML0A 4OLZH 1P1ZA 3QG7H 2VITB 4APXA 1DVFD 3BAXA 2B14A 1MCQA 4ZMPA 3FRUA 4U1HA 2KQNA 1U91B 3MCLL 5E8PA 3NZHH 3ARQA 4ZUTA 1QFOA 3V79C 4H0HB 3ZN6A 3H0TB 2K6WA 1HKLL 2NZIA 3GM8A 3BVNB 3P9LA 3PHOB 4A39A 2AQ2A 1HJCA 3U6RB 5KWYC 3MJ7A 2VXUH 1HE7A 3JWOH 2ZUUA 1V7ML 3MLVH 4OT1L 3TO4B 1KZYA 1TNNA 3HI6L 3QEHB 3MRQA 5ADPL 4OZHE 3U30C 2CO7B 2D31A 1XCWA 1CF1A 1T03H 3OLDA 2JB6B 1YEKH 5EZIH 3EBHA 5F9WC 4KK5C 5J9PB 3O0RL 4UZSA 5IJBC 5KVFH 4QRRB 5ALCH 3MDJA 4OM1H 3Q06A 4PGCB 3HNTL 4EI5A 2PCPB 4DF9A 4PJ5A 4JPVL 3ZDXF 4NGHL 4DKEL 1YQVL 3OZ9H 3K7UA 1BQHG 2DIAA 3OAYH 4CVWA 3MV8E 3VFPA 1XBDA 5E5MA 2FT6A 5EN3A 1ZTXL 2YSSB 3NQKA 3TBYB 2QV2A 2WQSA 1AC6A 4AC4A 1GGIH 4ZXBD 3G7TA 5IMOA 2FH8A 2R4SH 1ITBB 1KEMH 1T4KB 3LD8B 3REWA 1IGTB 1SPDA 4QRBA 4DZ8A 4XP4H 3ZU8A 2AFNA 2C3WA 4MQ7B 2Z6FA 3E8VA 3IU3A 4Z18A 1RUQH 3OHXC 4ZK8A 1TDQA 1MCIA 1TTAA 4PJCF 3U6XS 1UWEL 3NDYE 3QDJA 3TPUA 4AG4L 3HI1A 5JW3H 2GABA 5C3TA 1D6EB 4M3JA 5I0XA 3O8XC 5J3HC 2X3BA 5INDB 1YNTB 4G42B 3WV0A 3CMOL 2XG5B 4OJFH 4WTQA 3AT9A 1Q38A 2M2DA 5IGXL 2BP8A 5E9DB 3EFDL 2PW1B 4Q58C 4JZJA 3DVNB 3FO2B 3G5XB 2BNUB 3V8CA 1FNHA 3Q9QA 4M7ZC 4W6XB 4XMLH 4JM2F 2WYHA 1NBVH 2HP4A 2BCMA 4GQPH 4R5TA 3B7SA 4LDOB 2XY2A 3BVVA 2JI1A 2CXGA 3MJ8A 2H6PA 4IOSA 4DP7X 2A1WH 3KL5A 2VDNH 2TRYA 1WTLA 4KK5D 2XN1A 2LHAA 1E4XI 5E5LA 5T33L 2B59B 4DH2A 4AEHL 5EO9B 1KNOA 1QSVA 1WFMA 2O6FA 3ISRA 3SDXF 5JHAA 3CX2A 1WP6A 2HG5A 3N42B 3UBGA 4XR8C 4XAKE 4WW1B 2XHNA 4DEPB 5IVZB 3OL2A 3WUZA 2IH3B 4LLMA 3GB7B 3VI4A 4ZUVA 1UEYA 2J6WA 3B7TA 2G5UA 2QQNL 3ZL2A 2RCSH 4MB1A 4HJIA 4LKXA 3U9UA 4IIZA 5IW6A 2P42B 1RIHH 4JFTA 5EN2A 1PKQA 2BC4A 2XZAL 3DUHA 2C3GA 1WUZA 3LRMA 1MVFA 3ZQ9A 5AB2A 4JZOA 1YUKB 2AK1L 2VXVL 4GKNA 5L6YL 3WU1A 4JRXA 2OXGA 2UZXA 3O8XD 5J3HD 4XVSL 4TNWK 1JWSB 1N59A 4UTBH 4X6DF 3IDJB 3ARPA 3MLWL 4OGYL 4PI0A 2X6CA 4URKA 4P4RA 4IK7A 1Z5LB 1JHLH 5TK2A 4OZIB 4TUKH 3VQ2C 3DOSB 2DS4A 2P7TA 4ZYKB 2XN9B 5J6HB 4K8RL 2B5IB 2HPOA 1CGTA 1JZJA 3RY6C 3PU7A 4DP8X 1S9YB 3LEXA 3VQ1C 1I9IH 1FL6B 2Y06H 4GRWE 5EBGA 1N5AB 2DI7A 3CWGA 1XGQB 2WXRA 4Z3HA 2OL3L 1JZ2A 3LX9A 3T1FB 1GCYA 2TSBA 1T66C 3S2AA 1RZFH 4UOZA 1ZTMA 1U93B 4MQXC 1BMZA 5B38G 5G2NA 5IJCC 3BSZL 4Y1AB 1TQBB 4AGLA 3DTXB 4PTUA 5J1AA 3WO4B 3MR9B 4HWNA 1DQLL 1JV2A 1SJEA 1N64L 4OM0H 2L04A 2QKSA 5F96L 5I71B 1G5GA 1I31A 5F7NC 5J0BA 4PJXA 4LGSB 2ZKMX 4TUJA 5I9QC 1M05A 4U7SA 3QORC 2XPYA 1I1CA 1I85C 3MUY1 4JG5A 4XX5A 5I19L 1P7KA 5EU3B 1O5DT 5AOMA 2DYSB 1A47A 2DQEL 1M7XA 2KZBA 3GTTA 2OL3B 4PWGA 4FHKA 5JIIA 3D87B 5EDXA 4IDLA 3KCPA 3WEBA 2VM9A 4WFGD 1XBRA 1H5BC 3O2DL 4BZ2A 2EIZA 4JL1A 4X6EA 1AXSA 1LWRA 1OSZA 4G6JH 3KPQB 3T0DA 3MUGA 4FGMA 4YBLC 3QAQA 2A6DB 4GPVA 4YSUA 1JRHI 3QG6B 4AYBA 4CMMA 1VACB 2P3YA 4KV5E 4A37A 2XZZA 4Y89A 5IHUL 2PABA 1L7IH 4L9LA 2YD1A 1T66D 5GRUL 5AVTB 2EVFA 1D2OA 2YA2A 5HPMB 2B1HH 1PZUB 4MQXD 2NOYA 2XTJC 5CEZE 1BFTA 4WNJA 4NQCA 1KGCE 2I9TA 2C26A 1QLEL 2WZ5A 4D9QE 5JIQA 2G75B 5DGRA 4UNVA 2X0VA 3NFNA 2W60A 1DBBL 1BJMA 1T6WA 2XI9A 3O6LH 1EAJA 1GC1H 3HZVB 4GSDL 4EDWL 4HT1L 3W5MA 3IVKA 4NAQA 1BVKA 3W9EB 2IF7A 4HKJA 3JWNE 4O5LH 3WN5C 2XVGA 4E41B 4NUJB 4QLWA 5BOZG 3JWNG 2R1YA 3P2DA 4LVOC 4XRCA 5KS9E 1CICA 1QW9A 1GIGL 4XAWH 4U1GB 1MCJA 4B7LA 2VXSH 1PY0A 3CZFA 5K33A 2HWZL 2VDPL 4WI8A 3WXWL 3BWZA 3KVPA 2VR9A 5GGRY 3K4ZA 5GIRA 4E9LA 3SO3B 3M6DA 5F9OL 1NCBH 4N2EA 3FT9A 4L05A 1QO3B 4PVLA 1VZHA 5E2WH 1B0GB 4H20L 4OCRH 3FN0H 4KNTA 3K2IA 4NFCA 3IDYB 3QB7C 1F1DA 1QLEB 1NCDL 1OAXL 3ARFA 4XPAL 4BWTA 4L5FH 5FCUL 2P8LB 4LSQL 1GGUA 3VX1A 2Z0BA 2E59A 2N56A 3ARUA 3S3CB 1HK6A 3NAAH 4MJ5B 2ZWSA 1TJGH 5DHEA 5EHFA 3P4OA 2OJZL 4Y19B 2AJZA 5CFHA 2XTJD 3F3HA 2FJHA 1NLDH 1MCBA 1B4JH 3FQXA 3U9WA 5DMYA 4H8WC 5AKVA 5AWNL 2X9YA 4GG6B 3GK8H 1PYWB 3BZ4B 3JWNH 5C0IA 1SYVB 4O2FA 1V3MA 3DV4B 4B9KC 3NP4A 4HXBL 1E5YA 4DNLA 3RHWF 1EVTC 2VDPB 4ORZC 4QXUH 4UTCA 5DD1L 3BZDA 5E0FA 2C1PA 3N44B 3SGKA 1BZOA 1TQCB 3EJCA 4MJHA 1OQXA 4UTAL 1PGRB 2DQIL 4TN9A 1EXHA 4O9HL 5FKPA 2NUTB 3WJLA 4JFXA 1S7QA 1NEZB 3UMTA 1KYAA 2YBRA 3SPVB 1XSIA 2OBGA 2DQGL 3STLA 1IQWL 4H44C 1TLMA 3LN5B 5JW4R 1FLRH 2NR6C 3D39B 4WTXA 4OKDA 4R4FL 1IGIH 2M8XA 4CUCA 3IU4H 3OKOB 2DEWX 4Z7QE 4QTIL 3LHPL 5IKCA 4Z9KB 1I8KA 3D06A 3IJYB 4XHQA 3RZCA 4D3CH 2UZPA 5DRNA 2ATKA 1T83A 1TVBA 3D52A 3IKCA 4L37B 2AK4A 2B2XL 4JKKA 4NSKB 1OOAA 4E9XA 5EO0B 3TONA 4LSTH 4OZFA 5I1DB 3FHQA 2LLNA 1EWHA 1YN6B 1FVCA 4HK0A 2JKWA 3AITA 1AD9B 4GXUN 3JYCA 5I6OA 4NPJA 3ZDZF 1XF2B 4FQ1H 1QD0A 4JY4B 3WFCL 3K81A 2DBJA 4YGVA 1DDTA 2ZICA 5BXFA 3IF1B 1V54B 5JHLA 4R90H 4F7TA 2ODHA 2RB8A 1FAIH 4YSDA 1GZPA 5SWZE 5FYJD 2CDGB 1EJ6A 1MFNA 4JPWH 3BWAA 2ZOUA 3EDKA 4CN1A 5MHSE 3VXUE 3HR5A 1JZ3A 1F4XH 1NIAA 4KBPA 3U0WL 1F58H 3LB6C 4MYWB 3WHXB 1XGTA 4C4UA 3TO4D 2YPVH 3LRSA 4MDIB 1A3RH 2NXZC 3QNZA 4ONHA 1NMAL 4ZMYA 1JAEA 1WA0X 3H42L 4KFZC 5IFAL 1C8PA 5T5NF 1C12A 1JGDB 5CSGA 2F58H 3P0VL 1T1YA 2JI3A 3AGVA 4QRRD 4MNQD 5ICZA 1K8IB 1M7IB 3PHQA 4X5XB 3MRPA 3BPLB 1CURA 3MXWH 3T0XA 4CBPA 2NR6D 3SKJL 2OQJB 5CP3A 4AMKL 2BJML 5IB2B 1WC7B 1JK8A 5D7IF 1QPPA 4RDBA 5F44A 2EXWC 3IAGC 3GMLB 2ED6A 4YSSA 4XP6H 1BP3B 2ITFA 3CVIH 4AL8L 4L23A 4C56A 5JOPE 5D1XE 5ANMB 2HFEB 4H8PA 2OYKA 3FSZA 4ILDA 5TF1L 3R18A 3DGDA 2CO6A 2FRGP 3VSQA 1YNLL 1I3UA 1YMHA 4BV1A 3MACL 4X8JA 2CIIA 1XB8A 1NAML 2YXFA 3PXHA 4HC1H 5E9DD 5GRZA 1N68A 5C0DA 2RAMA 3X13B 2LTQB 5AYTA 3QWOB 4KY1L 2W91A 1RZQA 4K5MA 4RMRA 3L5XH 5BMFH 1X5AA 3LB6D 1JPTH 1OPOA 2B5IC 4BK5A 4JY6A 1TJIH 3ISYA 1VF5C 4X4YA 5AFAA 3VWJB 3L5HA 3L17A 4P9ML 3RFZB 3CVHA 3NABL 3HMXH 1WZLA 1IQDB 1MFCH 2NX5B 3FUJA 2XA8H 4PM1A 4R4NC 3LEYH 4PG2C 4IIQB 4X6FB 5KYXA 5I8EB 1MI5B 4JFFB 4FQQB 4WAFA 4TLSA 4MJ6A 3RPKA 3PGCA 1PX8A 3WEXA 2E75C 1OAUH 2AITA 2HKHL 1TQBC 3QDJE 3VTMA 5H4ZA 4X83A 3WY1A 5AVWB 4A2FA 5CD5D 4MCYA 5F7MC 3DV6B 5TDNB 5DF0A 1OAQH 1FPTH 5I71C 1AI1H 1JMXA 2YMXH 4N2KA 4WQOA 3H54A 4X8GA 3RPIB 3TN0A 4B9CA 4NUPA 2C1OA 1JPFA 2XWTB 1UJ3C 4UCFA 1NAMB 2EXWD 1HE8A 1GYCA 5DHVH 3JVGA 1YPZF 4A6YH 5F0LB 3DROB 3EGXB 5CSZA 3POHA 1F56A 1I8IA 4K8RC 4R7DA 2X6UA 4JDZB 4LLDB 3HE7A 2J5WA 2YA0A 3T0EA 2VRQA 4J3OH 1E42A 3EYSL 4FLRA 4WI9A 4AWJC 4AEEA 3IXTB 3QO1A 4XCCL 2NTFB 1BHGA 3BP5B 1PSKH 5C0GB 4AKQA 2QSTA 4NBYB 4QDGA 1KN4L 4GQQA 3FO1A 1JNNL 4IEFA 4KOBA 1G9NH 2VDRL 5KJRL 1SEBB 3PWPE 3GQFA 4J7RA 4CA4A 3RBGA 2WB7A 2E56A 2I7OA 2XN9D 3D51A 2YD2A 3L1GA 3VI4E 3QIBA 1UEMA 2QSQA 4Y2NA 2FUQA 2YQGA 4BWWA 4RGNE 4BXSV 3A67H 3CSFA 4U1SA 1C1EL 1JE6A 1COBA 2WXFA 4R4ND 1IVTA 3L4TA 1AQKH 1KYDA 4AGMA 4LQFL 4X7CC 1DEDA 3WJMB 4YHKH 1VCBC 3RB5A 2XZCH 3LZLA 4CILA 1FA4A 2IMNA 3V5DA 1HTYA 1E3XA 5TDPA 1YEEH 2I85A 4Y1AD 2CLVA 3FRPA 3BO8B 5ICXB 3LQAC 1C5CL 4LOFA 4O02L 5F1KC 4BKLB 2Y36H 3H9HA 2OJEA 3HB3C 4K23H 4XBPB 1ZT1B 4WCYH 3OX8B 4Y5YB 1L9MA 4L3CA 3V6ZA 1TR7A 2ADIB 3QEGH 1S7XA 1NFDF 2XWZA 1QRKA 5D6DC 4YK4B 3MRHA 5IWLC 2VDRB 5I1LB 4MMZA 1OK8A 3SHSA 2WTPA 2ZCLL 2Q3AA 2FNWA 4KVCH 3BUBA 3IEAA 5E51A 2OSLB 4K7PL 4K8RD 2AJUH 3Q8EA 4NWUL 4KNQA 1TYJA 3LRGA 3FQ1A 2Z34A 3D3VA 1R5IB 3S37X 5DDHA 3ULSB 5JPNB 1OCWH 3NJVA 3L3OA 1IBBA 1I4FB 3IGFA 4QGYA 1UKQA 3SQBB 2ZXCA 2GT9A 3ET9F 32C2A 4MJID 5KYWB 3GMPA 4M5SA 3CLFL 4I77H 3GO1H 3FH8A 5MENE 1FO0H 1MWOA 1ORQB 1CI5A 2NQ3A 5CKAA 1PEWA 1NIDA 3IRZA 3SJVA 4FKHA 3ZZSA 4O02B 1RIUH 4X9GA 5KBKA 4PJXE 3M7FB 4G8GA 4P99A 4AX3A 4XT1C 4HIQA 2L7UA 1K3IA 3ZLQC 4C59B 4XCEA 3IGLA 4W9EC 4N8PA 4WWPA 5CCKH 1OT1A 3O6KH 2EDMA 4TULH 3N1QC 5HPOA 2FO1A 4O2CA 2N1KA 3HRPA 3VE0A 1SYSA 1S6NA 2D3JA 3HB3D 3VD5A 5AL8A 5KAQG 3DUSB 3CAFA 2A9AA 2P4AB 2IH8A 3QUMA 3UH8A 1TQCC 3ETTA 2X89A 5HD8C 1B0RA 1WWWX 5CZXC 3IJHA 3ULVE 2CKBL 3MTRA 4PJFF 3RA7L 4E41D 4CSTA 1JIBA 5JORA 1G1YA 4N25A 1PIGA 2H32A 3W37A 2VH5H 1QA9B 3NA9H 2WD0A 4OCYL 1JGVL 4XBGB 3SDCB 4EKJA 5IMKB 3D2UB 2R23B 4YSEA 1DFBL 2WYTA 2VMCA 1DBJH 4XC3L 1NCTA 1SJHA 3MLYH 4DIXA 3RVVC 4UANA 5IROC 2VRKA 4MASA 4RISH 5KVGL 1Q9WB 2R0WH 4ZW7A 1QFWH 3HRZC 5DYOA 5C07B 4EUPB 3VW3H 3DIFA 2Q6WA 1DBAL 3ARDB 2EP6A 1O6TA 3IJ7A 1YMMA 4NQCE 5HHPA 5EORH 1ZV2A 3W0WA 1CDGA 4M7LT 4J4PC 3RWFB 2WGXA 4TQEH 3T4YA 3L6FA 1RK0B 4AMWA 3MLZL 2DLFH 2VDLL 4WKXA 1CF8H 2D03L 2Q76A 2IG2L 1NFKA 1AZCA 1T6BX 3RGVA 3GMMA 4PS4L 4PJ8B 3LMJH 1A4CA 2P24A 4CVZB 1WA2X 3RGHA 2GSGB 2LABA 2CKBB 5L2JA 4Y19D 4H0LC 3LKPA 4ODWB 1NBZB 4OLVL 3F5WB 3FU5A 3LRKA 1GGCH 3NJJA 4NP4H 3HAEH 3JZYA 2BSTB 2V2XA 4OBSA 2WM0A 3CBRA 3SQOH 2EUZA 1ET5A 1FV1A 4CMHC 1QSFE 4YLCA 3QIUA 5CCJA 1B2WL 4ELMA 2WCPA 1ROCA 5HD8D 1AG6A 5CZXD 4M9OA 2VB5A 4EMZA 2EKSA 5K9KA 5C7XH 4FEIA 3L3GB 4M5ZL 2A6JA 4C57C 3WEOA 3P11H 1WV7T 4RAUA 4LXFA 1OARH 2AQRA 1XVSA 2QJDA 5C0BB 2VXQL 3SD2A 1V3KA 2NSQA 5E1AB 2QPEB 5F3HA 4FZ8H 1Z3GH 2X4PB 3HEIB 3NSDA 4N26A 2VDLB 4P5SA 3EYVA 2PXYB 3KHOA 1OB1A 1N2RA 2W65B 3RVVD 1MRCL 4D9LH 1R5VA 4PGEB 3HKZA 3PWLB 1RU9L 1Z9NA 2DN7A 5CR8A 3GMRA 4ORGA 2RMNA 4LFHG 4LEXH 4IBUA 1V7NL 1R3IH 3FTGA 4EIBA 4J4PD 5E6IB 4WW2C 4PB0H 1HOCB 1XHHA 4AVKA 1WSST 1JUFB 2BOBA 3D48R 2VTFA 4WHDA 2WK2A 4F7CA 1ET7A 2EDRA 2FECL 4YDKH 5C08A 3S3BB 2BMKA 4WW2F 2DLHA 5CIPA 2EIBA 4WEMB 1OEZW 3FCSA 4GH7B 3E3QE 3D25A 2CR6A 2LTQC 3LZQA 5ANHA 1A22B 4NZUL 4WWID 1LJMA 4JAMB 3QWRD 3PP4H 1KCRH 3KWWB 4KTDH 4JBSA 3FT4A 3MA7A 3VWJC 3RFZC 1KEGL 3V0WL 3S5LA 3ZTJG 3MLXL 1RZGB 1KYFA 4W4OA 1KOAA 1Q0EA 5FO2A 4F2MB 1L6PA 4K07A 1F3DH 1EZSA 5E5UB 1IBDA 4F57H 3GKZA 2VZSA 5F7WC 1SEQH 3RU8L 3UADA 1SLUA 3ZL4H 1FG2A 2R69H 2AK4E 5CWSA 1JZGA 4Y5XB 1BYOA 3RLSA 5C0EA 5D2NC 2R2EA 2W07A 3RDTC 3LNEA 3P9WB 4OZFG 3SBPA 2ZP0T 1C16B 1NUGA 3APFA 1K4DA 4V33A 2NY0B 1L4IA 4WUUB 3BP4B 3RNKA 3WN6A 5I6XB 5D6CB 1EEZB 2VLMD 3PQYD 4NEHB 2XWDA 4S1SL 5F9JB 4GP5B 2Y0SA 1UKSA 1YAZA 4HX1B 4X4MA 2XLLA 3FSOA 3QRGH 4ZOCA 3VGAB 1XF4B 1Y6KR 3LZPA 2V7NB 1B0IA 2BS71 2OSWA 1LK3H 1ND0A 1XIWA 3BUPA 4PLOB 1QATA 1UUSA 3DVGA 4MX7B 1NLBL 3GIVB 4LRNL 3SDAA 1U2HA 1EJFA 2YRZA 4L29A 1RZ8A 5FW7A 4WTWA 4Q9CA 1QNZH 3CVBA 1TU2B 3I02B 3TBWA 3EFOB 2XWBA 2XG4B 3QEQA 1HL9A 3WDIA 1INQA 2YGNA 1N0LB 2NNCA 4B96A 3EJTA 1BBDL 2ZPKL 1BWMA 1FH2A 4WWNA 1SMDA 4OLYL 4BD4A 5F88A 1JV5B 3VWJD 1EXGA 1M6OA 3UXFA 1I8MA 3C08H 1VPOL 2NX5D 2V2WA 2W88A 3QXAB 5B3SB 1A65A 2YSTA 5EG6C 2GBAA 1OGAE 2BNQA 4ZZKA 1HHIA 3X11A 3MRKA 4UT9L 1DLHA 4JFFD 1CE1H 4C56E 3ISWA 4KO6A 2EUXA 2WQXA 3B2VL 3RDTD 3FSWA 4KVNL 1DQTA 2F61A 3HG1A 1X4ZA 4JPKH 4LHUA 2VR3A 3P30H 4WI4A 5DCCA 2ORBH 3H3PL 3ZBMA 4Y5YC 4AK1A 4NZJA 4EN3A 4N20A 2AJYH 1DQML 2IBGA 4YK4C 4NM4H 2XVKA 1FZJB 3AY4C 1IBGL 5KOVC 5AZ2H 3O11A 3SKMA 3GPEA 4BSWA 3OMNB 2DLIA 3DX1A 1H6TA 4ADGA 1I7RA 3HN5A 4W70A 5DVOA 3RVWC 4G59C 1N6QH 3MC0A 4M56A 1T2QL 5JPNC 1IFHL 1ZOXA 2BSEA 4L3FA 3GHBL 1MQKL 4NAMA 1TCRB 4Y4KB 4OCWL 1L7TH 1MWAA 3P77A 3VQMA 3HNVL 5EA0L 2BIPA 3FO9A 1YEJL 2YUXA 4EAEA 3IWUA 1YJDL 5I1IH 4MSWA 3BW9B 1N9PA 3O41B 2OMXA 4HAGA 4PSPA 1E4KA 2X4TA 4HJJL 4XN4A 2CHZA 4F8OA 1A9EB 3TEWA 3TT3H 2V7HA 3QQDA 3UBXG 1P6WA 3UO8B 2DMHA 3WY4A 4KQ0A 2HTKC 4FD0A 1OAKL 3LXBA 1SRDA 5D1QB 1CLZH 3K80A 4FLHA 1QI5A 4JFEA 1AQDB 1MEXH 4HS6B 1FNLA 4MJJA 4MMYA 4C54A 2OP4H 1DE4A 4E42A 1R3LB 3K6OA 1DDHA 1D7FA 1JPGA 2YPKA 4LCIL 4XCYB 3K6IA 5CSBA 5DVNA 2DJSA 2CRYA 2AV7A 1ZPLA 3VXSE 4QHMB 3V4PL 2XYBA 4MAYC 4PJBA 5FUOL 1KLGA 3L4YA 4M3HA 5EUOB 3WL9B 4U3SB 3SE4C 5ILTL 3QDGA 2E3VA 2G30A 3G5VB 3VGEA 3BKYL 2B39A 4O58H 1HHGB 4IRJC 4OZGF 3I6KA 1WDAA 1I7UB 4KJPC 3RVWD 5DO2D 4YAQA 3RIFK 1XCQB 1ED3A 1NCHA 1OCRB 3LNDA 4OLZL 3SDCC 1OGSA 2W92A 3QG7L 5BV7H 1E6OH 2LFGA 4W9KC 3V7AE 3O4LB 5HDWA 4JE0A 2WWOA 2X1PA 4XXCC 1A7OH 3KM2A 5E6YA 3VFSA 4UOW1 2D4FA 5FYJU 1O9ZA 3V7AG 2ZYHA 3SE9H 3X14A 3NZHL 2CALA 2OTUA 5DRZA 2BIMA 4H40A 3VFWB 5JOFB 1MCNA 4MXVE 3L9BA 3PPEA 3FRPG 4NHUA 3LY6A 5DZPA 2VXUL 3JWOL 1IAMA 1MCLA 2DL9A 2L7QA 4N5EC 4OQTA 2RGSA 3MLVL 4P3CH 4TNGA 1RD6A 3V4PB 3C6EA 1J8KA 2XKNB 2HTKD 3KYMB 3QC6X 3NEEA 2VKWA 4J6RH 3TBBA 2JKTM 4F8NA 4PRIE 2Z35B 1T03L 3JTSB 1SBBA 1C5BH 1XTLA 1YEKL 4QRQB 4UM8A 5EZIL 1IEAB 3V0IA 2E7DA 3ZTDC 3UPRB 5EF1A 5KVFL 5ALCL 1SZNA 1E3FA 3D3VE 4OM1L 5GSRA 5F89B 1G9MH 3AMLA 1NM9A 2XCMC 5FF6B 5HBBA 4N2OA 3OZ9L 4NKMB 4UQDA 1NGPL 4Y9GA 2HT4C 4FJYA 5F1OB 1HQRA 4Y7MA 4MAYD 4AUYA 4NCC2 2BW5A 4XMVA 1BVOA 4M6MH 2Z31B 1PKOA 5DJDB 4GKZA 2R1XB 1WG3A 1GGIL 1EAPB 5BZWB 2ZONA 2R4SL 4J3XA 5HVHC 3GWJA 1KEML 3KVDD 3BSHA 3OZKA 4IRJD 4JFDB 3SJVE 3DSFH 4YPGB 2UYLB 1LP9A 4XP4L 4PJAB 4KJPD 4QHPA 3KBPA 1JBJA 4B9IA 3UYRH 2NZ1A 2F18A 3SDCD 4WJ5A 5DRWA 2V2TA 3D2UD 1RUQL 2ZUYA 3UTPE 3DMMB 5ICYA 3RWEB 2VUKA 4PAZA 2PXYC 5ESVB 4P5TA 4WF7A 5JW3L 5C07D 1YVLA 3E80A 2FO4B 4QCIA 3PFUA 4P2QE 4HJGA 2WJ7A 3EF7A 3GDBA 4PIRF 3R0MA 4OJFL 3EYFB 5E6IC 3K6DA 2O5YH 4MS8C 3MTXA 1T0NB 1QRND 4N5ED 3T08A 1K8DA 4P5KA 5J6GB 2QPFA 1UXSB 3IMUA 4XMLL 1JVKA 5KG9B 1NBVL 3WTWA 4QYOA 4U4BA 2YOCA 2YGQA 2JFCA 4X8XA 1OSPL 1J11A 3DX4A 3ZJAA 4Y0GA 3C87A 2AANA 3B9VA 4GP4B 1BEYH 2VDNL 3H9ZA 3S3PA 3NZ8B 5EU7E 5C0CA 1U92B 2D8KA 4RA0C 5IK3A 3MV9A 5DD5H 5C7ZA 4PRHE 5JW5A 2DWEB 1M56B 3FT2A 3PAVA 1SGKA 5D1ZB 4I4WB 2HT4D 2X9XA 1E4XH 4LLWB 3T77B 3BP7A 1BX2B 4X9FA 4DFHA 1ID2A 4UF7C 3O3AA 2JQAA 2LU5A 5A6MA 3EW3B 1FG9C 2AZAA 1WAAA 2RCSL 3A47A 3W0WE 4XXWC 2YD4A 4UU9B 1NGWB 5C0BD 1HXKA 2OR9H 5J89A 1RIHL 2Y25A 1L0PA 4AQ1A 2HN7B 2RALA 4YDMA 2IQAA 1GR7A 4JVWA 4Z1PA 5GS0H 4LAJH 3II3A 5LXVA 2ATPB 4FULA 2PXYD 5K59F 2NY0C 4JM4H 2YAEA 5KSVB 2MNWA 5J7CC 4AV0A 1SQMA 1F3JA 2OFQA 5BO1H 1UT2A 5C0JA 1MPAH 2KC0A 4NYLA 3STBA 2PYEA 3GMNB 2EC8A 1H8OA 2VDNB 3VGAC 4UTBL 4YDZA 1JGEB 3NIDB 1F6FB 1OAYH 4JCWA 3MRBB 5E6ID 2ZWNA 1JHLL 3TBVB 1SFHA 2JSFA 3GS0A 3KYOB 2QTVA 4MS8D 4TUKL 1OTUD 5DJ0B 4XOBA 2JNZA 2DF3A 5LN8A 5IJKA 3PWJB 4ELME 1GS8A 1I9IL 1K2DA 4HKZA 1BAGA 1VGKA 3EOBA 3L3DA 4PWHA 2D0GA 2R2BA 2ROYA 1J9CT 4KROC 2LLGA 5T3XD 2H4EA 2NY4B 1PVHA 3KYKH 2K7QA 1MCPH 3W81A 1KCKA 1H3VA 2R0KH 1EZLA 3U7AA 1BVLA 2Z7WA 3EHBC 2EC9T 3HS0C 4OM0L 4QXTB 2FGZA 3GSQB 3UG4A 2XT1B 1A6UH 3IMRA 1MG2C 1KPUA 2YQ2A 3C6LB 1U8LB 5FLVA 4OI7A 1ZHKB 5DJ8A 5FPIA 2FYYA 2YUZA 1XGPA 3FNKA 2NY0D 4MQTB 5C08E 2HPTA 3FUDA 3DECA 3HCVA 4D94A 1T4WA 2APFA 2ILLA 4XN5A 1YEDB 5DEFA 3RIKA 3V4VA 5DJXB 2O1AA 1TZGH 5EC1B 4GLRI 1JYXA 2WSDA 2DQFA 3NJLA 1TYEB 1JHKH 5CEXB 1X9UA 4N2FA 3P9MB 5AOJA 3T8XA 1KTDB 4ZS6C 4WIQA 5IIEA 5GGUA 3LXAA 5I2IB 3LQZA 2UUDK 1KZQA 5EZLB 1GOGA 2KUTA 3HR6A 3T9WA 3K6SB 1WCBA 4Z3TA 3I6LD 5GS1B 1GSMA 1QFPA 4X6CE 8PAZA 2YAOA 3AABA 1CBVH 1JRHH 4QRSA 3LS4L 5J4MA 2EH8H 4N1EA 4KROD 1O7SA 4NLHA 5A7EA 2HJLB 2A38A 2B1HL 4L4JA 4PPTA 4HWEH 2MHAA 2J2ZB 1BFOB 2YEQA 4DJMA 2O5ZL 1GMIA 5DTFA 4E9SA 5TE4H 1HSAB 5HDQH 1VZGA 5LCVH 2Y1VA 2ZOWA 1IAKA 1DBMH 4YS4A 3QYMA 4X4ME 3APCA 4AH2B 3O6LL 2KQMA 3BPCA 1GC1L 1XGRA 3PXJA 5CGYC 1LQBC 5D7JC 2XYCA 2ZUSA 2B8OT 4OF7A 1UVQB 3AG4B 2QVTA 1VEOA 3M17A 4DWHA 3MRFB 3I84A 5MEQA 3K71A 1TJMA 5IFHH 1ZT7B 2PO6B 3CC5A 4O5LL 4V2BA 4LCUB 5B1CA 1IBHA 1YYMH 2WXHA 4HIHA 3ILPB 4HQQH 3LRHA 1IGYA 1L0XA 1ZPUA 3MRCA 5TTRA 4EF3A 2C9VA 4XAWL 1U8HB 4FS0A 1A4AA 1S7TB 2VXSL 3X12B 2HRGA 3QEQE 3JV5A 4HUMB 4LCCA 3V9CA 1JYVA 4YHPB 2ATAA 3OAUH 2KZ1B 2XFXB 1NCBL 3AC0A 4ZO7A 2BY2A 2BIOA 5FGBC 5E2WL 1XTMA 3NIFF 4ZS6D 4OCRL 3FN0L 1R6VA 3AT8A 1IU1A 2CAKA 3BH9B 3MVSA 4TLKA 4NQDA 2KZWA 3RWDA 2BNQE 4NIYE 1D6VH 4LLAA 3MBXH 4L5FL 3ZX1A 5HYJE 3QXDB 4S1QH 1PLCA 1TXKA 5K1NA 3NAAL 5C70A 2X7LB 1TJGL 4FXGC 2J57A 2G3MA 3HJ0A 1U4EA 3L4XA 2AXGB 1NLDL 4JANA 1B4JL 4S0TD 5DC9B 3UEZA 3GK8L 5FW8A 2WXGA 3ULUE 1W0YT 2G2PA 2WINA 2R1WB 4JM0A 1NDGB 2Q2EB 3SKOA 4JFOB 4QXUL 4JFYB 1EVUA 4FL4B 1DVSA 1F42A 4L3EB 1SN5A 3NGBC 5CGYD 5D7JD 3PP3H 1S5HB 4BSVA 1ZSDB 3N04A 3LHAA 4RVBA 5FM5M 1BLNB 1S8DA 1GJIA 4ABWA 2YK1H 4ZXBA 4A38A 4L4VD 1TTRA 4OUUB 1UCBH 1YG9A 5E8OB 2ITCA 3CPLB 1FLRL 4FTVB 5IVXF 2UV3A 1IGIL 1KPRA 4X80H 1ASOA 3IU4L 1BXVA 3ATFA 1OP3K 1T1WA 4NOBA 1LE5A 1P5VA 3VXOB 1RZKH 4D3CL 1J5IA 4HH9B 5ITBH 3DSNB 4ONFH 3JWOC 1G7JB 4FE9A 4LSTL 4CDHA 2YXWA 3DMMC 2IBZX 3TIDA 1G1KA 3M7OA 3AG1B 1A02N 3L7FA 3O4LD 4QHNA 5KS9B 4QIRA 4JFEE 4FQ1L 3ULUH 2YMOA 3P02A 2W9LA 4IU3A 3VACA 1SXAA 4NNYA 1FAIL 1XGUB 3NJMA 5KSBF 4UNIA 5D2LE 1F4HA 2ZWYA 2OZ4A 3WXVH 1ORSB 4G8EB 4FTDA 3DHMA 5D72H 4AJWA 1F4XL 3V6FA 4ZFFA 1F58L 1YY8A 4OV5A 4UOJA 4RDQF 1W72A 2YPVL 1R47A 2XBTA 4PEEA 1A3RL 1EHLH 4P59L 3QDGE 3VGFA 3QI9C 3JV4B 4AYID 2GTQA 2JKNA 3PUCA 5DJZA 3QDHA 4YHNA 1CBJA 2F58L 5HI5C 5HGBA 4BQCA 4APQC 1JXGA 3CGTA 4RZCB 2NW2A 3QGVA 3ROLB 3SCMC 5LAPA 1HQ4A 3BQUB 3KZ8A 3MXWL 5D1ZC 1KUMA 3D69A 1P2CA 3NN8A 4QEGA 4TF4A 2N0MA 2X0UA 1G1CA 3T0AA 4F20A 5K39B 2Z31D 3FUEA 3OXRB 4L48A 3WTTA 3HUJA 1TCMA 3PF2A 3RRQA 1I1FB 5F6IB 2ZXEB 1TKWB 2PCXA 3S5YA 3MRDA 3PGFH 4JFDD 3ESVF 4AXWB 4EI6A 2FR4A 1KBWA 3AU1B 1FFOA 1UG9A 2C7UB 3NDZE 4XP6L 5EF3A 3CVIL 4K73A 3OXSB 3DMMD 5D5MB 4Y16B 4JQVA 1KYOJ 1IC0A 2A3TA 1L6ZA 2WNXA 3MOBH 4GXFA 2YGPA 3AT0A 1VENA 4I9WE 5DD3H 4Q97A 4LBEA 4OCMC 1TTCA 4NERA 5ITFA 4PBDA 3QPXH 4U1KA 5D7LB 4RMQA 3EYOA 4IS6B 2NY2B 4A55A 4P57B 1GW0A 4R8WH 3OKEB 5FOBB 4HC1L 1WCQA 4KI5E 1AJ7H 5EU4A 2DTSA 1TZAA 1DJWA 3L5XL 2NUPA 5E6ZA 1BV8A 4LPYA 5BMFL 3WDJA 1JPTL 1FZOB 4FN0A 3Q6GH 4BYHA 3QZNA 4K9EH 2DOCA 4ODXA 3HMXL 5FKAB 5GGRA 1CLOH 5FYLH 2CLZB 3VDAA 1YEGH 2XA8L 5HI5D 1T20A 4YUEH 3K0YA 3LEYL 1OM3H 2J8UF 1AR1B 4WGKA 4XGZB 2DQJH 2L0DA 3V55A 1BPVA 4YFLF 3SCMD 1ZAGA 1DN0B 3VI3F 4U49A 1SMOA 1NICA 4GAYB 5D1ZD 1OAUL 4B9FA 5FGSA 1LO4H 4OIFA 4LCYB 5CLXA 4OQTH 1OAQL 2A83A 4J12A 4HOXA 4KXDA 3KPPB 1AI1L 5ABZA 2YMXL 4XPHH 5DFTA 2LU7A 1FBIH 1LO5B 2VDQH 4Q7DA 5T3ZH 1QACA 2IBZY 2F8VA 2GB2A 1PBYA 3C6LC 1F11B 1PLAA 4QY8B 2V3FA 5AVRB 1SF3A 4A6YL 1MZZA 1NMBH 3CG8A 4WI5A 1NCNA 3EO1A 5KUMA 1QP1A 1UQSB 5I1CH 4ACTA 5HDBF 8CGTA 5B1JC 3D4ZA 3MCKB 1EZVX 4LEOB 4JHBA 3EIFA 1BA9A 1NGYA 1PSKL 1PX3A 5C0CE 1E8WA 1X6LA 3C9NA 3TNNB 3MV9E 1KJVB 4JO3H 3X1EA 3QNYA 3EZ8A 1G9NL 1DVTA 1T22A 4YE4H 3UP6A 5E00B 1RJZA 4HLJA 1JPSH 2VDMH 1NIBA 2WIIB 3VYPA 3OKNA 3FW6A 4I2XA 3CJJA 5D1XB 1WAAE 4LEBA 1JF1B 2CD0A 1DQQA 4BXVA 4HUWB 3A67L 1PEZA 3MOQA 1MFDH 2EO7A 5GS1C 5KVEE 2KH2B 5D93B 2XV0A 3U0TB 1AQKL 1MW0A 2NRDA 4YHKL 5DHVB 4LP8A 5A1AA 2XZCL 4A6YB 4NC1E 4DW2H 1I85A 3OR7B 1O6SA 3CQFA 3ES6A 2J4WH 3MRRB 1A6ZA 3AMKA 4M1GH 2LT9A 5T1LB 3HBGA 2Y7SA 2Y36L 3CFDB 4WU7B 5IEKA 5ISZB 4R0LC 4K23L 2VABA 4BA0A 4WCYL 2L7JA 4YBQC 1ICTA 3QEGL 2WLJA 3C6LD 1A6PA 3QQNA 3UROR 2PUQT 4I5BB 4BFJA 3CFTA 2H0JA 4KVCL 3V0HA 2PO6C 4NP9A 3AS0A 3BESR 2UY7A 1FJ1A 2AJUL 2IWEA 4U6YB 4FG6C 1T2JA 1QEWB 3ILDA 2WNGA 1T0MB 1KJ2A 5IB4A 5LBSH 1ZKAA 4JHUA 5JLZB 4XWGH 2OMWA 1OCWL 3FOLB 2UXFA 5F8RC 5L8JB 3KPSD 1I82A 1JMZA 1EQWA 2ED8A 2X42A 3L9RB 4KQ3H 2WOYA 4JO1H 3WKQA 5A3IC 2R56H 1CXKA 5KBLA 4AK2A 4FLOA 5A16B 2GSIA 3TWYA 3UTSB 4M5TA 4LVHB 5AUMB 3GO1L 1CVRA 1NCWH 4XMKH 1FO0L 1OQOA 3KR3H 2WLLA 2Q5BA 1YAIA 3K2KA 4M61B 2ZXAA 4AIXA 4AENB 2MTPA 1E4HA 4NO3A 3VXMA 4AZ8A 1RIUL 1RPQA 5AQ0A 4AT6A 4JRYE 1T5XB 5CJQH 5BZDB 2P5EE 1EHNA 3CHOA 2Q86B 2D7PA 4FKKA 1OW0A 1RZIB 2FWLB 3PJNA 3VG0H 2GFBA 4W9FC 3IETB 5EOTB 1L9NA 1FI8C 4IMKC 4YXKH 5CCKL 3OKKB 2XWJB 3Q6FB 4DEWA 4TULL 1Q9KB 3WN5A 4J23A 2Y22A 1KY6A 3FZUC 3PWPB 1VLXA 4BH7A 1I1RA 1Q9LB 1QBBA 1FL3A 2QPSA 4Z7VB 4AQOA 4FL4C 2IADA 4X5PA 5BNXD 4ESKA 1HH9B 1OK0A 5HYSB 2NY3B 1XAKA 4AIZA 4GYBA 5GGQH 1JZ4A 3R7RA 2R8SH 3UAJC 4NO0B 1J18A 2PO6D 3B2UC 1UGKA 1FO0B 1SHMA 3DX0A 1F13A 1EZVY 3BISA 2GCYA 2Y7OA 5AOIA 3EH3B 4FG6D 1C08A 2VH5L 1T7VA 1JK9B 3NA9L 5EEWA 5KVDE 2A5UA 2YAMA 4X5WA 1X4XA 4DGWC 2VITA 4IKIA 1DBJL 1ES0B 4PJDB 4XWOC 3MLYL 4KKRA 2WVTA 5A3ID 4N3UA 3K0WA 4RISL 1BAFL 2R0WL 5JIDA 1QFWL 3VW3L 3CSPA 4ZOAA 1ADQA 4L1SA 1U91A 3LS5H 3S34H 5E9AA 3H0TA 1GYAA 1P84K 5DURB 2P1YA 1GAFH 3OTTA 5EORL 4JRFA 3NIGE 1E28A 3BVNA 3PHOA 5B4MD 5DS8B 4TQEL 3U6RA 4BCYA 1JFQH 4KRPB 5JPMC 2DLFL 4IW4C 1CF8L 3CSYB 3ZMNA 3TO4A 3QEHA 2CO7A 2YD7A 3LMJL 4UZUA 2YOAA 2P8PB 3VG9B 4Z7OB 2JB6A 2BO0A 3ZGHA 3L4UA 2R29H 5J9PA 5FWQA 4QRRA 3LN4B 2F9BT 4NN5C 4PGCA 1GGCL 2PCPA 3FZUD 3IMTA 1LDPH 1MREH 3FQNB 3GRGA 4HUXB 4NP4L 5KZCD 5MENB 3NBNA 2W0KA 4DEUA 1UD4A 1NCCH 3SQOL 4XN1A 2NR6A 2W0LA 3FCGA 4L3ED 4TL4A 3CBKB 2ZOTA 3WO3B 4P2RD 5KVDH 2BX5A 5B22A 2YSSA 3TBYA 2ZWLT 5C7XL 5I73B 1F4WH 3UAJD 4MNGB 4QD2E 3P11L 1TJXA 4OJCA 1OARL 1T4KA 2DLTA 1KLUB 2WUCH 1DP0A 1IGTA 2HJKB 4LESA 2IOMA 3F01A 4MQ7A 4FZ8L 1Z3GL 4N8CH 5A2IH 4FTVD 4QHKJ 1T5WB 4H1LB 3CSGA 4XWOD 3GXIA 1KCUH 2EUWA 5L4FA 3ASWA 2NW3B 3QR2A 4D9LL 4OD2B 2J1KA 4EEEA 2V9TA 1H3UA 4EXPX 1D6EA 4NC0B 5F6IC 3CZGA 3V5KB 4B50A 3A4EA 3ZKXB 4CJ1A 4RAHA 4LEXL 5INDA 3KW7A 1YNTA 4G42A 5HY9B 3KWUA 5HYFA 1P69B 2XG5A 5PCYA 1R3IL 4XO9A 5E9DA 2PW1A 4PGDB 3HAEB 4Y16C 2OYLA 3DVNA 3FO2A 3G5XA 2BNUA 4NQQA 2FL5B 4X4XB 2Q3ZA 5EMYA 4HJSA 1AS8A 1DSWA 3VGBA 3DJZA 4YDKL 4ZMWA 4N28A 2HTLC 1UM5H 3K8KA 3GF8A 3IMBA 1XB6A 4XZUB 5IFJB 3WS6A 4L4TB 2B59A 2G0KA 4CW1B 3S35H 1VESA 5EO9A 1WFIA 4YBHA 2K6ZA 3PP4L 1KCRL 4Q9QH 4KTDL 2HLFC 3D1MC 2CDEB 2W59A 3FFDB 1KIQB 4WW1A 1DO6A 5IVZA 3T2PA 3WJJC 3EYQD 1JD7A 2IH3A 3GB7A 4R7NB 3GKWH 2EAEA 3QUXC 4GW1B 4F57L 1P9MC 2OAAA 1HNGA 3J27A 5JHBA 5F70A 2BY1A 3ZL4L 1AR1C 2PKDA 2R69L 1TFHA 4JUTA 2ARJQ 3RNQB 3L13A 4LOUC 1F1AA 4OF6A 1U33A 1LTXA 5CU5A 5JMRA 4AIEA 5FO8B 2BNRD 1EBAA 5EULV 4JK0D 1PG7H 1XWVA 3UTOA 2ZAGA 4HIXH 3F7VA 4Y2DB 1QSFB 3MJ6A 4RQQB 1JWSA 3QRGL 4F33B 4OGZA 2NNFA 4W9JC 2AV1B 3BHBB 4N8UA 3IDJA 1EMTH 4LAQH 4OZIA 1LK3L 1THAA 1Z5LA 1KJ3H 4Y16D 3DK0A 1PCSA 4LO9A 4WJKB 3CH8A 1P7QD 4N2LA 3U4BH 4B7IA 2XN9A 4ZYKA 5J6HA 4FHBD 3B2DC 3VU2A 1S9YA 2CRMA 3A4DA 4YC2B 1UT9A 5F7DB 4LPTA 1FL6A 3D09A 4P4KC 5D7LD 3VXNB 1QNZL 1N5AA 2HTLD 1H0DB 1XGQA 1MLCB 2NY2D 3MBWB 2M1KA 3T1FA 2YRLA 5SX5H 3SO5A 4O51B 1G7HB 3N43F 4I88A 1EBPA 3VD3A 1CXHA 3DJTA 3SIKA 3TGXA 2YAFA 2WZPD 1FGVH 4UOQA 1U93A 1SNRA 3JV0A 4FA6A 2GJPA 1CQKA 4PP2B 4Y1AA 1TFPA 3DTXA 1U41A 4HMCA 3F64A 5A7BA 2VLJB 3HUJE 3ILQC 3MR9A 4L1BA 4ADIA 2QDWA 3ZKSD 3G3LA 5T8IA 3C08L 4BUHA 4L8CA 3C5JB 3TJEH 4YDVB 5D93C 3QUXD 2FVNA 2OMYB 1AR1D 1ECYA 1CE1L 3HJEA 5B7EA 4X7FC 4TUOB 2YC1B 5EU3A 3W82A 4LOUD 4QNPF 4J1UB 3TURA 4ZUSB 4KKZA 4JPKL 5E8DH 4HJEA 1XEDA 1FNSH 3O45B 4J3OC 3P30L 2C9QA 2CBMA 2ORBL 2ZUTA 3GSUB 1LL1A 5SWSD 2WZ6A 2BP3A 5DMKB 2OL3A 5AL0A 3TM6A 3FCUB 4DP1X 1TPXB 2FEDD 4DVBB 2WPGA 4NM4L 4X9BA 2B1OA 3UTTB 5DHDA 4AKPA 2XX1A 4GRLC 2YFOA 3QHZH 4Y8DC 1XZ0A 3KPQA 3N41F 3BSZA 4GB9A 2A6DA 1N6QL 1E8XA 3CFJB 2BSRB 3WIFB 3PL6C 1N19A 3QG6A 4GI8A 4P4KD 1VACA 1MF2H 5D9SB 5AAMC 1L7TL 4G11A 4MB3A 3NCJH 4PG9B 4HDIB 5HPMA 1MHCB 3MNVB 4UM9B 4X6DE 4Z7UF 5FECB 3TT3L 2VR6A 5I66B 3N50A 4PJHF 2R39A 2G75A 5DHMC 1Z7JA 2D0FA 3V52H 4JKNA 1CLZL 1USZA 5IESH 4WFGE 3HZVA 5D6DA 4OFQA 2G3XA 3PYCA 1QBAA 1QWHA 3DUUB 3W9EA 5C0RH 2OP4L 3P0YH 2X1QA 1SOQA 4R3SA 3DX2A 4E41A 4NUJA 1M71B 5CXPA 1Z1WA 3ZL1A 3N1PC 4J3OD 2IDSA 4P46B 1CL7H 5T1LD 3C5SB 5LN4A 3SE3A 5ISZD 3DURB 3R4RA 2FLRT 1K5NB 1GW6A 2F7RA 4J3BA 2P43B 4XP9H 3FQYA 3EGSB 1IAOB 2NY3C 4KAQH 4Y8AA 1PZAA 2Y9RT 5LHDA 2JCCB 2CA4A 6CGTA 1OGAB 1MXDA 4GRLD 1PU0A 1QO3A 1WFNA 4O58L 5TQ2H 4I2XE 1B0GA 1BF2A 5HHMB 2Q20A 1V5JA 5BV7L 1E6OL 1A9BB 1D7CA 1PAZA 1HWWA 2P8LA 4XNXH 1K85A 1WIOA 3H4FA 2VAJA 1X9LA 3SE9L 3UTSD 3QRLA 4KX7A 3TCTA 4MJ5A 1ZVSB 6TAAA 5JQHC 2RD0A 3WFDH 3D33A 4U05A 3SDDC 3D0LB 4Y19A 2G0LA 1T80A 1YEHH 2VO5A 3IDIB 3QBTB 2UWEB 5FS5A 4GG6A 3UZEC 3QUZB 1PYWA 3BZ4A 4P3CL 1SYVA 2ADJB 5I17B 3DV4A 1GSKA 5EOQH 4BELD 3A23A 1T3FB 4J6RL 4BH8B 5T1MB 2WXNA 1U8JB 4WDIB 3T0VA 2D3VA 1TTBA 1R4XA 1LO3H 1C5BL 2AMUA 1I7ZB 1KTKE 1YUHB 3K72B 1KPVB 5L2KB 2NUTA 2J56A 2A9MH 3TBCA 3GLDA 1KTCA 1NEZA 1G9ML 4RZKA 3SPVA 3UBXB 5BV7B 3LN5A 3WDHA 5IHWA 3D39A 2DQ6A 4BZ1H 35C8H 3G9VA 2NY3D 4M6ML 3OKOA 3QRFM 4NO0D 4J3SA 1OT2A 1IGJB 3IJYA 2XTJE 4U6HB 3DSFL 3NJNA 2JK5B 4YWGH 4RLDA 1KTRL 3UYRL 4L37A 3BOVA 2DJMA 4NSKA 5EO0A 4J4PA 1JDAA 5DZ9A 5I1DA 1YN6A 3LIZH 2GI0A 1R46A 1FNEB 1AD9A 3VXSB 2IEPA 3G6JF 2YO3A 1XF2A 1E5BA 2WBXA 3AY2A 4JY4A 1HILB 4V1DB 4UTAA 3IF1A 1KIRB 5AOLA 1R0AH 5KSAC 2B15A 1A7RH 3HZMB 3MNMA 2CDGA 3DX3A 3MFFB 3V6OA 1FFQA 4F8PA 2GSMB 2O5YL 4D0BB 2AVGA 1FF5A 1A3LH 2H1LM 3OSVA 4ONGH 5CO1A 2YARA 4AYGA 4FQIH 3QWRA 4MA1B 3WHXA 4UQ2B 3ZXAC 4DK6A 3MGOA 4MDIA 4AITA 3I85A 2WN2A 4WHCA 2E9IA 4TKWA 3E7JA 1JGDA 2P46B 4XZ4A 2NT0A 2Z7YA 5IMLB 4OFVA 1BQUA 1ZHBB 2FJUB 2WXKA 5DD5L 5A2BA 2WOBA 1K8IA 1FSKC 1M7IA 4X5XA 2AI0H 5DVKA 4N0UE 5F6HI 3GD1C 1E4XL 1AYRA 1D5XB 2OQJA 1XF3B 5FGCB 2N7SA 3HG0A 2ZKHH 3HC4H 5KTEH 2J12B 2UZIH 2OMTB 4K15A 2CUIA 5IB2A 1WC7A 3HZYB 1J88A 3PJSB 1YY9C 4OJDH 1KB3A 5FYJE 4PRIB 3MKKA 2OR9L 2RQ8A 3QS2A 2ARJB 3GMLA 4XOCA 3WFHB 2AW2A 3EUDA 1ETB1 5GS0L 2DWXA 1N5YH 1QPXA 5ANMA 3D85D 5SX5K 2HFEA 3KL0A 4N2BA 4JM4L 4F7EB 3MBEB 1JTOA 2EDKA 3OQRA 4FNTA 5BO1L 5IQMA 2Q3XA 1MPAL 2EXTA 3QPKA 1U2YA 2D7OA 1JZ8A 2FBRA 5KSAD 4ZW8A 5C3IA 4QRRE 3O9WB 4KKCC 2VW7A 5FLUA 4MNQE 1OAYL 2GY5A 4FJZA 3X13A 4ABVA 1S7RB 43C9B 2OW6A 4HJ1A 1NMCC 3QWOA 4TQPA 2YWZA