1OM9A

Structure of the gga1-appendage in complex with the p56 binding peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
142
structure length
142
Chain Sequence
b'ASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Structural basis for binding of accessory proteins by the appendage domain of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, signaling protein
total genus 16
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1om9A00
1OM9A 1GYUA 5CN2A 1GYWA 1W80A 1KYUA 1QTSA 1KYDA 2DWYA 1B9KA 1KY7A 2A7BA 1NA8A 5CN1A 1KYFA 2DWXA 2VJ0A 1IU1A 1QTPA 3ZY7A 2E9GA 2YMTA 1KY6A 3HS8A 4BCXA 1P4UA 3MNMA 3ZHFA 1GYVA
chains in the Genus database with same CATH superfamily
5ANMB 1OTTC 3BESR 4DUWA 2X5PA 1M7IA 1OGAA 2WLNA 4FQ2L 1J0IA 2IQAA 4KK9C 5CLYA 4BWWA 2Y9RT 4AMKL 3D4YA 2RD0A 1QYGL 2YRLA 3ASNB 3FRPG 1RZ7H 3RTQD 3JWDH 5F6HJ 2J56A 5DXWA 1PDKA 3IDIB 4XCYB 4X5WB 5GZNA 1IV8A 5IJKA 1J8HE 1FSKC 1G87A 5MP6H 3IWVA 4F5CA 2G2RA 3AABA 2DWEB 2NW2A 4PJ5D 3SPVB 1AR1B 5EDXA 3GSVA 4ZOCA 2LU7A 1OCWL 3WN5C 3HRZA 1KJ2L 5T1KB 1BMZA 1C8PA 1TFPA 2PPAA 4PM1A 4BXSV 4FAAB 2FHCA 3L5HA 5BS0E 4BSVB 2F6AA 3G5XA 3WTSA 1F1AA 2F18A 3U2SB 2E7CA 3M07A 1PF3A 1JYNA 2JI3A 3ZO0A 2WB7A 1ZJAA 3D3VD 2LLNA 3K6FA 1ZLEA 4NO5B 4WIQA 2NTFA 2YAHA 4P59L 5FO8A 5GGSA 3ZE1E 3BVWA 4L4VA 4JPIA 1FCCA 2VXTL 3AXLB 3LIUA 2AMGA 3IU4H 1CG9A 1E9QA 1NM4A 1S9XA 3D0LB 3K5RA 4EBQH 1L4IA 5JDJA 1QLEH 1Y6KR 4WNQB 4R83A 4YDNA 3RL2A 3NZHL 5D7LD 2AXHA 1ZTXE 1K8DB 5CJ8A 3UG5A 1BZDA 1A7RL 2X6CA 4L5FE 2H0JA 4YDJB 3AQDA 2DOCA 1G5AA 3QO1A 5LJYH 2PP8A 4LBEB 3C75A 4G71B 4BH8B 1KLFA 3Q1EA 4KJQD 3W81A 3GSUA 1Z5YD 1ES0A 5JUEL 3RB5A 4FLOA 1NQBA 2JK5B 4U1JA 1HH6A 1RZIB 5DRZB 5GS1B 3DA0A 5C0AB 4I0PC 4PQXA 1BPVA 5FGCB 5I18H 1KC5L 3VXRE 1MDAA 3ML8A 2PYFA 2IDFA 1PNCA 4ZOAA 3BQVA 4NCDA 3B7YA 1KYDA 1CO1A 5IVNA 1OQOA 4OCSL 1DO6A 1QNZL 1T5XB 5DHYB 4IOSA 2HX8A 3D09A 1YNTA 3FN0L 4A38A 5IW1A 2L7EA 5CUSL 3HHMA 3CLFH 4HBCL 4FXKA 3P4NA 1MPAL 2C1PA 2WXRA 4GAYA 4X9HA 1UWGL 5DJ6B 1DQKA 3LRHA 3PL6B 3BT2L 3HC4L 4ZX4A 1FNSL 1BFOA 3OJ2C 2DYPB 1MCNA 3D7PA 3MRHA 5IT2L 3QHZL 4QXGL 2XTJB 4NOFA 3KPRE 4A6YH 1FZOB 1ZTMA 1S8DB 4XXDB 4EXPX 3ZE1F 1DZBA 3LZOA 2HFFA 2VZTA 2Q86B 4JCWA 1XD0A 4PB0H 5FYJE 4HOMA 1TVBA 2J8UE 3OAUL 3FQXB 3KLAA 2NR6D 2QKSA 3ARUA 5IMOA 3HJEA 4HJUA 3FTWA 1K5NB 2X4OA 4K7FA 5BVPL 4I0KA 4XO5A 2FECL 1RUKH 1FZJB 3OJDB 4QGTA 1FH2A 1FJ1A 2ADFL 3CMOL 5CR8A 5EBGA 3L8QA 4LFHG 5ADPH 2F19L 1Q0XL 1QUPA 1PKOA 1H5BC 2P43B 2GEQA 3CPLA 1BFTA 1DCLA 5I8OL 4CVZA 5DEFB 3O0RH 4BH7B 5F9JB 2JKTM 4L8SC 1BF5A 4CVXA 2JCCA 4PCSA 2K7PA 1I7RA 3HZKB 3NFSH 5DDHB 5INCA 1RLBA 1CDCA 4FLSA 5DRXB 1KCBA 1T22B 3EGDB 4RRPG 1E9PA 2X4NA 5IF0A 3QIWB 3VXSD 1IM3D 1RUQH 5IBLC 1ET5A 4HWEH 4KI1A 1MWAL 2WXPA 3EO1B 2BY0A 3HMXH 1NBVH 4WUUE 3THMH 5T5NG 1DJZA 3FXIC 1AGBB 5T1LB 1AXTL 5HD8C 3ESUF 4QRRB 1QBML 4ZXBB 2NY2C 4KXCA 1IEAA 1DEEA 1NJ9A 1PCXA 4FQXC 2JKIS 1BQLL 1D5XB 3V8CA 2NDFA 4M4PA 1UZ8B 3GGWB 4OLYL 4AUYA 3W38A 1AKJB 1RHHB 2X42A 3DNKA 5LBGA 2X4QA 1ASOA 1YEWA 5DUJA 3PDDA 4P2RB 2H8PA 4L0ZA 2J8UF 5EC1B 1BAFL 4O02B 2WBJB 5G5DA 3FUMA 1B4JH 4JPKH 4RZCA 4PJBB 3N0PB 3VFVB 3QCUL 3VFNB 1CI5A 1U8IB 4YSTA 5C0GA 2CHZA 1P5UB 1UJ3C 2LABA 4NKMB 4KROB 3FUEA 4HPOL 2CO7B 3OXRB 4FFZL 3G6AA 4ALAH 2AXGA 3CXHK 1I85C 3SGDI 1MCPH 5GRYA 2XV3A 3WD5L 2R4SH 3O3EA 1GMIA 1XB8A 2YD8A 1PD1A 4WGWB 3ABKB 1N12A 3MGOA 1LE9B 2AC0A 2EZ0C 2GJZA 3GEFA 4N8UA 1PQZA 2VR7A 2NQCA 3PU7A 4XOBA 5E70A 4XPAH 1SFHA 2CBOA 2R0LH 3PHSA 2IPUK 4H8VA 1OKEA 4KQ3L 5ISZB 5KG9B 2WGXA 3UAJA 3OKOA 5KVDH 1ZT1A 3NK3A 2WC7A 2XG5B 4R7VA 4A7SA 3LQAL 4JLRA 4NAJA 3BZFA 1QUNA 5LBSA 4DTGL 1TQVA 3HG1D 2PXYB 3B9KD 4L4VE 3TEUA 3M1BA 2XXFA 1IRAY 1YEKH 1LVEA 2GQHA 4H1LA 4ODSH 1BZOA 4TLUA 3VXPA 3K74B 4A67A 2AQQA 2VRAA 2VSDA 5DO2D 3FSVA 2HLAA 3F00A 2YRPA 1E7VA 3PQYA 1FHNA 1U4FA 3AS1A 3QFJD 4K0OA 5DCCA 4JFOB 4LKCB 1TTAA 2CDEA 2D7MA 1CXIA 1CFVH 35C8L 4PI2A 1JD7A 3U46B 1BZEA 5AOJA 3WDJA 4JPQA 1PY4A 2Q8BL 2IAND 1AR1D 2FX9L 3HI1B 1DSYA 3OXSB 3GIZH 3U1QA 1I3RA 2WW8A 2EYSA 4IOIA 4Q9RL 3NCFB 3BO8B 5T1KD 2F08A 3P77A 1EJOL 2C26A 3NRFA 4ELDA 5I1CL 4RMQA 2XY1A 2WBXA 4NZ8A 4LAJH 1IBDA 1KTRL 5KTEL 4NT6A 1Q9OB 2GK0B 1CGSH 1U0QA 1RZKC 4H20H 2EO1A 2MKLC 3GBML 3PV7A 4PRBB 5L0QB 2N01B 1TZGL 5D93C 2OCFD 1N19A 3GMOA 3DROB 2DQTH 3WSQL 3GSWB 1I7TB 1F2QA 5KVFH 3QEUA 5FHAL 1G84A 1E3ZA 4TVPE 1W2KT 3C60D 3HW7A 3SDDB 5BW7C 4JQIA 3VXUB 4JM2F 2WLKA 4LIQH 3ARWA 3BGMB 4WW1A 5T5FL 5FS5A 1M7UA 1YJDH 2NY0B 1PPIA 1RSYA 4WO4C 3NA9L 4IS6A 3V4PB 4PJ8B 3MKKA 2VE6A 4Y16B 1JE6A 5IROC 3U36B 4G6JH 5DJ0B 3KPMB 1A22B 4G42B 3ME0B 4UT9A 1U8MB 5TE4L 4UNVA 4NSKB 4EJ1C 4PU2A 4YSPA 3PJSA 3LEYL 3C08L 1KOAA 4EIBA 2VC2H 4ODHL 1GAFL 3BVDB 5B1AB 2ZPKL 1MFAL 1ET7A 5IOPB 2OX5B 1CYXA 3QEHB 3I9AA 3QPXL 3DGGA 3RVVC 4WWPA 3CFBB 4BFFA 1ACYH 5L2KD 1O0VA 1GJUA 3QDGD 2Y5EA 2Y6SD 3WJJC 3PFQA 4GKSB 2AJXL 5E8EB 2F7PA 3FH8A 5C2BH 3CHOA 4J3XA 4HIHA 4YXLL 4YUEL 3ETBF 2OJEA 4KITB 4HKBB 5GZNC 3L1EA 2FEDD 2FWLB 2ICEC 2X9ZA 3SGJA 4LEOB 2OTUB 3FT4B 4XPBL 1T3FB 1Q9LA 2V4LA 3OKDB 3GMLB 25C8H 3HKFA 4EO5A 1OSPL 3L9YA 1YHPA 3Q0HA 3HRZC 1L5GA 5GSRA 4M7JH 1YNTF 2H32H 3QWQB 4RMVA 5DZJA 2J6WA 3HC2A 3WXWL 5DT1H 1OCZB 1AG0A 3HZVA 3NSXA 3FB8B 1IC7L 4JG9A 1ZVYA 3MFFA 2WHVA 4R84A 1V3LA 3S5LG 1IKFL 3BSZL 1F6AA 3UXFA 4A55A 1UB5B 5B3JE 4N0FB 5J57B 4JPSA 5CD3A 4DGIL 1JGIA 4DVRH 5C0NC 4H8HA 1URIA 1LK3H 2CBMA 2F2HA 5FW8A 5JHLH 5FXCH 5HVFB 3MLTA 3QUYA 3GLDA 1JXKA 2QSTA 3D0VA 2FVNA 1YEEH 2ADJA 4CGUB 4ODBD 4LEBA 4LCWB 4MYPA 4RIRB 1VA9A 3MLUH 1BJ8A 3EZJB 4HIEB 5BO0D 3VTAA 1ZVSB 4N2DA 5HJGA 2RAMA 1RU9H 3QRLA 4HK3J 4OUUA 2XJKA 2WKOA 4PP1D 1UD8A 4Y4HA 4AVHA 5GGRY 3QNXA 3TIEB 1DJWA 3LXUX 2ZNXA 5B4MD 4MMYB 1FFNA 3QZLA 4Z78A 2BERA 3ELAT 2FX7H 3CVHA 4HUXA 4AV0A 4F7PA 4IBQA 4OGZA 2CUAA 4L05A 1JG9A 3FT3B 1HHKA 4GRMA 3GYRA 3IJEA 4CNIA 3ESNA 4R2GB 4C55A 1EFXD 1PG7H 1R3KA 1PFOA 4GG6A 4TSAH 5DQDL 4KJWD 4AJVA 4WY7L 1ONQB 1H3XA 4OY9A 4UOW0 3VFGL 4F37K 5C7ZA 4R4NC 3TPKA 4FXKC 4PTTA 2BFVL 4BUQA 5BRZA 1FVEA 4KKRA 3V4LA 2IG2H 3NCJL 5B3JF 3CPUA 2WBJD 3STZA 2QLVB 4XVUD 3MQIA 1R0AH 4OLXL 2FZ3B 1ZPLA 2WO4A 5I15L 5A2JH 2ILLA 1NGYB 3TA3B 2V2WB 2WNXA 3UADA 2ED9A 4KROD 3RJOA 1JF6A 5JMOC 4X8XA 1I1CA 1IAKB 2YA1A 4TKWA 5B7EA 3P73A 3RPBA 3IDGA 1SVZA 2IVFC 5D1XA 3H9SD 5TQ0H 4BZ2H 4FA6A 5BOZG 1BQUA 3HMXA 1RFDL 4UV4L 1XX9C 4JGMA 3DYOA 2AS5M 5IEHA 2G5BB 5B8CB 2BM3A 1SJHB 1FFPB 2P24B 2XV6B 1JPGA 3VXOB 4BM7A 4L1SA 1T03L 3LKSA 1QQDB 1MREH 2DPKA 1VFAB 1FLTX 4YH6A 5FYLH 3NK4A 2BS9A 3N91A 1N4XH 1KF9B 3ZTNH 5HJDA 2WXIA 5E8PB 3FNKA 2MWCA 4QY8B 4AK2A 5ISZD 2P5EA 3IMVA 3IN0A 1TR7A 2K1MA 3EAKA 5DVOA 1SF5A 2BNQE 4APXA 4BUGA 4N5EC 3FHEA 2H26B 1S7QA 2R0WL 3SKUD 1WDAA 2VLRD 2WVTA 2IOOA 4OFIA 1YMMA 4W68A 1TQWA 2WGNB 1DFXA 4HDIA 5HHVH 5MENB 3QNYA 1J48A 2R1WB 2HVJB 1BAWA 3D39B 4ZO6A 1A6AA 4P4KB 1DQVA 3ARFB 2DQJH 2OR9H 1PZDA 2WXQA 4AJWA 4U1HA 4EQ3A 4TNGA 4LNRB 4QTHB 2EC9T 2EXYC 3JT2A 4I48A 4DZBA 1KIUA 3S37L 3GSOA 1CD9B 5C1MB 4JFPB 1IX2A 2DTMH 4F9PA 3ASWA 3V0AC 4HEPA 4M93C 3VUAA 5KYXB 3RVWC 4M62L 3PREA 2FJFA 3ECUA 4HYTB 1VAHA 3FQUB 1TLKA 4MMZB 4YPJA 4WF7A 4L8BB 2WLIA 3FULA 3FS9A 4G8GB 3DRQA 4JL1A 4MXWH 2W65B 1H6UA 3UC0L 4M8UA 3TZVA 3BCFA 4EVNB 2H2PC 3HAEH 1CDHA 1OAZH 5JIHA 5C7XH 1LTXA 1Z1WA 2GSIB 3WTTA 3IGAB 2I9LA 1WBZA 3I2CH 4C4UA 5K69A 2X3AA 4TNWK 4P9HL 3SD5A 4LCVA 1DLHB 2ZIDA 2Z8VC 2LU5A 3D48R 5JHDD 2YUXA 5KSUB 1NGZA 3HHSB 3PHOA 4LCYA 5EIIA 2QFRA 4K94C 3NT0A 1F4XH 1NCUA 2BK8A 4JM4L 1CDUA 1JPFA 2YFOA 1FGNL 5DQJB 1YYML 1ZS2A 3S36H 3M6DA 4NNPH 1JTPA 2DIBA 3H9YA 4M00A 3VFRB 2CIKA 2V5SA 3ESVF 5A43C 3RNQA 4PBXA 1THCA 3RUGA 1OWRM 3MV7D 4OD2B 3EHBD 3G5YA 4WWID 4X6BA 2K0RA 3CG8A 4HPYH 3P3RA 1R6VA 3X14B 2RA1A 1KBGL 3EFOB 2Z4QA 3R4RA 5EZJB 5BOPA 3UAJC 3K7UA 4M1DH 4QI3A 4I89A 1PZSA 3P02A 1U8HB 3UG3A 1MNUL 4Y1AE 5AKTA 4OM0L 5GJSH 5EBWA 3KJ4C 5DFVC 3DDFA 3VMOA 2Z93B 3GD1C 1G7PA 2H0EA 4XMLL 2D2CC 2IH9A 4JG5A 4PB9L 4Z6AT 2BNQB 3HG0A 4NN7B 1RK1A 1SJEA 3HUJA 4UOQA 1QFUH 3V10A 2BSEA 4JY4A 2VIRA 3VYNA 3EDJA 3TBTA 2TRHA 1JZ3A 1J9CT 1XIWA 3NSCA 1BF2A 5E03A 2DEXX 5CEZH 2YAOA 3IDNA 5FF6A 3QS3A 4MNGB 3WKNA 1KJVB 5T1MA 3MXVL 4XXCA 5SWQB 3BP7A 3VSTA 1XSKA 2R4RL 1N0XL 4RQQA 1N6UA 1IUZA 2OM5A 1I1AC 4FQ2H 4LVHC 1P4LB 2J20A 5IREA 4JRLA 4AMKH 4CMHB 3NH7L 2ZWKA 1IQDB 1QYGH 2F53D 2HWZL 1JMXA 4XNXL 4U1LB 4AIEA 3BIBX 2AQ2A 1GY2A 3BPCB 2E7LC 4YDVB 5IG7B 2JJUA 5HYSA 1TJGL 2X7LB 4X6EB 1GHFL 2KZ1B 4J1UB 5I2IA 4R7XA 5E4IA 1IFRA 2LHAA 4N2EA 1FLRL 3C9NA 4GG6E 2CLVA 3L48A 5CIPB 1OCWH 1YMHB 3APNA 2OSWA 1KJ2H 3RQ3A 2D8KA 3AFLA 3LRMA 3LXAA 1QSEA 4W9CC 3PF2A 5B1BB 2PPFA 3L95A 3ZQWA 2FBRA 3TYFB 2VMDA 3DETD 4RAVB 3BZDA 5BRZE 3MRRB 2QKIA 2HT4D 2IALA 4M48L 3X11A 3F65A 4OFKA 3NCYP 3RIFF 5SWSE 4CW1B 4XNAA 3VVVA 3NFNA 2V33A 5J11B 3D4ZA 2PCXA 3HFFA 5HJBA 1SHXA 3Q01A 2ZX7A 4N86A 3WN6A 1R5IB 3CXDL 4P59H 1K2DA 1HILB 5LNDA 5CGYD 2Y2YA 3RIAK 2YEZB 4YBQC 2VXTH 5DMIL 5SX4I 4RRPM 1KBKA 4GQ9L 1UD3A 1JNLL 5D1XE 1JV5B 2VMJA 3NZHH 1LO0L 2CGRL 3FPYA 2WKOF 4FQPA 2Q87A 1AIFB 2DKSA 4PR5A 1A7RH 4KX9A 3KJ6L 3OM3B 3L9RB 4JFQB 4IIQA 3I6GA 4FFVD 4FABL 3F5WA 1XBDA 4LCCC 4KZEL 4D7BA 2ZKHH 4C57C 3WEAA 4OI7A 5JHLA 3TEWA 3V2AR 5GGVL 3L3HB 4Y1AB 5D7EA 4P2QE 3VX1A 5BZZA 3C6LA 2YQBA 1MVYA 1UENA 1ZIAA 3DOIA 3FB5A 1BQKA 1OOWA 2XKNA 5JPNA 1KC5H 2XXGA 3GSRB 1AG6A 1OE2A 2P8LB 1RXLA 3DK2A 4KOCA 5HGBA 2UY6A 4GG6F 5D2NA 1TJIL 2OMWA 1YMME 4GINA 4AYMC 5FA4B 4OCSH 3GMRA 1X9UA 1QNZH 3FJTA 5EO9B 1BOGB 2Z34A 3FN0H 4WFHD 2IAMC 3QDMA 5CUSH 1NC2A 3CMGA 1JGDA 4HBCH 1BVOA 4ICXA 1JGEA 1S2EA 1MPAH 2HH0L 5FM4A 5D7JD 1UWGH 2XBZA 4X5PA 1CFQA 3BT2H 3HC4H 4J12A 4P2YA 3VRIB 2WD0A 1VZGA 1FNSH 2QT6A 2UXTA 3O11A 2IGLA 3T6ZA 3Q06A 3FFCA 2VLLA 1X4YA 5IT2H 1KYOJ 3QHZH 5ETUB 1ZT7A 4HK0A 4QXGH 2DQUL 1MRCL 5F70A 3LSOA 1S78C 1U58B 4MS8C 3EYOA 5C71A 5ID1A 1I53A 1U8QB 3EH5B 4GAGL 5FO7B 2X87A 3OAUH 4PW3A 4Y9GA 4ZDHA 5BVPH 2JQAA 3ARGB 3K72B 2YZ1A 5EC2B 5A2FA 4E9VA 5ITBL 4JFEB 5FM5M 1K9TA 1S7SB 1UA3A 1UZGA 3EOAA 4WWKC 3UROR 2VERA 3CMOH 4YJZL 2VDRL 1H3VA 5E23A 4AM0A 1S6NA 4KV5E 2F19H 3T2PA 3ZDXE 1Q0XH 3PCYA 2KBGA 3FYIB 4Z0XA 4Y5YA 5I8OH 3JV6A 4OB5L 1CN4A 3D39D 1PX8A 2WLJA 4NM8L 4X80L 5HHMD 3CV5A 4V1DB 4I9WE 1JVKA 1VGEL 2GUOB 2JSFA 1ZS8B 3K8LA 4OLUL 4WW2B 4E36A 3LQZB 1KB5A 3ALPA 1D5ZB 4CKQA 4UOZA 1G7HA 1U8PB 2NNRA 2VXVL 4FQHA 3AVEA 4BZ2A 5C0BA 4L1BA 3WI9A 3RVXC 1KB9J 4YFDB 1MWAH 4UBDC 3UYRL 2DLTA 1TTCA 4J3OH 3QJFA 2XKSA 3AGVA 1AXTH 1J5CA 4NDMB 1S4IA 1T66D 4G8GD 1XF4A 1QBMH 3S88L 2CJUL 4QWWD 1W8EA 1WJ3A 1AGDA 4JHUA 4R96B 1KDJA 2VR5A 3QULA 5EOTA 2WNGA 1BQLH 1NC4B 4K3HA 3NJFA 2B14A 3Q05A 2OAAA 4OLYH 2FWOB 4UB0L 3IJ9A 1MUJA 3HUJE 4BFBD 3EOBA 4DKDC 5GGVY 3TCTA 4X4YB 3E80A 2GTQA 4K5PA 5CBAA 1BAFH 3B4NA 5ACLA 3H42L 4H1LG 1KBVA 4XO8A 2NY4D 1BQHA 2WP3T 2V7NB 3IFPB 3V55A 2W38A 3QCUH 4WKZA 4YN3A 1X4ZA 1FCGA 5DJZB 4P2OD 1OT2A 3ARPA 4KV5F 1KEGL 3ARBA 3ZDXF 4NQVB 4HZLB 3DVNA 4HFWB 4HPOH 4FFZH 3SCMA 1SHWA 5HYFA 3S3SA 3US1A 3GZOA 3MACL 3CIQA 3EBGA 3WD5H 2Y07L 1FNAA 3PNWA 3HE7A 1EH9A 2Q3XA 1KGXA 2WZ6A 2Y7NA 4UDUA 4NO3B 4BXVA 3H9HB 4JKNA 1OV8A 3UJJL 3HAEA 5BXFB 3RUGF 1GW6A 1URLA 4LCIL 4LPWA 4MSWB 1VGKB 3TWCL 2ZWZA 3CVBA 4BYHA 4LDCA 5IFAL 2GTZA 4KQ3H 4PJ6A 5DZLA 1DVFC 1YEJH 4ALAC 1FL6B 1GZQA 3LQAH 3RWHB 3PJLA 3O2DL 2PO6B 4JM0A 5CP7B 4LLQB 4F9PC 4S0HA 3HEIB 4DTGH 2ZQKA 4I18A 4XMZA 3WLBA 4Z23A 1DQJA 1HCFX 1EHLL 3W56A 4FD0A 1PFCA 3B1UA 3EH3B 3HUJF 3HS0A 5J13B 1TPXB 4PJEB 1OD7A 2XV2A 3OC8A 4XN4A 4IYKA 1IGYA 3PWLB 3WE6B 4KKAC 3ZTCC 1CFBA 2F8OA 35C8H 3TZVC 5GQBA 5IHZB 1C08A 1OPGL 3SKMB 4QAMB 1S5HB 2WIMA 2E6PA 2EABA 2Q8BH 3TL5A 3QJQB 1EVTC 2FX9H 4DKAA 3ZKQD 1OP3K 4M56A 4X5LA 4Q9RH 1KT2B 4GO9A 2BOCA 4CSTA 1YPZB 1EJOH 5IHBA 4LF3A 2Q7YB 5E8NB 4XZUA 1S7RA 1T2JA 5I1CH 1T4WA 5AOIA 3UZQA 2EVFA 4KFZC 1AO7E 4KH9A 2EH7L 2E47A 1V3JA 1A9BA 5KTEH 2HFGL 1IM9A 3FH5A 2DI7A 4AEEA 1NDMA 2R2CA 1SQ2N 2CCLA 3QRBA 1QLFA 2Z8RA 4GBXD 5EH1A 2EADA 1TZGH 4J3UA 3QDME 1FH5L 3BWAB 5I8KL 3AZUA 4JL2A 1JDCA 2IWFA 5FWQA 4HKZB 1XL6A 4KVNL 3HPJB 4EI0A 5HPMB 5FHAH 2J88L 4LVEA 4Y5XA 2Y4SA 4TSBL 2C3VB 3T4YA 3FFCE 4NOBA 5T5FH 3FU5A 1GPOL 5BO1L 3BUIA 4OIFA 1A4CA 3NA9H 4ELKB 5D4QA 1FVCA 1H15A 1JZFA 3ZHKA 4K3JL 3CLWA 1QFWI 1GYUA 3HTLX 5AKVA 3F7VA 5FUZL 2R15A 4IRJA 3IDXL 5TE4H 3VXTB 5GGTL 1U8KA 3MCLL 3LEYH 3C08H 2GVYA 4W9ZA 5I1IL 4ZFOB 4ODHH 1GAFH 1T0OA 5BOJA 1Z9PA 2ZPKH 1MFAH 3CUPB 4XO3A 4WU7A 2ICES 3VFWA 1H8LA 4D0BA 5HHNB 3RBGA 3QPXH 2OMBA 1T21B 3T0VA 1IZKA 1FFQA 5HI4C 5AEAA 2OMZB 2AW2A 1J0HA 5IQOA 1YJDC 5TPWL 2AJXH 3IYLW 3W9DA 3K91A 1PJ9A 3T09A 5AVRB 4JK0D 1WZAA 2UZXA 2Z35A 1LP9A 3A5VA 4TOYL 4AQAB 1F3RB 5L2JA 4NYLB 4YXLH 4EZJA 3MNVA 4YUEH 2OMTB 2R23B 5DO8A 2DQFB 3D85B 4PW9A 4FJ6A 4WVRA 2XN9D 3OR7A 3EYSL 3TM6A 2Z1KA 2EUZA 1HXMA 2CBQA 4XPBH 2PPEA 1F42A 5C0BE 5CD5C 4HSCX 1N10A 1OSPH 4L3FA 1LD9A 3RE0A 2VN6A 1RZJL 4KAQL 4OR1A 4NFBA 1AQKL 3LN9A 2HMIC 5D9SB 1QR1B 3T77B 3WXWH 5EUKA 3Q8CA 4JFFD 4U6HA 1KY6A 2EKSB 3KH3A 2H6PB 3MBEA 3FTGA 1IC7H 4DP7X 2QKIC 1G9HA 3RWGB 1FV1B 4NM4L 4HUKB 5T3ZE 1IKFH 1S7UB 3BSZH 3O8XB 2VXSL 2MH4A 4L3EA 3IJ7A 4N0UB 2JLLA 4DGIH 3QJHA 3W11D 1XGPA 4JFED 4MRCA 4O5LL 1KACB 4MD5B 2UYLB 3MRQA 4Q9CA 1GCYA 2Q0ZX 4IGBA 2R0KL 1AO7B 4H0LC 3B6SB 3MC0A 3TOPA 3GS7A 1SEBA 1SPDA 2DLGA 4GB9A 5KSAC 5J1SC 1E3XA 4U4IA 3VFPA 4DGYL 1KG0B 1TO5A 5E2VL 1JNHA 3KM2A 4XNDA 3LIZL 2I69A 4JREC 2NX5A 4HX1A 2VWEE 4G1EA 3O6FB 5ITFB 2N7SA 2R69L 4Q7DA 2CXGA 3DX7A 1BBDL 5JQHC 3CSFA 3GMPB 2EAEA 4L4TE 2BIHA 4X8JA 5HP5A 4F8QA 1LXMA 1SDDA 2VAAA 3G08A 3OZKA 4G7SB 2R39A 1KTLA 3HR5B 5JPNC 1CFMA 4DESA 5JTWA 4KKBD 3IRCA 4QO1B 5D2NC 1C16A 1KFGA 1LNUB 1S7TB 1OW0A 1GJWA 3BUTA 3ETBJ 3AACA 3J7HA 3M45A 2NXZC 2H5UA 2ICWI 4WY7H 3E9UA 5DQDH 3E7JA 5A2CA 1GGCL 1Q8MA 4R7NB 1IKNA 3VFGH 2UWEA 5F88B 2JKRM 2P52A 5JZ7C 2VSMB 5KVEE 4RAHA 1TCRB 1H0DB 2BFVH 2M2DA 4JDTL 3NCWA 4JAMA 3SQBB 3D51A 3NCJH 2BZCA 4IJTA 1BW8A 1NMBL 5D1QD 4AJYV 2C9XA 4W9DC 2E9BA 2W9DL 1AHMA 2OSLB 2HJFA 4OLXH 3LTVA 1Y0LB 4YXKL 4M8VA 4LRIA 3B34A 4R90L 5AL8A 2OMYA 2MTPA 2F58H 4DN3L 2BY2A 5I15H 1F5WA 2GYSA 3ZZSA 4AVIA 2BRRL 3TCLA 4OKVB 1DUYA 4S2SA 4ZPVB 1UFUA 5SWZE 1NCJA 1WEJL 4HEPG 4C56A 4Y2DC 2Y7MA 1D9KA 5IMKB 4HLJA 1OL0A 4Q74A 1MWAA 3IXTB 3L1FA 3TA4D 2XU9A 3UPCA 3PGCB 5B39A 1RFDH 3GLAA 4UV4H 4DKFL 2P8MB 1RY7B 3DHJA 4KXDA 2NY3B 4LL1A 5DJYB 3BIKA 4AUJA 1P7KB 3IEAA 3N50A 4CC4C 1AHWC 1HYSC 2CUHA 4F2MB 1T03H 5JYMA 4PVBA 5HGAA 1KPVB 3WS3A 1IGCL 4FMFA 1I9RL 3BISA 3SODB 3MLRL 1T0MA 4FA8A 3BE1L 3C09B 4PLKD 5AB2A 4F7MB 3P54A 1E4WL 4X6DA 3O6LL 5DUPL 1B6DA 3KNBB 4ELME 1P1VA 2AJZA 1B4RA 1MHPL 5DMKA 4ZTEA 1X5YA 2QSVA 5GRWA 2GG1A 4PRNB 2RIKA 4P5TA 1KGUA 3NMEA 5EIIG 5I8CB 1UD4A 5AQ0A 2HXAA 5EORL 3HC0A 3WY2A 3TNMA 2DAVA 5JNYB 1P6AB 1HEZB 3QK0A 3S48A 2MKWA 4FFZA 4NQXA 2QVFB 1JZ7A 3S37H 2ITCA 3KS0J 2QL1A 1G7MA 4KMTL 1QTSA 4KNTA 3NQIA 1DR9A 4M62H 5LBVA 1M56B 4L4TB 4H0IA 5LGHL 5MHSD 3QUMB 3LOWA 3SE3A 3ZKMD 1MNNA 1DVXA 3F6IA 2N0KA 3CIAA 1VERA 4FTDA 1OGTB 5CN1A 3US9A 1BMWA 2DQEL 1R19A 4M5ZL 3RDJA 3UC0H 3NJXA 3MRPA 4YSDA 4NUJB 1P5VB 1W0YT 1OD9A 3QE5A 2VLKE 3EYQD 5DRWB 3SZKC 4HJ1A 4LSSL 5E08L 5DRNA 3FT0A 2VWEC 4P9HH 1AD9A 4RH4A 1F45A 3EDKA 1T7VA 3OKKA 1FSKB 1G4RA 3MLZL 3HC3L 2DQCL 4MRBA 3JV0A 4DHLA 1P7QD 3WN5B 4JM4H 1QW9A 4ELMF 1FGNH 3MJ7B 3MZGB 4ZZKA 1YYMH 1BDYA 1ACCA 3RPIB 4HZ1A 4Y9FA 3L5XL 5SWZB 3HBPA 2ZWLT 4P57B 1XF2A 3ZU8A 5HYSG 2ICWB 1C1EL 3C6SA 3CSYB 4M61B 3VFMA 4QT5A 5C0JA 3BFWA 1KBGH 4G9DB 5FM5O 4L3EE 3QWRD 3GEWB 1A3LL 1YYCA 4LVNB 3C2AL 3VCLB 1MNUH 4OM0H 1TJHL 3DUUB 3K0WA 4XRCA 1WWWX 2P7TA 2MQGA 1XF5A 5E8OA 3DX9A 3IFLL 3FHAA 3G5ZA 4I18C 1P1ZB 1R1CA 1B90A 1UZ6E 2NQ3A 2FJHB 3HIZA 5L4FA 2KZKA 2ZCZA 1O6TA 3FBKA 3ILEA 4XMLH 5TGBB 5A16A 4MXQC 4NRYB 5AVWB 4AIZB 4ES8A 4NKIL 4PB9H 1AQDA 4JKMA 5ILTL 5B7FA 4L1LA 2PPCA 5E5UB 4MQ7B 4A7TA 1P6FA 3MUJA 5I75C 2WJ7A 3QQDB 2IBBA 1EZVY 3WEXA 2O93L 4A2LA 3UYPB 3RY5A 3BVVA 4AWJC 3VD4A 4LGPB 3MXVH 5F7MC 3NCBB 5T5FA 3ZMRA 1N0XH 2R4RH 3RZCA 1CGVA 2WMPA 2X9XA 4N2KA 3T3MB 5B7MA 5IB5B 3R7QA 2FB4L 1FHGA 4I0PB 3NH7H 4XNXH 1SBSL 1PD6A 2HWZH 3QUZA 4ONHB 1I8MA 1Z9NA 1I1FA 3BW9B 3ULUE 2YPLE 3WIFB 3EBIA 1TJGH 1GHFH 3MOQA 1BZ7B 1FLRH 2VO5A 4RNRA 4APQA 3R0MA 2AP2A 1BQRA 3MTRA 1RVFL 4ANVA 1HSAA 3CVCA 2UWEE 1SHMA 1RCYA 3DTXA 3W0WA 5T8IA 1UG9A 3V0GA 5I5RA 1UD6A 3WNKA 3BZEB 1RL1A 4OZFH 1MDTA 5D71L 5B22A 3O6ML 3QJRB 4M48H 3JTBA 2F7QA 2FL5B 1OAJA 2A74A 2VLKB 4Y5XC 2AQ3A 4L2YA 3EJZC 3OG6B 1LQBC 3VWKA 3MOBL 4JN1L 3VH8A 4LSRL 2DM2A 3OGCB 5JXED 3QORA 4B9IA 3CXDH 3DBXA 3KEDA 4PRPA 1JHTB 2MQ3A 2Y23A 2Y2TA 3K46A 3O6FD 4QHNA 2PYEB 2K78A 5E6ZA 2YLHA 1G7QA 1UZ6F 4ZFGL 4HU8A 1WAAA 3WIIL 5DMIH 4IRJC 2J3SA 4U6YB 1Z32X 2FGWL 4GQ9H 4PD4J 1JNLH 2E9IA 2EQDA 2W8CA 4MJIB 2HN7B 4Q9BA 1LO0H 2NY1D 5KJ7E 4AYID 2CGRH 5DZNA 4C83A 3LKQB 1ETZA 5I1LB 4PBDA 4E0RA 3KJ6H 2IGTA 3P0VL 4GKOA 1IGJB 3BSZA 2PTTB 4FABH 1VADB 3S3DB 1UURA 4KZEH 5FK9B 3LN5B 3QRFM 4TUJA 3TBCA 4X6DE 5GGVH 5GGUA 1JI2A 5LNGA 5EU5A 4HPHA 1L9RA 3ULUF 2WVVA 1FFOB 1V55B 2HTKD 1G1YA 1UXWA 3P11L 4F8LA 4AGPA 4LLVB 4P5SA 1TJIH 3OKLA 4FKHA 1NWOA 1A4AA 2Y36L 2G9HA 2XI9A 4E9SA 1Z6JT 2UWEF 3D69B 3CZNA 4LEXL 2OV0A 4ENED 3FCTA 5AD0B 2FCBA 1KV7A 4HJ0C 4DQAA 3OLIA 1U8NA 1I1RA 5GZOC 4LFHD 2HH0H 2NY2B 3S5YA 2M8XA 3EZ8A 2EVGA 2ZSWB 4FQXB 1MCEA 1KIPB 2KLTA 5FFGA 4KRPC 4P5KA 4YHLL 2JB6A 1OK0A 3EF7A 5E5LA 1VEPA 3ELQA 1I1YB 1S7VA 1D6EB 3P9LA 1DQML 2DQUH 4Y89A 3PHQA 2NY3D 5I6LA 3ZIYA 4OU3A 2ZCKL 2J7LA 3U4AA 1E5BA 5IY5B 3SDCC 4GAGH 3Q2WA 4B9YA 4CA4A 4JN2A 3VB8A 4NKQB 2VT0A 2HVKB 2EIZB 1OP3H 3FC8A 5F0JB 1EEYB 1Q9WB 1WA1X 3P1VA 4J3OF 2UV3A 5ITBH 1A6ZB 4L48A 3PWVA 4PW4A 1QPXA 2BNUB 1I8IA 3MFGB 1T04B 1KY7A 1GXEA 1WBYB 2VDRH 4FL4C 1N5YH 3RDTD 1C12A 3JUYA 3KLQA 5LDSA 5E5MB 4QHLA 3P3TA 4RGNE 4EN3A 3RFRA 3TO4D 5CLWA 4X6DF 4OB5H 4NM8H 4X80H 2P8PB 5EU6E 4FKKA 1VGEH 4OLUH 3TGXA 3KCPA 4E9LA 3KCWA 4PJAA 2OJZL 1XMEB 1XO8A 5EIQA 2QQNL 4B50A 4F7EA 1FC2D 3L5JA 2VXVH 1EAPB 2WCGA 1OW0C 4OUOA 1TENA 1T89A 2HFTA 2YK1L 1ITBB 1IKNC 2XNAA 3UYRH 2IXQA 2X4PB 4IDLA 3DHPA 2YC1B 3C8DA 3STLB 1O6VA 3L6FA 5AW8B 1FN4A 1QEXA 5DWPA 4P5MA 3GNML 3HAEG 1F6LL 3GRWA 3S88H 2CJUH 2R59A 3B3IA 3TFBA 3RNKB 3NN8B 3SJVA 2WINB 2E76C 5HYEA 3DBSA 4GH7B 4QHKI 2NTSP 4MNQA 4UB0H 2X2UA 4QF1A 4ATTA 4KK9D 3SDAC 1T1ZB 1GGBL 5I17B 1JOIA 3UIYA 3VXNA 4PWEA 4YAQB 1NAMB 2WQSA 1BX2A 2XWJB 2FR4B 1OEZW 1D9KC 4WHTA 4OF3A 3RBSA 4X9FA 4LB8A 4L9LC 4C4KT 3H42H 8PAZA 5C08D 1S9YB 1A8JH 3V4VL 1MLCB 2IWEA 3I9IA 3A23A 3MRJB 4XX1E 4G8FB 1QFHA 2XRAL 1CF8L 2X0WA 4F20A 1E30A 1QX1A 1G7JA 2ZOLA 2YMXL 1BD2D 3GHPA 4P4RA 1KEGH 3EJSA 3CSTA 4S1QL 1V05A 3ECVA 5L7XL 2YBRB 3UTSD 1E2WA 5JORA 3MACH 2Q20A 2D3NA 2DWYA 2IH1B 1XGTA 1RJYB 1D5RA 1O5DT 2Y07H 3E6FB 1XAKA 5D93B 4JRWA 5DJCA 4YS4A 1PLCA 2XIBA 5I76B 3W0WE 2AXFA 3UJJH 3GBLA 3FO9A 4NKDB 4LCIH 1FO0B 1OTUC 3QIBD 4LHUB 4PJ9C 3TWCH 4RGMB 3I6LE 4HQQL 4XP6L 1E28A 5C0CD 5IFAH 4OD1L 1S9VB 2CJ3A 1F11A 1EJ6A 3LPPA 2CG9X 2OZNA 2NW3B 3BQUA 4WO4B 4AQEA 4KDTC 2WXKA 3KDPB 5EO1B 3OPZL 1RK0B 3O2DH 3JVGA 2W0FA 1OF0A 4A7VA 4PRPE 2HFEA 4B97A 1EHLH 2CMRL 1XSIA 3OPUA 5FECA 3BAWA 1WAAE 5JDSA 5EU6B 5IFHL 4WGVB 5ACMA 2WP3O 4QRPA 4Y4FB 3SE3C 4PGBB 1E8XA 2ZZUT 4TL4A 5FYJU 3KGUA 4I1PA 3S9DB 3Q6FA 3L7FA 5FM8A 4KX7A 3P0YL 1OPGH 1MH5B 1VLXA 1MCSA 1U4EA 3BLKA 4R7DB 5L8KB 3GSQB 1OGPA 1KV3A 3LQAC 5CFHA 3WTUA 2VLJB 1BOYA 1QZNA 1NFAA 1XR9B 1PDKB 2VISB 4X6CA 1MW2A 2ICEB 1YY8B 1CD8A 3ZE2B 2G2RB 3SY0A 4WI9A 2NW2B 4Y9CA 4GIPD 3RWIA 1YEGL 2HFGH 1ACXA 4RMRA 4QXTA 2G60L 1J8KA 4W6WB 1HI6A 4OFDA 5JIPA 2EDOA 4L8DA 1JK9A 3BMWA 3U79A 2BFGA 3DMMD 1NGWA 4U49A 2KQMA 1FH5H 5C3IA 5I8KH 4K07A 3LDBB 1CICD 4QYAA 1Z66A 2JIXB 4W4OA 4XCNA 4BWTA 4N26A 4A7QA 2A0LC 2RJMA 2J88H 3T0EA 4F8PA 4TSBH 5FKAB 5G2NA 1MI5B 1GPOH 5BO1H 2H1LM 1D5BB 1ORQB 5E6IA 2AERT 2J57A 4JZJA 4KDWA 2P5WA 1MHEB 4K3JH 1CLYL 3BH8A 4MS6A 2BP3A 1WAAF 5FUZH 2W59A 5KWYC 4K55A 3IDXH 2FLRT 4PGZA 4XVOA 2YWZA 2P42B 5GGTH 4ZMQA 2HRHA 3QQ3B 1KPRA 1VSCA 4G6ML 4HUWA 5AW0B 5I1IH 4FLQA 3GXMA 1CL7I 3DVGA 1ILUA 1J8HD 2IDQA 3AG3B 3MRIB 1PX4A 1FNLA 1BVNT 3LCYA 5TDPA 3Q1SL 1JPTL 5A6IA 1V3KA 3F83A 2QEJA 5TPWH 1QD0A 5CEYA 2VITA 4TOYH 3MX0A 1YN7B 3T1FB 1F4AA 1RJCA 3ZZQA 5BS0D 1OLLA 1ZLUK 5HD8D 2Z91A 2XV0A 3OSKA 1HL8A 1PL3A 3EYSH 2NY2D 4JRYB 1AS8A 4AY0A 1J9RA 3PJNA 2BINA 4FQXD 5IEKB 2VMFA 3HLAA 3SO3C 3JWNE 4JFXB 4ZAKA 4OF6A 1W72A 2E7HA 2H3NB 1T83C 1AANA 1F8TL 2YPVA 4U3XA 3BXNB 2P80A 3PAVA 4KO7A 4MDJA 1X5ZA 4POZC 1RZJH 1FL5B 4KAQH 1AQKH 3UAEA 1ZCRA 3LKOB 1E6JL 3H3KA 2F54A 3EUUA 3L3KA 3FCSA 5B21A 4N2OA 1S5IL 4TM9A 4BIKA 2VXSH 3OMIB 5TF1L 5IVXB 5IJCC 3VG0L 4MNQE 5EB9A 4XN7A 2A9CA 1KPUA 3DX0A 3P4OB 1EZVX 3QORC 1U8OB 2OL3L 4PCYA 3VM7A 2ZG2A 4X5QA 1X5GA 3KPLA 3SBWC 2R0KH 1XBRA 1JPSL 2A6KA 2ZOTA 1F56A 1NWPA 3FW6A 3WEBA 5IMOB 3U4KA 1ESOA 1DFBL 3WUWA 4DGYH 3ROOA 2Q7NA 2Z31A 4L4JA 4JEGB 5E2VH 3ZZLA 1LEKA 4PVLA 3FQNB 4G3YL 1CGWA 5F3HA 2EZ0D 4EIUA 3UP1A 4NN6C 5E6RB 2WO2B 4GSXA 3VXMA 3FTUA 2LT9A 4TQPA 3W5MA 2R69H 4D9QE 4HD9A 3RWFB 1BBDH 5B39G 4AENA 2GT9B 1UT2A 4J3OG 2R1YA 1DE4A 4CVXB 2BIMA 3FQRA 3MGAA 3QDHA 5FLUA 5CJQL 1S7WA 3WFEL 1A14L 2DQ6A 5KVGH 2GSGB 1BMGA 4JDEA 1FBIL 5ESAA 8CGTA 3N43F 3ULVE 1E9PB 1R24A 2E4TA 3PUCA 3TNNB 1NFIA 2NY5L 4FTVA 1H3UA 1GGCH 4PTUB 3DLQR 4GP5B 5D7KE 3FQTB 4A7GA 4GRWB 3DV6B 4HW6A 3KVDD 3F7YA 3SGKC 3L9EA 3OB8A 4JDTH 4OJDH 4YE0A 3MV9A 3GMQB 2XYCA 3AAZA 4M93B 4MD4A 5FWRA 4X83A 1XSOA 1NMBH 3QJVB 4QKTA 3D6GA 2W9DH 4PUBL 1QFWL 1CD1B 4YC2C 4G7VL 4YXKH 4YSQA 2WQAA 4R90H 4QRPE 2X4QB 3MRFB 4DN3H 1FAKT 4ADIA 3FHQA 3BI9X 3FCUB 4Q56A 2BRRH 4PJIA 3S98A 3TBWB 1WEJH 2ID5A 3CC1A 4K8RL 1Z9OA 4S1RL 4JFYB 4RX4A 1XH3B 2D7OA 4IEFB 5B38A 3N1MC 5ESQA 3KHOA 2FLBT 1YEDA 4WEEA 4DKFH 3S7GA 4MXVE 2XZAL 3W3BA 5F1OB 3TH4T 4HS3B 2H3XC 1IGCH 3ZPDA 1I7ZA 4X6CE 1I9RH 1MCHA 3RG1C 4AXWA 5EPMA 5J1AB 3MLRH 3RL1A 3BE1H 3NJGA 1JTTA 2FEJA 2CKNA 5K9KB 4AGNA 1HQRA 1N64L 1JWMB 5IVOA 1E4WH 4WUUD 5IW3A 2DBLL 5TDNB 2ED7A 3U0PA 3O6LH 5DUPH 5DSCB 5MEOA 1BWMA 4EKJA 3MREB 3BHBA 3T4AA 1MHPH 2ZG1A 4XMPL 4ZRGA 3S4SB 1SJVA 5C07B 3ULVF 1A9EA 1B9ZA 1M9WA 4XAKD 1FFTB 4ODVH 1OF2B 1KULA 4WV1A 5F97E 3ES6A 4Q6IA 1EANA 5DA4A 5EORH 5C70A 2X1OA 3OKOB 3EGSA 3QRGL 3ECWA 1T2XA 5DJ8B 1KUMA 3VQLA 5D2LE 2COVD 4P06A 3KBEA 3KH4A 2BWDA 4KMTH 4YHNA 1E0OB 2HJKA 3M1BB 3O3BB 3RVVD 4F58L 2BRQA 3VYPA 3QARA 5H2BA 2Y1VA 2K45A 2GHWB 5LGHH 1OGAD 4EEEA 5IK3B 3FUKA 1JHKL 3PQYB 4TQIA 2ZYIA 2ZKWA 3WYRA 3KYNA 2VLJD 1THAA 3V5KB 3B8SA 5CSBA 1HZLA 1BWWA 4UNUA 5GZND 2DQEH 1ROWA 3G7TA 4M5ZH 5ABAA 3UTPD 1T2QL 2A6IB 4U6XB 1FYTE 1AZBA 4GKZA 2MNWA 3BT0A 1I1AB 4BV1A 4LVHB 1C5DB 3EJPA 4MXVF 4XN9A 4LSSH 4N20A 4XMXA 1ETB1 5D5MB 5E08H 1EBAA 2NNAA 3O2DA 3T6WA 3J8F7 4X6CF 4M8QA 5EBLB 3L3OA 3ZQ9A 5JIMA 1J0ZA 4NCC1 3CJJA 2IBZX 3MLZH 3HC3H 3WE1A 2DQCH 4XX1G 1S7XB 2GI0A 3R8BB 2WLYA 3H54A 5C0ND 3L7EB 3VFTA 3TLRA 5EUOA 4NZTL 3PWPB 4PAZA 1KLUB 5BMFL 2EDKA 3L5XH 4JDZA 4PJ7A 3W57A 3UTZA 1U42A 5HI5C 4BRJA 3RY6A 4UT6L 5IR1B 1C1EH 4KVPA 4K7PL 3O41A 3QDJE 4PWFA 4WI2A 2GJ6A 3EUDA 3WFHB 4NHUB 5F7DB 3PWUA 5AWNL 4P9HC 4YO0B 4P46A 4NZFA 1A3LH 3BQUC 3C2AH 5D2LF 1MJ8L 1FF5A 4BUHA 1RHFA 1TJHH 5J06A 4P3DA 1E3FA 4HS6A 4HC1A 2C9SA 3UBXA 4U7MA 3ISWA 3F64A 3Q2VA 3FAXA 4PJFB 4E5XA 4NKIH 5IB3B 3AG1B 4X4ZA 4UU9A 5ILTH 3C8KB 4YXHL 2YWYA 2FO8A 3WV0A 1OAQL 3VA2C 3MGTA 2EKJA 2NZ1A 4GXFA 5AVZB 3T65A 2CPCA 4UZUA 1BG1A 4YHYB 4B3EA 4LCCB 4A63A 2GAZB 4ZD3L 3V0HA 2V3DA 3HZ3A 4HS8L 4BKLA 1WQVT 4ZW8A 1MHCA 3HHRB 5CAYB 1CT8A 2WXJA 4OVUA 4IOSD 4XCCL 5AENA 3RFZB 5D2LB 4ZUSB 2FB4H 3BUYB 4LLUB 4RWYL 1GGTA 2RFXA 1SBSH 3CK0L 3DOHA 1ZHBA 2EEXA 5TQ2L 1QLEB 2UUDK 5HY9B 2A9BA 3FTZA 4Z7VA 4PJCB 1G6RA 1E9OB 5GGTA 3B56A 2VZOA 3MRNA 2X0UA 4WTZA 5HGDB 3OMAB 2WTRB 2ZUSA 2AV1A 1RVFH 4P23A 1UYWL 2IAMB 3U2IA 2DLHA 3X12A 2G3NA 1MFVA 4PWHA 3WY4A 1ADWA 1MJJB 1R5WA 1B0WA 2P26A 2FDBP 2W94A 4NQCB 1Y1DA 5DO2C 5EZOL 5KANG 3SYAA 4ZS6C 5I1DB 1FYTB 5IJVA 5L4MA 4W4OC 3BGAA 1B0RA 5D71H 5DS8A 5IBTL 3O6MH 3N1PC 1MAML 2IWKA 3T0EC 5EZIL 3RWEA 5AOKA 2H7WA 4HHAB 2J4WH 4P9ML 4KZCA 1GOFA 3MOBH 4JN1H 5E6IC 4LSRH 4F3FA 2VM4A 4JZJC 3HKZA 4NQEE 4JO3L 2F9BT 2WOYA 4LLMA 4ZFGH 2YKKA 4PJIE 3X13A 4MHHG 3RGHA 5DGRA 3WIIH 2QQQA 5K9OB 5F1KC 1JZGA 2FGWH 4ZSOA 2MJWA 3M1OA 1CDIA 4NPJA 3GJFK 1NGPL 5CWSB 3H6AA 2PWHA 4O51A 3ZDZE 4PG2A 4IBVA 4MKMA 4TPRL 4WWKB 3KLKA 3QNXB 5CJXA 1E8YA 4X98A 3L2MA 1IC0A 3P0VH 3OZLA 3QDJB 1FNHA 3KHQA 2DMGA 4JMNA 4AT6A 4HWZA 3GIVA 12E8H 3LZRA 4A6YB 3ZR5A 4K7PY 1XEUA 4FRWA 4OZIB 4G9FA 5F7FA 1AGEB 4CADA 1DP0A 2R9HC 1X5FA 4WTWA 1KXQA 1NFDB 2GJJA 3C60C 1GR7A 3QQ4B 5TJWK 4QOKE 4UANA 2FRGP 3ZT5A 7TAAA 4R97C 3P11H 5I1GL 5GSVB 1P7BA 5K9JL 3WY3A 4TUOA 2JKLA 2Y7QB 3IXAA 3MUUA 2Y36H 5C0FB 4K3EL 2ZOKA 1TVHB 4LEXH 1DVSA 1KLGB 1CE1H 4A7GF 4PTTB 1LE5A 2IPTH 3OV6A 3TS8A 1QSZA 2R69A 4YWGL 3JWNG 1RIHL 3H55A 1OGSA 4YIQA 2H2PD 3CN1A 4YHLH 1TUPA 5JOPE 4IMKC 2ZXBA 2DIJA 3QUKA 5ERWB 3QG7L 3KPQA 2QR0B 4LK4A 1DQMH 5D1ZA 4CBPA 5GRUH 2Y6SC 3RVTC 5E4EC 1WC7A 2KI6A 4BFNA 4PJIF 3C2SA 4CVUA 3KPOB 1ZTXL 4HAKA 1JERA 4QRTB 4L5FL 2Z31C 1IAOA 3ZDZF 4U7SA 5LQBL 1KZQA 1N8ZB 4IU3B 3K4AA 4OLZL 3IJ8A 1X6LA 3P0GB 4IHOB 3O9WB 2QZQA 5IW6B 5EIVA 5I0VA 4B5ZA 3E2HB 1UB6B 3UGXA 3F85A 2WO3B 4POYA 4MNHB 3UAJD 1MHHB 4MB5A 2C4FT 2ESVE 4UNIA 1FNGB 5EUOE 2ZUWA 4KHXL 5IM7B 2OJZH 4NQEB 4F9LA 5C0EA 2QQNH 4PJ7E 4EI6B 4XCEA 1HE8A 4TULL 4NQDA 3GMMB 2JKWA 3CTTA 5CLXA 3P30L 1NCIA 2YK1H 2X41A 1EO5A 1DVFB 1XGUA 3CFKB 3PQYD 5A1AA 4M3JA 2HG5B 1KIUB 2NYKA 4M6ML 4MTMA 3GNMH 4MWFB 4PP1C 1ZSDA 1B4LA 2JH2A 2E5EA 4H44C 3HI5L 7FABL 1JF1A 1T1YA 5FYJL 5E7BA 5B4MC 3JYCA 1QG3A 3OF6D 4IKIA 2GEEA 4QOKB 4BFIA 1BZ9B 4UQ2B 4G7YL 3FTYA 3VFOB 4GO8A 2DTSA 2Q2LA 4X7TA 5E00A 2OQJB 5EF1A 1H3PL 4QRQB 2VR6A 3SOTA 4U2YA 1OTSC 1G9EA 4YFLI 2V37A 3V4VH 1MCKA 3ZSTA 4ZMXA 4XGZA 5JOFB 5I8EA 2XRAH 1ZLUH 1CF8H 5CGTA 3M86A 4KJWC 3T6QC 1NEZA 2YMXH 4UQ3B 4JJ5B 1PZBA 1XZWA 2A38A 3PWNA 4FADA 4S1QH 1EHXA 5L7XH 4A2MA 4Z7VE 2OMXA 1F90L 4FI7A 1NKGA 3LZLA 1LMIA 4YLBA 1T0NA 3FB7A 5EUOF 4L3CA 4Z7QE 4XBMA 3LRSB 1DVTA 2LU3A 1KB9K 4LSTL 4XVUC 3T4AC 4DOHE 3ZHNA 1ZA6B 4PJ7F 2CIKB 4P99A 2XVGA 4HCGA 1LK2B 3F7KA 4X6BB 3JYBA 4QIRA 4WV1C 1Z0NA 3U30C 4Q6IC 2BVQB 1PX3A 4XP6H 4HQQH 2ZX6A 3ZTJG 4EUPH 5K39B 4OD1H 2VZ1A 4I9XA 5EEWA 4UYQA 5BRPA 1K4DA 3DX4A 4XTRC 3OPZH 4FQ1L 4LOUC 3QFDB 3VSVA 1HHJA 2EDEA 1G7PB 5CEXA 3KWVA 2CMRH 1IQWL 2KC0A 4HGWB 1M2OA 3HZMA 4QYOA 1L9OA 5IFHH 2ESVB 4ZSOE 5EA0L 3TJEL 2OSXA 1NUGA 4I5BB 2EXTA 5ICXB 1VHPA 1OO2A 1O9ZA 1QLRB 3P4MA 1M05A 3ZXAC 4OGQC 3G04A 4ZTOL 3EDDA 4PRDA 3HN5A 3P0YH 2G4EA 2O6PA 4ODXB 4RETB 4EOWL 3BDYL 2CJTA 4U2ZA 4DN4L 1LGVA 3V4PL 2NMSA 5GRXG 2H0PA 4FYRA 4JZNB 4TTDD 2ZXWB 2Y7SA 1KXQE 1XGQB 3T04D 4M9PA 4N90E 3FSAA 4NC1E 3O3AB 3IU3A 2IMMA 4TLSA 2CO6A 4Z7VF 4S0TD 4D0DA 1NGXB 2VW7A 3C9NB 2D3LA 3REVA 5J6HB 2F7RA 5JW5B 2VC2B 1M6OB 1CFSA 4Z7QF 1UOKA 3GLEA 1KBBA 1QSFA 1AMYA 2G60H 2VW6A 4DERA 5IV2B 1W0VB 4D3CL 4Z1PA 1WT5A 4NNXB 2R2HA 5C09E 1S78D 2XPZA 5H94B 2QKIB 2UY7A 2BP0A 2WYHA 3BAKA 3NCEB 5IFJB 1EK3A 3X11B 1JK8B 1QAWA 2NSMA 4QDGA 4X6FA 4HG4J 4EMZA 3GFUA 4F8TA 4YNYA 5DYOA 4KXBA 1AP2B 5KVGE 4DP6X 2BSTA 4Y4KA 1DSFL 1CK0L 3APMA 1A3ZA 1VFUA 2I60L 3C5ZA 3VGBA 4PRIB 1T1XB 1VACB 4XOAA 1CLYH 2DQMA 1E4KC 1ECZA 1YDPB 2XPGB 5KSAB 4GRLA 2H32B 1QA9A 3C5SB 1Y18A 4L23A 4EF3A 1UH4A 4JZOA 4G6FB 1RZPA 4G6MH 2C1OB 2W9LA 1RZQA 4JREB 3RB7A 2VAJA 1H3WM 3AREA 3IAPA 2BSSB 3B5GA 2BZ7A 4WKXA 5DVKA 2CH8A 4NKOA 2YD2A 4DP4X 2PCPA 4GQRA 1MCLA 3Q1SH 1JPTH 4J6RL 5DFWH 1AZRA 3WUWG 3LNIA 3VJ6A 3OLGA 5DVPA 1E27B 4UBDD 4LKXA 3EHBC 3G5WA 3FB5B 1PYWA 4QAWA 4Y1TA 3IKKA 2R1XB 3U9UA 5BRZD 4YHPB 3V5DB 5FLVA 3MRGA 1UUNA 2E9GA 1HJBC 1TNMA 1WITA 2DBJA 2GBTA 2O30A 4K71B 5D2NB 1XT5A 4NQDE 3IS1X 4XPFL 4FG2A 1IEHA 2NXZB 1N5AA 5EU3A 1F8TH 4P23C 3BP5A 2ITDB 2R29L 4YDMA 1JZ6A 3FN9A 1JGEB 3DXAB 1M6UA 1X5JA 4TVPL 3H3BC 1E6JH 4ZNEE 4GOSA 4M02A 4E42A 2V3EA 1NCCL 1S5IH 1VEOA 1SVCP 4XB8A 4Y2OA 4GMTL 5GS2H 5TF1H 3D33A 4HK0B 1M3IA 1JIBA 4PGDA 3LRGA 3VG0H 1Y07A 3D07A 4FG0A 2F74A 3O2WL 5ENWB 2KZWA 3CZFB 3N55A 1LLAA 3MRLB 5ID1B 4AZ8B 2OL3H 2WY3B 4FHBD 5E9NA 4IKKA 4BFJA 1JPSH 3K6OA 4Y2DB 3U4EA 4AUUA 4LLYB 4ZBJA 1CUOA 5M94B 5CCJA 4LCUB 4A66A 4Z3JA 3QVAA 1U2HA 1DFBH 1RZJC 4WU5A 4ZO9A 1J5IA 5DZ9A 2P5ED 5C09B 5JQ6L 2OMUA 4ZUWA 4G3YH 4BQ6A 3EOAB 1AHWB 3PNRB 4MA1C 1OCCB 2C7UA 3JBG7 2CXKA 3TVMA 3K71A 4PRAA 3VXQB 3QPKA 4AX3A 3ARYA 1MLBB 3V6ZA 3IGLA 5B38G 5AVYB 2MMXA 4IKNA 3DETC 3K6DA 1IL1B 3IJYB 4KXZH 4D9RE 3GM8A 2RB8A 4G8IA 1TTGA 1AYRA 2AKRA 2XWCA 4FEMA 4O2FA 4S1DD 5CJQH 5GGSY 3WFEH 1A14H 4QR7A 2WZPA 4TQ8A 1FBIH 2F0CA 2Q3AA 1B0GB 3SD2A 4ZO7A 1BYNA 1F6FB 1FVDA 4ZNCD 2NY5H 2BS71 2V5RA 4OSUL 3OKMA 4QHMA 2CKBA 5DEGA 1BXXA 5E6YA 4F27A 4ETYA 3H8NA 1Q0EA 3V0FA 3TZVD 4LRNL 4BDVB 4IRSB 2J1YA 4FQQA 2V2XB 2VQUA 3VWJA 5DEZA 1FG2B 4Z7WB 3BLPX 4PUBH 2EJ1A 1QFWH 4Z3IA 5I28A 4G7VH 2FYVA 3SSGA 1UWEL 2YAPA 2YPKA 3K5SA 3T0XA 2Z8SA 3HG4A 2DS4A 3IJSA 2XVLA 1J88A 4MCMA 1RZGA 2G3ZA 5DVNA 4ZUTA 1OIOA 3BD4A 3BKJL 5BZWB 3ZKSD 4FI8A 4K7PX 4CU8A 1HQ4B 3IJHA 3FSZA 1CL7L 3ECQA 4K8RH 3S34L 4S1RH 5EN3A 4JVUA 2JJTC 1BIHA 4B9JA 2FIKA 3CFEA 1MAKA 1Q9KA 2ZKXA 1HHIB 1XZ0B 3EO0B 1BVKA 1U3NA 4K15A 2I24N 5INDB 2XZAH 3OD3A 3VI3E 2ATPA 4JPWL 2UUDH 5IQNA 5I66A 2H3KA 2PNDA 2YSTA 4JE0A 1WTLA 2R0ZL 4M7LL 2Z7YA 3I6SA 3VGDA 4IJ3C 1M7XA 3Q5YA 2ZUVA 2X4UA 3QEQB 4YSCA 4CGTA 1N64H 4G43A 5D7JC 3PNWB 3MRBA 2DBLH 2VDKB 2QZ5A 3LH2L 1QSFE 4XMPH 4JY6A 4F9LC 5D6CB 4ZK8A 1CD0A 1YQVL 4AGOA 1IBFA 1P4UA 4W93A 2YGOA 3V4VA 1XCQA 2AEIT 4U4BA 4XHQA 4KFMA 3QRGH 1QABA 5AVQB 2BSED 4ICWA 5LBSL 1IBZA 1EJ8A 2WCSA 4YL9A 1GZQB 3WL9B 1T20A 2COQA 3MU3A 1UEMA 3QI9A 1XIWD 4NX0A 2WWKO 4I18B 5LGJB 2I9TA 1DQJB 2D31B 4PLNC 3BCDA 1NGQH 2GSMB 3GJFH 2DLFL 15C8L 1F97A 3SGEH 3ZY7A 3PV6A 4JRXB 4XOCA 3DIDA 9CGTA 2XVBA 3C5XA 4K3DL 2EIJB 2V2TB 4BSWB 3O4LE 3UBXG 3DECA 5I75B 2KLSA 2ATKB 1T2QH 2YD6A 2CDGA 3RVUC 3SIKA 4ZODA 8FABB 1CIUA 1KGJA 4E5XG 5CD5D 1REIA 1ZEAL 3FT2A 1N59B 1Y7VA 1G7LA 2XSKA 3VI3F 2XWRA 1QSED 3SYPA 3M7OA 2MNJB 5JYLA 5F93C 2NUTA 5J7CC 1XF3A 2O6EA 4X7CC 3B5HA 4XNMA 2QBWA 2TSAA 4QWWC 4FFTA 2DQHL 1INDL 4J2XA 5FB8A 4NZTH 2HSIA 1WAEA 2FECI 2FWSA 3AXHA 5BMFH 1J1XL 3FFDB 1RZFL 3R06B 1MELA 2EDTA 2JJVA 4Y19A 4BGLA 3O3DA 4JQIL 4UT6H 1G9NL 1WFIA 5E5RB 4MCZA 4WTZG 3MV8A 2FSDA 1HS6A 2WWNA 3G9AB 3JWDL 1E6OL 2Y22A 4YPGA 3RWDA 5AWNH 1AH1A 4GI6A 4D0CB 2XKUA 2IJ0C 1MJ8H 2NY4C 4J23A 4E41A 4ISVA 4MJ6A 4UT9L 1ETJA 5FHBL 4P2OC 5DJ2B 2W80C 4AM0Q 1NDTA 2GIYA 2BC4A 2ZX5A 3IPFA 5CSZA 1KJ2B 3QXDA 1UADC 3L3IB 1CVSC 3MLSL 1EV2E 1FQ9C 4G8EB 4GKNA 1MRDL 2X53A 1OZTG 3L13A 4YXHH 3C6LD 4TN9A 4DZ8A 2B08A 5IKCA 1QWHA 3GBNL 1OAQH 4D8PA 2NUPA 5CLZA 1W0WA 2WQ8A 3CZGA 5TDOB 4ZD3H 1N0LA 3FSWA 3CQQA 1ZKAA 2QVKA 2B39A 3MKGA 2EDBA 4HS8H 2NXZD 4ODWA 4U1SA 1KCVL 1ZDSA 3P9MB 4ABVA 4JB9H 1U93B 3DX6A 2AJUL 3QDMD 5JZ7D 4RWYH 1NC2D 4DO6A 3CK0H 1JI1A 2X4TB 3KPSB 2X40A 3TT1H 2P45B 2QHRL 4N2HA 4BCYA 4LL4A 5TQ2H 4U3SB 3ASOB 3GUFA 3BP4A 4IBWA 3H1ZA 1CQYA 3RTQA 4QUOA 1L0YA 4M5YL 3FFCD 5MERA 2XVKA 2LFEA 1QFPA 3IMTA 3CHRA 3I02A 5FOBB 1UYWH 1A64A 1V7NL 1P9MA 4HMDA 5EUKB 2J55A 3W39B 3FTGB 1ZHLA 5EZOH 3VW3L 3MBWA 3HE6A 1U92A 2XETA 5IBTH 4KRPB 4U0RC 1MAMH 1R47A 5H35B 3ZRFC 3O45A 3ETTA 3AU1B 4QLRA 4O9HL 5EZIH 5I6XC 4BE5A 3Q13A 3CH1A 3Q8BA 4OZGB 4P9MH 4J8QA 3MRQB 4Y4KC 2B59A 4PJDA 4IOFC 4XWGL 3C5ZC 2J73A 2QGDA 2X6MA 3SDCB 3GSXA 4JO3H 1PKQE 4G70B 4LQ1A 4GRLC 5DK2A 4BHUA 4EIGB 5KBKA 4UMGA 1F86A 4IKJA 4IU2B 4OH2A 5HGGS 4FS0A 5ICZB 1JNHB 5E1AA 3QC6X 1NGPH 4UIMA 3AUVA 1HL4A 2UVFA 4N8CL 5FW6A 1R4XA 4HX1B 4TPRH 5HHOB 3AREC 4FL4B 3CVHL 5E4AA 4WCYL 1PZ2A 4CMMA 5JW4M 4M4RB 4O2CA 5C0BD 5A2LH 3T0DA 4JHZA 1O6SB 4G2AA 3DK0A 4ZW3A 1L9NA 1OAKL 4HJGA 4GSUA 2OZ4L 1XGRA 5FYLD 3MRCA 3VGAC 4LMQE 4V2CB 4TLKA 4F7TB 5T3ZD 5C0IA 5I1GH 3T9WA 1NBYB 1TTBA 2XYBA 1K3ZA 1NOLA 1Q94A 2H2SD 3NIFB 3O81A 3QJZA 4N22A 3QJXA 1F1GA 2CLZA 3G6DL 3I75A 1J5OH 4LAQL 1CMOA 4YLCA 4EDXB 4ECNA 1ZA3A 5ANHA 2IQ9L 1G0YR 4PN6A 1ODAA 1F00I 3DIFA 5MEQA 2WUBL 3ZYIA 4J5VA 4Y7MA 4YWGH 1EHKB 1CJYA 2CO1A 2EIBA 3NSYA 2BHYA 5FGBA 3ZMNA 3QG7H 1MZYA 3SDAB 5F3FA 1JZ4A 2D7QA 1T7YA 4AQ1C 3EGXA 1INQB 4PD4K 4XH2A 1KNOA 2XY2A 4KKCC 4QPEA 4URKA 5KEZA 2NLJA 1A1OB 1UVQB 3E8UL 4PRHA 5DQ9B 4C56B 1JWSB 1D9KB 1NBZA 1H9VA 4I2XA 4JO4H 4JFWA 4L9LB 1ZTXH 3EXJA 2A2QT 5DF0A 4L5FH 4N9GA 5CMAA 5LQBH 3HE7D 3ARDC 3H4FA 4XNBA 3QO0A 4OLZH 3UTTA 3FQ1A 2BVOB 3Q3GB 4DAGL 3ULSA 1KYFA 1HOEA 2MHAB 3EFFA 4MMXB 4HMCA 5JIQA 2AQNA 1OVZA 2E27L 4QGYA 4LLDB 3MNWA 3PGDB 2ZD0A 3NSDA 4UAHA 4U1MA 4U3CA 3FF8A 1L6PA 4DEWA 3T3PB 1DVUA 2AK4B 4P3CL 1U3ZA 3BEVA 4KHXH 5DMKB 1NEZG 5BUAA 5DHXB 1YY9C 3U7YL 5BUGA 1S46A 2L7JA 3PDOA 1GC1L 5DD0L 5DURD 5EU7E 3W11C 5IUSA 2D03L 2DLEA 4I3SL 4TULH 4NNYB 4PJ9B 3P30H 3IDMA 4HJEA 1FZKB 5A3ID 1NLBL 2BY1A 3L5WB 4RVBA 5DC9B 1DQTA 3A47A 1P69B 4P0DA 3ZL2A 2GBAA 1TKWA 2HUHA 2ADGA 4HGKC 4AQZA 4F15C 4NQXB 3AMLA 1RJLA 4M6MH 5CINL 2KPNA 4E41E 5HYJB 4Y5VA 3GXPA 5FKPB 1D3CA 5E6SB 4HXBL 2PW2A 3QUXA 5CBEB 4GSQA 3HI5H 3AS2A 3RIFK 3RGVA 1LDPL 1PTZA 7FABH 3NJMA 2DF3A 2OPCA 2A73A 1NCWL 2Y72A 4KTDL 5FYJH 1UA6L 2DKMA 2FK9A 4EI5B 4JR9H 4DP5X 4WI0B 4Y2NA 2I5YL 4G7YH 1A6VL 1PG7W 4WQOA 4DP2X 1KCUL 1H3PH 4HU2A 1D2PA 4U1KA 1WA2X 5ICYB 1IM9D 1BLNB 1JGUL 1VFMA 3LVTA 4JQXC 5J1TC 1WIUA 3IPEA 4KKBC 3HMWL 4AGLA 3BC9A 1AD9B 1X9LA 2YO3A 5FO9A 5I0ZA 2GCYA 2E7DA 4HOXA 1A4KA 3IVKB 5IMLB 2NCEA 4M1GL 5CEZD 5D70L 2XQYK 3FRUA 3N42F 5JIDA 4M1CC 3GUTB 2X05A 2ARJB 2Q10A 1TQSA 5KANI 4H40A 2DQGL 3INUH 1V27A 1F90H 5DD6A 4NB7A 1ORSB 3V6OA 5D1QC 2AANA 5ALBL 2VQ4A 1NIFA 4LSTH 4M6NL 4TMPA 4I0CC 3VGFA 5CM1A 3CDCA 4OZHA 3HLKA 2XN1A 4DP1X 1AZCA 3VFMB 1E5AA 3GJEB 5C0JB 3KXFB 1ND0A 4QCIB 4IRJD 2JWYA 1NPUA 4N3UA 3BZ4B 3ECBA 2QV4A 1L6ZA 2X09A 4NO0B 3DOSB 3GI8L 2HRPL 1VFOA 3NP3A 2XLLA 3DV4A 2Z3FA 1KGWA 1S9WA 2DIEA 4C58B 2D4DA 2B3IA 4M6OL 3E1F1 4FQ1H 1ZE3H 5EU4A 3AY2A 1X7QA 3V0VA 1HH9A 4ZW7A 4F24A 2DEYX 4G1MB 1IQWH 4PGCB 5AKRA 2XIIA 4JMXA 4U3HA 4FQCL 5GGRB 5EA0H 3TJEH 2OMVA 3ZVVA 3B9KA 3H0TA 1MWOA 4PLKC 3TBSA 1R9FA 2C9RA 4UQ2A 1TZHB 1CCZA 4Z7UE 2ZXDA 2C4FU 5ANMA 3R0NA 3KPSD 3NFPB 2RHEA 5D7LE 4ODUB 4ZTOH 1OPOA 3NSFA 3TIDB 1IAIM 3S35L 4X5XB 1TZAA 2R51A 2NSXA 4EOWH 5DU7A 3BDYH 4ZUVB 4ABWA 4L8CB 1YN6B 3IDIA 4XCYA 3A4EA 1MCQA 4X5WA 3V4PH 4DN4H 1KJ3L 2QQLL 3KL0A 3PWJB 3WNPA 4Z7OE 2NT0A 1J87A 1JZDC 1VFBA 2DWEA 3SPVA 1I8MB 4HJ0D 3HCVA 5H37A 3H4HA 1GSKA 3MBED 3OKEB 4W70A 3S3PA 3V6BR 3ZHLA 3MLYL 3WBDA 1KBWA 1TITA 2BNRB 1E65A 3SO3B 5E95B 4L3ED 5L4JA 2WVUA 1IE5A 1JS4A 3PXJA 4YHIB 5L8JB 1H9DA 5F6IC 4F57L 4KU1A 3GSNB 3BDBA 2BSBA 4R26L 4IGBD 3L9BA 3U2SA 1V7ML 5IUCA 1U36A 3QEGL 4PY8J 3LMJL 3LH8A 4XPHL 3L5IA 2FAUA 4NO5A 5IIEB 1TQCC 1G7IB 4ANUA 5LAXA 2YR3A 4YSAA 5HYIA 1DDHB 1PNDA 4H88L 1I9IL 1MFDL 3AXLA 4G8AC 5TF0A 3VH8B 4MJHA 1KXVA 1PCSA 3ZDYE 3VI4E 3D0LA 1DSFH 1CK0H 2NX5D 5F7WC 1KZYA 3IKCB 4NUQA 3CFUA 2I60H 3AM8A 1UM4L 4TVUA 2KERA 4PRHE 2O6DA 5KYUB 1K8DA 4I2XE 1JL8A 1CFNB 2ZX8A 2AHIA 5IB4B 4CBZA 4YDJA 3WXVL 4Z7UF 4LBEA 1KTJA 4PJ5B 5DMYA 2LTQC 3NDZE 2V8MA 3UTTE 4NN6B 1AFVL 2CRIA 1ODUA 2JK5A 3T5WA 5GS1A 1RZIA 4GUCA 4EN2A 5C0AA 4NQSA 5JLZB 3QYCA 2Y0SA 2CHNA 1WH0A 4HKXB 4MX7B 5F7BA 4Z7OF 1JAEA 1U2CA 2XACC 4J6IA 2J5LC 1YEIL 5F7UA 1X6NA 1CIDA 3C87A 4XAWL 3PAUA 1UJTA 5E8DL 1T5XA 2J8OA 5PAZA 3D3VB 2XFGB 1ZT4B 3BMVA 4B53A 3LPWA 4XPFH 2E3VA 4NZDA 1MG2C 2TSBA 3QT2A 5DJ6A 1WGOA 1WYJA 1KJMB 2R29H 3PL6A 4FG6D 1P9MC 4OCMC 3VXSE 2DYPA 2Q8AL 5HTSA 4TVPH 3LEXB 3HE6C 2EIEA 1ZLVK 3RWJB 4C56D 3IGFA 1D9KD 3TYGL 1FZOA 4P5KB 1NCCH 3B2XA 1OHZA 3L3DB 4XXDA 5IQLA 5D6DA 3FB6B 3A6CL 2Q86A 4GMTH 4O2EB 5EV7A 4YC2B 1M7DB 1R34A 4J3OD 2PCYA 1GIGL 1CBJA 3QG6B 4Z95L 3ZDYF 4PWJA 4LNVA 3VI4F 2IH3B 1GS7A 3FQXA 3O2WH 5AYTA 4CKVX 4G7QB 1K5NA 4UZSA 4JG1L 1XF1A 1Q4NX 5AL0A 1SHSA 3V9CA 3OJDA 1FZJA 3FQYA 3QJSB 1H19A 3K1DA 3S2CA 1GZPB 4BK5A 4DJMA 3L1OL 4H7VA 5JQ6H 2G4GA 4D2NA 4KI5C 5HGHB 4ORZC 4X8CA 4K5OA 5GPRA 1G1OA 5DEFA 3IAGC 4BH7A 4P5TD 1G1CA 2FSEA 5F9JA 2EVIA 1FI8C 3UTOA 1OTUD 3HZKA 5KS9B 43CAB 3CDFA 3W9EB 5DDHA 1WK0A 2AQRA 5J8OA 2BCKB 1KB5L 1KTDB 5DRXA 3VI4B 1T22A 3EGDA 5DEJA 1WZ1L 5HHPB 3WMQA 3AADB 5I1HL 3QIWA 2H9GB 2QTEA 3V6OE 2X9WA 3B2VL 3RP1A 3Q7JA 3EO1A 5I6OA 3KS0H 4OZHE 3WJLA 5HYJD 5JXEC 2K3TA 3S96B 1AGBA 3FN3A 5T1LA 1EZSA 4F91B 4QRRA 4ZXBA 4OSUH 2W07B 1FN4B 5T3ZL 4BCZA 1BLIA 2VDNL 4BSJA 4BZYA 1UZ8A 4JFUA 3GGWA 3SPHA 1AKJA 1RHHA 2PETA 4FKEA 3WUZA 4MVBC 4LRNH 4W4NA 2YOCA 3OSVA 4MCNA 3BRFA 1JXJA 6PCYA 4P2RA 5ES4B 2RQ8A 1YEFL 5EC1A 2V6HA 4O02A 1UWEH 1VEMA 3UPRB 3JZYA 1WIPA 5DS1A 3NA4A 1ASQA 4PJBA 4BQCA 4PV9B 4DKTA 5ANME 3VFNA 3BKJH 1EQWA 1U8IA 1EPFA 3EJUA 2NY5C 1P5UA 2EDFA 4XWOD 5DI8B 4RGND 3S34H 1KIQB 1RJZA 4XMWA 1IJNA 4NKMA 2HTKC 2YJLA 5IHLB 1X7SA 2CO7A 3OXRA 3B8YA 4MA7L 1IM3B 3BPLC 4XP5L 1L3WA 5GS0D 3DO7B 4JPWH 1A1MB 3UZEA 2IANE 2X2IA 1HT6A 3LV3B 3MAWA 4KJYB 2R0ZH 4M7LH 2I07B 4KZDL 3SKOB 4GQZA 1MIEL 3MRKB 1FRGL 4U1IB 2YQ3A 4HMEA 1LE9A 2X6BA 1NIEA 3WNNA 3MJ8A 5I16B 2DWTA 1E5YA 2VO8A 3LH2H 3UAAA 5EZLB 4UDTB 1MF2L 1QVOB 2DMCA 4OZHF 5KG9A 1BBJB 3I2CL 3WNIA 4MCYA 1KCWA 1IEBB 1YQVH 2ZT9C 1I8LC 2XG5A 5AB9A 5KVEL 3DSNB 1J9QA 4E9QA 5LBSH 2PXYA 3IRPX 1WFNA 5J6GA 2K4WA 1E2ZA 4H1LH 3LKRB 3NQKA 1ZGLB 4GS7C 5ALCL 4MD0B 1E7UA 3S36L 5FECB 1BF8A 4DCQB 3RGVC 5LLIC 2DLFH 4JFOA 4LKCA 3RZCD 3RDTC 1E8ZA 4OV5B 3TO4C 3QUZD 4K3DH 3ZL4L 2J44A 4N0CD 4X7SH 3HI1A 2WIIB 3OXSA 1YG9A 4I8DA 5EMYA 5C0AE 2Z0BA 1UH2A 2IFFH 4H2CA 4ZFZB 1KN2L 1ZEAH 5FGCE 4XCFL 1TZIB 3AQYA 4POZD 3NYKA 4V33A 1E4XL 1OSZB 3W0WD 1Q9OA 2GK0A 2VR9A 3V5HA 2EO7A 4EZKA 1BSIA 4PRBA 3V8OA 1JHLL 2B20A 3MRDB 5L9DL 3I6LD 5B1CA 1PZ5B 4HIXL 4QXTB 3ZR6A 3DROA 4AE0A 2ORBL 4ODTL 3HG1B 2DQHH 3VWKD 1INDH 3GSWA 1I7TA 2X28A 5B1JC 2MRYA 4XMUA 1OZUA 3QORD 2ED6A 2YZ8A 1J1XH 4PRPD 3SDDA 4OF0A 1RZFH 3VXUA 1JPEA 5FV1L 2AJ3B 5DTFB 3BGMA 2O4EA 3TH3T 1HXYB 4JQIH 1G9NH 3PAZA 2IPKA 2XTJE 3BAIA 3QFJB 1MAJA 4XO9A 2Q6WB 5KBLA 3V4PA 4PJ8A 3E6HB 3T0EB 1E6OH 4Y16A 4Z3EA 2A83B 4L29B 4XNQB 4ZFQA 3U36A 2V5TA 5DJ0A 5E6IB 4DK3A 4G42A 2HX7A 2IANB 3ME0A 5AW1B 1UT9A 1U8MA 4NSKA 5LHDA 4UT9H 2BVPA 5KYNA 5FHBH 5EZPA 5IOPA 2VDPL 2PLTA 3B2MA 2OX5A 3VG9C 3QEHA 3MLSH 1MRDH 4BFRA 3DVGB 4OZFB 2DI8A 4CRPA 3GBNH 4JBSA 1AQMA 4ZQKB 4GKSA 2C9QA 1DTUA 4JM2A 5E8EA 5K9JH 1P2CB 3ISYA 1X3DA 4J3SA 5K1JA 3TCXA 3B2DC 3IK2A 3FOMB 4Z3TA 3BP6B 3QZWG 1KCVH 3EYUL 5AB0A 4LEOA 3DYMA 3FT4A 2AJUH 3QIBC 4PMEA 1T3FA 4ONGL 4WJ5B 3OKDA 3VD0A 2APFA 3C60B 3GMLA 1MJ7L 4KO6A 1EAQA 3OC5A 2QHRH 2OSYA 2CNZA 4LASL 2VABB 4J3BA 4XMTA 5BV7L 3CWGA 1IBHA 1HESA 1ZHNB 1A65A 1IE4A 1O7DE 3FB8A 4JQVC 1U3HA 4M5YH 3SO5A 5KBPA 2QELA 4QRRE 1AKPA 3QAQA 2YD5A 4F1SA 5JA8B 4NN5B 3TBBA 2EYTB 1V7NH 2ZKHL 1A6PA 1UB5A 1M53A 4N0FA 4DVBB 3B9VA 3L4VA 3IGUA 2V3FA 1BM3L 2LAGB 4HIQA 3VW3H 2A6DB 3DX3A 3L54A 3U9WA 3DI3B 1R3LB 1IKOP 2BH0A 1CE6A 3CHXA 4JHAL 4X5RA 5J9PB 2NNXA 4O9HH 5L2KB 4RIRA 4P2RE 4LCWA 1GS8A 2WN3A 3QDGB 2HLFC 4EDWL 1KXVC 3WKYA 5DD3L 5BUPA 4KRLB 4HIEA 4UM8B 4XNYL 1ZVSA 4XWGH 5E4EB 3AM8C 4PJBE 5JQIB 3LKPB 4KGLA 4FXGC 5ABDE 3KYMB 2PTUA 2J1KA 3MLXL 4EN3D 2R29A 5AVUB 3UDWC 5JW4N 3TIEA 5M7QA 2BLFA 3CC5B 4MMYA 1MJUL 1ZAGA 2C3WA 3CFNA 4N8CH 4FLRA 5MEOB 3JTSB 3H9SE 2HJLB 5LCVL 3CVHH 3ZRCC 4WCYH 5GS1C 2B1AL 3BUDA 3WGVB 1KGIA 3QH3B 3DMMC 3FT3A 3FBQA 4ZYKB 3FQRB 1CICC 3ULUL 2BW5A 1OAKH 3IMBA 2DZEA 2OZ4H 4KK8C 2QPSA 1ONQA 1TYRA 3KL5A 4AEFA 2E9JA 5ISZE 3SJVD 3ETSA 5LXGL 3NEXA 2KKQA 3LXCA 5FA3B 3VNZA 1A6TB 3LYRA 3G6DH 2HAZA 4MNQD 1SYSB 4R0LC 4LAQH 5JO5B 5C0RL 4LHJB 2VDRB 2JVUA 2IQ9H 4K9EL 5FUCE 5CN2A 3MODL 4NHCL 4I3GA 2FZ3A 2D7PA 2WUBH 1NZRA 4YVNA 3LB6C 1NGYA 1MCWW 2V2WA 3TA3A 4GUPB 3UBXI 2KYIA 3GTTA 2VDQL 2BP8B 2JI2A 2DM4A 4MAUL 1IAKA 2E86A 4HZAA 5T3XE 2A6JB 2YJQA 5DMGC 2G75B 2Q7AA 1XR8B 3H7BB 4PJBF 3VTTA 4AYSA 3HPLB 3LZFL 5DZPA 3E8UH 3AGWA 4D9QD 5KN5A 4AYFB 1J9TA 3NJIA 2G5BA 5B8CA 1PIGA 1SJHA 2N0MA 1FFPA 2P24A 3MYZA 5DD1L 3VXOA 1DBAL 4PJGB 1XXFC 1QQDA 1EFXB 1YEDB 3KR3L 1VFAA 1M57B 1EHAA 3VD7A 2A77L 5IB2B 4UTCA 2YKLL 4DAGH 4OZ4A 4DNLA 1WSST 5E8PA 4QY8A 2ROYA 2E27H 5HI5D 5EPMB 4PP2B 4BBWA 4LP4A 3AW5A 3F12B 3GDBA 1LWJA 2H26A 5E7FA 4CILA 3U0PB 1DANT 4JHVA 4NRXB 5JHDE 3ZKND 2OXGB 5AAPA 2BSDA 4P3CH 4UQBA 3BQUD 5MENA 3MROB 4A2GA 3U7YH 2R1WA 2HVJA 1GC1H 2XWBB 1H3TA 3ARFA 3FU7A 4P4KA 5DD0H 4NO2B 4WV1B 2D03H 1EDQA 4I3SH 3VXUE 5IZ7A 4FFWD 1QOKA 3QQXA 4QTHA 5EWIL 4OIIL 3VFUB 1NLBH 5I30L 1SLXA 4QRPD 4JFPA 2YXVA 3MV7E 3H9SB 4HVBA 4HH9B 3QR0A 3CZKA 3KWWB 5CINH 3FQUA 3FU0A 4MLIA 2VXUL 1YYLL 1BXVA 2VQTA 2FUQA 1EZUA 4AL8L 1BECA 4MMZA 1IIKA 4HXBH 4XXWC 4BCXA 4L8BA 2X2HA 1SUJA 3MXWL 1CXHA 1LDPH 1WRFA 3H2QA 5I23A 2W65A 1NCWH 4LE8A 4KTDH 3WNLA 1WGVA 1UA6H 3CCHB 4EVNA 1DEDA 3QQ9D 5A6LA 1U6AL 2O61B 2K4AA 1PZAA 3UBGA 3SYCA 2I5YH 1TEFA 2GSIA 2EDJA 3IGAA 3K3QA 1A6VH 1UXSB 1KCUH 1YEJL 2PP9A 2WUCL 1X4XA 3HI6L 1DLHA 4DH2A 1A7BA 1JGUH 1GKOA 1KXTB 2XFXB 3A24A 2VLRB 3TJHD 5AUMB 3HMWH 2NQDA 2PWFA 1ROCA 1B3JA 4M8QB 4L0YA 3UZEC 1BYPA 4WJG3 1TTUA 2ADIB 2JKNA 4M1GH 3FU8A 2E74C 5E0QA 1ML0A 1NBQA 5D70H 5DQJA