1ON3A

Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound)
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
517
structure length
517
Chain Sequence
KLASTMEGRVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNNTEEASFVNPNNDVSPNTELRDIVPIDGKKGYDVRDVIAKIVDWGDYLEVKAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMCNRDLGADAVYAWPSAEIAVMGAEGAANVIFRKEIKAADDPDAMRAEKIEEYQNAFNTPYVAAARGQVDDVIDPADTRRKIASALEMYATKRQTRPAKKHGNFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methylmalonyl-CoA carboxyltransferase 12S subunit
publication title Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core
pubmed doi rcsb
source organism Propionibacterium freudenreichii
molecule tags Transferase
total genus 196
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A01
3PE8A 4JCRA 4QIIA 2VREA 2F6IA 4Z0MA 4ZU2A 3SWXA 1WZ8A 2PBPA 3T8AA 4JCQA 3DORA 3M6MA 3PEAA 4JOTA 1FC9A 5MGBA 3ZWBA 4I42A 1X0UA 1UYRA 5DU4A 1XX4A 4U0HA 5FUSA 2Q34A 3GLMA 2BZRA 2PG8A 2C8TA 2VSSE 3TZ3A 3HRXA 2FW2A 2J5GA 5G1QA 3L3SA 2FBMA 4U0GH 2ZL2A 4FN7A 2J5II 1XNVA 4OG1A 3MT6A 4JWVA 3TV5A 3GF7A 2X58A 4FN8A 5DU6A 1O8UA 4OMRA 3FF6A 2NP9A 3U9TB 4ZDEA 3TT6A 3T89A 5KDRB 4WZ8B 3IBBA 1OD2A 4KWBA 5JBWA 4FB8A 3Q1TA 4K2NA 4Q1IA 3ZWCA 1HNUA 3WG5A 5JBXA 4ELXA 2F9IB 2ZQRA 3U9SB 3LKEA 1PIXA 3KTKA 3Q0JA 2VSSA 5INGA 4FZWC 5DUFA 2DUBA 1NZYB 3BPPA 1EF9A 4L6WA 3M6NA 3KTGA 3T3WA 1JXZA 3T88A 5KJPA 4ZDBA 4RYFA 4IZBA 5IKLB 4U0GA 1EF8A 4OLQA 2VX2A 3KTIA 4JJTA 3RSIA 4G2RA 3HLN1 4QFEA 3H0UA 1HZDA 3P2LA 3MOYA 3TRRA 4B3IA 1HNOA 4KD6A 3R9QA 5G1RA 2W3PA 1UIYA 1OD4A 4U1AA 4U19A 5FIFA 2DEOA 3KQFA 2F9YB 4B3JA 4WCZA 4EMPA 4JYJA 3ST9A 1UYVA 3GMAA 3QKAA 5DUCA 1RJNA 2J5SA 2Q35A 3Q0GA 3H0QA 5INIA 5CTCA 1MJ3A 4FZWA 3TVUA 3R9SA 3KTJA 4B3HA 2IEXA 4JYLA 1N6FA 4ZDDA 3R6HA 5KDRA 3JU1A 5INFA 2A81A 2GTRA 1YG8A 3V5EA 4NNQA 2A7SA 2F9IA 1Q51A 2CBYA 3TVWA 1XNYA 2A7KA 4MOUA 3HE2A 3T8BA 5CTBA 5DU8A 3ZW9A 1NZYA 4MXIA 2ZL3A 1N6DA 3PGQA 3ZWAA 4ZDCA 4YLHA 2VSSF 4WYOB 3ZW8A 4I4ZA 3RSTA 3OT6A 3R0OA 2ZL0A 4JFCA 1RJMA 3IB9A 3OMEA 4F47A 3U9RB 1VRGA 3GF3A 3SLLA 3TLFA 5E0NX 3G64A 3QK8A 1YG6A 3I47A 3N6RB 3TDCA 1EY3A 4FNDA 2D3TA 3IAVA 3DJAA 1XNWA 3QYRA 4QIJA 4HNKA 3R9TA 2FZSA 4ELSA 3HINA 4JCSA 4HC8A 1FCFA 2J5IB 1UYTA 1K32A 2ZQQA 3P5MA 5E0SH 1N6EA 4L8KA 2F9YA 4KNPA 3BEZA 3QMJA 1PJHA 2ZL4A 1SZOA 2VSUC 4RCNA 3H02A 2QQ3A 1XO6A 5C90A 1DUBA 4IZDA 4K29A 4K3WA 1WDKA 3P85A 4NEKA 3QXZA 5G1SA 1TG6A 2WTBA 2PPYA 1W2XA 3MYBA 4LK5A 4JCTA 1ON9A 1K39A 3H0SA 2VSUE 4U18A 3VIVA 1SG4A 3NJBA 3MFMA 4ZDFA 4RYFH 3H0JA 3LAOA 4GM2A 2X24A 3QREA 4FJWD 5DKPA 1Q52A 5DZKH 4DI1A 1WDMA 2UZFA 3V5IA 3QWDA 3GKBA 4Q0GA 4GHNA 1FC7A 4I52A 4ASIA 5E0SA 3FDUA 3TT7A 5DL1A 4JVTA 2EJ5A 3QXIA 4MI2A 1TYFA 3OC7A 4IZCA 1WDLA 1DCIA 1UYSA 4ELWA 4FNBA 2F6QA 5DTWA 3HP0A 1Y7OA 4EMMA 3K8XA 4KPKA 3ISAA 2HW5A 3H81A 3PZKA 3STAA 2Q2XA 2VSUA 3RRVA 2VSUF 4EMLA 1J7XA 3BF0A 5DTPA 5C9GA 3NJDA 1ON3A 4JSBA 2J5GD 1FC6A 2J5IA 3KTHA 3Q7HA 2CE3A 5DZKA 3K50A
chains in the Genus database with same CATH superfamily
3PE8A 4JCRA 4QIIA 2VREA 2F6IA 4Z0MA 4ZU2A 3SWXA 1WZ8A 2PBPA 3BPTA 3T8AA 4JCQA 3DORA 3M6MA 3PEAA 4JOTA 1FC9A 5MGBA 3ZWBA 4I42A 1X0UA 1UYRA 5DU4A 1XX4A 4U0HA 5FUSA 2Q34A 3GLMA 2BZRA 2PG8A 2C8TA 2VSSE 3TZ3A 3HRXA 2FW2A 2J5GA 5G1QA 3L3SA 2FBMA 4U0GH 2ZL2A 4FN7A 2J5II 1XNVA 4OG1A 3MT6A 4JWVA 3TV5A 3GF7A 2X58A 4FN8A 5DU6A 1O8UA 4OMRA 3FF6A 2NP9A 3U9TB 4ZDEA 3TT6A 3T89A 5KDRB 4WZ8B 3IBBA 1OD2A 4KWBA 5JBWA 4FB8A 3Q1TA 4K2NA 4Q1IA 3ZWCA 1HNUA 3WG5A 5JBXA 4ELXA 2F9IB 2ZQRA 3U9SB 3LKEA 1PIXA 3KTKA 3Q0JA 2VSSA 5INGA 4FZWC 5DUFA 2DUBA 1NZYB 3BPPA 1EF9A 4L6WA 3M6NA 4NARA 3KTGA 3T3WA 1JXZA 3T88A 5KJPA 4ZDBA 4RYFA 4IZBA 5IKLB 4U0GA 1EF8A 4OLQA 2VX2A 5HUQA 3KTIA 4JJTA 3RSIA 4G2RA 3HLN1 4QFEA 3H0UA 1HZDA 3P2LA 3MOYA 3TRRA 4B3IA 1HNOA 4KD6A 3R9QA 5G1RA 2W3PA 1UIYA 1OD4A 4U1AA 4U19A 5FIFA 2DEOA 3KQFA 2F9YB 4B3JA 4WCZA 4EMPA 4JYJA 3ST9A 1UYVA 3GMAA 3QKAA 5DUCA 1RJNA 2J5SA 2Q35A 3Q0GA 3H0QA 5INIA 5CTCA 1MJ3A 4FZWA 3TVUA 3R9SA 3KTJA 4B3HA 2IEXA 4JYLA 1N6FA 4ZDDA 3R6HA 5KDRA 3JU1A 5INFA 2A81A 2GTRA 1YG8A 3V5EA 4NNQA 2A7SA 2F9IA 1Q51A 2CBYA 3TVWA 1XNYA 2A7KA 4MOUA 3HE2A 3T8BA 5CTBA 5DU8A 3ZW9A 1NZYA 4MXIA 2ZL3A 4HDTA 1N6DA 3PGQA 3ZWAA 4ZDCA 4YLHA 2VSSF 4WYOB 3ZW8A 4I4ZA 3RSTA 3OT6A 3R0OA 2ZL0A 4JFCA 1RJMA 3IB9A 3OMEA 4F47A 3U9RB 1VRGA 3GF3A 3SLLA 3TLFA 5E0NX 3G64A 3QK8A 1YG6A 3I47A 3N6RB 3TDCA 1EY3A 4FNDA 2D3TA 3IAVA 3DJAA 1XNWA 3QYRA 4QIJA 4HNKA 3R9TA 2FZSA 4ELSA 3HINA 4JCSA 4HC8A 1FCFA 2J5IB 1UYTA 1K32A 2ZQQA 3P5MA 5E0SH 1N6EA 4L8KA 2F9YA 4KNPA 3BEZA 3QMJA 1PJHA 2ZL4A 1SZOA 2VSUC 4RCNA 3H02A 2QQ3A 1XO6A 5C90A 1DUBA 4IZDA 4K29A 4K3WA 1WDKA 3P85A 4NEKA 3QXZA 5G1SA 1TG6A 2WTBA 2PPYA 1W2XA 3MYBA 4LK5A 4JCTA 1ON9A 1K39A 3H0SA 2VSUE 4U18A 3VIVA 1SG4A 3NJBA 3MFMA 4ZDFA 4RYFH 3H0JA 3LAOA 4GM2A 2X24A 3QREA 4FJWD 5DKPA 1Q52A 5DZKH 4DI1A 1WDMA 2UZFA 3V5IA 3QWDA 3GKBA 4Q0GA 4GHNA 1FC7A 4I52A 4ASIA 5E0SA 3FDUA 3TT7A 5DL1A 4JVTA 2EJ5A 3QXIA 4MI2A 1TYFA 2YJGA 3OC7A 4IZCA 1WDLA 1DCIA 1UYSA 4ELWA 4FNBA 2F6QA 5DTWA 3HP0A 1Y7OA 4EMMA 3K8XA 4KPKA 3ISAA 2HW5A 3H81A 3PZKA 3STAA 2Q2XA 2VSUA 3RRVA 2VSUF 4EMLA 1J7XA 3BF0A 5DTPA 5C9GA 3NJDA 1ON3A 4JSBA 2J5GD 1FC6A 2J5IA 3KTHA 3Q7HA 2CE3A 5DZKA 3K50A 4J2UA
chains in the Genus database with same CATH topology
3PE8A 4JCRA 4QIIA 2VREA 2F6IA 4Z0MA 4ZU2A 3SWXA 1WZ8A 2PBPA 3BPTA 3T8AA 4JCQA 3DORA 3M6MA 3PEAA 4JOTA 1FC9A 5MGBA 3ZWBA 4I42A 1X0UA 1UYRA 5DU4A 1XX4A 4U0HA 5FUSA 2Q34A 3GLMA 2BZRA 2PG8A 2C8TA 2VSSE 3TZ3A 3HRXA 2FW2A 2J5GA 5G1QA 3L3SA 2FBMA 4U0GH 2ZL2A 4FN7A 2J5II 1XNVA 4OG1A 3MT6A 4JWVA 3TV5A 3GF7A 2X58A 4FN8A 5DU6A 1O8UA 4OMRA 3FF6A 2NP9A 3U9TB 4ZDEA 3TT6A 3T89A 5KDRB 4WZ8B 3IBBA 1OD2A 4KWBA 5JBWA 4FB8A 3Q1TA 4K2NA 4Q1IA 3ZWCA 1HNUA 3WG5A 5JBXA 4ELXA 2F9IB 2ZQRA 3U9SB 3LKEA 1PIXA 3KTKA 3Q0JA 2VSSA 5INGA 4FZWC 5DUFA 2DUBA 1NZYB 3BPPA 1EF9A 4L6WA 3M6NA 4NARA 3KTGA 3T3WA 1JXZA 3T88A 5KJPA 4ZDBA 4RYFA 4IZBA 5IKLB 4U0GA 1EF8A 4OLQA 2VX2A 5HUQA 3KTIA 4JJTA 3RSIA 4G2RA 3HLN1 4QFEA 3H0UA 1HZDA 3P2LA 3MOYA 3TRRA 4B3IA 1HNOA 4KD6A 3R9QA 5G1RA 2W3PA 1UIYA 1OD4A 4U1AA 4U19A 5FIFA 2DEOA 3KQFA 2F9YB 4B3JA 4WCZA 4EMPA 4JYJA 3ST9A 1UYVA 3GMAA 3QKAA 5DUCA 1RJNA 2J5SA 2Q35A 3Q0GA 3H0QA 5INIA 5CTCA 1MJ3A 4FZWA 3TVUA 3R9SA 3KTJA 4B3HA 2IEXA 4JYLA 1N6FA 4ZDDA 3R6HA 5KDRA 3JU1A 5INFA 2A81A 2GTRA 1YG8A 3V5EA 4NNQA 2A7SA 2F9IA 1Q51A 2CBYA 3TVWA 1XNYA 2A7KA 4MOUA 3HE2A 3T8BA 5CTBA 5DU8A 3ZW9A 1NZYA 4MXIA 2ZL3A 4HDTA 1N6DA 3PGQA 3ZWAA 4ZDCA 4YLHA 2VSSF 4WYOB 3ZW8A 4I4ZA 3RSTA 3OT6A 3R0OA 2ZL0A 4JFCA 1RJMA 3IB9A 3OMEA 4F47A 3U9RB 1VRGA 3GF3A 3SLLA 3TLFA 5E0NX 3G64A 3QK8A 1YG6A 3I47A 3N6RB 3TDCA 1EY3A 4FNDA 2D3TA 3IAVA 3DJAA 1XNWA 3QYRA 4QIJA 4HNKA 3R9TA 2FZSA 4ELSA 3HINA 4JCSA 4HC8A 1FCFA 2J5IB 1UYTA 1K32A 2ZQQA 3P5MA 5E0SH 1N6EA 4L8KA 2F9YA 4KNPA 3BEZA 3QMJA 1PJHA 2ZL4A 1SZOA 2VSUC 4RCNA 3H02A 2QQ3A 1XO6A 5C90A 1DUBA 4IZDA 4K29A 4K3WA 1WDKA 3P85A 4NEKA 3QXZA 5G1SA 1TG6A 2WTBA 2PPYA 1W2XA 3MYBA 4LK5A 4JCTA 1ON9A 1K39A 3H0SA 2VSUE 4U18A 3VIVA 1SG4A 3NJBA 3MFMA 4ZDFA 4RYFH 3H0JA 3LAOA 4GM2A 2X24A 3QREA 4FJWD 5DKPA 1Q52A 5DZKH 4DI1A 1WDMA 2UZFA 3V5IA 3QWDA 3GKBA 4Q0GA 4GHNA 1FC7A 4I52A 4ASIA 5E0SA 3FDUA 3TT7A 5DL1A 4JVTA 2EJ5A 3QXIA 4MI2A 1TYFA 2YJGA 3OC7A 4IZCA 1WDLA 1DCIA 1UYSA 4ELWA 4FNBA 2F6QA 5DTWA 3HP0A 1Y7OA 4EMMA 3K8XA 4KPKA 3ISAA 2HW5A 3H81A 3PZKA 3STAA 2Q2XA 2VSUA 3RRVA 2VSUF 4EMLA 1J7XA 3BF0A 5DTPA 5C9GA 3NJDA 1ON3A 4JSBA 2J5GD 1FC6A 2J5IA 3KTHA 3Q7HA 2CE3A 5DZKA 3K50A 4J2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PE8 A;  4JCR A;  4QII A;  2VRE A;  2F6I A;  4Z0M A;  4ZU2 A;  3SWX A;  1WZ8 A;  2PBP A;  3T8A A;  4JCQ A;  3DOR A;  3M6M A;  3PEA A;  4JOT A;  1FC9 A;  5MGB A;  3ZWB A;  4I42 A;  1X0U A;  1UYR A;  5DU4 A;  1XX4 A;  4U0H A;  5FUS A;  2Q34 A;  3GLM A;  2BZR A;  2PG8 A;  2C8T A;  2VSS E;  3TZ3 A;  3HRX A;  2FW2 A;  2J5G A;  5G1Q A;  3L3S A;  2FBM A;  4U0G H;  2ZL2 A;  4FN7 A;  2J5I I;  1XNV A;  4OG1 A;  3MT6 A;  4JWV A;  3TV5 A;  3GF7 A;  2X58 A;  4FN8 A;  5DU6 A;  1O8U A;  4OMR A;  3FF6 A;  2NP9 A;  3U9T B;  4ZDE A;  3TT6 A;  3T89 A;  5KDR B;  4WZ8 B;  3IBB A;  1OD2 A;  4KWB A;  5JBW A;  4FB8 A;  3Q1T A;  4K2N A;  4Q1I A;  3ZWC A;  1HNU A;  3WG5 A;  5JBX A;  4ELX A;  2F9I B;  2ZQR A;  3U9S B;  3LKE A;  1PIX A;  3KTK A;  3Q0J A;  2VSS A;  5ING A;  4FZW C;  5DUF A;  2DUB A;  1NZY B;  3BPP A;  1EF9 A;  4L6W A;  3M6N A;  3KTG A;  3T3W A;  1JXZ A;  3T88 A;  5KJP A;  4ZDB A;  4RYF A;  4IZB A;  5IKL B;  4U0G A;  1EF8 A;  4OLQ A;  2VX2 A;  3KTI A;  4JJT A;  3RSI A;  4G2R A;  3HLN 1;  4QFE A;  3H0U A;  1HZD A;  3P2L A;  3MOY A;  3TRR A;  4B3I A;  1HNO A;  4KD6 A;  3R9Q A;  5G1R A;  2W3P A;  1UIY A;  1OD4 A;  4U1A A;  4U19 A;  5FIF A;  2DEO A;  3KQF A;  2F9Y B;  4B3J A;  4WCZ A;  4EMP A;  4JYJ A;  3ST9 A;  1UYV A;  3GMA A;  3QKA A;  5DUC A;  1RJN A;  2J5S A;  2Q35 A;  3Q0G A;  3H0Q A;  5INI A;  5CTC A;  1MJ3 A;  4FZW A;  3TVU A;  3R9S A;  3KTJ A;  4B3H A;  2IEX A;  4JYL A;  1N6F A;  4ZDD A;  3R6H A;  5KDR A;  3JU1 A;  5INF A;  2A81 A;  2GTR A;  1YG8 A;  3V5E A;  4NNQ A;  2A7S A;  2F9I A;  1Q51 A;  2CBY A;  3TVW A;  1XNY A;  2A7K A;  4MOU A;  3HE2 A;  3T8B A;  5CTB A;  5DU8 A;  3ZW9 A;  1NZY A;  4MXI A;  2ZL3 A;  1N6D A;  3PGQ A;  3ZWA A;  4ZDC A;  4YLH A;  2VSS F;  4WYO B;  3ZW8 A;  4I4Z A;  3RST A;  3OT6 A;  3R0O A;  2ZL0 A;  4JFC A;  1RJM A;  3IB9 A;  3OME A;  4F47 A;  3U9R B;  1VRG A;  3GF3 A;  3SLL A;  3TLF A;  5E0N X;  3G64 A;  3QK8 A;  1YG6 A;  3I47 A;  3N6R B;  3TDC A;  1EY3 A;  4FND A;  2D3T A;  3IAV A;  3DJA A;  1XNW A;  3QYR A;  4QIJ A;  4HNK A;  3R9T A;  2FZS A;  4ELS A;  3HIN A;  4JCS A;  4HC8 A;  1FCF A;  2J5I B;  1UYT A;  1K32 A;  2ZQQ A;  3P5M A;  5E0S H;  1N6E A;  4L8K A;  2F9Y A;  4KNP A;  3BEZ A;  3QMJ A;  1PJH A;  2ZL4 A;  1SZO A;  2VSU C;  4RCN A;  3H02 A;  2QQ3 A;  1XO6 A;  5C90 A;  1DUB A;  4IZD A;  4K29 A;  4K3W A;  1WDK A;  3P85 A;  4NEK A;  3QXZ A;  5G1S A;  1TG6 A;  2WTB A;  2PPY A;  1W2X A;  3MYB A;  4LK5 A;  4JCT A;  1ON9 A;  1K39 A;  3H0S A;  2VSU E;  4U18 A;  3VIV A;  1SG4 A;  3NJB A;  3MFM A;  4ZDF A;  4RYF H;  3H0J A;  3LAO A;  4GM2 A;  2X24 A;  3QRE A;  4FJW D;  5DKP A;  1Q52 A;  5DZK H;  4DI1 A;  1WDM A;  2UZF A;  3V5I A;  3QWD A;  3GKB A;  4Q0G A;  4GHN A;  1FC7 A;  4I52 A;  4ASI A;  5E0S A;  3FDU A;  3TT7 A;  5DL1 A;  4JVT A;  2EJ5 A;  3QXI A;  4MI2 A;  1TYF A;  3OC7 A;  4IZC A;  1WDL A;  1DCI A;  1UYS A;  4ELW A;  4FNB A;  2F6Q A;  5DTW A;  3HP0 A;  1Y7O A;  4EMM A;  3K8X A;  4KPK A;  3ISA A;  2HW5 A;  3H81 A;  3PZK A;  3STA A;  2Q2X A;  2VSU A;  3RRV A;  2VSU F;  4EML A;  1J7X A;  3BF0 A;  5DTP A;  5C9G A;  3NJD A;  1ON3 A;  4JSB A;  2J5G D;  1FC6 A;  2J5I A;  3KTH A;  3Q7H A;  2CE3 A;  5DZK A;  3K50 A; 
#chains in the Genus database with same CATH topology
 3PE8 A;  4JCR A;  4QII A;  2VRE A;  2F6I A;  4Z0M A;  4ZU2 A;  3SWX A;  1WZ8 A;  2PBP A;  3BPT A;  3T8A A;  4JCQ A;  3DOR A;  3M6M A;  3PEA A;  4JOT A;  1FC9 A;  5MGB A;  3ZWB A;  4I42 A;  1X0U A;  1UYR A;  5DU4 A;  1XX4 A;  4U0H A;  5FUS A;  2Q34 A;  3GLM A;  2BZR A;  2PG8 A;  2C8T A;  2VSS E;  3TZ3 A;  3HRX A;  2FW2 A;  2J5G A;  5G1Q A;  3L3S A;  2FBM A;  4U0G H;  2ZL2 A;  4FN7 A;  2J5I I;  1XNV A;  4OG1 A;  3MT6 A;  4JWV A;  3TV5 A;  3GF7 A;  2X58 A;  4FN8 A;  5DU6 A;  1O8U A;  4OMR A;  3FF6 A;  2NP9 A;  3U9T B;  4ZDE A;  3TT6 A;  3T89 A;  5KDR B;  4WZ8 B;  3IBB A;  1OD2 A;  4KWB A;  5JBW A;  4FB8 A;  3Q1T A;  4K2N A;  4Q1I A;  3ZWC A;  1HNU A;  3WG5 A;  5JBX A;  4ELX A;  2F9I B;  2ZQR A;  3U9S B;  3LKE A;  1PIX A;  3KTK A;  3Q0J A;  2VSS A;  5ING A;  4FZW C;  5DUF A;  2DUB A;  1NZY B;  3BPP A;  1EF9 A;  4L6W A;  3M6N A;  4NAR A;  3KTG A;  3T3W A;  1JXZ A;  3T88 A;  5KJP A;  4ZDB A;  4RYF A;  4IZB A;  5IKL B;  4U0G A;  1EF8 A;  4OLQ A;  2VX2 A;  5HUQ A;  3KTI A;  4JJT A;  3RSI A;  4G2R A;  3HLN 1;  4QFE A;  3H0U A;  1HZD A;  3P2L A;  3MOY A;  3TRR A;  4B3I A;  1HNO A;  4KD6 A;  3R9Q A;  5G1R A;  2W3P A;  1UIY A;  1OD4 A;  4U1A A;  4U19 A;  5FIF A;  2DEO A;  3KQF A;  2F9Y B;  4B3J A;  4WCZ A;  4EMP A;  4JYJ A;  3ST9 A;  1UYV A;  3GMA A;  3QKA A;  5DUC A;  1RJN A;  2J5S A;  2Q35 A;  3Q0G A;  3H0Q A;  5INI A;  5CTC A;  1MJ3 A;  4FZW A;  3TVU A;  3R9S A;  3KTJ A;  4B3H A;  2IEX A;  4JYL A;  1N6F A;  4ZDD A;  3R6H A;  5KDR A;  3JU1 A;  5INF A;  2A81 A;  2GTR A;  1YG8 A;  3V5E A;  4NNQ A;  2A7S A;  2F9I A;  1Q51 A;  2CBY A;  3TVW A;  1XNY A;  2A7K A;  4MOU A;  3HE2 A;  3T8B A;  5CTB A;  5DU8 A;  3ZW9 A;  1NZY A;  4MXI A;  2ZL3 A;  4HDT A;  1N6D A;  3PGQ A;  3ZWA A;  4ZDC A;  4YLH A;  2VSS F;  4WYO B;  3ZW8 A;  4I4Z A;  3RST A;  3OT6 A;  3R0O A;  2ZL0 A;  4JFC A;  1RJM A;  3IB9 A;  3OME A;  4F47 A;  3U9R B;  1VRG A;  3GF3 A;  3SLL A;  3TLF A;  5E0N X;  3G64 A;  3QK8 A;  1YG6 A;  3I47 A;  3N6R B;  3TDC A;  1EY3 A;  4FND A;  2D3T A;  3IAV A;  3DJA A;  1XNW A;  3QYR A;  4QIJ A;  4HNK A;  3R9T A;  2FZS A;  4ELS A;  3HIN A;  4JCS A;  4HC8 A;  1FCF A;  2J5I B;  1UYT A;  1K32 A;  2ZQQ A;  3P5M A;  5E0S H;  1N6E A;  4L8K A;  2F9Y A;  4KNP A;  3BEZ A;  3QMJ A;  1PJH A;  2ZL4 A;  1SZO A;  2VSU C;  4RCN A;  3H02 A;  2QQ3 A;  1XO6 A;  5C90 A;  1DUB A;  4IZD A;  4K29 A;  4K3W A;  1WDK A;  3P85 A;  4NEK A;  3QXZ A;  5G1S A;  1TG6 A;  2WTB A;  2PPY A;  1W2X A;  3MYB A;  4LK5 A;  4JCT A;  1ON9 A;  1K39 A;  3H0S A;  2VSU E;  4U18 A;  3VIV A;  1SG4 A;  3NJB A;  3MFM A;  4ZDF A;  4RYF H;  3H0J A;  3LAO A;  4GM2 A;  2X24 A;  3QRE A;  4FJW D;  5DKP A;  1Q52 A;  5DZK H;  4DI1 A;  1WDM A;  2UZF A;  3V5I A;  3QWD A;  3GKB A;  4Q0G A;  4GHN A;  1FC7 A;  4I52 A;  4ASI A;  5E0S A;  3FDU A;  3TT7 A;  5DL1 A;  4JVT A;  2EJ5 A;  3QXI A;  4MI2 A;  1TYF A;  2YJG A;  3OC7 A;  4IZC A;  1WDL A;  1DCI A;  1UYS A;  4ELW A;  4FNB A;  2F6Q A;  5DTW A;  3HP0 A;  1Y7O A;  4EMM A;  3K8X A;  4KPK A;  3ISA A;  2HW5 A;  3H81 A;  3PZK A;  3STA A;  2Q2X A;  2VSU A;  3RRV A;  2VSU F;  4EML A;  1J7X A;  3BF0 A;  5DTP A;  5C9G A;  3NJD A;  1ON3 A;  4JSB A;  2J5G D;  1FC6 A;  2J5I A;  3KTH A;  3Q7H A;  2CE3 A;  5DZK A;  3K50 A;  4J2U A; 
#chains in the Genus database with same CATH homology
 3PE8 A;  4JCR A;  4QII A;  2VRE A;  2F6I A;  4Z0M A;  4ZU2 A;  3SWX A;  1WZ8 A;  2PBP A;  3BPT A;  3T8A A;  4JCQ A;  3DOR A;  3M6M A;  3PEA A;  4JOT A;  1FC9 A;  5MGB A;  3ZWB A;  4I42 A;  1X0U A;  1UYR A;  5DU4 A;  1XX4 A;  4U0H A;  5FUS A;  2Q34 A;  3GLM A;  2BZR A;  2PG8 A;  2C8T A;  2VSS E;  3TZ3 A;  3HRX A;  2FW2 A;  2J5G A;  5G1Q A;  3L3S A;  2FBM A;  4U0G H;  2ZL2 A;  4FN7 A;  2J5I I;  1XNV A;  4OG1 A;  3MT6 A;  4JWV A;  3TV5 A;  3GF7 A;  2X58 A;  4FN8 A;  5DU6 A;  1O8U A;  4OMR A;  3FF6 A;  2NP9 A;  3U9T B;  4ZDE A;  3TT6 A;  3T89 A;  5KDR B;  4WZ8 B;  3IBB A;  1OD2 A;  4KWB A;  5JBW A;  4FB8 A;  3Q1T A;  4K2N A;  4Q1I A;  3ZWC A;  1HNU A;  3WG5 A;  5JBX A;  4ELX A;  2F9I B;  2ZQR A;  3U9S B;  3LKE A;  1PIX A;  3KTK A;  3Q0J A;  2VSS A;  5ING A;  4FZW C;  5DUF A;  2DUB A;  1NZY B;  3BPP A;  1EF9 A;  4L6W A;  3M6N A;  4NAR A;  3KTG A;  3T3W A;  1JXZ A;  3T88 A;  5KJP A;  4ZDB A;  4RYF A;  4IZB A;  5IKL B;  4U0G A;  1EF8 A;  4OLQ A;  2VX2 A;  5HUQ A;  3KTI A;  4JJT A;  3RSI A;  4G2R A;  3HLN 1;  4QFE A;  3H0U A;  1HZD A;  3P2L A;  3MOY A;  3TRR A;  4B3I A;  1HNO A;  4KD6 A;  3R9Q A;  5G1R A;  2W3P A;  1UIY A;  1OD4 A;  4U1A A;  4U19 A;  5FIF A;  2DEO A;  3KQF A;  2F9Y B;  4B3J A;  4WCZ A;  4EMP A;  4JYJ A;  3ST9 A;  1UYV A;  3GMA A;  3QKA A;  5DUC A;  1RJN A;  2J5S A;  2Q35 A;  3Q0G A;  3H0Q A;  5INI A;  5CTC A;  1MJ3 A;  4FZW A;  3TVU A;  3R9S A;  3KTJ A;  4B3H A;  2IEX A;  4JYL A;  1N6F A;  4ZDD A;  3R6H A;  5KDR A;  3JU1 A;  5INF A;  2A81 A;  2GTR A;  1YG8 A;  3V5E A;  4NNQ A;  2A7S A;  2F9I A;  1Q51 A;  2CBY A;  3TVW A;  1XNY A;  2A7K A;  4MOU A;  3HE2 A;  3T8B A;  5CTB A;  5DU8 A;  3ZW9 A;  1NZY A;  4MXI A;  2ZL3 A;  4HDT A;  1N6D A;  3PGQ A;  3ZWA A;  4ZDC A;  4YLH A;  2VSS F;  4WYO B;  3ZW8 A;  4I4Z A;  3RST A;  3OT6 A;  3R0O A;  2ZL0 A;  4JFC A;  1RJM A;  3IB9 A;  3OME A;  4F47 A;  3U9R B;  1VRG A;  3GF3 A;  3SLL A;  3TLF A;  5E0N X;  3G64 A;  3QK8 A;  1YG6 A;  3I47 A;  3N6R B;  3TDC A;  1EY3 A;  4FND A;  2D3T A;  3IAV A;  3DJA A;  1XNW A;  3QYR A;  4QIJ A;  4HNK A;  3R9T A;  2FZS A;  4ELS A;  3HIN A;  4JCS A;  4HC8 A;  1FCF A;  2J5I B;  1UYT A;  1K32 A;  2ZQQ A;  3P5M A;  5E0S H;  1N6E A;  4L8K A;  2F9Y A;  4KNP A;  3BEZ A;  3QMJ A;  1PJH A;  2ZL4 A;  1SZO A;  2VSU C;  4RCN A;  3H02 A;  2QQ3 A;  1XO6 A;  5C90 A;  1DUB A;  4IZD A;  4K29 A;  4K3W A;  1WDK A;  3P85 A;  4NEK A;  3QXZ A;  5G1S A;  1TG6 A;  2WTB A;  2PPY A;  1W2X A;  3MYB A;  4LK5 A;  4JCT A;  1ON9 A;  1K39 A;  3H0S A;  2VSU E;  4U18 A;  3VIV A;  1SG4 A;  3NJB A;  3MFM A;  4ZDF A;  4RYF H;  3H0J A;  3LAO A;  4GM2 A;  2X24 A;  3QRE A;  4FJW D;  5DKP A;  1Q52 A;  5DZK H;  4DI1 A;  1WDM A;  2UZF A;  3V5I A;  3QWD A;  3GKB A;  4Q0G A;  4GHN A;  1FC7 A;  4I52 A;  4ASI A;  5E0S A;  3FDU A;  3TT7 A;  5DL1 A;  4JVT A;  2EJ5 A;  3QXI A;  4MI2 A;  1TYF A;  2YJG A;  3OC7 A;  4IZC A;  1WDL A;  1DCI A;  1UYS A;  4ELW A;  4FNB A;  2F6Q A;  5DTW A;  3HP0 A;  1Y7O A;  4EMM A;  3K8X A;  4KPK A;  3ISA A;  2HW5 A;  3H81 A;  3PZK A;  3STA A;  2Q2X A;  2VSU A;  3RRV A;  2VSU F;  4EML A;  1J7X A;  3BF0 A;  5DTP A;  5C9G A;  3NJD A;  1ON3 A;  4JSB A;  2J5G D;  1FC6 A;  2J5I A;  3KTH A;  3Q7H A;  2CE3 A;  5DZK A;  3K50 A;  4J2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...