1ON3A

Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound)
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
517
structure length
517
Chain Sequence
b'KLASTMEGRVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNNTEEASFVNPNNDVSPNTELRDIVPIDGKKGYDVRDVIAKIVDWGDYLEVKAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMCNRDLGADAVYAWPSAEIAVMGAEGAANVIFRKEIKAADDPDAMRAEKIEEYQNAFNTPYVAAARGQVDDVIDPADTRRKIASALEMYATKRQTRPAKKHGNFPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methylmalonyl-CoA carboxyltransferase 12S subunit
publication title Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core
pubmed doi rcsb
source organism Propionibacterium freudenreichii
molecule tags Transferase
total genus 196
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A01
3M6NA 4K3WA 2VSUE 3TV5A 4NEKA 3STAA 3WG5A 1N6EA 4JYJA 4JCRA 3H0JA 3TT7A 3KQFA 4QFEA 5DTWA 3GF7A 1DCIA 1NZYB 5KJPA 3U9TB 4ASIA 1PIXA 4KWBA 1FC9A 2VSUA 3H0UA 3TT6A 2VSSF 5G1RA 2F9IB 1OD4A 4MXIA 2PBPA 4FNBA 1EY3A 3KTGA 4JCQA 3OT6A 4B3IA 1TG6A 1FC6A 4ELSA 1WDKA 4Q0GA 3T89A 3LAOA 2J5IB 4EMMA 2GTRA 3QMJA 3T8AA 4OMRA 4ZDFA 3I47A 3BF0A 3QKAA 3NJDA 3GF3A 5INGA 2W3PA 4EMPA 4K29A 4IZCA 4EMLA 3L3SA 2FW2A 3KTIA 3PEAA 4FNDA 4I4ZA 3HINA 3QREA 1FCFA 2PG8A 4FZWA 1W2XA 4ZDDA 4Z0MA 3R6HA 5E0NX 3Q7HA 3HLN1 2J5GD 1YG8A 1XNYA 4JVTA 4ELXA 2ZQQA 1TYFA 4I52A 4KD6A 3GLMA 2VSUC 3HRXA 3PGQA 3ZWBA 4JYLA 4ELWA 3T8BA 3BEZA 4RCNA 3ISAA 3SLLA 1RJMA 3M6MA 4Q1IA 1XNVA 4F47A 1O8UA 4JWVA 4NNQA 2A7SA 2ZL4A 3IAVA 3Q0JA 1Q52A 3G64A 4L8KA 1DUBA 3N6RB 3TDCA 3FF6A 5DU8A 2VREA 5JBWA 3R9TA 5E0SA 1OD2A 2F9YA 2F6IA 1UYTA 2Q2XA 4U19A 4GM2A 4IZBA 3ZWCA 1Q51A 1UIYA 3H0SA 3MOYA 1Y7OA 5DKPA 4FB8A 1WDLA 2FBMA 2Q35A 5DUFA 3ST9A 2VSUF 3OMEA 1SG4A 1XNWA 4FJWD 2A81A 2PPYA 3IBBA 4JOTA 3RRVA 4FZWC 4JFCA 4WCZA 3U9RB 3P85A 5INIA 3H81A 5C90A 4HNKA 5E0SH 3R9QA 5JBXA 1RJNA 2CBYA 1K32A 3QYRA 5DZKA 3DORA 3HP0A 4WZ8B 4LK5A 5KDRB 2J5GA 1NZYA 1HNOA 1X0UA 1FC7A 2F9IA 1JXZA 1EF8A 3R9SA 3MT6A 5FUSA 5IKLB 1PJHA 5C9GA 1K39A 3FDUA 3NJBA 3HE2A 4ZU2A 5DUCA 3ZW8A 3TZ3A 3RSTA 4FN7A 2QQ3A 4HC8A 3KTJA 2X58A 4FN8A 4ZDEA 3U9SB 2VSSE 1VRGA 2J5IA 3Q1TA 4QIIA 3H0QA 2VX2A 3KTHA 3TVUA 2J5SA 4L6WA 2CE3A 5DZKH 1UYVA 2D3TA 3GMAA 4B3HA 5DTPA 4B3JA 1MJ3A 3MFMA 5DU4A 3IB9A 3V5IA 4U0GA 1WDMA 2ZL2A 3ZW9A 4IZDA 1N6DA 3QXZA 3Q0GA 3QWDA 2Q34A 2ZL3A 2WTBA 3PE8A 4ZDCA 4U0HA 4WYOB 2IEXA 1J7XA 4KPKA 1ON3A 1EF9A 2A7KA 1XO6A 4QIJA 4RYFH 5INFA 4KNPA 1N6FA 5DL1A 3T3WA 1HNUA 1SZOA 4U0GH 4I42A 2HW5A 4U18A 4MOUA 3GKBA 3T88A 3V5EA 3QK8A 3PZKA 4G2RA 4ZDBA 3R0OA 3SWXA 3JU1A 4JCSA 2ZQRA 5MGBA 5FIFA 3P5MA 4DI1A 1ON9A 2DUBA 3P2LA 5CTCA 3K8XA 2ZL0A 2FZSA 4GHNA 5G1SA 3BPPA 5DU6A 4JCTA 5G1QA 2EJ5A 4K2NA 2UZFA 1UYRA 2DEOA 3MYBA 4JJTA 1YG6A 4JSBA 2C8TA 1UYSA 4U1AA 3RSIA 2F9YB 3TRRA 3OC7A 3TLFA 1HZDA 4OG1A 2X24A 4YLHA 5CTBA 2F6QA 4RYFA 3TVWA 3DJAA 3K50A 4OLQA 1WZ8A 3QXIA 3VIVA 1XX4A 3H02A 3KTKA 3LKEA 2BZRA 2VSSA 2J5II 2NP9A 4MI2A 3ZWAA 5KDRA
chains in the Genus database with same CATH superfamily
3M6NA 4K3WA 2VSUE 3TV5A 4NEKA 3STAA 3WG5A 1N6EA 4JYJA 4JCRA 3H0JA 3TT7A 3KQFA 4QFEA 5HUQA 5DTWA 3GF7A 1DCIA 1NZYB 5KJPA 3U9TB 4ASIA 1PIXA 4KWBA 1FC9A 2VSUA 3H0UA 3TT6A 2VSSF 5G1RA 2F9IB 1OD4A 4MXIA 2PBPA 4FNBA 1EY3A 3KTGA 4JCQA 3OT6A 4B3IA 1TG6A 1FC6A 4ELSA 1WDKA 4Q0GA 3T89A 3LAOA 2J5IB 4EMMA 2GTRA 3QMJA 3T8AA 4OMRA 4ZDFA 3I47A 3BF0A 3QKAA 3NJDA 3GF3A 5INGA 2W3PA 4EMPA 4K29A 4IZCA 4EMLA 3L3SA 2FW2A 3KTIA 3PEAA 4FNDA 4I4ZA 3HINA 3QREA 1FCFA 2PG8A 4FZWA 1W2XA 4ZDDA 4Z0MA 3R6HA 4J2UA 5E0NX 3Q7HA 3HLN1 2J5GD 1YG8A 1XNYA 3BPTA 4JVTA 4ELXA 2ZQQA 1TYFA 4I52A 4KD6A 3GLMA 2VSUC 3HRXA 3PGQA 3ZWBA 4JYLA 4ELWA 3T8BA 3BEZA 4RCNA 3ISAA 3SLLA 1RJMA 3M6MA 4Q1IA 1XNVA 4F47A 1O8UA 4JWVA 4NNQA 2A7SA 2ZL4A 3IAVA 3Q0JA 1Q52A 3G64A 4L8KA 1DUBA 3N6RB 3TDCA 3FF6A 5DU8A 2VREA 5JBWA 3R9TA 5E0SA 1OD2A 2F9YA 2F6IA 1UYTA 2Q2XA 4U19A 4GM2A 4IZBA 3ZWCA 1Q51A 1UIYA 3H0SA 3MOYA 1Y7OA 5DKPA 4FB8A 1WDLA 2FBMA 2Q35A 5DUFA 3ST9A 2VSUF 3OMEA 1SG4A 1XNWA 4FJWD 2A81A 2PPYA 3IBBA 4JOTA 3RRVA 4FZWC 4JFCA 4WCZA 3U9RB 3P85A 5INIA 3H81A 5C90A 4HNKA 5E0SH 3R9QA 5JBXA 1RJNA 2CBYA 1K32A 3QYRA 5DZKA 3DORA 3HP0A 4WZ8B 4LK5A 5KDRB 2J5GA 1NZYA 1HNOA 1X0UA 1FC7A 2F9IA 1JXZA 1EF8A 3R9SA 3MT6A 5FUSA 5IKLB 1PJHA 5C9GA 1K39A 3FDUA 3NJBA 3HE2A 4ZU2A 5DUCA 3ZW8A 3TZ3A 3RSTA 4FN7A 2QQ3A 4HC8A 3KTJA 2X58A 4FN8A 2YJGA 4ZDEA 3U9SB 2VSSE 1VRGA 2J5IA 3Q1TA 4QIIA 3H0QA 2VX2A 3KTHA 3TVUA 2J5SA 4L6WA 2CE3A 5DZKH 1UYVA 2D3TA 3GMAA 4B3HA 5DTPA 4B3JA 1MJ3A 3MFMA 5DU4A 3IB9A 3V5IA 4U0GA 1WDMA 2ZL2A 3ZW9A 4IZDA 1N6DA 3QXZA 3Q0GA 3QWDA 2Q34A 2ZL3A 2WTBA 3PE8A 4ZDCA 4U0HA 4HDTA 4WYOB 2IEXA 1J7XA 4KPKA 1ON3A 1EF9A 2A7KA 1XO6A 4QIJA 4RYFH 5INFA 4KNPA 1N6FA 5DL1A 3T3WA 1HNUA 1SZOA 4U0GH 4I42A 2HW5A 4U18A 4MOUA 3GKBA 3T88A 3V5EA 3QK8A 3PZKA 4NARA 4G2RA 4ZDBA 3R0OA 3SWXA 3JU1A 4JCSA 2ZQRA 5MGBA 5FIFA 3P5MA 4DI1A 1ON9A 2DUBA 3P2LA 5CTCA 3K8XA 2ZL0A 2FZSA 4GHNA 5G1SA 3BPPA 5DU6A 4JCTA 5G1QA 2EJ5A 4K2NA 2UZFA 1UYRA 2DEOA 3MYBA 4JJTA 1YG6A 4JSBA 2C8TA 1UYSA 4U1AA 3RSIA 2F9YB 3TRRA 3OC7A 3TLFA 1HZDA 4OG1A 2X24A 4YLHA 5CTBA 2F6QA 4RYFA 3TVWA 3DJAA 3K50A 4OLQA 1WZ8A 3QXIA 3VIVA 1XX4A 3H02A 3KTKA 3LKEA 2BZRA 2VSSA 2J5II 2NP9A 4MI2A 3ZWAA 5KDRA
chains in the Genus database with same CATH topology
3M6NA 4K3WA 2VSUE 3TV5A 4NEKA 3STAA 3WG5A 1N6EA 4JYJA 4JCRA 3H0JA 3TT7A 3KQFA 4QFEA 5HUQA 5DTWA 3GF7A 1DCIA 1NZYB 5KJPA 3U9TB 4ASIA 1PIXA 4KWBA 1FC9A 2VSUA 3H0UA 3TT6A 2VSSF 5G1RA 2F9IB 1OD4A 4MXIA 2PBPA 4FNBA 1EY3A 3KTGA 4JCQA 3OT6A 4B3IA 1TG6A 1FC6A 4ELSA 1WDKA 4Q0GA 3T89A 3LAOA 2J5IB 4EMMA 2GTRA 3QMJA 3T8AA 4OMRA 4ZDFA 3I47A 3BF0A 3QKAA 3NJDA 3GF3A 5INGA 2W3PA 4EMPA 4K29A 4IZCA 4EMLA 3L3SA 2FW2A 3KTIA 3PEAA 4FNDA 4I4ZA 3HINA 3QREA 1FCFA 2PG8A 4FZWA 1W2XA 4ZDDA 4Z0MA 3R6HA 4J2UA 5E0NX 3Q7HA 3HLN1 2J5GD 1YG8A 1XNYA 3BPTA 4JVTA 4ELXA 2ZQQA 1TYFA 4I52A 4KD6A 3GLMA 2VSUC 3HRXA 3PGQA 3ZWBA 4JYLA 4ELWA 3T8BA 3BEZA 4RCNA 3ISAA 3SLLA 1RJMA 3M6MA 4Q1IA 1XNVA 4F47A 1O8UA 4JWVA 4NNQA 2A7SA 2ZL4A 3IAVA 3Q0JA 1Q52A 3G64A 4L8KA 1DUBA 3N6RB 3TDCA 3FF6A 5DU8A 2VREA 5JBWA 3R9TA 5E0SA 1OD2A 2F9YA 2F6IA 1UYTA 2Q2XA 4U19A 4GM2A 4IZBA 3ZWCA 1Q51A 1UIYA 3H0SA 3MOYA 1Y7OA 5DKPA 4FB8A 1WDLA 2FBMA 2Q35A 5DUFA 3ST9A 2VSUF 3OMEA 1SG4A 1XNWA 4FJWD 2A81A 2PPYA 3IBBA 4JOTA 3RRVA 4FZWC 4JFCA 4WCZA 3U9RB 3P85A 5INIA 3H81A 5C90A 4HNKA 5E0SH 3R9QA 5JBXA 1RJNA 2CBYA 1K32A 3QYRA 5DZKA 3DORA 3HP0A 4WZ8B 4LK5A 5KDRB 2J5GA 1NZYA 1HNOA 1X0UA 1FC7A 2F9IA 1JXZA 1EF8A 3R9SA 3MT6A 5FUSA 5IKLB 1PJHA 5C9GA 1K39A 3FDUA 3NJBA 3HE2A 4ZU2A 5DUCA 3ZW8A 3TZ3A 3RSTA 4FN7A 2QQ3A 4HC8A 3KTJA 2X58A 4FN8A 2YJGA 4ZDEA 3U9SB 2VSSE 1VRGA 2J5IA 3Q1TA 4QIIA 3H0QA 2VX2A 3KTHA 3TVUA 2J5SA 4L6WA 2CE3A 5DZKH 1UYVA 2D3TA 3GMAA 4B3HA 5DTPA 4B3JA 1MJ3A 3MFMA 5DU4A 3IB9A 3V5IA 4U0GA 1WDMA 2ZL2A 3ZW9A 4IZDA 1N6DA 3QXZA 3Q0GA 3QWDA 2Q34A 2ZL3A 2WTBA 3PE8A 4ZDCA 4U0HA 4HDTA 4WYOB 2IEXA 1J7XA 4KPKA 1ON3A 1EF9A 2A7KA 1XO6A 4QIJA 4RYFH 5INFA 4KNPA 1N6FA 5DL1A 3T3WA 1HNUA 1SZOA 4U0GH 4I42A 2HW5A 4U18A 4MOUA 3GKBA 3T88A 3V5EA 3QK8A 3PZKA 4NARA 4G2RA 4ZDBA 3R0OA 3SWXA 3JU1A 4JCSA 2ZQRA 5MGBA 5FIFA 3P5MA 4DI1A 1ON9A 2DUBA 3P2LA 5CTCA 3K8XA 2ZL0A 2FZSA 4GHNA 5G1SA 3BPPA 5DU6A 4JCTA 5G1QA 2EJ5A 4K2NA 2UZFA 1UYRA 2DEOA 3MYBA 4JJTA 1YG6A 4JSBA 2C8TA 1UYSA 4U1AA 3RSIA 2F9YB 3TRRA 3OC7A 3TLFA 1HZDA 4OG1A 2X24A 4YLHA 5CTBA 2F6QA 4RYFA 3TVWA 3DJAA 3K50A 4OLQA 1WZ8A 3QXIA 3VIVA 1XX4A 3H02A 3KTKA 3LKEA 2BZRA 2VSSA 2J5II 2NP9A 4MI2A 3ZWAA 5KDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6N A;  4K3W A;  2VSU E;  3TV5 A;  4NEK A;  3STA A;  3WG5 A;  1N6E A;  4JYJ A;  4JCR A;  3H0J A;  3TT7 A;  3KQF A;  4QFE A;  5DTW A;  3GF7 A;  1DCI A;  1NZY B;  5KJP A;  3U9T B;  4ASI A;  1PIX A;  4KWB A;  1FC9 A;  2VSU A;  3H0U A;  3TT6 A;  2VSS F;  5G1R A;  2F9I B;  1OD4 A;  4MXI A;  2PBP A;  4FNB A;  1EY3 A;  3KTG A;  4JCQ A;  3OT6 A;  4B3I A;  1TG6 A;  1FC6 A;  4ELS A;  1WDK A;  4Q0G A;  3T89 A;  3LAO A;  2J5I B;  4EMM A;  2GTR A;  3QMJ A;  3T8A A;  4OMR A;  4ZDF A;  3I47 A;  3BF0 A;  3QKA A;  3NJD A;  3GF3 A;  5ING A;  2W3P A;  4EMP A;  4K29 A;  4IZC A;  4EML A;  3L3S A;  2FW2 A;  3KTI A;  3PEA A;  4FND A;  4I4Z A;  3HIN A;  3QRE A;  1FCF A;  2PG8 A;  4FZW A;  1W2X A;  4ZDD A;  4Z0M A;  3R6H A;  5E0N X;  3Q7H A;  3HLN 1;  2J5G D;  1YG8 A;  1XNY A;  4JVT A;  4ELX A;  2ZQQ A;  1TYF A;  4I52 A;  4KD6 A;  3GLM A;  2VSU C;  3HRX A;  3PGQ A;  3ZWB A;  4JYL A;  4ELW A;  3T8B A;  3BEZ A;  4RCN A;  3ISA A;  3SLL A;  1RJM A;  3M6M A;  4Q1I A;  1XNV A;  4F47 A;  1O8U A;  4JWV A;  4NNQ A;  2A7S A;  2ZL4 A;  3IAV A;  3Q0J A;  1Q52 A;  3G64 A;  4L8K A;  1DUB A;  3N6R B;  3TDC A;  3FF6 A;  5DU8 A;  2VRE A;  5JBW A;  3R9T A;  5E0S A;  1OD2 A;  2F9Y A;  2F6I A;  1UYT A;  2Q2X A;  4U19 A;  4GM2 A;  4IZB A;  3ZWC A;  1Q51 A;  1UIY A;  3H0S A;  3MOY A;  1Y7O A;  5DKP A;  4FB8 A;  1WDL A;  2FBM A;  2Q35 A;  5DUF A;  3ST9 A;  2VSU F;  3OME A;  1SG4 A;  1XNW A;  4FJW D;  2A81 A;  2PPY A;  3IBB A;  4JOT A;  3RRV A;  4FZW C;  4JFC A;  4WCZ A;  3U9R B;  3P85 A;  5INI A;  3H81 A;  5C90 A;  4HNK A;  5E0S H;  3R9Q A;  5JBX A;  1RJN A;  2CBY A;  1K32 A;  3QYR A;  5DZK A;  3DOR A;  3HP0 A;  4WZ8 B;  4LK5 A;  5KDR B;  2J5G A;  1NZY A;  1HNO A;  1X0U A;  1FC7 A;  2F9I A;  1JXZ A;  1EF8 A;  3R9S A;  3MT6 A;  5FUS A;  5IKL B;  1PJH A;  5C9G A;  1K39 A;  3FDU A;  3NJB A;  3HE2 A;  4ZU2 A;  5DUC A;  3ZW8 A;  3TZ3 A;  3RST A;  4FN7 A;  2QQ3 A;  4HC8 A;  3KTJ A;  2X58 A;  4FN8 A;  4ZDE A;  3U9S B;  2VSS E;  1VRG A;  2J5I A;  3Q1T A;  4QII A;  3H0Q A;  2VX2 A;  3KTH A;  3TVU A;  2J5S A;  4L6W A;  2CE3 A;  5DZK H;  1UYV A;  2D3T A;  3GMA A;  4B3H A;  5DTP A;  4B3J A;  1MJ3 A;  3MFM A;  5DU4 A;  3IB9 A;  3V5I A;  4U0G A;  1WDM A;  2ZL2 A;  3ZW9 A;  4IZD A;  1N6D A;  3QXZ A;  3Q0G A;  3QWD A;  2Q34 A;  2ZL3 A;  2WTB A;  3PE8 A;  4ZDC A;  4U0H A;  4WYO B;  2IEX A;  1J7X A;  4KPK A;  1ON3 A;  1EF9 A;  2A7K A;  1XO6 A;  4QIJ A;  4RYF H;  5INF A;  4KNP A;  1N6F A;  5DL1 A;  3T3W A;  1HNU A;  1SZO A;  4U0G H;  4I42 A;  2HW5 A;  4U18 A;  4MOU A;  3GKB A;  3T88 A;  3V5E A;  3QK8 A;  3PZK A;  4G2R A;  4ZDB A;  3R0O A;  3SWX A;  3JU1 A;  4JCS A;  2ZQR A;  5MGB A;  5FIF A;  3P5M A;  4DI1 A;  1ON9 A;  2DUB A;  3P2L A;  5CTC A;  3K8X A;  2ZL0 A;  2FZS A;  4GHN A;  5G1S A;  3BPP A;  5DU6 A;  4JCT A;  5G1Q A;  2EJ5 A;  4K2N A;  2UZF A;  1UYR A;  2DEO A;  3MYB A;  4JJT A;  1YG6 A;  4JSB A;  2C8T A;  1UYS A;  4U1A A;  3RSI A;  2F9Y B;  3TRR A;  3OC7 A;  3TLF A;  1HZD A;  4OG1 A;  2X24 A;  4YLH A;  5CTB A;  2F6Q A;  4RYF A;  3TVW A;  3DJA A;  3K50 A;  4OLQ A;  1WZ8 A;  3QXI A;  3VIV A;  1XX4 A;  3H02 A;  3KTK A;  3LKE A;  2BZR A;  2VSS A;  2J5I I;  2NP9 A;  4MI2 A;  3ZWA A;  5KDR A; 
#chains in the Genus database with same CATH topology
 3M6N A;  4K3W A;  2VSU E;  3TV5 A;  4NEK A;  3STA A;  3WG5 A;  1N6E A;  4JYJ A;  4JCR A;  3H0J A;  3TT7 A;  3KQF A;  4QFE A;  5HUQ A;  5DTW A;  3GF7 A;  1DCI A;  1NZY B;  5KJP A;  3U9T B;  4ASI A;  1PIX A;  4KWB A;  1FC9 A;  2VSU A;  3H0U A;  3TT6 A;  2VSS F;  5G1R A;  2F9I B;  1OD4 A;  4MXI A;  2PBP A;  4FNB A;  1EY3 A;  3KTG A;  4JCQ A;  3OT6 A;  4B3I A;  1TG6 A;  1FC6 A;  4ELS A;  1WDK A;  4Q0G A;  3T89 A;  3LAO A;  2J5I B;  4EMM A;  2GTR A;  3QMJ A;  3T8A A;  4OMR A;  4ZDF A;  3I47 A;  3BF0 A;  3QKA A;  3NJD A;  3GF3 A;  5ING A;  2W3P A;  4EMP A;  4K29 A;  4IZC A;  4EML A;  3L3S A;  2FW2 A;  3KTI A;  3PEA A;  4FND A;  4I4Z A;  3HIN A;  3QRE A;  1FCF A;  2PG8 A;  4FZW A;  1W2X A;  4ZDD A;  4Z0M A;  3R6H A;  4J2U A;  5E0N X;  3Q7H A;  3HLN 1;  2J5G D;  1YG8 A;  1XNY A;  3BPT A;  4JVT A;  4ELX A;  2ZQQ A;  1TYF A;  4I52 A;  4KD6 A;  3GLM A;  2VSU C;  3HRX A;  3PGQ A;  3ZWB A;  4JYL A;  4ELW A;  3T8B A;  3BEZ A;  4RCN A;  3ISA A;  3SLL A;  1RJM A;  3M6M A;  4Q1I A;  1XNV A;  4F47 A;  1O8U A;  4JWV A;  4NNQ A;  2A7S A;  2ZL4 A;  3IAV A;  3Q0J A;  1Q52 A;  3G64 A;  4L8K A;  1DUB A;  3N6R B;  3TDC A;  3FF6 A;  5DU8 A;  2VRE A;  5JBW A;  3R9T A;  5E0S A;  1OD2 A;  2F9Y A;  2F6I A;  1UYT A;  2Q2X A;  4U19 A;  4GM2 A;  4IZB A;  3ZWC A;  1Q51 A;  1UIY A;  3H0S A;  3MOY A;  1Y7O A;  5DKP A;  4FB8 A;  1WDL A;  2FBM A;  2Q35 A;  5DUF A;  3ST9 A;  2VSU F;  3OME A;  1SG4 A;  1XNW A;  4FJW D;  2A81 A;  2PPY A;  3IBB A;  4JOT A;  3RRV A;  4FZW C;  4JFC A;  4WCZ A;  3U9R B;  3P85 A;  5INI A;  3H81 A;  5C90 A;  4HNK A;  5E0S H;  3R9Q A;  5JBX A;  1RJN A;  2CBY A;  1K32 A;  3QYR A;  5DZK A;  3DOR A;  3HP0 A;  4WZ8 B;  4LK5 A;  5KDR B;  2J5G A;  1NZY A;  1HNO A;  1X0U A;  1FC7 A;  2F9I A;  1JXZ A;  1EF8 A;  3R9S A;  3MT6 A;  5FUS A;  5IKL B;  1PJH A;  5C9G A;  1K39 A;  3FDU A;  3NJB A;  3HE2 A;  4ZU2 A;  5DUC A;  3ZW8 A;  3TZ3 A;  3RST A;  4FN7 A;  2QQ3 A;  4HC8 A;  3KTJ A;  2X58 A;  4FN8 A;  2YJG A;  4ZDE A;  3U9S B;  2VSS E;  1VRG A;  2J5I A;  3Q1T A;  4QII A;  3H0Q A;  2VX2 A;  3KTH A;  3TVU A;  2J5S A;  4L6W A;  2CE3 A;  5DZK H;  1UYV A;  2D3T A;  3GMA A;  4B3H A;  5DTP A;  4B3J A;  1MJ3 A;  3MFM A;  5DU4 A;  3IB9 A;  3V5I A;  4U0G A;  1WDM A;  2ZL2 A;  3ZW9 A;  4IZD A;  1N6D A;  3QXZ A;  3Q0G A;  3QWD A;  2Q34 A;  2ZL3 A;  2WTB A;  3PE8 A;  4ZDC A;  4U0H A;  4HDT A;  4WYO B;  2IEX A;  1J7X A;  4KPK A;  1ON3 A;  1EF9 A;  2A7K A;  1XO6 A;  4QIJ A;  4RYF H;  5INF A;  4KNP A;  1N6F A;  5DL1 A;  3T3W A;  1HNU A;  1SZO A;  4U0G H;  4I42 A;  2HW5 A;  4U18 A;  4MOU A;  3GKB A;  3T88 A;  3V5E A;  3QK8 A;  3PZK A;  4NAR A;  4G2R A;  4ZDB A;  3R0O A;  3SWX A;  3JU1 A;  4JCS A;  2ZQR A;  5MGB A;  5FIF A;  3P5M A;  4DI1 A;  1ON9 A;  2DUB A;  3P2L A;  5CTC A;  3K8X A;  2ZL0 A;  2FZS A;  4GHN A;  5G1S A;  3BPP A;  5DU6 A;  4JCT A;  5G1Q A;  2EJ5 A;  4K2N A;  2UZF A;  1UYR A;  2DEO A;  3MYB A;  4JJT A;  1YG6 A;  4JSB A;  2C8T A;  1UYS A;  4U1A A;  3RSI A;  2F9Y B;  3TRR A;  3OC7 A;  3TLF A;  1HZD A;  4OG1 A;  2X24 A;  4YLH A;  5CTB A;  2F6Q A;  4RYF A;  3TVW A;  3DJA A;  3K50 A;  4OLQ A;  1WZ8 A;  3QXI A;  3VIV A;  1XX4 A;  3H02 A;  3KTK A;  3LKE A;  2BZR A;  2VSS A;  2J5I I;  2NP9 A;  4MI2 A;  3ZWA A;  5KDR A; 
#chains in the Genus database with same CATH homology
 3M6N A;  4K3W A;  2VSU E;  3TV5 A;  4NEK A;  3STA A;  3WG5 A;  1N6E A;  4JYJ A;  4JCR A;  3H0J A;  3TT7 A;  3KQF A;  4QFE A;  5HUQ A;  5DTW A;  3GF7 A;  1DCI A;  1NZY B;  5KJP A;  3U9T B;  4ASI A;  1PIX A;  4KWB A;  1FC9 A;  2VSU A;  3H0U A;  3TT6 A;  2VSS F;  5G1R A;  2F9I B;  1OD4 A;  4MXI A;  2PBP A;  4FNB A;  1EY3 A;  3KTG A;  4JCQ A;  3OT6 A;  4B3I A;  1TG6 A;  1FC6 A;  4ELS A;  1WDK A;  4Q0G A;  3T89 A;  3LAO A;  2J5I B;  4EMM A;  2GTR A;  3QMJ A;  3T8A A;  4OMR A;  4ZDF A;  3I47 A;  3BF0 A;  3QKA A;  3NJD A;  3GF3 A;  5ING A;  2W3P A;  4EMP A;  4K29 A;  4IZC A;  4EML A;  3L3S A;  2FW2 A;  3KTI A;  3PEA A;  4FND A;  4I4Z A;  3HIN A;  3QRE A;  1FCF A;  2PG8 A;  4FZW A;  1W2X A;  4ZDD A;  4Z0M A;  3R6H A;  4J2U A;  5E0N X;  3Q7H A;  3HLN 1;  2J5G D;  1YG8 A;  1XNY A;  3BPT A;  4JVT A;  4ELX A;  2ZQQ A;  1TYF A;  4I52 A;  4KD6 A;  3GLM A;  2VSU C;  3HRX A;  3PGQ A;  3ZWB A;  4JYL A;  4ELW A;  3T8B A;  3BEZ A;  4RCN A;  3ISA A;  3SLL A;  1RJM A;  3M6M A;  4Q1I A;  1XNV A;  4F47 A;  1O8U A;  4JWV A;  4NNQ A;  2A7S A;  2ZL4 A;  3IAV A;  3Q0J A;  1Q52 A;  3G64 A;  4L8K A;  1DUB A;  3N6R B;  3TDC A;  3FF6 A;  5DU8 A;  2VRE A;  5JBW A;  3R9T A;  5E0S A;  1OD2 A;  2F9Y A;  2F6I A;  1UYT A;  2Q2X A;  4U19 A;  4GM2 A;  4IZB A;  3ZWC A;  1Q51 A;  1UIY A;  3H0S A;  3MOY A;  1Y7O A;  5DKP A;  4FB8 A;  1WDL A;  2FBM A;  2Q35 A;  5DUF A;  3ST9 A;  2VSU F;  3OME A;  1SG4 A;  1XNW A;  4FJW D;  2A81 A;  2PPY A;  3IBB A;  4JOT A;  3RRV A;  4FZW C;  4JFC A;  4WCZ A;  3U9R B;  3P85 A;  5INI A;  3H81 A;  5C90 A;  4HNK A;  5E0S H;  3R9Q A;  5JBX A;  1RJN A;  2CBY A;  1K32 A;  3QYR A;  5DZK A;  3DOR A;  3HP0 A;  4WZ8 B;  4LK5 A;  5KDR B;  2J5G A;  1NZY A;  1HNO A;  1X0U A;  1FC7 A;  2F9I A;  1JXZ A;  1EF8 A;  3R9S A;  3MT6 A;  5FUS A;  5IKL B;  1PJH A;  5C9G A;  1K39 A;  3FDU A;  3NJB A;  3HE2 A;  4ZU2 A;  5DUC A;  3ZW8 A;  3TZ3 A;  3RST A;  4FN7 A;  2QQ3 A;  4HC8 A;  3KTJ A;  2X58 A;  4FN8 A;  2YJG A;  4ZDE A;  3U9S B;  2VSS E;  1VRG A;  2J5I A;  3Q1T A;  4QII A;  3H0Q A;  2VX2 A;  3KTH A;  3TVU A;  2J5S A;  4L6W A;  2CE3 A;  5DZK H;  1UYV A;  2D3T A;  3GMA A;  4B3H A;  5DTP A;  4B3J A;  1MJ3 A;  3MFM A;  5DU4 A;  3IB9 A;  3V5I A;  4U0G A;  1WDM A;  2ZL2 A;  3ZW9 A;  4IZD A;  1N6D A;  3QXZ A;  3Q0G A;  3QWD A;  2Q34 A;  2ZL3 A;  2WTB A;  3PE8 A;  4ZDC A;  4U0H A;  4HDT A;  4WYO B;  2IEX A;  1J7X A;  4KPK A;  1ON3 A;  1EF9 A;  2A7K A;  1XO6 A;  4QIJ A;  4RYF H;  5INF A;  4KNP A;  1N6F A;  5DL1 A;  3T3W A;  1HNU A;  1SZO A;  4U0G H;  4I42 A;  2HW5 A;  4U18 A;  4MOU A;  3GKB A;  3T88 A;  3V5E A;  3QK8 A;  3PZK A;  4NAR A;  4G2R A;  4ZDB A;  3R0O A;  3SWX A;  3JU1 A;  4JCS A;  2ZQR A;  5MGB A;  5FIF A;  3P5M A;  4DI1 A;  1ON9 A;  2DUB A;  3P2L A;  5CTC A;  3K8X A;  2ZL0 A;  2FZS A;  4GHN A;  5G1S A;  3BPP A;  5DU6 A;  4JCT A;  5G1Q A;  2EJ5 A;  4K2N A;  2UZF A;  1UYR A;  2DEO A;  3MYB A;  4JJT A;  1YG6 A;  4JSB A;  2C8T A;  1UYS A;  4U1A A;  3RSI A;  2F9Y B;  3TRR A;  3OC7 A;  3TLF A;  1HZD A;  4OG1 A;  2X24 A;  4YLH A;  5CTB A;  2F6Q A;  4RYF A;  3TVW A;  3DJA A;  3K50 A;  4OLQ A;  1WZ8 A;  3QXI A;  3VIV A;  1XX4 A;  3H02 A;  3KTK A;  3LKE A;  2BZR A;  2VSS A;  2J5I I;  2NP9 A;  4MI2 A;  3ZWA A;  5KDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...