1ON3A

Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound)
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
517
structure length
517
Chain Sequence
KLASTMEGRVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNNTEEASFVNPNNDVSPNTELRDIVPIDGKKGYDVRDVIAKIVDWGDYLEVKAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMCNRDLGADAVYAWPSAEIAVMGAEGAANVIFRKEIKAADDPDAMRAEKIEEYQNAFNTPYVAAARGQVDDVIDPADTRRKIASALEMYATKRQTRPAKKHGNFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core
pubmed doi rcsb
source organism Propionibacterium freudenreichii
molecule tags Transferase
molecule keywords Methylmalonyl-CoA carboxyltransferase 12S subunit
total genus 196
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A01
3R6HA 3IBBA 3TRRA 4KD6A 4EMPA 4ZDDA 3MOYA 5G1QA 3RRVA 1FCFA 2J5II 3HLN1 4RCNA 3TVWA 5INFA 5INIA 3TT7A 4L8KA 4FN7A 4JCQA 3WG5A 5DUCA 4EMMA 1WZ8A 4B3JA 1SG4A 1DCIA 2ZL4A 4U1AA 3QWDA 3ZW9A 3NJBA 4MXIA 3GLMA 5FIFA 1FC6A 2FZSA 3STAA 4ZDCA 1TYFA 4JCRA 4U0HA 1N6EA 4G2RA 4HC8A 3FF6A 3TT6A 4OMRA 3TDCA 3Q1TA 4IZDA 3KTGA 2FW2A 2WTBA 2F9IB 4QIJA 2J5SA 4FNBA 1MJ3A 3MFMA 4ASIA 4B3HA 5E0SA 3QMJA 4HNKA 4KPKA 5C9GA 1UYVA 3V5IA 3KTHA 3HRXA 2VSUE 5DKPA 4U19A 4OLQA 2X58A 3KTJA 4LK5A 4OG1A 2F6QA 2NP9A 3OMEA 3BEZA 2Q35A 3OC7A 5MGBA 2HW5A 2J5GA 3GKBA 3RSTA 4KNPA 2QQ3A 2F9YA 3LKEA 1PIXA 3HP0A 4ELXA 3R9SA 1DUBA 3T8BA 3LAOA 2VX2A 3H0QA 3QYRA 5E0NX 2VREA 3PE8A 4U0GA 1XNVA 5DU8A 1WDLA 4Q0GA 1SZOA 1RJMA 3GF3A 3ST9A 2F9IA 1UYRA 2EJ5A 4JJTA 5DU4A 4K2NA 1PJHA 1XNWA 2VSUF 4EMLA 4GHNA 3BPPA 3Q7HA 3TVUA 3RSIA 2DUBA 4ZDFA 1Y7OA 2ZL0A 2PPYA 4JVTA 5CTCA 2D3TA 5JBXA 1N6DA 3IB9A 3Q0JA 1UIYA 5KDRA 1EF8A 2ZQQA 4NNQA 4RYFA 1Q52A 4MOUA 4L6WA 3TLFA 3QK8A 2BZRA 4I42A 3ZWAA 4QFEA 3H0SA 1TG6A 1XO6A 4WCZA 1UYTA 4B3IA 4I4ZA 5IKLB 2VSUA 3M6NA 3QREA 4JWVA 3PZKA 3P85A 4JSBA 2C8TA 1YG8A 3DORA 1YG6A 1NZYB 4IZCA 2X24A 3H0UA 2PG8A 4WYOB 4ZU2A 3K50A 3MT6A 4YLHA 1Q51A 3KQFA 4WZ8B 3SWXA 4FZWC 4FN8A 4FJWD 1K39A 3U9SB 1OD4A 2CBYA 2F9YB 3P2LA 4GM2A 4I52A 3TV5A 4ZDEA 1ON9A 3ZWBA 1WDKA 3QXZA 5DZKH 3DJAA 3TZ3A 1RJNA 4JYJA 4RYFH 3ZWCA 3ZW8A 4ELWA 4FZWA 3H02A 3BF0A 4IZBA 5DU6A 4F47A 3T8AA 3V5EA 1J7XA 3QKAA 3I47A 3HE2A 5C90A 5DL1A 2ZL2A 5DTWA 4KWBA 4JFCA 2VSSA 5G1SA 1X0UA 2J5IB 1N6FA 2PBPA 5DZKA 3VIVA 1EF9A 5KJPA 4JOTA 3G64A 3H81A 2Q34A 2F6IA 3T3WA 1O8UA 1K32A 4K29A 3FDUA 4FB8A 5DUFA 4Q1IA 5G1RA 2ZL3A 1XX4A 3H0JA 1FC7A 1JXZA 3IAVA 4K3WA 5E0SH 4DI1A 3Q0GA 1EY3A 2VSSE 4JYLA 3ISAA 3L3SA 3PEAA 3JU1A 4U0GH 1WDMA 2W3PA 3QXIA 1HNUA 3SLLA 2VSUC 5CTBA 2VSSF 2J5IA 3PGQA 4U18A 3MYBA 3U9TB 5DTPA 1VRGA 3T89A 2IEXA 4JCTA 3K8XA 3GMAA 1W2XA 5INGA 3R0OA 3HINA 1UYSA 2Q2XA 1HZDA 3OT6A 4ZDBA 2UZFA 3N6RB 3R9TA 3KTIA 5FUSA 1OD2A 4FNDA 3GF7A 2ZQRA 2FBMA 3T88A 2A7KA 1FC9A 2CE3A 5KDRB 2DEOA 2J5GD 1XNYA 3P5MA 1ON3A 3U9RB 4JCSA 4NEKA 4MI2A 4ELSA 1HNOA 3M6MA 4QIIA 5JBWA 3KTKA 1NZYA 2GTRA 3NJDA 2A81A 2A7SA 3R9QA 4Z0MA
chains in the Genus database with same CATH superfamily
3R6HA 3IBBA 3TRRA 4KD6A 4EMPA 4ZDDA 3MOYA 5G1QA 3RRVA 1FCFA 2J5II 3HLN1 4RCNA 3TVWA 5INFA 5INIA 3TT7A 4L8KA 4FN7A 4JCQA 3WG5A 5DUCA 4EMMA 1WZ8A 4B3JA 1SG4A 1DCIA 2ZL4A 4U1AA 3QWDA 3ZW9A 3NJBA 4MXIA 3GLMA 5FIFA 1FC6A 2FZSA 3STAA 4ZDCA 1TYFA 4JCRA 4U0HA 1N6EA 4G2RA 4HC8A 3FF6A 3TT6A 4OMRA 3TDCA 3Q1TA 4IZDA 3KTGA 2FW2A 2WTBA 2F9IB 4QIJA 2YJGA 2J5SA 4FNBA 1MJ3A 3MFMA 4ASIA 4B3HA 5E0SA 3QMJA 4HNKA 4KPKA 5C9GA 1UYVA 3V5IA 3KTHA 3HRXA 2VSUE 5DKPA 4U19A 4OLQA 2X58A 3KTJA 4LK5A 4OG1A 2F6QA 2NP9A 3OMEA 3BEZA 2Q35A 3OC7A 5MGBA 2HW5A 2J5GA 3GKBA 3RSTA 4KNPA 2QQ3A 2F9YA 3LKEA 1PIXA 3HP0A 4ELXA 3R9SA 1DUBA 3T8BA 3LAOA 2VX2A 3H0QA 3QYRA 5E0NX 2VREA 3PE8A 4U0GA 1XNVA 5DU8A 1WDLA 4Q0GA 1SZOA 1RJMA 3GF3A 3ST9A 2F9IA 1UYRA 2EJ5A 4JJTA 5DU4A 4K2NA 1PJHA 1XNWA 2VSUF 4EMLA 4GHNA 4J2UA 3BPPA 3Q7HA 3TVUA 3RSIA 2DUBA 4ZDFA 1Y7OA 2ZL0A 2PPYA 4JVTA 5CTCA 2D3TA 5JBXA 1N6DA 3IB9A 3Q0JA 1UIYA 5KDRA 1EF8A 2ZQQA 4NNQA 4RYFA 1Q52A 4MOUA 4L6WA 3TLFA 3QK8A 2BZRA 4I42A 3ZWAA 4QFEA 3H0SA 1TG6A 1XO6A 4WCZA 1UYTA 4B3IA 4I4ZA 5IKLB 2VSUA 3M6NA 3QREA 4JWVA 3PZKA 3P85A 4JSBA 2C8TA 1YG8A 3DORA 1YG6A 1NZYB 4IZCA 2X24A 3H0UA 2PG8A 4WYOB 4ZU2A 3K50A 3MT6A 4YLHA 1Q51A 3KQFA 4WZ8B 3SWXA 4FZWC 4FN8A 4FJWD 1K39A 3U9SB 1OD4A 2CBYA 2F9YB 3P2LA 4GM2A 4I52A 3TV5A 4ZDEA 1ON9A 3ZWBA 1WDKA 3QXZA 5DZKH 3DJAA 3TZ3A 1RJNA 4JYJA 4RYFH 3ZWCA 3ZW8A 5HUQA 4ELWA 4FZWA 3H02A 3BF0A 4IZBA 5DU6A 4F47A 3T8AA 3V5EA 1J7XA 3QKAA 3I47A 4NARA 3HE2A 5C90A 5DL1A 2ZL2A 5DTWA 4KWBA 4JFCA 2VSSA 5G1SA 1X0UA 2J5IB 1N6FA 2PBPA 5DZKA 3VIVA 1EF9A 5KJPA 4JOTA 3G64A 4HDTA 3H81A 2Q34A 2F6IA 3T3WA 1O8UA 1K32A 4K29A 3FDUA 4FB8A 5DUFA 4Q1IA 5G1RA 2ZL3A 1XX4A 3H0JA 1FC7A 1JXZA 3IAVA 4K3WA 5E0SH 4DI1A 3Q0GA 1EY3A 2VSSE 4JYLA 3ISAA 3L3SA 3PEAA 3JU1A 4U0GH 1WDMA 2W3PA 3QXIA 1HNUA 3BPTA 3SLLA 2VSUC 5CTBA 2VSSF 2J5IA 3PGQA 4U18A 3MYBA 3U9TB 5DTPA 1VRGA 3T89A 2IEXA 4JCTA 3K8XA 3GMAA 1W2XA 5INGA 3R0OA 3HINA 1UYSA 2Q2XA 1HZDA 3OT6A 4ZDBA 2UZFA 3N6RB 3R9TA 3KTIA 5FUSA 1OD2A 4FNDA 3GF7A 2ZQRA 2FBMA 3T88A 2A7KA 1FC9A 2CE3A 5KDRB 2DEOA 2J5GD 1XNYA 3P5MA 1ON3A 3U9RB 4JCSA 4NEKA 4MI2A 4ELSA 1HNOA 3M6MA 4QIIA 5JBWA 3KTKA 1NZYA 2GTRA 3NJDA 2A81A 2A7SA 3R9QA 4Z0MA
chains in the Genus database with same CATH topology
3R6HA 3IBBA 3TRRA 4KD6A 4EMPA 4ZDDA 3MOYA 5G1QA 3RRVA 1FCFA 2J5II 3HLN1 4RCNA 3TVWA 5INFA 5INIA 3TT7A 4L8KA 4FN7A 4JCQA 3WG5A 5DUCA 4EMMA 1WZ8A 4B3JA 1SG4A 1DCIA 2ZL4A 4U1AA 3QWDA 3ZW9A 3NJBA 4MXIA 3GLMA 5FIFA 1FC6A 2FZSA 3STAA 4ZDCA 1TYFA 4JCRA 4U0HA 1N6EA 4G2RA 4HC8A 3FF6A 3TT6A 4OMRA 3TDCA 3Q1TA 4IZDA 3KTGA 2FW2A 2WTBA 2F9IB 4QIJA 2YJGA 2J5SA 4FNBA 1MJ3A 3MFMA 4ASIA 4B3HA 5E0SA 3QMJA 4HNKA 4KPKA 5C9GA 1UYVA 3V5IA 3KTHA 3HRXA 2VSUE 5DKPA 4U19A 4OLQA 2X58A 3KTJA 4LK5A 4OG1A 2F6QA 2NP9A 3OMEA 3BEZA 2Q35A 3OC7A 5MGBA 2HW5A 2J5GA 3GKBA 3RSTA 4KNPA 2QQ3A 2F9YA 3LKEA 1PIXA 3HP0A 4ELXA 3R9SA 1DUBA 3T8BA 3LAOA 2VX2A 3H0QA 3QYRA 5E0NX 2VREA 3PE8A 4U0GA 1XNVA 5DU8A 1WDLA 4Q0GA 1SZOA 1RJMA 3GF3A 3ST9A 2F9IA 1UYRA 2EJ5A 4JJTA 5DU4A 4K2NA 1PJHA 1XNWA 2VSUF 4EMLA 4GHNA 4J2UA 3BPPA 3Q7HA 3TVUA 3RSIA 2DUBA 4ZDFA 1Y7OA 2ZL0A 2PPYA 4JVTA 5CTCA 2D3TA 5JBXA 1N6DA 3IB9A 3Q0JA 1UIYA 5KDRA 1EF8A 2ZQQA 4NNQA 4RYFA 1Q52A 4MOUA 4L6WA 3TLFA 3QK8A 2BZRA 4I42A 3ZWAA 4QFEA 3H0SA 1TG6A 1XO6A 4WCZA 1UYTA 4B3IA 4I4ZA 5IKLB 2VSUA 3M6NA 3QREA 4JWVA 3PZKA 3P85A 4JSBA 2C8TA 1YG8A 3DORA 1YG6A 1NZYB 4IZCA 2X24A 3H0UA 2PG8A 4WYOB 4ZU2A 3K50A 3MT6A 4YLHA 1Q51A 3KQFA 4WZ8B 3SWXA 4FZWC 4FN8A 4FJWD 1K39A 3U9SB 1OD4A 2CBYA 2F9YB 3P2LA 4GM2A 4I52A 3TV5A 4ZDEA 1ON9A 3ZWBA 1WDKA 3QXZA 5DZKH 3DJAA 3TZ3A 1RJNA 4JYJA 4RYFH 3ZWCA 3ZW8A 5HUQA 4ELWA 4FZWA 3H02A 3BF0A 4IZBA 5DU6A 4F47A 3T8AA 3V5EA 1J7XA 3QKAA 3I47A 4NARA 3HE2A 5C90A 5DL1A 2ZL2A 5DTWA 4KWBA 4JFCA 2VSSA 5G1SA 1X0UA 2J5IB 1N6FA 2PBPA 5DZKA 3VIVA 1EF9A 5KJPA 4JOTA 3G64A 4HDTA 3H81A 2Q34A 2F6IA 3T3WA 1O8UA 1K32A 4K29A 3FDUA 4FB8A 5DUFA 4Q1IA 5G1RA 2ZL3A 1XX4A 3H0JA 1FC7A 1JXZA 3IAVA 4K3WA 5E0SH 4DI1A 3Q0GA 1EY3A 2VSSE 4JYLA 3ISAA 3L3SA 3PEAA 3JU1A 4U0GH 1WDMA 2W3PA 3QXIA 1HNUA 3BPTA 3SLLA 2VSUC 5CTBA 2VSSF 2J5IA 3PGQA 4U18A 3MYBA 3U9TB 5DTPA 1VRGA 3T89A 2IEXA 4JCTA 3K8XA 3GMAA 1W2XA 5INGA 3R0OA 3HINA 1UYSA 2Q2XA 1HZDA 3OT6A 4ZDBA 2UZFA 3N6RB 3R9TA 3KTIA 5FUSA 1OD2A 4FNDA 3GF7A 2ZQRA 2FBMA 3T88A 2A7KA 1FC9A 2CE3A 5KDRB 2DEOA 2J5GD 1XNYA 3P5MA 1ON3A 3U9RB 4JCSA 4NEKA 4MI2A 4ELSA 1HNOA 3M6MA 4QIIA 5JBWA 3KTKA 1NZYA 2GTRA 3NJDA 2A81A 2A7SA 3R9QA 4Z0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6H A;  3IBB A;  3TRR A;  4KD6 A;  4EMP A;  4ZDD A;  3MOY A;  5G1Q A;  3RRV A;  1FCF A;  2J5I I;  3HLN 1;  4RCN A;  3TVW A;  5INF A;  5INI A;  3TT7 A;  4L8K A;  4FN7 A;  4JCQ A;  3WG5 A;  5DUC A;  4EMM A;  1WZ8 A;  4B3J A;  1SG4 A;  1DCI A;  2ZL4 A;  4U1A A;  3QWD A;  3ZW9 A;  3NJB A;  4MXI A;  3GLM A;  5FIF A;  1FC6 A;  2FZS A;  3STA A;  4ZDC A;  1TYF A;  4JCR A;  4U0H A;  1N6E A;  4G2R A;  4HC8 A;  3FF6 A;  3TT6 A;  4OMR A;  3TDC A;  3Q1T A;  4IZD A;  3KTG A;  2FW2 A;  2WTB A;  2F9I B;  4QIJ A;  2J5S A;  4FNB A;  1MJ3 A;  3MFM A;  4ASI A;  4B3H A;  5E0S A;  3QMJ A;  4HNK A;  4KPK A;  5C9G A;  1UYV A;  3V5I A;  3KTH A;  3HRX A;  2VSU E;  5DKP A;  4U19 A;  4OLQ A;  2X58 A;  3KTJ A;  4LK5 A;  4OG1 A;  2F6Q A;  2NP9 A;  3OME A;  3BEZ A;  2Q35 A;  3OC7 A;  5MGB A;  2HW5 A;  2J5G A;  3GKB A;  3RST A;  4KNP A;  2QQ3 A;  2F9Y A;  3LKE A;  1PIX A;  3HP0 A;  4ELX A;  3R9S A;  1DUB A;  3T8B A;  3LAO A;  2VX2 A;  3H0Q A;  3QYR A;  5E0N X;  2VRE A;  3PE8 A;  4U0G A;  1XNV A;  5DU8 A;  1WDL A;  4Q0G A;  1SZO A;  1RJM A;  3GF3 A;  3ST9 A;  2F9I A;  1UYR A;  2EJ5 A;  4JJT A;  5DU4 A;  4K2N A;  1PJH A;  1XNW A;  2VSU F;  4EML A;  4GHN A;  3BPP A;  3Q7H A;  3TVU A;  3RSI A;  2DUB A;  4ZDF A;  1Y7O A;  2ZL0 A;  2PPY A;  4JVT A;  5CTC A;  2D3T A;  5JBX A;  1N6D A;  3IB9 A;  3Q0J A;  1UIY A;  5KDR A;  1EF8 A;  2ZQQ A;  4NNQ A;  4RYF A;  1Q52 A;  4MOU A;  4L6W A;  3TLF A;  3QK8 A;  2BZR A;  4I42 A;  3ZWA A;  4QFE A;  3H0S A;  1TG6 A;  1XO6 A;  4WCZ A;  1UYT A;  4B3I A;  4I4Z A;  5IKL B;  2VSU A;  3M6N A;  3QRE A;  4JWV A;  3PZK A;  3P85 A;  4JSB A;  2C8T A;  1YG8 A;  3DOR A;  1YG6 A;  1NZY B;  4IZC A;  2X24 A;  3H0U A;  2PG8 A;  4WYO B;  4ZU2 A;  3K50 A;  3MT6 A;  4YLH A;  1Q51 A;  3KQF A;  4WZ8 B;  3SWX A;  4FZW C;  4FN8 A;  4FJW D;  1K39 A;  3U9S B;  1OD4 A;  2CBY A;  2F9Y B;  3P2L A;  4GM2 A;  4I52 A;  3TV5 A;  4ZDE A;  1ON9 A;  3ZWB A;  1WDK A;  3QXZ A;  5DZK H;  3DJA A;  3TZ3 A;  1RJN A;  4JYJ A;  4RYF H;  3ZWC A;  3ZW8 A;  4ELW A;  4FZW A;  3H02 A;  3BF0 A;  4IZB A;  5DU6 A;  4F47 A;  3T8A A;  3V5E A;  1J7X A;  3QKA A;  3I47 A;  3HE2 A;  5C90 A;  5DL1 A;  2ZL2 A;  5DTW A;  4KWB A;  4JFC A;  2VSS A;  5G1S A;  1X0U A;  2J5I B;  1N6F A;  2PBP A;  5DZK A;  3VIV A;  1EF9 A;  5KJP A;  4JOT A;  3G64 A;  3H81 A;  2Q34 A;  2F6I A;  3T3W A;  1O8U A;  1K32 A;  4K29 A;  3FDU A;  4FB8 A;  5DUF A;  4Q1I A;  5G1R A;  2ZL3 A;  1XX4 A;  3H0J A;  1FC7 A;  1JXZ A;  3IAV A;  4K3W A;  5E0S H;  4DI1 A;  3Q0G A;  1EY3 A;  2VSS E;  4JYL A;  3ISA A;  3L3S A;  3PEA A;  3JU1 A;  4U0G H;  1WDM A;  2W3P A;  3QXI A;  1HNU A;  3SLL A;  2VSU C;  5CTB A;  2VSS F;  2J5I A;  3PGQ A;  4U18 A;  3MYB A;  3U9T B;  5DTP A;  1VRG A;  3T89 A;  2IEX A;  4JCT A;  3K8X A;  3GMA A;  1W2X A;  5ING A;  3R0O A;  3HIN A;  1UYS A;  2Q2X A;  1HZD A;  3OT6 A;  4ZDB A;  2UZF A;  3N6R B;  3R9T A;  3KTI A;  5FUS A;  1OD2 A;  4FND A;  3GF7 A;  2ZQR A;  2FBM A;  3T88 A;  2A7K A;  1FC9 A;  2CE3 A;  5KDR B;  2DEO A;  2J5G D;  1XNY A;  3P5M A;  1ON3 A;  3U9R B;  4JCS A;  4NEK A;  4MI2 A;  4ELS A;  1HNO A;  3M6M A;  4QII A;  5JBW A;  3KTK A;  1NZY A;  2GTR A;  3NJD A;  2A81 A;  2A7S A;  3R9Q A;  4Z0M A; 
#chains in the Genus database with same CATH topology
 3R6H A;  3IBB A;  3TRR A;  4KD6 A;  4EMP A;  4ZDD A;  3MOY A;  5G1Q A;  3RRV A;  1FCF A;  2J5I I;  3HLN 1;  4RCN A;  3TVW A;  5INF A;  5INI A;  3TT7 A;  4L8K A;  4FN7 A;  4JCQ A;  3WG5 A;  5DUC A;  4EMM A;  1WZ8 A;  4B3J A;  1SG4 A;  1DCI A;  2ZL4 A;  4U1A A;  3QWD A;  3ZW9 A;  3NJB A;  4MXI A;  3GLM A;  5FIF A;  1FC6 A;  2FZS A;  3STA A;  4ZDC A;  1TYF A;  4JCR A;  4U0H A;  1N6E A;  4G2R A;  4HC8 A;  3FF6 A;  3TT6 A;  4OMR A;  3TDC A;  3Q1T A;  4IZD A;  3KTG A;  2FW2 A;  2WTB A;  2F9I B;  4QIJ A;  2YJG A;  2J5S A;  4FNB A;  1MJ3 A;  3MFM A;  4ASI A;  4B3H A;  5E0S A;  3QMJ A;  4HNK A;  4KPK A;  5C9G A;  1UYV A;  3V5I A;  3KTH A;  3HRX A;  2VSU E;  5DKP A;  4U19 A;  4OLQ A;  2X58 A;  3KTJ A;  4LK5 A;  4OG1 A;  2F6Q A;  2NP9 A;  3OME A;  3BEZ A;  2Q35 A;  3OC7 A;  5MGB A;  2HW5 A;  2J5G A;  3GKB A;  3RST A;  4KNP A;  2QQ3 A;  2F9Y A;  3LKE A;  1PIX A;  3HP0 A;  4ELX A;  3R9S A;  1DUB A;  3T8B A;  3LAO A;  2VX2 A;  3H0Q A;  3QYR A;  5E0N X;  2VRE A;  3PE8 A;  4U0G A;  1XNV A;  5DU8 A;  1WDL A;  4Q0G A;  1SZO A;  1RJM A;  3GF3 A;  3ST9 A;  2F9I A;  1UYR A;  2EJ5 A;  4JJT A;  5DU4 A;  4K2N A;  1PJH A;  1XNW A;  2VSU F;  4EML A;  4GHN A;  4J2U A;  3BPP A;  3Q7H A;  3TVU A;  3RSI A;  2DUB A;  4ZDF A;  1Y7O A;  2ZL0 A;  2PPY A;  4JVT A;  5CTC A;  2D3T A;  5JBX A;  1N6D A;  3IB9 A;  3Q0J A;  1UIY A;  5KDR A;  1EF8 A;  2ZQQ A;  4NNQ A;  4RYF A;  1Q52 A;  4MOU A;  4L6W A;  3TLF A;  3QK8 A;  2BZR A;  4I42 A;  3ZWA A;  4QFE A;  3H0S A;  1TG6 A;  1XO6 A;  4WCZ A;  1UYT A;  4B3I A;  4I4Z A;  5IKL B;  2VSU A;  3M6N A;  3QRE A;  4JWV A;  3PZK A;  3P85 A;  4JSB A;  2C8T A;  1YG8 A;  3DOR A;  1YG6 A;  1NZY B;  4IZC A;  2X24 A;  3H0U A;  2PG8 A;  4WYO B;  4ZU2 A;  3K50 A;  3MT6 A;  4YLH A;  1Q51 A;  3KQF A;  4WZ8 B;  3SWX A;  4FZW C;  4FN8 A;  4FJW D;  1K39 A;  3U9S B;  1OD4 A;  2CBY A;  2F9Y B;  3P2L A;  4GM2 A;  4I52 A;  3TV5 A;  4ZDE A;  1ON9 A;  3ZWB A;  1WDK A;  3QXZ A;  5DZK H;  3DJA A;  3TZ3 A;  1RJN A;  4JYJ A;  4RYF H;  3ZWC A;  3ZW8 A;  5HUQ A;  4ELW A;  4FZW A;  3H02 A;  3BF0 A;  4IZB A;  5DU6 A;  4F47 A;  3T8A A;  3V5E A;  1J7X A;  3QKA A;  3I47 A;  4NAR A;  3HE2 A;  5C90 A;  5DL1 A;  2ZL2 A;  5DTW A;  4KWB A;  4JFC A;  2VSS A;  5G1S A;  1X0U A;  2J5I B;  1N6F A;  2PBP A;  5DZK A;  3VIV A;  1EF9 A;  5KJP A;  4JOT A;  3G64 A;  4HDT A;  3H81 A;  2Q34 A;  2F6I A;  3T3W A;  1O8U A;  1K32 A;  4K29 A;  3FDU A;  4FB8 A;  5DUF A;  4Q1I A;  5G1R A;  2ZL3 A;  1XX4 A;  3H0J A;  1FC7 A;  1JXZ A;  3IAV A;  4K3W A;  5E0S H;  4DI1 A;  3Q0G A;  1EY3 A;  2VSS E;  4JYL A;  3ISA A;  3L3S A;  3PEA A;  3JU1 A;  4U0G H;  1WDM A;  2W3P A;  3QXI A;  1HNU A;  3BPT A;  3SLL A;  2VSU C;  5CTB A;  2VSS F;  2J5I A;  3PGQ A;  4U18 A;  3MYB A;  3U9T B;  5DTP A;  1VRG A;  3T89 A;  2IEX A;  4JCT A;  3K8X A;  3GMA A;  1W2X A;  5ING A;  3R0O A;  3HIN A;  1UYS A;  2Q2X A;  1HZD A;  3OT6 A;  4ZDB A;  2UZF A;  3N6R B;  3R9T A;  3KTI A;  5FUS A;  1OD2 A;  4FND A;  3GF7 A;  2ZQR A;  2FBM A;  3T88 A;  2A7K A;  1FC9 A;  2CE3 A;  5KDR B;  2DEO A;  2J5G D;  1XNY A;  3P5M A;  1ON3 A;  3U9R B;  4JCS A;  4NEK A;  4MI2 A;  4ELS A;  1HNO A;  3M6M A;  4QII A;  5JBW A;  3KTK A;  1NZY A;  2GTR A;  3NJD A;  2A81 A;  2A7S A;  3R9Q A;  4Z0M A; 
#chains in the Genus database with same CATH homology
 3R6H A;  3IBB A;  3TRR A;  4KD6 A;  4EMP A;  4ZDD A;  3MOY A;  5G1Q A;  3RRV A;  1FCF A;  2J5I I;  3HLN 1;  4RCN A;  3TVW A;  5INF A;  5INI A;  3TT7 A;  4L8K A;  4FN7 A;  4JCQ A;  3WG5 A;  5DUC A;  4EMM A;  1WZ8 A;  4B3J A;  1SG4 A;  1DCI A;  2ZL4 A;  4U1A A;  3QWD A;  3ZW9 A;  3NJB A;  4MXI A;  3GLM A;  5FIF A;  1FC6 A;  2FZS A;  3STA A;  4ZDC A;  1TYF A;  4JCR A;  4U0H A;  1N6E A;  4G2R A;  4HC8 A;  3FF6 A;  3TT6 A;  4OMR A;  3TDC A;  3Q1T A;  4IZD A;  3KTG A;  2FW2 A;  2WTB A;  2F9I B;  4QIJ A;  2YJG A;  2J5S A;  4FNB A;  1MJ3 A;  3MFM A;  4ASI A;  4B3H A;  5E0S A;  3QMJ A;  4HNK A;  4KPK A;  5C9G A;  1UYV A;  3V5I A;  3KTH A;  3HRX A;  2VSU E;  5DKP A;  4U19 A;  4OLQ A;  2X58 A;  3KTJ A;  4LK5 A;  4OG1 A;  2F6Q A;  2NP9 A;  3OME A;  3BEZ A;  2Q35 A;  3OC7 A;  5MGB A;  2HW5 A;  2J5G A;  3GKB A;  3RST A;  4KNP A;  2QQ3 A;  2F9Y A;  3LKE A;  1PIX A;  3HP0 A;  4ELX A;  3R9S A;  1DUB A;  3T8B A;  3LAO A;  2VX2 A;  3H0Q A;  3QYR A;  5E0N X;  2VRE A;  3PE8 A;  4U0G A;  1XNV A;  5DU8 A;  1WDL A;  4Q0G A;  1SZO A;  1RJM A;  3GF3 A;  3ST9 A;  2F9I A;  1UYR A;  2EJ5 A;  4JJT A;  5DU4 A;  4K2N A;  1PJH A;  1XNW A;  2VSU F;  4EML A;  4GHN A;  4J2U A;  3BPP A;  3Q7H A;  3TVU A;  3RSI A;  2DUB A;  4ZDF A;  1Y7O A;  2ZL0 A;  2PPY A;  4JVT A;  5CTC A;  2D3T A;  5JBX A;  1N6D A;  3IB9 A;  3Q0J A;  1UIY A;  5KDR A;  1EF8 A;  2ZQQ A;  4NNQ A;  4RYF A;  1Q52 A;  4MOU A;  4L6W A;  3TLF A;  3QK8 A;  2BZR A;  4I42 A;  3ZWA A;  4QFE A;  3H0S A;  1TG6 A;  1XO6 A;  4WCZ A;  1UYT A;  4B3I A;  4I4Z A;  5IKL B;  2VSU A;  3M6N A;  3QRE A;  4JWV A;  3PZK A;  3P85 A;  4JSB A;  2C8T A;  1YG8 A;  3DOR A;  1YG6 A;  1NZY B;  4IZC A;  2X24 A;  3H0U A;  2PG8 A;  4WYO B;  4ZU2 A;  3K50 A;  3MT6 A;  4YLH A;  1Q51 A;  3KQF A;  4WZ8 B;  3SWX A;  4FZW C;  4FN8 A;  4FJW D;  1K39 A;  3U9S B;  1OD4 A;  2CBY A;  2F9Y B;  3P2L A;  4GM2 A;  4I52 A;  3TV5 A;  4ZDE A;  1ON9 A;  3ZWB A;  1WDK A;  3QXZ A;  5DZK H;  3DJA A;  3TZ3 A;  1RJN A;  4JYJ A;  4RYF H;  3ZWC A;  3ZW8 A;  5HUQ A;  4ELW A;  4FZW A;  3H02 A;  3BF0 A;  4IZB A;  5DU6 A;  4F47 A;  3T8A A;  3V5E A;  1J7X A;  3QKA A;  3I47 A;  4NAR A;  3HE2 A;  5C90 A;  5DL1 A;  2ZL2 A;  5DTW A;  4KWB A;  4JFC A;  2VSS A;  5G1S A;  1X0U A;  2J5I B;  1N6F A;  2PBP A;  5DZK A;  3VIV A;  1EF9 A;  5KJP A;  4JOT A;  3G64 A;  4HDT A;  3H81 A;  2Q34 A;  2F6I A;  3T3W A;  1O8U A;  1K32 A;  4K29 A;  3FDU A;  4FB8 A;  5DUF A;  4Q1I A;  5G1R A;  2ZL3 A;  1XX4 A;  3H0J A;  1FC7 A;  1JXZ A;  3IAV A;  4K3W A;  5E0S H;  4DI1 A;  3Q0G A;  1EY3 A;  2VSS E;  4JYL A;  3ISA A;  3L3S A;  3PEA A;  3JU1 A;  4U0G H;  1WDM A;  2W3P A;  3QXI A;  1HNU A;  3BPT A;  3SLL A;  2VSU C;  5CTB A;  2VSS F;  2J5I A;  3PGQ A;  4U18 A;  3MYB A;  3U9T B;  5DTP A;  1VRG A;  3T89 A;  2IEX A;  4JCT A;  3K8X A;  3GMA A;  1W2X A;  5ING A;  3R0O A;  3HIN A;  1UYS A;  2Q2X A;  1HZD A;  3OT6 A;  4ZDB A;  2UZF A;  3N6R B;  3R9T A;  3KTI A;  5FUS A;  1OD2 A;  4FND A;  3GF7 A;  2ZQR A;  2FBM A;  3T88 A;  2A7K A;  1FC9 A;  2CE3 A;  5KDR B;  2DEO A;  2J5G D;  1XNY A;  3P5M A;  1ON3 A;  3U9R B;  4JCS A;  4NEK A;  4MI2 A;  4ELS A;  1HNO A;  3M6M A;  4QII A;  5JBW A;  3KTK A;  1NZY A;  2GTR A;  3NJD A;  2A81 A;  2A7S A;  3R9Q A;  4Z0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...