1ON3A

Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound)
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
517
structure length
517
Chain Sequence
KLASTMEGRVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNNTEEASFVNPNNDVSPNTELRDIVPIDGKKGYDVRDVIAKIVDWGDYLEVKAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMCNRDLGADAVYAWPSAEIAVMGAEGAANVIFRKEIKAADDPDAMRAEKIEEYQNAFNTPYVAAARGQVDDVIDPADTRRKIASALEMYATKRQTRPAKKHGNFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core
pubmed doi rcsb
source organism Propionibacterium freudenreichii
molecule tags Transferase
molecule keywords Methylmalonyl-CoA carboxyltransferase 12S subunit
total genus 196
structure length 517
sequence length 517
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on3A01
3K50A 5CTBA 2F6IA 5DZKA 2J5IB 4WYOB 3GLMA 3RSTA 1J7XA 1UIYA 1PJHA 1XO6A 3DJAA 3V5EA 3RSIA 2A81A 3T88A 2UZFA 3TLFA 4FZWC 3ZW8A 3ZWCA 3H0SA 4ZU2A 5G1RA 1OD2A 5INGA 4EMMA 5DUFA 2F6QA 2EJ5A 3KTIA 4I42A 4YLHA 1Y7OA 2A7KA 3QREA 4FNBA 5IKLB 2DEOA 1FCFA 3Q0JA 2QQ3A 3QWDA 3TT7A 3GMAA 5C90A 4JJTA 4OLQA 3H0QA 1YG6A 4ZDDA 4K29A 5MGBA 4JYJA 1HNOA 2NP9A 2VSSE 3ZW9A 3LAOA 3I47A 2X24A 4K2NA 3M6MA 1ON3A 3R9TA 5DTWA 4IZCA 3R9SA 4KPKA 1EF8A 5JBWA 2HW5A 1SZOA 3HLN1 3P5MA 3U9RB 1UYTA 1MJ3A 3QYRA 1XX4A 4RYFH 2ZL3A 4NNQA 1EF9A 3MT6A 3IAVA 1K39A 4KNPA 3TVWA 5CTCA 4U0GA 3G64A 4FN8A 4JCTA 3OT6A 1DUBA 4FB8A 4GHNA 2C8TA 1EY3A 3IBBA 3FDUA 4FZWA 3ZWAA 4NEKA 1N6EA 5FIFA 3H0JA 3GF3A 4G2RA 3H02A 1WDLA 3T8BA 2A7SA 3P2LA 2ZQQA 5FUSA 2F9IB 2F9YB 2VSUC 4HC8A 2VSUE 4IZDA 4JCSA 3DORA 1FC9A 2VSUF 2IEXA 3KQFA 3OMEA 4ASIA 4QFEA 2PPYA 3R0OA 5DTPA 4ELWA 2W3PA 2DUBA 3PEAA 1Q52A 3VIVA 4Z0MA 3BEZA 2ZL0A 1UYRA 1UYVA 3MYBA 1XNVA 4RYFA 2WTBA 4OMRA 3QXIA 5KDRB 3HE2A 3QKAA 4K3WA 1NZYA 3MFMA 3KTJA 4U1AA 4HNKA 3TDCA 4ELSA 4OG1A 5G1QA 3NJDA 1X0UA 3BF0A 5DU6A 4EMPA 3PGQA 3TV5A 5E0NX 3SLLA 3Q0GA 5KDRA 2PBPA 4KWBA 4L8KA 4Q1IA 1WDKA 3TZ3A 3KTGA 1N6FA 4I4ZA 4JYLA 2Q2XA 1RJMA 2D3TA 1XNYA 2F9YA 2ZL4A 5E0SH 3P85A 3QK8A 5DZKH 1DCIA 2VSSA 5DKPA 5KJPA 4U0GH 3L3SA 2ZQRA 4WZ8B 3TVUA 2J5II 4WCZA 4U19A 2GTRA 5DL1A 4L6WA 3T3WA 4LK5A 1TG6A 3QXZA 1TYFA 2CE3A 2BZRA 4U18A 4U0HA 3R9QA 4JWVA 2Q34A 3OC7A 4JVTA 1N6DA 3WG5A 4DI1A 3H0UA 4Q0GA 4JSBA 2J5GA 5DUCA 1XNWA 4JCQA 3RRVA 5INFA 1WDMA 1JXZA 2J5SA 2VX2A 4B3IA 4RCNA 2X58A 3M6NA 2PG8A 3Q1TA 5DU8A 3STAA 1K32A 3U9TB 3BPPA 4FN7A 3HP0A 4B3HA 3TT6A 3IB9A 2FW2A 4ZDCA 1HZDA 3HINA 3NJBA 1VRGA 3PE8A 2FBMA 1O8UA 2Q35A 1W2XA 4FNDA 2FZSA 3R6HA 3GKBA 3N6RB 3TRRA 1HNUA 3ZWBA 3PZKA 3V5IA 3H81A 4ELXA 3T8AA 3QMJA 3ISAA 3HRXA 1WZ8A 5C9GA 4MXIA 4QIJA 3FF6A 1SG4A 4ZDEA 3SWXA 2CBYA 2VSUA 1NZYB 4EMLA 1Q51A 4QIIA 3MOYA 2VREA 1FC6A 5DU4A 1PIXA 4JCRA 1FC7A 5INIA 4KD6A 3LKEA 5JBXA 4ZDBA 1YG8A 5E0SA 1RJNA 4FJWD 1UYSA 4I52A 3KTHA 4MI2A 3Q7HA 4MOUA 4B3JA 3KTKA 4ZDFA 2J5IA 2ZL2A 4GM2A 2VSSF 3JU1A 3T89A 4IZBA 3K8XA 1OD4A 3GF7A 2J5GD 4JOTA 3U9SB 2F9IA 5G1SA 3ST9A 4F47A 4JFCA 1ON9A
chains in the Genus database with same CATH superfamily
3K50A 5CTBA 2F6IA 5DZKA 2J5IB 4WYOB 3GLMA 3RSTA 1J7XA 1UIYA 1PJHA 1XO6A 3DJAA 3V5EA 3RSIA 2A81A 3T88A 2UZFA 3TLFA 4FZWC 3ZW8A 3ZWCA 3H0SA 4ZU2A 5G1RA 1OD2A 5INGA 4EMMA 5DUFA 2F6QA 2EJ5A 3KTIA 4I42A 4YLHA 1Y7OA 2A7KA 3QREA 4FNBA 5IKLB 2DEOA 1FCFA 3Q0JA 2QQ3A 3QWDA 3TT7A 3GMAA 5C90A 4JJTA 4OLQA 3H0QA 1YG6A 4ZDDA 4K29A 5MGBA 4JYJA 1HNOA 2NP9A 2VSSE 3ZW9A 3LAOA 3I47A 2X24A 4K2NA 3M6MA 1ON3A 3R9TA 5DTWA 4IZCA 3R9SA 4KPKA 1EF8A 5JBWA 2HW5A 1SZOA 3HLN1 3P5MA 3U9RB 1UYTA 1MJ3A 3QYRA 1XX4A 4RYFH 2ZL3A 4NNQA 1EF9A 3MT6A 3IAVA 1K39A 4KNPA 3TVWA 5CTCA 4U0GA 4J2UA 3G64A 4FN8A 4JCTA 3OT6A 1DUBA 4FB8A 4GHNA 2C8TA 1EY3A 3IBBA 3FDUA 4FZWA 3ZWAA 4NEKA 1N6EA 5FIFA 3H0JA 3GF3A 4G2RA 3H02A 1WDLA 3T8BA 2A7SA 3P2LA 2ZQQA 5FUSA 2F9IB 2F9YB 2VSUC 4HC8A 2VSUE 4IZDA 4JCSA 3DORA 1FC9A 2VSUF 2IEXA 3KQFA 4NARA 3OMEA 4ASIA 4QFEA 2PPYA 3R0OA 5DTPA 4ELWA 2W3PA 2DUBA 3PEAA 1Q52A 3VIVA 4Z0MA 3BEZA 2ZL0A 1UYRA 1UYVA 3MYBA 1XNVA 4RYFA 2WTBA 4OMRA 3QXIA 4K3WA 3HE2A 3QKAA 5KDRB 1NZYA 3MFMA 3KTJA 4U1AA 4HNKA 3TDCA 4ELSA 4OG1A 5G1QA 2YJGA 3NJDA 1X0UA 3BF0A 5DU6A 4EMPA 3PGQA 3TV5A 5E0NX 3SLLA 3Q0GA 5KDRA 2PBPA 4KWBA 4L8KA 4Q1IA 1WDKA 3TZ3A 3KTGA 1N6FA 4I4ZA 4JYLA 2Q2XA 1RJMA 2D3TA 1XNYA 2F9YA 2ZL4A 5E0SH 3P85A 3QK8A 5DZKH 1DCIA 2VSSA 5DKPA 5KJPA 4HDTA 4U0GH 3L3SA 2ZQRA 4WZ8B 3TVUA 2J5II 4WCZA 4U19A 2GTRA 5DL1A 4L6WA 3T3WA 4LK5A 1TG6A 3QXZA 1TYFA 2CE3A 2BZRA 4U18A 4U0HA 3R9QA 4JWVA 2Q34A 3OC7A 4JVTA 1N6DA 3WG5A 4DI1A 3H0UA 4Q0GA 4JSBA 2J5GA 5DUCA 1XNWA 4JCQA 3RRVA 5INFA 3BPTA 1WDMA 1JXZA 2J5SA 2VX2A 4B3IA 4RCNA 2X58A 3M6NA 2PG8A 3Q1TA 5DU8A 3STAA 1K32A 3U9TB 5HUQA 3BPPA 4FN7A 3HP0A 4B3HA 3TT6A 3IB9A 2FW2A 4ZDCA 1HZDA 3HINA 3NJBA 1VRGA 3PE8A 2FBMA 1O8UA 2Q35A 1W2XA 4FNDA 2FZSA 3R6HA 3GKBA 3N6RB 3TRRA 1HNUA 3ZWBA 3PZKA 3V5IA 3H81A 4ELXA 3T8AA 3QMJA 3ISAA 3HRXA 1WZ8A 5C9GA 4MXIA 4QIJA 3FF6A 1SG4A 4ZDEA 3SWXA 2CBYA 2VSUA 1NZYB 4EMLA 1Q51A 4QIIA 3MOYA 2VREA 1FC6A 5DU4A 1PIXA 4JCRA 1FC7A 5INIA 4KD6A 3LKEA 5JBXA 4ZDBA 1YG8A 5E0SA 1RJNA 4FJWD 1UYSA 4I52A 3KTHA 4MI2A 3Q7HA 4MOUA 4B3JA 3KTKA 4ZDFA 2J5IA 2ZL2A 4GM2A 2VSSF 3JU1A 3T89A 4IZBA 3K8XA 1OD4A 3GF7A 2J5GD 4JOTA 3U9SB 2F9IA 5G1SA 3ST9A 4F47A 4JFCA 1ON9A
chains in the Genus database with same CATH topology
3K50A 5CTBA 2F6IA 5DZKA 2J5IB 4WYOB 3GLMA 3RSTA 1J7XA 1UIYA 1PJHA 1XO6A 3DJAA 3V5EA 3RSIA 2A81A 3T88A 2UZFA 3TLFA 4FZWC 3ZW8A 3ZWCA 3H0SA 4ZU2A 5G1RA 1OD2A 5INGA 4EMMA 5DUFA 2F6QA 2EJ5A 3KTIA 4I42A 4YLHA 1Y7OA 2A7KA 3QREA 4FNBA 5IKLB 2DEOA 1FCFA 3Q0JA 2QQ3A 3QWDA 3TT7A 3GMAA 5C90A 4JJTA 4OLQA 3H0QA 1YG6A 4ZDDA 4K29A 5MGBA 4JYJA 1HNOA 2NP9A 2VSSE 3ZW9A 3LAOA 3I47A 2X24A 4K2NA 3M6MA 1ON3A 3R9TA 5DTWA 4IZCA 3R9SA 4KPKA 1EF8A 5JBWA 2HW5A 1SZOA 3HLN1 3P5MA 3U9RB 1UYTA 1MJ3A 3QYRA 1XX4A 4RYFH 2ZL3A 4NNQA 1EF9A 3MT6A 3IAVA 1K39A 4KNPA 3TVWA 5CTCA 4U0GA 4J2UA 3G64A 4FN8A 4JCTA 3OT6A 1DUBA 4FB8A 4GHNA 2C8TA 1EY3A 3IBBA 3FDUA 4FZWA 3ZWAA 4NEKA 1N6EA 5FIFA 3H0JA 3GF3A 4G2RA 3H02A 1WDLA 3T8BA 2A7SA 3P2LA 2ZQQA 5FUSA 2F9IB 2F9YB 2VSUC 4HC8A 2VSUE 4IZDA 4JCSA 3DORA 1FC9A 2VSUF 2IEXA 3KQFA 4NARA 3OMEA 4ASIA 4QFEA 2PPYA 3R0OA 5DTPA 4ELWA 2W3PA 2DUBA 3PEAA 1Q52A 3VIVA 4Z0MA 3BEZA 2ZL0A 1UYRA 1UYVA 3MYBA 1XNVA 4RYFA 2WTBA 4OMRA 3QXIA 4K3WA 3HE2A 3QKAA 5KDRB 1NZYA 3MFMA 3KTJA 4U1AA 4HNKA 3TDCA 4ELSA 4OG1A 5G1QA 2YJGA 3NJDA 1X0UA 3BF0A 5DU6A 4EMPA 3PGQA 3TV5A 5E0NX 3SLLA 3Q0GA 5KDRA 2PBPA 4KWBA 4L8KA 4Q1IA 1WDKA 3TZ3A 3KTGA 1N6FA 4I4ZA 4JYLA 2Q2XA 1RJMA 2D3TA 1XNYA 2F9YA 2ZL4A 5E0SH 3P85A 3QK8A 5DZKH 1DCIA 2VSSA 5DKPA 5KJPA 4HDTA 4U0GH 3L3SA 2ZQRA 4WZ8B 3TVUA 2J5II 4WCZA 4U19A 2GTRA 5DL1A 4L6WA 3T3WA 4LK5A 1TG6A 3QXZA 1TYFA 2CE3A 2BZRA 4U18A 4U0HA 3R9QA 4JWVA 2Q34A 3OC7A 4JVTA 1N6DA 3WG5A 4DI1A 3H0UA 4Q0GA 4JSBA 2J5GA 5DUCA 1XNWA 4JCQA 3RRVA 5INFA 3BPTA 1WDMA 1JXZA 2J5SA 2VX2A 4B3IA 4RCNA 2X58A 3M6NA 2PG8A 3Q1TA 5DU8A 3STAA 1K32A 3U9TB 5HUQA 3BPPA 4FN7A 3HP0A 4B3HA 3TT6A 3IB9A 2FW2A 4ZDCA 1HZDA 3HINA 3NJBA 1VRGA 3PE8A 2FBMA 1O8UA 2Q35A 1W2XA 4FNDA 2FZSA 3R6HA 3GKBA 3N6RB 3TRRA 1HNUA 3ZWBA 3PZKA 3V5IA 3H81A 4ELXA 3T8AA 3QMJA 3ISAA 3HRXA 1WZ8A 5C9GA 4MXIA 4QIJA 3FF6A 1SG4A 4ZDEA 3SWXA 2CBYA 2VSUA 1NZYB 4EMLA 1Q51A 4QIIA 3MOYA 2VREA 1FC6A 5DU4A 1PIXA 4JCRA 1FC7A 5INIA 4KD6A 3LKEA 5JBXA 4ZDBA 1YG8A 5E0SA 1RJNA 4FJWD 1UYSA 4I52A 3KTHA 4MI2A 3Q7HA 4MOUA 4B3JA 3KTKA 4ZDFA 2J5IA 2ZL2A 4GM2A 2VSSF 3JU1A 3T89A 4IZBA 3K8XA 1OD4A 3GF7A 2J5GD 4JOTA 3U9SB 2F9IA 5G1SA 3ST9A 4F47A 4JFCA 1ON9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K50 A;  5CTB A;  2F6I A;  5DZK A;  2J5I B;  4WYO B;  3GLM A;  3RST A;  1J7X A;  1UIY A;  1PJH A;  1XO6 A;  3DJA A;  3V5E A;  3RSI A;  2A81 A;  3T88 A;  2UZF A;  3TLF A;  4FZW C;  3ZW8 A;  3ZWC A;  3H0S A;  4ZU2 A;  5G1R A;  1OD2 A;  5ING A;  4EMM A;  5DUF A;  2F6Q A;  2EJ5 A;  3KTI A;  4I42 A;  4YLH A;  1Y7O A;  2A7K A;  3QRE A;  4FNB A;  5IKL B;  2DEO A;  1FCF A;  3Q0J A;  2QQ3 A;  3QWD A;  3TT7 A;  3GMA A;  5C90 A;  4JJT A;  4OLQ A;  3H0Q A;  1YG6 A;  4ZDD A;  4K29 A;  5MGB A;  4JYJ A;  1HNO A;  2NP9 A;  2VSS E;  3ZW9 A;  3LAO A;  3I47 A;  2X24 A;  4K2N A;  3M6M A;  1ON3 A;  3R9T A;  5DTW A;  4IZC A;  3R9S A;  4KPK A;  1EF8 A;  5JBW A;  2HW5 A;  1SZO A;  3HLN 1;  3P5M A;  3U9R B;  1UYT A;  1MJ3 A;  3QYR A;  1XX4 A;  4RYF H;  2ZL3 A;  4NNQ A;  1EF9 A;  3MT6 A;  3IAV A;  1K39 A;  4KNP A;  3TVW A;  5CTC A;  4U0G A;  3G64 A;  4FN8 A;  4JCT A;  3OT6 A;  1DUB A;  4FB8 A;  4GHN A;  2C8T A;  1EY3 A;  3IBB A;  3FDU A;  4FZW A;  3ZWA A;  4NEK A;  1N6E A;  5FIF A;  3H0J A;  3GF3 A;  4G2R A;  3H02 A;  1WDL A;  3T8B A;  2A7S A;  3P2L A;  2ZQQ A;  5FUS A;  2F9I B;  2F9Y B;  2VSU C;  4HC8 A;  2VSU E;  4IZD A;  4JCS A;  3DOR A;  1FC9 A;  2VSU F;  2IEX A;  3KQF A;  3OME A;  4ASI A;  4QFE A;  2PPY A;  3R0O A;  5DTP A;  4ELW A;  2W3P A;  2DUB A;  3PEA A;  1Q52 A;  3VIV A;  4Z0M A;  3BEZ A;  2ZL0 A;  1UYR A;  1UYV A;  3MYB A;  1XNV A;  4RYF A;  2WTB A;  4OMR A;  3QXI A;  5KDR B;  3HE2 A;  3QKA A;  4K3W A;  1NZY A;  3MFM A;  3KTJ A;  4U1A A;  4HNK A;  3TDC A;  4ELS A;  4OG1 A;  5G1Q A;  3NJD A;  1X0U A;  3BF0 A;  5DU6 A;  4EMP A;  3PGQ A;  3TV5 A;  5E0N X;  3SLL A;  3Q0G A;  5KDR A;  2PBP A;  4KWB A;  4L8K A;  4Q1I A;  1WDK A;  3TZ3 A;  3KTG A;  1N6F A;  4I4Z A;  4JYL A;  2Q2X A;  1RJM A;  2D3T A;  1XNY A;  2F9Y A;  2ZL4 A;  5E0S H;  3P85 A;  3QK8 A;  5DZK H;  1DCI A;  2VSS A;  5DKP A;  5KJP A;  4U0G H;  3L3S A;  2ZQR A;  4WZ8 B;  3TVU A;  2J5I I;  4WCZ A;  4U19 A;  2GTR A;  5DL1 A;  4L6W A;  3T3W A;  4LK5 A;  1TG6 A;  3QXZ A;  1TYF A;  2CE3 A;  2BZR A;  4U18 A;  4U0H A;  3R9Q A;  4JWV A;  2Q34 A;  3OC7 A;  4JVT A;  1N6D A;  3WG5 A;  4DI1 A;  3H0U A;  4Q0G A;  4JSB A;  2J5G A;  5DUC A;  1XNW A;  4JCQ A;  3RRV A;  5INF A;  1WDM A;  1JXZ A;  2J5S A;  2VX2 A;  4B3I A;  4RCN A;  2X58 A;  3M6N A;  2PG8 A;  3Q1T A;  5DU8 A;  3STA A;  1K32 A;  3U9T B;  3BPP A;  4FN7 A;  3HP0 A;  4B3H A;  3TT6 A;  3IB9 A;  2FW2 A;  4ZDC A;  1HZD A;  3HIN A;  3NJB A;  1VRG A;  3PE8 A;  2FBM A;  1O8U A;  2Q35 A;  1W2X A;  4FND A;  2FZS A;  3R6H A;  3GKB A;  3N6R B;  3TRR A;  1HNU A;  3ZWB A;  3PZK A;  3V5I A;  3H81 A;  4ELX A;  3T8A A;  3QMJ A;  3ISA A;  3HRX A;  1WZ8 A;  5C9G A;  4MXI A;  4QIJ A;  3FF6 A;  1SG4 A;  4ZDE A;  3SWX A;  2CBY A;  2VSU A;  1NZY B;  4EML A;  1Q51 A;  4QII A;  3MOY A;  2VRE A;  1FC6 A;  5DU4 A;  1PIX A;  4JCR A;  1FC7 A;  5INI A;  4KD6 A;  3LKE A;  5JBX A;  4ZDB A;  1YG8 A;  5E0S A;  1RJN A;  4FJW D;  1UYS A;  4I52 A;  3KTH A;  4MI2 A;  3Q7H A;  4MOU A;  4B3J A;  3KTK A;  4ZDF A;  2J5I A;  2ZL2 A;  4GM2 A;  2VSS F;  3JU1 A;  3T89 A;  4IZB A;  3K8X A;  1OD4 A;  3GF7 A;  2J5G D;  4JOT A;  3U9S B;  2F9I A;  5G1S A;  3ST9 A;  4F47 A;  4JFC A;  1ON9 A; 
#chains in the Genus database with same CATH topology
 3K50 A;  5CTB A;  2F6I A;  5DZK A;  2J5I B;  4WYO B;  3GLM A;  3RST A;  1J7X A;  1UIY A;  1PJH A;  1XO6 A;  3DJA A;  3V5E A;  3RSI A;  2A81 A;  3T88 A;  2UZF A;  3TLF A;  4FZW C;  3ZW8 A;  3ZWC A;  3H0S A;  4ZU2 A;  5G1R A;  1OD2 A;  5ING A;  4EMM A;  5DUF A;  2F6Q A;  2EJ5 A;  3KTI A;  4I42 A;  4YLH A;  1Y7O A;  2A7K A;  3QRE A;  4FNB A;  5IKL B;  2DEO A;  1FCF A;  3Q0J A;  2QQ3 A;  3QWD A;  3TT7 A;  3GMA A;  5C90 A;  4JJT A;  4OLQ A;  3H0Q A;  1YG6 A;  4ZDD A;  4K29 A;  5MGB A;  4JYJ A;  1HNO A;  2NP9 A;  2VSS E;  3ZW9 A;  3LAO A;  3I47 A;  2X24 A;  4K2N A;  3M6M A;  1ON3 A;  3R9T A;  5DTW A;  4IZC A;  3R9S A;  4KPK A;  1EF8 A;  5JBW A;  2HW5 A;  1SZO A;  3HLN 1;  3P5M A;  3U9R B;  1UYT A;  1MJ3 A;  3QYR A;  1XX4 A;  4RYF H;  2ZL3 A;  4NNQ A;  1EF9 A;  3MT6 A;  3IAV A;  1K39 A;  4KNP A;  3TVW A;  5CTC A;  4U0G A;  4J2U A;  3G64 A;  4FN8 A;  4JCT A;  3OT6 A;  1DUB A;  4FB8 A;  4GHN A;  2C8T A;  1EY3 A;  3IBB A;  3FDU A;  4FZW A;  3ZWA A;  4NEK A;  1N6E A;  5FIF A;  3H0J A;  3GF3 A;  4G2R A;  3H02 A;  1WDL A;  3T8B A;  2A7S A;  3P2L A;  2ZQQ A;  5FUS A;  2F9I B;  2F9Y B;  2VSU C;  4HC8 A;  2VSU E;  4IZD A;  4JCS A;  3DOR A;  1FC9 A;  2VSU F;  2IEX A;  3KQF A;  4NAR A;  3OME A;  4ASI A;  4QFE A;  2PPY A;  3R0O A;  5DTP A;  4ELW A;  2W3P A;  2DUB A;  3PEA A;  1Q52 A;  3VIV A;  4Z0M A;  3BEZ A;  2ZL0 A;  1UYR A;  1UYV A;  3MYB A;  1XNV A;  4RYF A;  2WTB A;  4OMR A;  3QXI A;  4K3W A;  3HE2 A;  3QKA A;  5KDR B;  1NZY A;  3MFM A;  3KTJ A;  4U1A A;  4HNK A;  3TDC A;  4ELS A;  4OG1 A;  5G1Q A;  2YJG A;  3NJD A;  1X0U A;  3BF0 A;  5DU6 A;  4EMP A;  3PGQ A;  3TV5 A;  5E0N X;  3SLL A;  3Q0G A;  5KDR A;  2PBP A;  4KWB A;  4L8K A;  4Q1I A;  1WDK A;  3TZ3 A;  3KTG A;  1N6F A;  4I4Z A;  4JYL A;  2Q2X A;  1RJM A;  2D3T A;  1XNY A;  2F9Y A;  2ZL4 A;  5E0S H;  3P85 A;  3QK8 A;  5DZK H;  1DCI A;  2VSS A;  5DKP A;  5KJP A;  4HDT A;  4U0G H;  3L3S A;  2ZQR A;  4WZ8 B;  3TVU A;  2J5I I;  4WCZ A;  4U19 A;  2GTR A;  5DL1 A;  4L6W A;  3T3W A;  4LK5 A;  1TG6 A;  3QXZ A;  1TYF A;  2CE3 A;  2BZR A;  4U18 A;  4U0H A;  3R9Q A;  4JWV A;  2Q34 A;  3OC7 A;  4JVT A;  1N6D A;  3WG5 A;  4DI1 A;  3H0U A;  4Q0G A;  4JSB A;  2J5G A;  5DUC A;  1XNW A;  4JCQ A;  3RRV A;  5INF A;  3BPT A;  1WDM A;  1JXZ A;  2J5S A;  2VX2 A;  4B3I A;  4RCN A;  2X58 A;  3M6N A;  2PG8 A;  3Q1T A;  5DU8 A;  3STA A;  1K32 A;  3U9T B;  5HUQ A;  3BPP A;  4FN7 A;  3HP0 A;  4B3H A;  3TT6 A;  3IB9 A;  2FW2 A;  4ZDC A;  1HZD A;  3HIN A;  3NJB A;  1VRG A;  3PE8 A;  2FBM A;  1O8U A;  2Q35 A;  1W2X A;  4FND A;  2FZS A;  3R6H A;  3GKB A;  3N6R B;  3TRR A;  1HNU A;  3ZWB A;  3PZK A;  3V5I A;  3H81 A;  4ELX A;  3T8A A;  3QMJ A;  3ISA A;  3HRX A;  1WZ8 A;  5C9G A;  4MXI A;  4QIJ A;  3FF6 A;  1SG4 A;  4ZDE A;  3SWX A;  2CBY A;  2VSU A;  1NZY B;  4EML A;  1Q51 A;  4QII A;  3MOY A;  2VRE A;  1FC6 A;  5DU4 A;  1PIX A;  4JCR A;  1FC7 A;  5INI A;  4KD6 A;  3LKE A;  5JBX A;  4ZDB A;  1YG8 A;  5E0S A;  1RJN A;  4FJW D;  1UYS A;  4I52 A;  3KTH A;  4MI2 A;  3Q7H A;  4MOU A;  4B3J A;  3KTK A;  4ZDF A;  2J5I A;  2ZL2 A;  4GM2 A;  2VSS F;  3JU1 A;  3T89 A;  4IZB A;  3K8X A;  1OD4 A;  3GF7 A;  2J5G D;  4JOT A;  3U9S B;  2F9I A;  5G1S A;  3ST9 A;  4F47 A;  4JFC A;  1ON9 A; 
#chains in the Genus database with same CATH homology
 3K50 A;  5CTB A;  2F6I A;  5DZK A;  2J5I B;  4WYO B;  3GLM A;  3RST A;  1J7X A;  1UIY A;  1PJH A;  1XO6 A;  3DJA A;  3V5E A;  3RSI A;  2A81 A;  3T88 A;  2UZF A;  3TLF A;  4FZW C;  3ZW8 A;  3ZWC A;  3H0S A;  4ZU2 A;  5G1R A;  1OD2 A;  5ING A;  4EMM A;  5DUF A;  2F6Q A;  2EJ5 A;  3KTI A;  4I42 A;  4YLH A;  1Y7O A;  2A7K A;  3QRE A;  4FNB A;  5IKL B;  2DEO A;  1FCF A;  3Q0J A;  2QQ3 A;  3QWD A;  3TT7 A;  3GMA A;  5C90 A;  4JJT A;  4OLQ A;  3H0Q A;  1YG6 A;  4ZDD A;  4K29 A;  5MGB A;  4JYJ A;  1HNO A;  2NP9 A;  2VSS E;  3ZW9 A;  3LAO A;  3I47 A;  2X24 A;  4K2N A;  3M6M A;  1ON3 A;  3R9T A;  5DTW A;  4IZC A;  3R9S A;  4KPK A;  1EF8 A;  5JBW A;  2HW5 A;  1SZO A;  3HLN 1;  3P5M A;  3U9R B;  1UYT A;  1MJ3 A;  3QYR A;  1XX4 A;  4RYF H;  2ZL3 A;  4NNQ A;  1EF9 A;  3MT6 A;  3IAV A;  1K39 A;  4KNP A;  3TVW A;  5CTC A;  4U0G A;  4J2U A;  3G64 A;  4FN8 A;  4JCT A;  3OT6 A;  1DUB A;  4FB8 A;  4GHN A;  2C8T A;  1EY3 A;  3IBB A;  3FDU A;  4FZW A;  3ZWA A;  4NEK A;  1N6E A;  5FIF A;  3H0J A;  3GF3 A;  4G2R A;  3H02 A;  1WDL A;  3T8B A;  2A7S A;  3P2L A;  2ZQQ A;  5FUS A;  2F9I B;  2F9Y B;  2VSU C;  4HC8 A;  2VSU E;  4IZD A;  4JCS A;  3DOR A;  1FC9 A;  2VSU F;  2IEX A;  3KQF A;  4NAR A;  3OME A;  4ASI A;  4QFE A;  2PPY A;  3R0O A;  5DTP A;  4ELW A;  2W3P A;  2DUB A;  3PEA A;  1Q52 A;  3VIV A;  4Z0M A;  3BEZ A;  2ZL0 A;  1UYR A;  1UYV A;  3MYB A;  1XNV A;  4RYF A;  2WTB A;  4OMR A;  3QXI A;  4K3W A;  3HE2 A;  3QKA A;  5KDR B;  1NZY A;  3MFM A;  3KTJ A;  4U1A A;  4HNK A;  3TDC A;  4ELS A;  4OG1 A;  5G1Q A;  2YJG A;  3NJD A;  1X0U A;  3BF0 A;  5DU6 A;  4EMP A;  3PGQ A;  3TV5 A;  5E0N X;  3SLL A;  3Q0G A;  5KDR A;  2PBP A;  4KWB A;  4L8K A;  4Q1I A;  1WDK A;  3TZ3 A;  3KTG A;  1N6F A;  4I4Z A;  4JYL A;  2Q2X A;  1RJM A;  2D3T A;  1XNY A;  2F9Y A;  2ZL4 A;  5E0S H;  3P85 A;  3QK8 A;  5DZK H;  1DCI A;  2VSS A;  5DKP A;  5KJP A;  4HDT A;  4U0G H;  3L3S A;  2ZQR A;  4WZ8 B;  3TVU A;  2J5I I;  4WCZ A;  4U19 A;  2GTR A;  5DL1 A;  4L6W A;  3T3W A;  4LK5 A;  1TG6 A;  3QXZ A;  1TYF A;  2CE3 A;  2BZR A;  4U18 A;  4U0H A;  3R9Q A;  4JWV A;  2Q34 A;  3OC7 A;  4JVT A;  1N6D A;  3WG5 A;  4DI1 A;  3H0U A;  4Q0G A;  4JSB A;  2J5G A;  5DUC A;  1XNW A;  4JCQ A;  3RRV A;  5INF A;  3BPT A;  1WDM A;  1JXZ A;  2J5S A;  2VX2 A;  4B3I A;  4RCN A;  2X58 A;  3M6N A;  2PG8 A;  3Q1T A;  5DU8 A;  3STA A;  1K32 A;  3U9T B;  5HUQ A;  3BPP A;  4FN7 A;  3HP0 A;  4B3H A;  3TT6 A;  3IB9 A;  2FW2 A;  4ZDC A;  1HZD A;  3HIN A;  3NJB A;  1VRG A;  3PE8 A;  2FBM A;  1O8U A;  2Q35 A;  1W2X A;  4FND A;  2FZS A;  3R6H A;  3GKB A;  3N6R B;  3TRR A;  1HNU A;  3ZWB A;  3PZK A;  3V5I A;  3H81 A;  4ELX A;  3T8A A;  3QMJ A;  3ISA A;  3HRX A;  1WZ8 A;  5C9G A;  4MXI A;  4QIJ A;  3FF6 A;  1SG4 A;  4ZDE A;  3SWX A;  2CBY A;  2VSU A;  1NZY B;  4EML A;  1Q51 A;  4QII A;  3MOY A;  2VRE A;  1FC6 A;  5DU4 A;  1PIX A;  4JCR A;  1FC7 A;  5INI A;  4KD6 A;  3LKE A;  5JBX A;  4ZDB A;  1YG8 A;  5E0S A;  1RJN A;  4FJW D;  1UYS A;  4I52 A;  3KTH A;  4MI2 A;  3Q7H A;  4MOU A;  4B3J A;  3KTK A;  4ZDF A;  2J5I A;  2ZL2 A;  4GM2 A;  2VSS F;  3JU1 A;  3T89 A;  4IZB A;  3K8X A;  1OD4 A;  3GF7 A;  2J5G D;  4JOT A;  3U9S B;  2F9I A;  5G1S A;  3ST9 A;  4F47 A;  4JFC A;  1ON9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...