1ON9A

Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with hydrolyzed methylmalonyl-coenzyme a bound)
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
516
structure length
516
Chain Sequence
b'LASTMEGRVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNNTEEASFVNPNNDVSPNTELRDIVPIDGKKGYDVRDVIAKIVDWGDYLEVKAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMCNRDLGADAVYAWPSAEIAVMGAEGAANVIFRKEIKAADDPDAMRAEKIEEYQNAFNTPYVAAARGQVDDVIDPADTRRKIASALEMYATKRQTRPAKKHGNFPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methylmalonyl-CoA carboxyltransferase 12S subunit
publication title Transcarboxylase 12S crystal structure: hexamer assembly and substrate binding to a multienzyme core
pubmed doi rcsb
source organism Propionibacterium freudenreichii
molecule tags Transferase
total genus 194
structure length 516
sequence length 516
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on9A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1on9A01
3TV5A 2QQ3A 4U0GH 2F9YB 5DTPA 4Q1IA 3ISAA 3R6HA 2F9IA 1RJMA 4MI2A 3JU1A 4B3HA 3KTGA 2CE3A 3NJDA 1UYVA 4RCNA 1FC6A 4U19A 3V5IA 3IBBA 3L3SA 1XNYA 4JOTA 3STAA 1X0UA 3H0QA 1FCFA 3P85A 3TDCA 4OLQA 5E0SA 3HINA 1NZYA 4K2NA 4HC8A 5G1RA 3WG5A 5MGBA 4WZ8B 3U9SB 2VSSE 1FC9A 4WYOB 3GMAA 5E0NX 1PJHA 1RJNA 4JYLA 4KWBA 2BZRA 2VREA 1OD4A 2Q34A 2UZFA 1N6EA 2ZQQA 4ASIA 3GKBA 4QIIA 3KTKA 4KPKA 3QXZA 4RYFA 1UIYA 2D3TA 1SZOA 3RRVA 4FN7A 1JXZA 3P5MA 3OC7A 5DUCA 2PG8A 2J5IB 4ELSA 3ZWAA 3SWXA 4Z0MA 1MJ3A 4JCQA 1K32A 4IZBA 4JSBA 4ZDBA 1UYTA 1HNUA 3R9SA 3FF6A 3H81A 4QIJA 3KTHA 3HRXA 1XX4A 1PIXA 2ZL2A 3G64A 2ZL0A 4ZDDA 3OMEA 3T8BA 5FUSA 3MYBA 3QK8A 1DCIA 3M6MA 5DU8A 5INGA 3Q0JA 4FNDA 4JCTA 2CBYA 3BEZA 4EMLA 1YG6A 3NJBA 3PGQA 5DKPA 5DTWA 2DUBA 2C8TA 4FNBA 3OT6A 4GM2A 3PEAA 2J5GA 3LAOA 3M6NA 3Q0GA 2Q2XA 2A81A 1XO6A 4L6WA 2A7KA 3TT7A 3HLN1 3DORA 1XNVA 4I42A 5DZKH 1WZ8A 2X24A 3QREA 2J5II 4OMRA 2FZSA 2GTRA 4FN8A 3KQFA 3ST9A 3I47A 3KTIA 2VSUF 1OD2A 1W2XA 3FDUA 4FJWD 1FC7A 5JBXA 2ZQRA 1EY3A 2VX2A 2ZL3A 1YG8A 1SG4A 2PPYA 1ON9A 3U9TB 2F9YA 4I52A 3HE2A 5KDRB 4MOUA 3Q1TA 4K3WA 1HZDA 4ZDEA 5DL1A 5DU6A 4MXIA 3MFMA 4YLHA 5CTBA 5FIFA 2F9IB 4ZDFA 5IKLB 3TZ3A 5DUFA 3H0UA 2J5GD 2W3PA 1O8UA 4JJTA 5E0SH 4FZWC 2HW5A 2F6QA 4ZU2A 4QFEA 4G2RA 3T89A 3ZWCA 2VSSF 3Q7HA 3BF0A 3R0OA 2PBPA 3T3WA 5C90A 3H0SA 3MOYA 3IAVA 3H02A 3KTJA 3QWDA 4LK5A 4DI1A 4JCRA 3DJAA 4FZWA 4EMMA 3RSIA 3IB9A 4L8KA 3K8XA 3H0JA 4EMPA 3BPPA 2Q35A 4RYFH 4JYJA 3TVWA 3QMJA 1J7XA 3TLFA 4OG1A 4KD6A 2X58A 2J5IA 2WTBA 1Y7OA 1ON3A 1WDLA 1TG6A 5DU4A 3ZW9A 3GF3A 2FBMA 4Q0GA 1Q51A 4ZDCA 3TRRA 2F6IA 1K39A 4HNKA 1EF9A 3LKEA 3GLMA 3K50A 1EF8A 3QXIA 3PE8A 3RSTA 1DUBA 4B3IA 2FW2A 3U9RB 4IZDA 4IZCA 3QYRA 2VSSA 5JBWA 3TT6A 3PZKA 1WDKA 5G1SA 4GHNA 5G1QA 4K29A 1TYFA 1N6FA 2IEXA 1UYRA 5KJPA 1WDMA 1N6DA 3MT6A 2J5SA 4U0GA 1XNWA 2NP9A 4B3JA 3V5EA 3QKAA 1UYSA 4JWVA 3HP0A 4JCSA 3ZWBA 4ELXA 3GF7A 2DEOA 2A7SA 1Q52A 2VSUC 4JFCA 3TVUA 5CTCA 5C9GA 5INIA 4F47A 2EJ5A 4U0HA 5DZKA 3SLLA 4WCZA 4NNQA 4U1AA 4KNPA 3VIVA 4ELWA 3ZW8A 1NZYB 4NEKA 2VSUA 3T88A 4I4ZA 2VSUE 4U18A 1VRGA 3T8AA 4FB8A 3N6RB 3R9QA 3R9TA 5KDRA 1HNOA 4JVTA 5INFA 3P2LA 2ZL4A
chains in the Genus database with same CATH superfamily
4NARA 3TV5A 2QQ3A 4U0GH 2F9YB 5DTPA 4Q1IA 3ISAA 3R6HA 2F9IA 1RJMA 4MI2A 3JU1A 4B3HA 3KTGA 2CE3A 3NJDA 1UYVA 4RCNA 1FC6A 4U19A 3V5IA 3IBBA 3L3SA 1XNYA 4JOTA 3STAA 1X0UA 3H0QA 1FCFA 3P85A 3TDCA 4OLQA 5E0SA 3HINA 1NZYA 4K2NA 4HC8A 5G1RA 3WG5A 5MGBA 4WZ8B 3U9SB 2VSSE 1FC9A 4WYOB 3GMAA 5E0NX 1PJHA 1RJNA 4JYLA 4KWBA 2YJGA 2BZRA 2VREA 1OD4A 2Q34A 2UZFA 1N6EA 2ZQQA 4ASIA 3GKBA 4QIIA 3KTKA 4KPKA 3QXZA 4RYFA 1UIYA 2D3TA 1SZOA 3RRVA 4FN7A 1JXZA 3P5MA 3OC7A 5DUCA 2PG8A 2J5IB 4ELSA 3ZWAA 3SWXA 4Z0MA 1MJ3A 4JCQA 1K32A 4IZBA 4JSBA 4ZDBA 1UYTA 1HNUA 3R9SA 3FF6A 3H81A 4QIJA 3KTHA 3HRXA 1XX4A 1PIXA 2ZL2A 3G64A 2ZL0A 4ZDDA 3OMEA 3T8BA 5FUSA 3MYBA 3QK8A 1DCIA 3M6MA 5DU8A 5INGA 3Q0JA 4FNDA 4JCTA 2CBYA 3BEZA 4EMLA 1YG6A 3NJBA 3PGQA 5DKPA 5DTWA 2DUBA 2C8TA 4FNBA 3OT6A 4GM2A 3PEAA 2J5GA 3LAOA 3M6NA 3Q0GA 2Q2XA 2A81A 1XO6A 4L6WA 2A7KA 3TT7A 3HLN1 3DORA 1XNVA 4I42A 5DZKH 1WZ8A 2X24A 3QREA 2J5II 4OMRA 2FZSA 2GTRA 4FN8A 3KQFA 3ST9A 3I47A 3KTIA 2VSUF 1OD2A 1W2XA 3FDUA 4FJWD 1FC7A 5JBXA 2ZQRA 1EY3A 2VX2A 2ZL3A 1YG8A 1SG4A 2PPYA 1ON9A 3U9TB 2F9YA 4I52A 3HE2A 5KDRB 4MOUA 3Q1TA 4K3WA 1HZDA 4ZDEA 5DL1A 5DU6A 4MXIA 3MFMA 4YLHA 5CTBA 5FIFA 2F9IB 4ZDFA 5IKLB 3TZ3A 5DUFA 3H0UA 2J5GD 2W3PA 1O8UA 4JJTA 5E0SH 4FZWC 2HW5A 2F6QA 4ZU2A 4QFEA 4G2RA 3T89A 3ZWCA 2VSSF 3Q7HA 3BF0A 3R0OA 2PBPA 3T3WA 5C90A 3H0SA 3MOYA 3IAVA 3H02A 3KTJA 3QWDA 4LK5A 4DI1A 4JCRA 3DJAA 4FZWA 4EMMA 3RSIA 3IB9A 4L8KA 3K8XA 3H0JA 4EMPA 3BPPA 2Q35A 4RYFH 4JYJA 3TVWA 3QMJA 1J7XA 3TLFA 4OG1A 4KD6A 2X58A 2J5IA 2WTBA 1Y7OA 5HUQA 1ON3A 1WDLA 1TG6A 5DU4A 3ZW9A 3GF3A 2FBMA 4J2UA 4Q0GA 1Q51A 4ZDCA 3TRRA 2F6IA 1K39A 4HNKA 1EF9A 3LKEA 3GLMA 3K50A 1EF8A 4HDTA 3QXIA 3PE8A 3RSTA 1DUBA 4B3IA 2FW2A 3U9RB 4IZDA 4IZCA 3QYRA 2VSSA 5JBWA 3TT6A 3PZKA 1WDKA 5G1SA 4GHNA 3BPTA 5G1QA 4K29A 1TYFA 1N6FA 2IEXA 1UYRA 5KJPA 1WDMA 1N6DA 3MT6A 2J5SA 4U0GA 1XNWA 2NP9A 4B3JA 3V5EA 3QKAA 1UYSA 4JWVA 3HP0A 4JCSA 3ZWBA 4ELXA 3GF7A 2DEOA 2A7SA 1Q52A 2VSUC 4JFCA 3TVUA 5CTCA 5C9GA 5INIA 4F47A 2EJ5A 4U0HA 5DZKA 3SLLA 4WCZA 4NNQA 4U1AA 4KNPA 3VIVA 4ELWA 3ZW8A 1NZYB 4NEKA 2VSUA 3T88A 4I4ZA 2VSUE 4U18A 1VRGA 3T8AA 4FB8A 3N6RB 3R9QA 3R9TA 5KDRA 1HNOA 4JVTA 5INFA 3P2LA 2ZL4A
chains in the Genus database with same CATH topology
4NARA 3TV5A 2QQ3A 4U0GH 2F9YB 5DTPA 4Q1IA 3ISAA 3R6HA 2F9IA 1RJMA 4MI2A 3JU1A 4B3HA 3KTGA 2CE3A 3NJDA 1UYVA 4RCNA 1FC6A 4U19A 3V5IA 3IBBA 3L3SA 1XNYA 4JOTA 3STAA 1X0UA 3H0QA 1FCFA 3P85A 3TDCA 4OLQA 5E0SA 3HINA 1NZYA 4K2NA 4HC8A 5G1RA 3WG5A 5MGBA 4WZ8B 3U9SB 2VSSE 1FC9A 4WYOB 3GMAA 5E0NX 1PJHA 1RJNA 4JYLA 4KWBA 2YJGA 2BZRA 2VREA 1OD4A 2Q34A 2UZFA 1N6EA 2ZQQA 4ASIA 3GKBA 4QIIA 3KTKA 4KPKA 3QXZA 4RYFA 1UIYA 2D3TA 1SZOA 3RRVA 4FN7A 1JXZA 3P5MA 3OC7A 5DUCA 2PG8A 2J5IB 4ELSA 3ZWAA 3SWXA 4Z0MA 1MJ3A 4JCQA 1K32A 4IZBA 4JSBA 4ZDBA 1UYTA 1HNUA 3R9SA 3FF6A 3H81A 4QIJA 3KTHA 3HRXA 1XX4A 1PIXA 2ZL2A 3G64A 2ZL0A 4ZDDA 3OMEA 3T8BA 5FUSA 3MYBA 3QK8A 1DCIA 3M6MA 5DU8A 5INGA 3Q0JA 4FNDA 4JCTA 2CBYA 3BEZA 4EMLA 1YG6A 3NJBA 3PGQA 5DKPA 5DTWA 2DUBA 2C8TA 4FNBA 3OT6A 4GM2A 3PEAA 2J5GA 3LAOA 3M6NA 3Q0GA 2Q2XA 2A81A 1XO6A 4L6WA 2A7KA 3TT7A 3HLN1 3DORA 1XNVA 4I42A 5DZKH 1WZ8A 2X24A 3QREA 2J5II 4OMRA 2FZSA 2GTRA 4FN8A 3KQFA 3ST9A 3I47A 3KTIA 2VSUF 1OD2A 1W2XA 3FDUA 4FJWD 1FC7A 5JBXA 2ZQRA 1EY3A 2VX2A 2ZL3A 1YG8A 1SG4A 2PPYA 1ON9A 3U9TB 2F9YA 4I52A 3HE2A 5KDRB 4MOUA 3Q1TA 4K3WA 1HZDA 4ZDEA 5DL1A 5DU6A 4MXIA 3MFMA 4YLHA 5CTBA 5FIFA 2F9IB 4ZDFA 5IKLB 3TZ3A 5DUFA 3H0UA 2J5GD 2W3PA 1O8UA 4JJTA 5E0SH 4FZWC 2HW5A 2F6QA 4ZU2A 4QFEA 4G2RA 3T89A 3ZWCA 2VSSF 3Q7HA 3BF0A 3R0OA 2PBPA 3T3WA 5C90A 3H0SA 3MOYA 3IAVA 3H02A 3KTJA 3QWDA 4LK5A 4DI1A 4JCRA 3DJAA 4FZWA 4EMMA 3RSIA 3IB9A 4L8KA 3K8XA 3H0JA 4EMPA 3BPPA 2Q35A 4RYFH 4JYJA 3TVWA 3QMJA 1J7XA 3TLFA 4OG1A 4KD6A 2X58A 2J5IA 2WTBA 1Y7OA 5HUQA 1ON3A 1WDLA 1TG6A 5DU4A 3ZW9A 3GF3A 2FBMA 4J2UA 4Q0GA 1Q51A 4ZDCA 3TRRA 2F6IA 1K39A 4HNKA 1EF9A 3LKEA 3GLMA 3K50A 1EF8A 4HDTA 3QXIA 3PE8A 3RSTA 1DUBA 4B3IA 2FW2A 3U9RB 4IZDA 4IZCA 3QYRA 2VSSA 5JBWA 3TT6A 3PZKA 1WDKA 5G1SA 4GHNA 3BPTA 5G1QA 4K29A 1TYFA 1N6FA 2IEXA 1UYRA 5KJPA 1WDMA 1N6DA 3MT6A 2J5SA 4U0GA 1XNWA 2NP9A 4B3JA 3V5EA 3QKAA 1UYSA 4JWVA 3HP0A 4JCSA 3ZWBA 4ELXA 3GF7A 2DEOA 2A7SA 1Q52A 2VSUC 4JFCA 3TVUA 5CTCA 5C9GA 5INIA 4F47A 2EJ5A 4U0HA 5DZKA 3SLLA 4WCZA 4NNQA 4U1AA 4KNPA 3VIVA 4ELWA 3ZW8A 1NZYB 4NEKA 2VSUA 3T88A 4I4ZA 2VSUE 4U18A 1VRGA 3T8AA 4FB8A 3N6RB 3R9QA 3R9TA 5KDRA 1HNOA 4JVTA 5INFA 3P2LA 2ZL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TV5 A;  2QQ3 A;  4U0G H;  2F9Y B;  5DTP A;  4Q1I A;  3ISA A;  3R6H A;  2F9I A;  1RJM A;  4MI2 A;  3JU1 A;  4B3H A;  3KTG A;  2CE3 A;  3NJD A;  1UYV A;  4RCN A;  1FC6 A;  4U19 A;  3V5I A;  3IBB A;  3L3S A;  1XNY A;  4JOT A;  3STA A;  1X0U A;  3H0Q A;  1FCF A;  3P85 A;  3TDC A;  4OLQ A;  5E0S A;  3HIN A;  1NZY A;  4K2N A;  4HC8 A;  5G1R A;  3WG5 A;  5MGB A;  4WZ8 B;  3U9S B;  2VSS E;  1FC9 A;  4WYO B;  3GMA A;  5E0N X;  1PJH A;  1RJN A;  4JYL A;  4KWB A;  2BZR A;  2VRE A;  1OD4 A;  2Q34 A;  2UZF A;  1N6E A;  2ZQQ A;  4ASI A;  3GKB A;  4QII A;  3KTK A;  4KPK A;  3QXZ A;  4RYF A;  1UIY A;  2D3T A;  1SZO A;  3RRV A;  4FN7 A;  1JXZ A;  3P5M A;  3OC7 A;  5DUC A;  2PG8 A;  2J5I B;  4ELS A;  3ZWA A;  3SWX A;  4Z0M A;  1MJ3 A;  4JCQ A;  1K32 A;  4IZB A;  4JSB A;  4ZDB A;  1UYT A;  1HNU A;  3R9S A;  3FF6 A;  3H81 A;  4QIJ A;  3KTH A;  3HRX A;  1XX4 A;  1PIX A;  2ZL2 A;  3G64 A;  2ZL0 A;  4ZDD A;  3OME A;  3T8B A;  5FUS A;  3MYB A;  3QK8 A;  1DCI A;  3M6M A;  5DU8 A;  5ING A;  3Q0J A;  4FND A;  4JCT A;  2CBY A;  3BEZ A;  4EML A;  1YG6 A;  3NJB A;  3PGQ A;  5DKP A;  5DTW A;  2DUB A;  2C8T A;  4FNB A;  3OT6 A;  4GM2 A;  3PEA A;  2J5G A;  3LAO A;  3M6N A;  3Q0G A;  2Q2X A;  2A81 A;  1XO6 A;  4L6W A;  2A7K A;  3TT7 A;  3HLN 1;  3DOR A;  1XNV A;  4I42 A;  5DZK H;  1WZ8 A;  2X24 A;  3QRE A;  2J5I I;  4OMR A;  2FZS A;  2GTR A;  4FN8 A;  3KQF A;  3ST9 A;  3I47 A;  3KTI A;  2VSU F;  1OD2 A;  1W2X A;  3FDU A;  4FJW D;  1FC7 A;  5JBX A;  2ZQR A;  1EY3 A;  2VX2 A;  2ZL3 A;  1YG8 A;  1SG4 A;  2PPY A;  1ON9 A;  3U9T B;  2F9Y A;  4I52 A;  3HE2 A;  5KDR B;  4MOU A;  3Q1T A;  4K3W A;  1HZD A;  4ZDE A;  5DL1 A;  5DU6 A;  4MXI A;  3MFM A;  4YLH A;  5CTB A;  5FIF A;  2F9I B;  4ZDF A;  5IKL B;  3TZ3 A;  5DUF A;  3H0U A;  2J5G D;  2W3P A;  1O8U A;  4JJT A;  5E0S H;  4FZW C;  2HW5 A;  2F6Q A;  4ZU2 A;  4QFE A;  4G2R A;  3T89 A;  3ZWC A;  2VSS F;  3Q7H A;  3BF0 A;  3R0O A;  2PBP A;  3T3W A;  5C90 A;  3H0S A;  3MOY A;  3IAV A;  3H02 A;  3KTJ A;  3QWD A;  4LK5 A;  4DI1 A;  4JCR A;  3DJA A;  4FZW A;  4EMM A;  3RSI A;  3IB9 A;  4L8K A;  3K8X A;  3H0J A;  4EMP A;  3BPP A;  2Q35 A;  4RYF H;  4JYJ A;  3TVW A;  3QMJ A;  1J7X A;  3TLF A;  4OG1 A;  4KD6 A;  2X58 A;  2J5I A;  2WTB A;  1Y7O A;  1ON3 A;  1WDL A;  1TG6 A;  5DU4 A;  3ZW9 A;  3GF3 A;  2FBM A;  4Q0G A;  1Q51 A;  4ZDC A;  3TRR A;  2F6I A;  1K39 A;  4HNK A;  1EF9 A;  3LKE A;  3GLM A;  3K50 A;  1EF8 A;  3QXI A;  3PE8 A;  3RST A;  1DUB A;  4B3I A;  2FW2 A;  3U9R B;  4IZD A;  4IZC A;  3QYR A;  2VSS A;  5JBW A;  3TT6 A;  3PZK A;  1WDK A;  5G1S A;  4GHN A;  5G1Q A;  4K29 A;  1TYF A;  1N6F A;  2IEX A;  1UYR A;  5KJP A;  1WDM A;  1N6D A;  3MT6 A;  2J5S A;  4U0G A;  1XNW A;  2NP9 A;  4B3J A;  3V5E A;  3QKA A;  1UYS A;  4JWV A;  3HP0 A;  4JCS A;  3ZWB A;  4ELX A;  3GF7 A;  2DEO A;  2A7S A;  1Q52 A;  2VSU C;  4JFC A;  3TVU A;  5CTC A;  5C9G A;  5INI A;  4F47 A;  2EJ5 A;  4U0H A;  5DZK A;  3SLL A;  4WCZ A;  4NNQ A;  4U1A A;  4KNP A;  3VIV A;  4ELW A;  3ZW8 A;  1NZY B;  4NEK A;  2VSU A;  3T88 A;  4I4Z A;  2VSU E;  4U18 A;  1VRG A;  3T8A A;  4FB8 A;  3N6R B;  3R9Q A;  3R9T A;  5KDR A;  1HNO A;  4JVT A;  5INF A;  3P2L A;  2ZL4 A; 
#chains in the Genus database with same CATH topology
 4NAR A;  3TV5 A;  2QQ3 A;  4U0G H;  2F9Y B;  5DTP A;  4Q1I A;  3ISA A;  3R6H A;  2F9I A;  1RJM A;  4MI2 A;  3JU1 A;  4B3H A;  3KTG A;  2CE3 A;  3NJD A;  1UYV A;  4RCN A;  1FC6 A;  4U19 A;  3V5I A;  3IBB A;  3L3S A;  1XNY A;  4JOT A;  3STA A;  1X0U A;  3H0Q A;  1FCF A;  3P85 A;  3TDC A;  4OLQ A;  5E0S A;  3HIN A;  1NZY A;  4K2N A;  4HC8 A;  5G1R A;  3WG5 A;  5MGB A;  4WZ8 B;  3U9S B;  2VSS E;  1FC9 A;  4WYO B;  3GMA A;  5E0N X;  1PJH A;  1RJN A;  4JYL A;  4KWB A;  2YJG A;  2BZR A;  2VRE A;  1OD4 A;  2Q34 A;  2UZF A;  1N6E A;  2ZQQ A;  4ASI A;  3GKB A;  4QII A;  3KTK A;  4KPK A;  3QXZ A;  4RYF A;  1UIY A;  2D3T A;  1SZO A;  3RRV A;  4FN7 A;  1JXZ A;  3P5M A;  3OC7 A;  5DUC A;  2PG8 A;  2J5I B;  4ELS A;  3ZWA A;  3SWX A;  4Z0M A;  1MJ3 A;  4JCQ A;  1K32 A;  4IZB A;  4JSB A;  4ZDB A;  1UYT A;  1HNU A;  3R9S A;  3FF6 A;  3H81 A;  4QIJ A;  3KTH A;  3HRX A;  1XX4 A;  1PIX A;  2ZL2 A;  3G64 A;  2ZL0 A;  4ZDD A;  3OME A;  3T8B A;  5FUS A;  3MYB A;  3QK8 A;  1DCI A;  3M6M A;  5DU8 A;  5ING A;  3Q0J A;  4FND A;  4JCT A;  2CBY A;  3BEZ A;  4EML A;  1YG6 A;  3NJB A;  3PGQ A;  5DKP A;  5DTW A;  2DUB A;  2C8T A;  4FNB A;  3OT6 A;  4GM2 A;  3PEA A;  2J5G A;  3LAO A;  3M6N A;  3Q0G A;  2Q2X A;  2A81 A;  1XO6 A;  4L6W A;  2A7K A;  3TT7 A;  3HLN 1;  3DOR A;  1XNV A;  4I42 A;  5DZK H;  1WZ8 A;  2X24 A;  3QRE A;  2J5I I;  4OMR A;  2FZS A;  2GTR A;  4FN8 A;  3KQF A;  3ST9 A;  3I47 A;  3KTI A;  2VSU F;  1OD2 A;  1W2X A;  3FDU A;  4FJW D;  1FC7 A;  5JBX A;  2ZQR A;  1EY3 A;  2VX2 A;  2ZL3 A;  1YG8 A;  1SG4 A;  2PPY A;  1ON9 A;  3U9T B;  2F9Y A;  4I52 A;  3HE2 A;  5KDR B;  4MOU A;  3Q1T A;  4K3W A;  1HZD A;  4ZDE A;  5DL1 A;  5DU6 A;  4MXI A;  3MFM A;  4YLH A;  5CTB A;  5FIF A;  2F9I B;  4ZDF A;  5IKL B;  3TZ3 A;  5DUF A;  3H0U A;  2J5G D;  2W3P A;  1O8U A;  4JJT A;  5E0S H;  4FZW C;  2HW5 A;  2F6Q A;  4ZU2 A;  4QFE A;  4G2R A;  3T89 A;  3ZWC A;  2VSS F;  3Q7H A;  3BF0 A;  3R0O A;  2PBP A;  3T3W A;  5C90 A;  3H0S A;  3MOY A;  3IAV A;  3H02 A;  3KTJ A;  3QWD A;  4LK5 A;  4DI1 A;  4JCR A;  3DJA A;  4FZW A;  4EMM A;  3RSI A;  3IB9 A;  4L8K A;  3K8X A;  3H0J A;  4EMP A;  3BPP A;  2Q35 A;  4RYF H;  4JYJ A;  3TVW A;  3QMJ A;  1J7X A;  3TLF A;  4OG1 A;  4KD6 A;  2X58 A;  2J5I A;  2WTB A;  1Y7O A;  5HUQ A;  1ON3 A;  1WDL A;  1TG6 A;  5DU4 A;  3ZW9 A;  3GF3 A;  2FBM A;  4J2U A;  4Q0G A;  1Q51 A;  4ZDC A;  3TRR A;  2F6I A;  1K39 A;  4HNK A;  1EF9 A;  3LKE A;  3GLM A;  3K50 A;  1EF8 A;  4HDT A;  3QXI A;  3PE8 A;  3RST A;  1DUB A;  4B3I A;  2FW2 A;  3U9R B;  4IZD A;  4IZC A;  3QYR A;  2VSS A;  5JBW A;  3TT6 A;  3PZK A;  1WDK A;  5G1S A;  4GHN A;  3BPT A;  5G1Q A;  4K29 A;  1TYF A;  1N6F A;  2IEX A;  1UYR A;  5KJP A;  1WDM A;  1N6D A;  3MT6 A;  2J5S A;  4U0G A;  1XNW A;  2NP9 A;  4B3J A;  3V5E A;  3QKA A;  1UYS A;  4JWV A;  3HP0 A;  4JCS A;  3ZWB A;  4ELX A;  3GF7 A;  2DEO A;  2A7S A;  1Q52 A;  2VSU C;  4JFC A;  3TVU A;  5CTC A;  5C9G A;  5INI A;  4F47 A;  2EJ5 A;  4U0H A;  5DZK A;  3SLL A;  4WCZ A;  4NNQ A;  4U1A A;  4KNP A;  3VIV A;  4ELW A;  3ZW8 A;  1NZY B;  4NEK A;  2VSU A;  3T88 A;  4I4Z A;  2VSU E;  4U18 A;  1VRG A;  3T8A A;  4FB8 A;  3N6R B;  3R9Q A;  3R9T A;  5KDR A;  1HNO A;  4JVT A;  5INF A;  3P2L A;  2ZL4 A; 
#chains in the Genus database with same CATH homology
 4NAR A;  3TV5 A;  2QQ3 A;  4U0G H;  2F9Y B;  5DTP A;  4Q1I A;  3ISA A;  3R6H A;  2F9I A;  1RJM A;  4MI2 A;  3JU1 A;  4B3H A;  3KTG A;  2CE3 A;  3NJD A;  1UYV A;  4RCN A;  1FC6 A;  4U19 A;  3V5I A;  3IBB A;  3L3S A;  1XNY A;  4JOT A;  3STA A;  1X0U A;  3H0Q A;  1FCF A;  3P85 A;  3TDC A;  4OLQ A;  5E0S A;  3HIN A;  1NZY A;  4K2N A;  4HC8 A;  5G1R A;  3WG5 A;  5MGB A;  4WZ8 B;  3U9S B;  2VSS E;  1FC9 A;  4WYO B;  3GMA A;  5E0N X;  1PJH A;  1RJN A;  4JYL A;  4KWB A;  2YJG A;  2BZR A;  2VRE A;  1OD4 A;  2Q34 A;  2UZF A;  1N6E A;  2ZQQ A;  4ASI A;  3GKB A;  4QII A;  3KTK A;  4KPK A;  3QXZ A;  4RYF A;  1UIY A;  2D3T A;  1SZO A;  3RRV A;  4FN7 A;  1JXZ A;  3P5M A;  3OC7 A;  5DUC A;  2PG8 A;  2J5I B;  4ELS A;  3ZWA A;  3SWX A;  4Z0M A;  1MJ3 A;  4JCQ A;  1K32 A;  4IZB A;  4JSB A;  4ZDB A;  1UYT A;  1HNU A;  3R9S A;  3FF6 A;  3H81 A;  4QIJ A;  3KTH A;  3HRX A;  1XX4 A;  1PIX A;  2ZL2 A;  3G64 A;  2ZL0 A;  4ZDD A;  3OME A;  3T8B A;  5FUS A;  3MYB A;  3QK8 A;  1DCI A;  3M6M A;  5DU8 A;  5ING A;  3Q0J A;  4FND A;  4JCT A;  2CBY A;  3BEZ A;  4EML A;  1YG6 A;  3NJB A;  3PGQ A;  5DKP A;  5DTW A;  2DUB A;  2C8T A;  4FNB A;  3OT6 A;  4GM2 A;  3PEA A;  2J5G A;  3LAO A;  3M6N A;  3Q0G A;  2Q2X A;  2A81 A;  1XO6 A;  4L6W A;  2A7K A;  3TT7 A;  3HLN 1;  3DOR A;  1XNV A;  4I42 A;  5DZK H;  1WZ8 A;  2X24 A;  3QRE A;  2J5I I;  4OMR A;  2FZS A;  2GTR A;  4FN8 A;  3KQF A;  3ST9 A;  3I47 A;  3KTI A;  2VSU F;  1OD2 A;  1W2X A;  3FDU A;  4FJW D;  1FC7 A;  5JBX A;  2ZQR A;  1EY3 A;  2VX2 A;  2ZL3 A;  1YG8 A;  1SG4 A;  2PPY A;  1ON9 A;  3U9T B;  2F9Y A;  4I52 A;  3HE2 A;  5KDR B;  4MOU A;  3Q1T A;  4K3W A;  1HZD A;  4ZDE A;  5DL1 A;  5DU6 A;  4MXI A;  3MFM A;  4YLH A;  5CTB A;  5FIF A;  2F9I B;  4ZDF A;  5IKL B;  3TZ3 A;  5DUF A;  3H0U A;  2J5G D;  2W3P A;  1O8U A;  4JJT A;  5E0S H;  4FZW C;  2HW5 A;  2F6Q A;  4ZU2 A;  4QFE A;  4G2R A;  3T89 A;  3ZWC A;  2VSS F;  3Q7H A;  3BF0 A;  3R0O A;  2PBP A;  3T3W A;  5C90 A;  3H0S A;  3MOY A;  3IAV A;  3H02 A;  3KTJ A;  3QWD A;  4LK5 A;  4DI1 A;  4JCR A;  3DJA A;  4FZW A;  4EMM A;  3RSI A;  3IB9 A;  4L8K A;  3K8X A;  3H0J A;  4EMP A;  3BPP A;  2Q35 A;  4RYF H;  4JYJ A;  3TVW A;  3QMJ A;  1J7X A;  3TLF A;  4OG1 A;  4KD6 A;  2X58 A;  2J5I A;  2WTB A;  1Y7O A;  5HUQ A;  1ON3 A;  1WDL A;  1TG6 A;  5DU4 A;  3ZW9 A;  3GF3 A;  2FBM A;  4J2U A;  4Q0G A;  1Q51 A;  4ZDC A;  3TRR A;  2F6I A;  1K39 A;  4HNK A;  1EF9 A;  3LKE A;  3GLM A;  3K50 A;  1EF8 A;  4HDT A;  3QXI A;  3PE8 A;  3RST A;  1DUB A;  4B3I A;  2FW2 A;  3U9R B;  4IZD A;  4IZC A;  3QYR A;  2VSS A;  5JBW A;  3TT6 A;  3PZK A;  1WDK A;  5G1S A;  4GHN A;  3BPT A;  5G1Q A;  4K29 A;  1TYF A;  1N6F A;  2IEX A;  1UYR A;  5KJP A;  1WDM A;  1N6D A;  3MT6 A;  2J5S A;  4U0G A;  1XNW A;  2NP9 A;  4B3J A;  3V5E A;  3QKA A;  1UYS A;  4JWV A;  3HP0 A;  4JCS A;  3ZWB A;  4ELX A;  3GF7 A;  2DEO A;  2A7S A;  1Q52 A;  2VSU C;  4JFC A;  3TVU A;  5CTC A;  5C9G A;  5INI A;  4F47 A;  2EJ5 A;  4U0H A;  5DZK A;  3SLL A;  4WCZ A;  4NNQ A;  4U1A A;  4KNP A;  3VIV A;  4ELW A;  3ZW8 A;  1NZY B;  4NEK A;  2VSU A;  3T88 A;  4I4Z A;  2VSU E;  4U18 A;  1VRG A;  3T8A A;  4FB8 A;  3N6R B;  3R9Q A;  3R9T A;  5KDR A;  1HNO A;  4JVT A;  5INF A;  3P2L A;  2ZL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...