1OOEA

Structural genomics of caenorhabditis elegans : dihydropteridine reductase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
235
structure length
235
Chain Sequence
SSGKVIVYGGKGALGSAILEFFKKNGYTVLNIDLSANDQADSNILVDGNKNWTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSASSKDFVKNADLMIKQSVWSSAIAAKLATTHLKPGGLLQLTGAAAAMGPTPSMIGYGMAKAAVHHLTSSLAAKDSGLPDNSAVLTIMPVTLDTPMNRKWMPNADHSSWTPLSFISEHLLKWTTETSSRPSSGALLKITTENGTSTITPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteridine reductase
publication title Structural genomics of Caenorhabditis elegans: structure of dihydropteridine reductase.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 85
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 1.6.99.7: Transferred entry: 1.5.1.34.
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ooeA00
1DLJA 1L7EA 3IJPA 5ENVA 1XQ6A 1K3TA 3STHA 1JKIA 1ONNA 4YRAA 2X0NA 3KVOA 4EJ0A 3TL2A 1IPFA 2J3HA 3H9EO 4BNLA 4BVAA 2O3QA 2YUTA 2Y1DA 3UH1A 3H6KA 2JCXA 1J0XO 2J3IA 4UEJA 3L4SO 1SOVA 1T1RA 1LRJA 3RUDA 2AEMA 4BKUA 3I9NA 5EPOA 3W6UA 5DT9A 4OO3A 2DBZA 3OA0A 4CMHA 5L9AA 4TRJA 4YR9A 3AK4A 2HK8A 4FIZA 2C2YA 3H9UA 2VWPA 1EUCA 1G1AA 2J5QA 1R0SA 2AQIA 2X8LA 5TSDA 4Q3BA 1H6CA 1OFGA 4TSKA 3QP9A 4MVJD 3V5NA 3BHJA 1HDRA 3ZCXA 4C4OA 1EVYA 4RPHA 1J49A 3P5SA 1PR3A 2UV8A 2DAPA 3F5SA 3WWZA 4ZHSA 2VWGA 1BXGA 3IKTA 1WVGA 3V2UA 2CY0A 2AXQA 3QLJA 1GV0A 1NHGA 3LT4A 1ONPA 3GDGA 3BMOB 3GEMA 3NEPX 1V35A 5A3JA 1JKJA 1DC6A 2W2KB 2EHDA 3DOJA 4MP6A 1NNUA 1PL8A 3SLGA 4XKJA 3JQ8B 4D41A 4YYZA 5K0ZA 1ZK3A 3QVSA 5MDHA 1M76A 3DHNA 4W82A 4L4SA 3IC5A 3ZV5A 1YRLA 4ZQEA 5JC8A 1C1DA 4CMKA 5JNLA 3O26A 2DC1A 4E4YA 1GPJA 4GX0A 1Y5MA 3WGOA 1LEHA 5DOZA 2IZ1A 4A5OA 2J3KA 3NDIA 1BGVA 4J1SA 4AJ2A 3TFOA 4DPKA 5IDQA 5EINA 4YJFA 4CLOA 3FNEA 1CERA 4RQUA 1DC4A 1CJCA 4YA6A 3DTYA 3PIIA 4OXYA 3TNLA 4IIVA 4IXTA 1SAYA 5GMOA 4PRLA 1Q7GA 1YBAA 2HMTA 1HEUA 4OH1A 3GG9A 3C1OA 3GZNB 1R6DA 2HJRA 1A27A 3AOGA 4OIMA 3A4VA 5DP2A 2E82A 3S55A 2B4RO 1EFKA 1AXGA 4KUHA 1DRUA 1U2DA 3PFFA 2QQ5A 4ZQBA 4XGKA 1T24A 3JQ9C 5F1PA 5G4KB 4IQ0A 4CM8A 5L7WA 4R9RA 4GLLA 1U4OA 2FPIA 4PLVA 4AVYA 3JQ9A 1PJQA 5HA5A 2QRKA 1IUKA 4UVEA 1GZ6A 3D3WB 3LVFO 5KCZA 1EE2A 3C1TA 4Z0PA 1MX3A 2X0IA 1B0AA 1H6AA 1R0KA 5T5QA 1GUFA 1X1TA 1E3WB 1I36A 1AE1A 4DYDA 5CG1A 4K6CA 1HDOA 3IUSA 1C0PA 3KSDO 4H15A 4Y9DA 3RWBA 4YACA 3K5PA 1XGKA 1EK6A 3DZGA 4GSKA 2YDYA 4CM7A 3H4VA 3GFBA 3IP1A 3LLVA 2E49A 1UH5A 5CDSA 5TF4A 4CM5A 4IM7A 2H1SA 3ROKA 4D7AA 4DMLA 5THKA 5KVSA 1NQAO 4J2HA 2X0RA 4JNKA 4YAKA 5A02A 5AXAA 4Z0HO 3DZJA 4CLEA 2X5JO 4FC6A 4C7JA 1WMAA 4S3MA 4AJLA 1EDZA 1B7GO 5JYDA 1B8UA 1MLDA 4YTEA 2VZ9A 4Z9YA 1IULA 4KP7A 2BFMA 4DMMA 1QYCA 3NDJA 4RVUA 3B20A 5A9SB 4E21A 1B16A 1BWSA 2DUUA 4W6ZA 5EN4A 1UR5A 4AJ1A 5EJ2A 1E7YA 3UN1A 7ADHA 4BKRA 1YE3A 2WJPA 4JBGA 1KY5A 2HLPA 2NU7A 3CZRA 3GRPA 4JN6B 3O8QB 1ZEJA 3TOZA 4B4WA 3DBHA 3W4IA 1IB6A 2EIHA 4YT2A 5JAIA 2ZK7A 1G0NA 3DZKA 3TFQA 3U3XA 3OQ1A 3VZPA 4D0RA 4DBVO 2J6IA 1P1KA 4M49A 1Z82A 4FJ0A 4DUPA 2ZTUA 3Q1LA 4D44A 5JAZA 1GFSA 1HETA 1UZLA 3G49A 1NPYA 4CODB 2B5WA 5B1YA 1DIBA 1HDGO 2AMFA 2GGSA 2VZ0A 5AXDA 2OOSA 3RUFA 2YHIA 4PG4A 1RJWA 4NIMA 3KEOA 3UOGA 2WWRA 4J4BA 1P44A 3PFWO 4CLRB 1NWCA 1Y8QB 1DJQA 2WTBA 1YJQA 2EXXA 4A2CA 3G1TA 3I9JA 5KJ6A 3GNQA 3D5TA 5DOVA 3RFVA 1LDBA 2AW5A 4R51A 4P22A 2G5CA 4Y6PA 1VSVA 1IPEA 1HDYA 1ZK4A 3RD5A 4M89A 1DHRA 2XOXA 3WQSB 1HZZA 1U5CA 4B8WA 3Q0EA 3JYPA 3GVHA 1ML3A 2JD1A 3GOHA 3CH6A 1JAYA 4XJSA 3RI3A 4IGEA 2HK9A 2I65A 1Z75A 4EYEA 1EVZA 1MG0A 2I66A 4GQAA 3ICPA 2GZ1A 4GAEA 1V6AA 4EJMA 2UAGA 3BIOA 1IY8A 2FR1A 2OL4A 5I9LA 4GMFA 4YWJA 3U4IA 1LI4A 2W8ZA 4P4NA 2IEDA 3BMCB 3FNFA 3PWZA 2ZB4A 1IE3A 2JJYA 2GO1A 4YT5A 1VKNA 4BIIA 1N7HA 2C7GA 4EJ6A 4D3DA 1VI2A 4LRTB 1E92A 2D4AA 2DFDA 3JYQA 5JYEA 3JQGA 2C82A 1GQQA 5COAA 1YBVA 4DIBA 1T1SA 2EW2A 4Z0TA 3V1YA 4BO5A 5I7FA 2DBQA 4CLDA 5A4DA 1E3EA 4W9NC 3DBRA 3DHEA 3VPSA 4RPJA 4LVCA 1TVEA 4LSWA 4HKTA 3MJEA 1I10A 2WMDA 2A92A 3H7AA 1N92A 1NAIA 4GH5A 1O6ZA 1T25A 4RVHA 4ILKA 3TDKA 4CQMA 4BHTA 1TA4A 3D4NA 1QORA 1Y1PA 1S7CA 3ITKA 2C0CA 3RC7A 3F9IA 4CMAA 1HF3A 1ADGA 1SOWA 2W2LA 5KIAA 1X15A 5IZ4A 3GEGA 4DLLA 3A9WA 1XIVA 1DLIA 1RWBA 2C07A 4ND2A 1VLLA 2YY7A 5JFOA 3WB9A 2QX7A 1F06A 2IEBA 3KYDB 4ALIA 1QMGA 3PQFA 2OBYA 3KSZO 5LCXA 2JD2A 4AICA 1VKOA 2DTEA 1XU7A 3LQFA 4ONEA 4WLVA 1GAEO 4KOAA 1Z6ZA 4ALMA 3DBLB 3NT2A 5LDHA 4WLNA 3DO5A 1I30A 1ADFA 1YJ8A 2YHUA 3RJ5A 3V1UA 1ZXBA 3F47A 3DXFA 3JQAD 3HDJA 2BH9A 2FZWA 1OC4A 1NM5A 1R4MA 3MWEB 5L45A 5TNXA 3HNPA 4WLEA 3VZRA 4CLXA 1PZEA 1KC1A 3V8BA 1X7HA 2GN6A 1J6UA 1I2BA 2LDBA 2Q1WA 2PD4A 2AEJA 2HJSA 5G0UA 1R4NA 4Q3NA 2GSDA 1PQUA 4RLHA 4TZKA 1DAPA 2O2SA 4W7IA 2WM3A 5A5FA 4CV3A 4J7XA 3M1LA 4M8SA 4BNZA 3VPGA 4A03A 4BGVA 1U8FO 2O23A 1DAOA 1WZEA 1GD1O 4UAGA 5KWEA 8LDHA 1E1LA 3UCFA 4PGFA 2BFAA 3BYZA 3H5RA 5CFZA 4YRDA 1NTOA 5I9NA 5JY1A 4W99A 4MVJI 4J7UA 3ZW8A 4ZU3A 4FJ1A 1LLQA 4ROSA 1VRWA 1WMBA 5KVQA 3KBOA 5TJHA 3TPCA 3GVPA 4AJKA 1CETA 5DZSA 4XB1A 3N7UA 2O4UX 3GNSA 4ALKA 4EZBA 3M2TA 5BT9A 3L77A 3TRIA 2LDXA 2D59A 3I6IA 4TKLA 4WGGA 3MTJA 1JLLA 4A26A 5T57A 2B37A 4ND4A 4DPLA 3HE3A 3UW3A 3H3JA 3SX2A 2ZB8A 2VTDA 2PZKA 4A7PA 3JD1A 4AJNA 3Q2KA 2DPHA 4PLCA 5TLSA 2ET6A 4LGVA 4NBTA 5T64A 4E5KA 4NMHA 3DAFA 4ZQFA 1PWZA 4XA8A 3CMMA 4YDRA 4U5QA 3ZHZA 2Q2WA 3Q6IA 4MJLA 3VPXA 3BXXA 4MVJM 1ZK2A 4E2ZA 1E1NA 1E1MA 2JAPA 2O50A 2FZEA 1MV8A 4KUGA 1SB8A 2ZYDA 3WDSA 4KWHA 2IYPA 2P9EA 4MOWA 2HSDA 4TRNA 4B7XA 1LLUA 1GTMA 4DL9A 1FMCA 5K9ZA 3A06A 5IZCC 4R54A 2E4AA 3LF1A 2QW8A 2X5KO 3GLQA 4HXYA 3VH3A 1HXHA 4RPGA 2VHXA 3SVTA 3DZBA 5IZCA 2P91A 3GVIA 3LK7A 1GR0A 4WEOA 4DXHA 2J3JA 1NQ5A 2DTDA 4L76A 3CSDA 1E5LA 2X9VA 3JTMA 3WYEA 1AHHA 5G0TA 3VKVA 3C85A 3L9WA 4OOFA 1KS9A 1A7AA 1EBFA 3GPDG 4PVCA 3WYCA 5GZ1A 3K6JA 3EY4A 4ITUA 4J1TA 4YAIA 3U4HA 4FC7A 1DHTA 2YW9A 3JQEA 2DBVO 3KLMX 4JP3A 1QLHA 1NASA 1V3TA 3NRCA 2X0JA 4BGEA 4BNWA 4CV0A 1AHIA 1GQ2A 3U49A 3ZWWA 3WR5A 2P5UA 4PLYA 5AVOA 4PLHA 1QYXA 4IDDA 2CD9A 5TT1A 4NBUA 4RF2A 1P3DA 1UDBA 3RFTA 3VVCA 2GNAA 2YQ5A 3QWHA 3RKRA 3RUEA 2JFHA 1QYWA 2P5YA 4CR7A 4PG6A 1PJCA 1K2WA 1KEWA 1EE9A 2RHCA 4GGPA 4EI2A 2X7HA 4Q3CA 3V2GA 4QEDA 3KETA 3BTVA 4IQ8A 2UYYA 3IS3A 5AQ1A 1P1HA 2R00A 4ZRMA 4O5OA 1YOVB 1ISFA 4IDBA 4YVFA 1Q1NA 4E2WA 3U9LA 4XD2A 1CIVA 2G1UA 1K0UA 4OQYA 2SCUA 2XXBA 2GZ3A 2EG9A 4GLOA 1LUAA 1C1XB 2CF6A 2PGDA 5GZ6A 1TT7A 1Z74A 4BV8A 4IJUA 1SEPA 1DIRA 3SBOA 1GADO 5BSEA 3UUWA 2P4QA 5A1TA 2CF5A 1F12A 1A9ZA 3NGXA 1PX0A 4H7PA 3FPCA 1E6UA 4K26A 3ANMA 4IS3A 2WYWA 3GT0A 1JQBA 3LU1A 4GKBA 3K2EA 5IDXA 4WLFA 5I9MA 1FXSA 3JQFC 3GHYA 4YJHA 3WNVA 2NV6A 1QKIA 5AYVA 3LC2O 3GEDA 3BMQA 4OQZA 5JE8A 2YDXA 1E6EA 4FFNA 1LDMA 1YBMA 3TF5A 3JQFA 4G65A 3MZ0A 3HUDA 1CWUA 3I4CA 3QE3A 2B0JA 4JJIA 3SLKA 1XHLA 1KY4A 3I1JA 3MWDB 2PKQO 4L4XA 4N7RA 4YAJA 2Z1MA 3UAGA 1NVGA 2OMEA 1GDHA 1GCUA 4F46A 1TEHA 2VOJA 4EW6A 3QV1A 4LK3A 2PLAA 2QYSA 1NPDA 1NR7A 1PS8A 1H2BA 1EQ2A 3PXXA 5THQA 3S2EA 2OGUA 1PJ2A 4FOOA 1K89A 2DVMA 3WYBA 4GSLA 5CEFA 3E1KA 2WD7B 1SO8A 5U9CA 4BNJA 5MGBA 4GWKA 1RM4A 3HJAA 1P1JA 2X4GA 2VRCD 3RFXA 1Y5RA 3NTQA 3BAZA 5EMHA 5EIOA 1Y9EA 2C5AA 4CMIB 3WGTA 3WLFA 2IXAA 5ENDA 4YJGA 1P0FA 1DC3A 1A5ZA 1LRLA 2NU8A 3UICA 1ZVMA 2YFQA 4NK5A 3PZBA 1B14A 4E33A 4UREA 2VUUA 4U7WA 3NV9A 4N5MA 1PJTA 4ND3A 3Q2IA 5KKAA 4QO8A 4FFLA 4YT8A 1EDOA 1ENZA 4XWYA 3ENKA 5B4UA 5K6AC 1XKQA 3D1LA 4NJMB 1VL0A 4UUMA 1D1TA 4DGSA 1UXHA 2Z5LA 1TB4A 1HLDA 5K6AA 1LNQA 2V6FA 3FTPA 1CF2O 1MXHA 4PLFA 4FGSA 4TVOA 2V6MA 1OC2A 4FBGA 2CMDA 3IDSA 4XGNA 1ZSVA 4EUHA 4RVDA 4F6LA 1K6IA 3LYLA 1PJLA 4NHEA 5T8KC 1UUFA 1QP8A 2VT3A 1MC5A 2NSDA 1I2ZA 4AJ4A 5F3RA 5IDWA 5JCJD 1E3SA 3ZWYA 1ENOA 1HE4A 1XLTA 5T8KA 2BELA 5EESA 3WGQA 3QRWA 5JO9A 1MUUA 3RBVA 4XIJA 3BMNA 4ALLA 3EZYA 2V65A 4E6PA 3OQBA 4J43A 1PGJA 1GEEA 2XAAA 1PWXA 1KETA 2VHZA 3F3SA 1BVUA 1V8BA 3LT1A 1QV7A 1BDBA 4KDEA 4OMUA 3JQ7B 4BNIA 1PGPA 3E48A 3WGHA 5L4SA 4PZDA 1R15A 1YKFA 2PH3A 1UP6A 3DQPA 4IQGA 5I7SA 1BG6A 2PZMA 5ICMA 5AOVA 3VDRA 4EGFA 3O38A 3O9ZA 4QTZA 2O4CA 2HDHA 3HFSA 1UDAA 5A5EA 4QXMA 1KYQA 2Q99A 1U2GA 4XYLA 4XYBA 4NBWA 2EKLA 5HS4A 2RH4A 1AXEA 1I3KA 4CPDA 4DQXA 3AI1A 3AUAA 1HDXA 1HDZA 4GVLA 2R6JA 3UHAA 4JP2A 5A06A 3TL3A 2HO5A 4AL4A 4R01A 3NYWA 1ZNQO 1E7MA 4RVGA 3RSHA 4BMNA 1NFFA 4JBHA 3V1TC 2NWQA 4LRSB 3H8VA 2YQ4A 1CDOA 2GERA 3GVXA 5F21A 2VYVA 4J0EA 3JSAA 1V0JA 4ZQGA 5TC4A 5L7YA 4C7KA 3DOCA 3QWBA 4QT0A 2ZJ1A 3VTZA 4PLTA 2YJZA 1WP4A 2OP1A 1YVEI 3GGGA 1JU9A 3S2GA 1DIHA 2Y68A 2YV2A 3GA0A 1X13A 4RF5A 3FRJA 3HSKA 3H65A 1BVRA 3FTNA 5H82A 1EQUA 1LC0A 2HQ1A 5ILGA 1N7GA 3GFGA 4D42A 3GR6A 2IYOA 3FHLA 3CEAA 4WLOA 1P74A 1RM3A 3AUTA 2ZYGA 1LRKA 2JKVA 1BXGB 4J1NA 4MIYA 4TQGA 4BNKA 3ITDA 5C7LO 4PVDA 1E3LA 4CM6A 4B7CA 2FRDA 2QG4A 4IJVA 4WNCA 2QZ9A 5EQDA 3VH4A 3OP4A 4FFRA 4LSMA 3W4JA 1GU7A 5KJEA 1NFRA 1V3UA 3ZWPA 3ZWVA 2X58A 1ADBA 1QYVA 1DJNA 1TT5A 2BLLA 2RH8A 3GMDA 4IJWA 1NX6A 2EKQA 4Q3AA 2BGMA 1YXMA 3SC4A 1EBUA 3JD0A 3R6DA 4AJIA 5TQVA 3HFGA 1HE5A 1ADCA 2Y0CA 3BTOA 4EEXA 1Y9AA 1D1SA 4BKOA 3O03A 3WGIA 3NX4A 1IHYA 4XGIA 1LSOA 1XQ1A 1I3NA 1JW9B 1C1DB 1CRWG 1QR6A 4D46A 3FCOA 5L51A 1S6YA 4BGIA 4Q3DA 4Q39A 4AFNA 4LCJA 3PWSA 3UF0A 2PGLA 3KYBA 3B1FA 4YCAA 5T67A 1SMKA 3B6ZA 1JWAB 4E31A 3ULKA 3DB2A 4BNTA 4YJFB 4CLOB 5EL0A 1XWFA 1O89A 2G17A 3I9LA 1K5HA 1QLJA 5HM8A 4XDYA 4FPXA 2NADA 2CUKA 4L0QA 3Q9NA 1Q7CA 3VDQA 1SPXA 1RPNA 3H2SA 4WCFC 3X2EA 4YT4A 1N1EA 1A4IA 2O7QA 1ZW1A 3PDJA 4WCFA 2YYYA 5BSFA 5FI5A 2DBRA 2G82A 2E48A 3WBBA 2UUPA 4GI2A 8ADHA 3ZH2A 1OBFO 3AI3A 4KQWA 1MG5A 4I5DA 3QVOA 3MOIA 1FJHA 1M75A 2W90A 2Q4BA 5DBGA 3D5QA 3INGA 1YWGO 4XYMA 2AQHA 2OUIA 1G6KA 1OOEA 1KEUA 1ZIDA 2D1YA 3JQCA 4HBGA 4EEZA 2Q2QA 3ROPA 4OKNA 3C7DB 3ZWNA 1YGYA 1YO6A 2AEFA 3I23A 1AUPA 2WDZA 3K30A 3QA9A 5G2OA 3OM9A 1HWYA 1ZCJA 1P1FA 3OF2A 4I1IA 4XIYA 2VNSA 5JY6A 3JD2A 1ISGA 2NU9A 1I5RA 5BQFA 2VRBA 2CNBA 3L0DA 2CDBA 1I8TA 3KYCA 2NVBA 2W4QA 1E7QA 3WTCA 1RKXA 3JQ6A 1VL6A 3C7AA 1WNTA 2RBEA 1DIAA 1MA0A 3R3JA 3E9MA 3ZHXA 4O6VA 4MP3A 3ON5A 1X7DA 3RU9A 4N54A 5F5LA 2TMDA 3AWDA 3FNGA 2I5PO 4J49A 3VKUA 5CDUA 2B83A 1KEPA 3E8XA 5KVCA 2GPTA 2OO5A 3SC6A 1EUDA 2BF7A 3MOGA 4BO2A 4CR8A 1T4BA 4XRGA 2IODA 4HFMA 4IXWA 4TMFA 3N74A 1ISIA 3D4OA 4FFPA 2AHRA 3Q9UA 1BMDA 2OHXA 3JYNA 3IOYA 3QVTA 4CMJA 2VYNA 4BB6A 4IUYA 3BZUA 1ZSYA 3DBHB 3EDMA 2BRUA 4O0LA 4ND5A 3GRKA 5A9RA 4CQLA 4RO0A 1N5DA 3F6YA 3QVWA 4NBVA 4I9UA 2I3GA 2I67A 3M2PA 3QWAA 4GX2A 2UUOA 1X0VA 4HFRA 4IZHA 3PWKA 4LISA 1WLYA 1F8GA 3LT2A 4UEKA 2NM0A 4RDIA 3WX0A 4BKPA 2YHIB 2YFHA 2IXBA 3OHSX 4QX6A 3NT5A 4TKMA 1W8DA 5LDGA 5T6BA 2RHRA 2ZTLA 3KEQA 3PTZA 3QQPA 4L8VA 1K6JA 3LC7O 5AXCA 5I8ZA 2BKAA 2Q45A 3VPFA 4UUPA 1NFQA 3RBZA 1QG6A 1H6DA 1M2WA 4MVJP 3HDQA 1JVSA 3LDHA 1EVJA 1JVBA 4D0SA 3E5RA 1HE2A 2H5LA 3I9KA 1NXQA 3PHJA 4J9VA 1PS0A 2BFOA 4W9NA 3UFXA 4CM4A 1YL6A 4EUEA 4R3WA 4A10A 2NVUA 2GN9A 1NVTA 5JBIA 3ZNPA 2CVZA 3X2FA 3ASVA 4JROA 2WD8A 1IOLA 1WXDA 1NHWA 1E6WA 4AJEA 5ER9A 4IMRA 4I8XA 4XX0A 5JDCC 1EMDA 4I5GA 1Q0HA 1U3VA 3JQAB 3MJSA 5IJZA 1UAGA 1HLPA 3U0BA 1MB4A 3WSVA 1RM5A 3ZN2A 4HX5A 2I99A 4CMCA 5JDCA 3OH8A 2NTVA 3D4PA 2FMUA 4NU6A 2C54A 2GYYA 3HDYA 4OXKA 4KUEA 1Z73A 2ZTMA 5JAQA 4CMGA 3ZZNA 4CUZA 3INRA 4WE3A 4YBZA 3OECA 4IZIA 1B3RA 4DBZA 3JQGB 4R41A 4DVJA 5KJ1A 1PL7A 3GF4A 1ENYA 4HP8A 3ZWAA 1T2AA 4DQUA 2QIOA 4RGBA 1UAYA 3OJFA 5TGDA 3G1UA 3PJFA 2BI8A 3DBRB 4RVSA 4XCVA 1H2HA 4BO9A 4TRRA 5TT0A 1HL3A 1C14A 2FN7A 1VC2A 4XRRA 3S2FA 5CAEA 3RC2A 3GGOA 4BNHA 3WWYA 1MP0A 2ZTVA 3JQBC 3ZWBA 1EFLA 4ZJUA 2FPPA 1JN0A 3MJTA 3ZHBA 3LT0A 2JHFA 1HE3A 5DULA 1P31A 3JQBA 3JCZA 3LLSA 1GY8A 4ND1A 1KVQA 2VWHA 2FY8A 2GUGA 3PHGA 2RCYA 1SBYA 4XQ9A 3MEQA 3W6ZA 5LC1A 4CQMB 1P1RA 4DWVA 1AGNA 2DQ4A 5KVVA 1JAXA 4ZICA 2J5KA 3H9JA 2YZ7A 5DDIP 3ZHYA 1EUZA 3H3FA 5CP8A 5IXYA 3GGPA 4BO6A 3DOOA 4XZ3A 3QW2A 2WYUA 4IIUA 4R4JA 1FDTA 1H94A 3T7CA 3SEFA 2I3AA 4K28A 4PZEA 2D5AA 1D3AA 4K6FA 3HQ4O 5JPIA 1VSUA 5ICSA 4GKVA 2YV1A 4J6FA 2ZATA 1R66A 2WE8A 1LJ8A 3EVNA 3R0IA 4HADA 1LDYA 4OJNA 5EERA 1U28A 4KDFA 3WS7A 5ITWA 1DXYA 2HRBA 4A73A 3GNTA 1P77A 3PHHA 1R4MB 3GHHA 4CQMD 1GYQA 4RQTA 2B5VA 4H3VA 4U6SA 2PNFA 2ZQYA 4I08A 2Q4EA 3EYWA 4J90A 4RPKA 3ZNNA 2A94A 4CUKA 1A72A 1PJSA 4WKGA 3VZSA 4TROA 4CMBA 4Z9FA 3VHRA 3K9QO 3D7LA 2W2LD 1LQUA 1XDWA 2A4KA 2FP4A 4YEDA 3NJ8A 2BGKA 2NUAA 1R4NB 2PZLA 1FDWA 4UEOA 4R68A 2ZCUA 2BFPA 5A3VA 1K6XA 2VCYA 2EWMA 4QECA 1F8FA 1PZGA 3LC1O 3ZV3A 4WECA 4OM8A 1G0OA 2YV3A 2OORA 5L40A 1W4ZA 3OICA 4CL8A 3F4BA 4BB5A 4RF4A 4BO8A 2H6EA 5G4LA 4EDFA 1ZJZA 1M6HA 4HNGA 4UVHA 1YB5A 2VHVA 2JCYA 1ZXLA 3VZQA 4LW8A 5IG2A 1CQJA 4BNNA 1UXGA 1SEVA 1I3MA 2GASA 2VQ3A 3ZNQA 1BRMA 1NVMB 4H16A 5CEJA 3U09A 3PYXA 4OOEA 1TXGA 1UXKA 5G0VA 1BW9A 4IDFA 3ST7A 1O0SA 2HK7A 3QWFA 3TZQA 1ID1A 4QUKA 4R1TA 1Q0QA 2DM6A 2I6TA 2QRLA 3KO8A 2A9FA 2Y67A 1E3IA 2C59A 3ZW9A 3WICA 1X1EA 3KXDA 3WOHA 3ZWXA 4L4RA 4UUOA 1U9JA 3AUSA 4GGOA 1NQTA 4QFDA 4XQCA 2PA3A 3WXBA 1ULUA 1Y8RA 2JFGA 3T4EA 4CM9A 4BO7A 5FEUA 4NBRA 1DC5A 2QZZA 4BOYA 5DBIA 2TMGA 3RUHA 1B8PA 1U5AA 3Q3CA 5G0WA 4YAEA 4L74A 2B36A 4AJJA 5ILOA 5FFFA 4S1VA 1LC3A 2Q1SA 4DYVA 3ASUA 3FR7A 1I2CA 4CLHA 3NUGA 3OIGA 2Z1NA 4ALJA 1U4SA 4GMGA 5DF1A 1YOVA 4WK6A 2FSVA 4FCCA 2UDPA 3PIDA 1FF9A 1N9GA 2VN8A 3FI9A 4FR5A 3BTSA 4BO0A 2PH5A 5B4TA 5JS6A 2VZ8A 3MJVA 1X14A 4Z3DA 5IN4A 3KUXA 4KMSA 4NPCA 2IRWA 2OZPA 3GG2A 5BR7A 1OI7A 4II2A 5ER6A 4HY3A 3PQDA 1VJ0A 1LLDA 5C7OO 1YL7A 5CPBA 4NZ9A 3UCEA 4WOKA 3VH2A 1FK8A 2O3JA 3B1JA 4JK3A 2O3UA 5FYDA 5HWSA 2I9PA 2Y05A 3AY6A 2GCGA 3G17A 3NTOA 1ZEMA 5TIIA 4YQZA 1KERA 5DCUA 1UXIA 3D3EA 1EK5A 4DPMA 1SCUA 3ZWMA 3HWRA 5H81A 3COSA 4JQCA 2I76A 2AE2A 4HFNA 5ADHA 3AY3A 4AJOA 1I24A 4QQRA 1VE9A 1ZMOA 1PQWA 2E37A 3SXPA 4LMPA 3GC6A 4BMVA 1R12A 3CINA 2VWQA 2FR0A 3DHYA 3ZV6A 4TWRA 4Z6KA 5C37A 5CDGA 4IDEA 5H83A 3T4XA 4TVBA 1LBEA 2WE7A 4BMSA 3I6QA 2QRJA 1DPGA 1EZ4A 1YQXA 2CZCA 4FQ8A 2O48X 4P4LA 3EW7A 5L7TA 3ORFA 1KVUA 1D4FA 4HWKA 1A4UA 1P33A 1CQIA 2Q3EA 3U4DA 2DPGA 2HRZA 2DU8A 3WFJA 4O63O 3UXYA 1PQPA 1ZUD1 2EKPA 2V7PA 3BHIA 5IDYA 4PG7A 1F14A 2X6TA 2XF8A 2PZJA 5G0SA 1T4DA 1E5QA 3WIDA 4KZPA 3K96A 3IIEA 3EK2A 3H9GA 4Y6RA 1JTVA 3HG7A 1VJ1A 4GL4A 3IL2A 1OMOA 4KQXA 4BO3A 4D79A 1X7GA 4PLZA 2GF2A 2HCTA 3ROQA 4E5YA 4BNFA 4BKQA 3PQEA 4II3A 2ZQZA 4RZHA 4MVJG 4BS9A 4CMEC 3E82A 3P2YA 1LXCA 2DUWA 3BMQB 1H6BA 2Q50A 1SZJG 3TSCA 4P4GA 1U3UA 3WQRA 3OSUA 3FWNA 4CMEA 1IZ0A 5TS3A 3QHAA 1SNYA 4URFA 1WWKA 4XDZA 4MVJA 1XYGA 4WLUA 2G76A 1LDGA 2C20A 3EUWA 1A9YA 1Q7BA 3PK0A 1J4AA 3E6AA 2B35A 4NFHA 2ILTA 2ZB7A 3KV3O 3RVDA 4E2XA 5I7EA 2AA3A 2EGHA 2HKIA 4CR6A 5JMWA 4G81A 3I9MA 4GX5A 3AOEC 3DMTC 2H9IA 1P45A 2AG5A 2PGJA 5JLAA 3A28A 1DBVO 1VM6A 3DMTA 2Q46A 5KNLA 2VOEA 4DRYA 1QXSA 3WGZA 2DFVA 4YJGB 1H9AA 5B4VA 4L75A 4ZA2A 4XYGA 3VH1A 1BXKA 3CIFA 5L3ZA 1PL6A 1T2EA 2R2GA 3ZDFA 1KOLA 2OP0A 5L53A 5DCYA 1QV6A 4NH4A 2HMWA 3BA1A 3GAFA 4B4UA 1FDVA 3OJLA 5J23A 3TZHA 3RASA 1O95A 1NPTO 1PS9A 1YB4A 1YQDA 3O4RA 3WJ7A 3IKVA 4R16A 3PZRA 3MJ4A 5ES3A 1DFGA 4R5HA 4BNVA 2NTJA 4P38A 5IFLA 3R3SA 1XR3A 1I01A 3DC2A 2O3TA 5CG2A 4BNUA 3BMOA 5B12A 3WJAA 2PTGA 2Y0DA 3K31A 3UVEA 3N58A 2W2KA 4FFOA 4BQPA 1H9BA 1NR1A 3PEFA 3NTRA 1WDLA 3VAZA 1XCBA 3DTTA 3JQ8A 3PJGA 3E5MA 4NQZA 4E3ZA 3RBXA 1WZIA 3L07A 3ETDA 3TZKA 3I4FA 2Z95A 3BMNB 1Y6JA 3PDUA 4CM1A 1E0DA 3KZVA 5L4LA 4D43A 3DDNA 1LA2A 2B4QA 2X1HA 4XQGA 2D2IA 1R0LA 5FF9A 5BSHA 3CPSA 4ESOA 4ZVVA 4XB2A 1HYEA 3W4KA 5KJCA 1HSZA 3RAJA 2Y1EA 1GUZA 2BHLA 4Y98A 4BL5A 4WPGA 3AFMA 1UJMA 1L1FA 2GDZA 4Q9NA 2NU6A 3E9NA 3I83A 4MP8A 1YONA 2ZJ0A 2EW8A 3HN2A 4IGFA 4B3HA 5U1PA 3SJ7A 3JYOA 4E12A 3ZWOA 4KWIA 4YXFA 3K73O 4XEHA 1M6WA 5HS6A 4FOSA 4CM3A 1MXFA 4GBJA 4QO7A 1P1IA 2Y93A 3GZNA 3F5QA 4RVFA 3PJEA 4E5PA 4NNJA 1LSJA 1M67A 1XSEA 3IUPA 4BNGA 5JW6A 1U3WA 4OYRA 4R3NA 2EEZA 4B4VA 4Z3KA 2CDAA 1E77A 4NG5A 5G4KA 2EF1A 1RYDA 3Q11A 3RUIA 3KM0A 5C3MA 6ADHA 3PLRA 2D8AA 3HHPA 3JD4A 2NQTA 3KTDA 4B8ZA 4R1UA 1LDNA 1WDMA 3GMSA 4R69A 3C8MA 1R37A 4W7HA 3R1IA 4J16A 3S2IA 4FD3A 2O7SA 4OSPA 3D3WA 4NFYA 1PZHA 4OKIA 3S1LA 2PD6A 5CEEA 3FSRA 3RJ9A 4FGWA 3IMFA 4YPOA 2NLOA 4TZTA 4EBFA 1E3WA 4UULA 4D45A 1ONOA 2GRAA 3NKLA 4WUVA 2AG8A 1YB1A 5F1OA 4IY1A 3ICCA 1VJTA 5GZ3A 4MKZA 4BO1A 5KTKA 2NNLD 4LVUA 5FWNA 2AQ8A 5L95A 1DRVA 5DNAA 3H2ZA 3GY0A 4J4HA 4YJDA 3OEYA 3CXRA 3HDHA 4R5MA 1GEGA 1JDJA 1HT0A 4M54A 1LSSA 5GY7A 3L9XA 3OEWA 3JYLA 3ETGA 4FJ2A 3SJUA 2VYVD 1E7WA 1KIFA 3D64A 1TT5B 3GAZA 2PV7A 4Y8VA 3DBVO 4O1MA 4DIOA 2OXIA 1IZ9A 3IP3A 3ABIA 3GN2A 4BO4A 3VOSA 3ZI0A 3DONA 1EEHA 3U5TA 2IE0A 1Z7EA 3V2HA 1O8CA 2Y0EA 4XYEA 5A9SA 5CDTA 1JA9A 4CM8B 5U4QA 3PYLA 4AJPA 1GYRA 1NQOA 1T2DA 3QJ5A 4NU5A 1OAAA 4R1SA 1QYDA 4IPTA 4FDAA 4OL9A 1H5QA 3K8ZA 4LN1A 3O8QA 4XQEA 3CE6A 4E13A 3BTUA 1N8KA 1LX6A 2ZIZA 2EERA 1GYPA 2P9GA 2PWZA 3NAQA 5B37A 3OJ0A 1WPQA 4WJZA 4A27A 3FD8A 2JCVA 3I52A 2X22A 4I5FA 3VVBA 3ZU2A 2F1KA 5I8WA 1CEQA 1V9LA 3PGJA 1W73A 1PEDA 3U4CA 1SB9A 2Y66A 4P8RA 1NWHA 4PRKA 2VTEA 2UVDA 3W1VA 3CKYA 4E32A 2C29D 4WCFB 1ZSNA 4B4OA 1LSUA 2HMVA 5TX7A 2EJVA 4CLRA 1XA0A 1Y8QA 5A05A 5BNFA 4NI5A 3DWFA 1HSOA 1RM0A 3ENNA 1UDCA 4JX8A 1C3VA 3PGXA 2CVOA 3P19A 4CUJA 3EGOA 1T2FA 2POQX 4KTVE 4GVXA 2PKQP 4MVJF 2JL1A 3HZZA 1HYHA 2FHSA 3HB4X 4E5MA 1DB3A 4M87A 4IDCA 3EC7A 3DAPA 3TQHA 2Q1UA 9LDTA 5HTOA 3L6EA 3NGLA 3W8FA 3AM4A 4M55A 3AU8A 1KEVA 3GQVA 5JSFA 4Y6SA 4MINA 4XR9A 2GZ2A 3S8MA 1Q0LA 4K1LA 1L7DA 3VPHA 5A03A 2HU2A 2Y1CA 4QSMA 1WDKA 4UVGA 4O59O 3BMCA 4NJOA 3I5MA 3AJRA 4JBIA 2AQKA 4X54A 5BNIA 4F3YA 3G3EA 3KYCB 3ETEA 3OIDA 4M86A 5DBFA 3TJRA 2NACA 4PZCA 1BSVA 4E30A 3ADOA 1GPDG 4WEQA 4GPD1 3RIHA 4MIOA 2J5RA 3RKUA 2VHWA 3OJOA 4K9DA 3OA2A 2C5EA 5JAMA 1QSGA 2B4TO 5COBA 4CV2A 3FR8A 4B3IA 2FOIA 1TI7A 3ONFA 2GR9A 3INTA 3RUAA 3AY7A 3RROA 1DDOA 4DQVA 1ZKMA 2WSBA 1NBOA 1DOHA 2ZB3A 1U8XX 1BDMA 3W8EA 3HN7A 1IYZA 3IQDB 3JQAA 3MTGA 3FF4A 2JAHA 2D5CA 1DIGA 1MC4A 1UP7A 2VNAA 4CQLB 4RV9A 5JO0A 3DZHA 4U0KA 5KJFA 4F45A 1N2SA 3CUKA 2DLDA 1XG5A 3IAHA 2Q49A 3TOXA 3H5NA 5CHEA 2X23A 2D0IA 4YRBA 1PR9A 1TLTA 4PCVA 3WGGA 4WASA 2HAEA 3KYDA 1WW8A 1XU9A 5CDYA 4MDHA 4DIFA 2BGLA 3EAGA 1GZ4A 4GWGA 3L6DA 3DBLA 3L4BC 1YH3A 3OQ6A 4IDGA 1NAHA 1UXJA 2QHXA 1ARZA 1C0IA 3RU7A 2VYND 2FWMX 3L4BA 1Z7BA 3G0OA 4HV4A 5JDIC 1HZJA 4UVIA 1F0YA 1B8VA 3HB5X 2QYTA 3ZU5A 4E5NA 1BXZA 3GK3A 4Q3EA 2XXJA 3NJ4A 5EQFA 5JDIA 4BGUA 1VL8A 3PJDA 4I5EA 4B7UA 4ALNA 2JFFA 2RIRA 1A71A 4CM4B 1H0KA 4NK4A 2NVUB 1ISMA 1SC6A 2NTNA 4WOJA 3WSWA 3A14A 5IF3A 4MO2A 2VHYA 3DAGA 4G2NA 4E2YA 5IAAA 3U62A 3EVTA 6LDHA 1WAMA 3LSYA 4L73A 1A7KA 2NVWA 3AW9A 4NDNE 3RC9A 4R1NA 1T26A 4PN3A 1YQGA 4FW8A 4PG5A 3GPIA 4MVJH 3ZU4A 2EJWA 4MVJE 4Y67A 4RPLA 1PJ3A 1ULSA 2HMSA 3TZ6A 4J0FA 1YDEA 3F46A 3WBFA 4DC1A 3AU9A 2GN4A 1PJBA 4I9HA 1ENPA 4CJXA 2X5OA 2V6BA 5I7VA 1U7TA 3WLEA 4PFJA 1BTOA 2BD0A 1I0ZA 1YDWA 1T2CA 3M1AA 1P9LA 4FFMA 4RZIA 2J8ZA 3HADA 4J7CA 4MKXA 5TJ9A 1ZK0A 3JD3A 1B2LA 1O9BA 3JV7A 1KVRA 3DMYA 3WTBA 5IXSA 3AI2A 3D0OA 1JWBB 3AM5A 4XR4A 3FPLA 2JHGA 1PIWA 7MDHA 4IMPA 1KVTA 4N18A 2GD1O 3IJRA 3LF2A 5ITVA 1D7OA 1PZFA 2AE1A 4MKRA 5JCXA 3WGYA 1NP3A 1GQYA 1M66A 4IBOA 1RYEA 4CV1A 1XELA 2DKNA 2PKRA 4TRMA 4ZRNA 2V6GA 4E0BA 3PHLA 4WNIA 4J91A 4ZN6A 1B26A 2CSUA 4JLWA 3KOUA 4DLBA 1W0CA 4LMRA 4A0SA 2VUSA 2WEKA 1X0XA 1UZMA 2P4HX 4AG3A 2Y1GA 1LQTA 4XJTA 1Z45A 3OMLA 4FN4A 3ADPA 5A04A 2P9CA 1HDCA 4ID9A 2D3TA 4U0JA 4NFSA 4N5LA 3PRJA 2E6UX 3ANNA 4J3FA 4PLPA 3GUCA 4DREA 1B15A 1E7RA 4MIEA 3ZGYA 4PLWA 3PLNA 1LDEA 4JGBA 3E9QA 3ONEA 3K92A 2Q2VA 1DO8A 3PHIA 3CMCO 3GUYA 2PD3A 2G0TA 4BQRA 3W8DA 3RQSA 2O3SA 1ZFNA 2GN8A 3KSUA 4F6CA 4W4TA 4Z9XA 1F17A 3E03A 2DTXA 3PVZA 3RCBA 3TWOA 1B3BA 3CZMA 3ZWCA 1VPDA 2PFGA 4GX1A 5F5NA 5DCWA 1IL0A 3K2BA 4KTTE 2FSSA 3I9OA 4J9UE 4RLSA 5KOIA 3DFUA 4HUJA 4NR0A 2VUTA 2DT5A 2EV9A 3C1AA 4UUNA 3P7MA 3DZIA 5DP1A 4DLAA 4RL6A 3RC1A 2X86A 3ANLA 4ZD6A 3GN1A 4J2OA 1U3TA 4I9NA 1PGOA 5JC1A 4RF3A 2F00A 2X9NA 4QFCA 4D3FA 1E7SA 1CYDA 3ZU3A 1BHSA 4N5NA 1ZO8A 1ZBQA 3C7CB 5BSGA 2CDCA 4U8GA 4YB8A 5CPFA 3B70A 1ZK1A 2H63A 4INAA 2IDZA 1BW9B 3NDRA 4RORA 1C0LA 2PR2A 5AXBA 2NQ8A 1YL5A 5KKCA 1MFPA 4U6QA 4BV9A 3KHUA 3PYMA 3H5AA 1PSDA 9LDBA 3UKOA 4DA9A 5IN5A 3QWIA 4FS3A 4RDHA 2Q1TA 2IZZA 2CVQA 3F1LA 1ISHA 4BNYA 3WG9A 3ZV4A 3FWZA 4IDAA 1UZNA 3LZ6A 4L9RA 3VC7A 1C1XA 1O94A 1U7HA 4JXKA 3RUCA 4PG8A 4JJFA 1ZMTA 2JD0A 2ZCVA 1Y8RB 2C2XA 3ROMA 4OAQA 1NYTA 3TZCA 2P2SA 3DZFA 2O2YA 1I32A 2P68A 3NT4A 2GLXA 3QY9A 5TRTA 2IZ0A 2Y1FA 1GV1A 5HBRA 1DFHA 3F1KA 2HUNA 2VRCA 3I3OA 5JXWA 4J1QA 1OZAA 2R00C 1GL3A 4FSHA 3TN7A 3GH3A 1IHXA 3PPIA 4BUCA 3QIVA 4MPDA 1V3VA 3FBTA 3UGKA 4RCVA 3FNHA 2HMUA 3C3XA 2RAFA 3GDOA 3DR3A 5C7IO 1N9GB 1JKFA 3WMXA 4G5HA 4BNMA 1PJ4A 3CTMA 4ZGWA 2Y99A 2W98A 3A1NA 1YS4A 2BI7A 3KB6A 5FI3A 1PTJA 4CM9D 4HNHA 4PIVA 1N1GA 3OFSA 1HTBA 4OXNA 3F4LA 3FBGA 3GDFA 1Y81A 3P2OA 4JIGA 2B69A 4LCEA 1Y7TA 1HKUA 3UCXA 2WD7A 3VTFA 1GZ3A 3PI7A 2EP7A 4OGWA 5DN9A 1XEAA 3EZLA 4CMIA 3WIEA 1P0CA 3MJCA 3DFZA 4DC0A 1MFZA 3OJEA 5JCJA 2FR8A 1I3LA 3GVCA 3WFIA 3OETA 1EVIA 1QRRA 4ZQHA 3JQDA 3L6OO 3ZNOA 3AFNA 1U1IA 3FN4A 3MCVA 4IJKA 3ONDA 2PY6A 3KLPX 4UVDA 4FB5A 3OIFA 5JMPA 4M1QA 2CFCA 2EP5A 1KVSA 2Y1OA 1FDSA 4NJMA 4PLGA 3H9QA 3EHEA 2C7VA 2ZKLA 2ZYAA 3OBBA 1ZZEA 1DEHA 1LTHR 4YJHB 4OSOA 2OBNA 1MGOA 4IINA 1UP4A 3GZ4A 3M6IA 3B1KA 2FPGA 1D8AA 3AM3A 1GUYA 3E18A 1H93A 1Q2XA 4J4TA 4OHUA 5HRUA 1HYGA 1ISJA 3EMKA 1LLCA 1AN9A 1ZJYA 3PP8A 2WYVA 1ZH8A 4CL3A 2O3RA 4IS2A 3KRTA 1R16A 2OFPA 5F1KA 4D3SA 1E1KA 5C5IA 5BNTA 5L4NA 4EITA 3G79A 4JJGA 2BMAA 1O5IA 2A35A 3BHMA 3DL2A 3WQQA 3QVXA 4EUFA 1I33A 4DTIA 1DFIA 4YQYA 5COQA 3WNQA 4WCDA 3AOEA 4JCOA 3AUUA 1KC3A 1LU9A 4R9SA 3JQ7A 2X9GA 1GCOA 4YAGA 2EGGA 1PGNA 1FDUA 1ORRA 1J5PA 5A9TA 4AJHA 1C0KA 1PGQA 2PK3A 3WMWA 4B3JA 3DEYX 4HFJA 2VT2A 4RJTA 1DSSG 1KBZA 3T7EA 1E3JA 2XPCA 1HRDA 1DRWA 1W6UA 4BNXA 4B79A 1PU2A 3QSGA 3C24A
chains in the Genus database with same CATH superfamily
1C29B 3USCS 1P80A 3IJPA 2YZGA 3AEUB 5DBHX 4AULA 3DE2X 5KTNA 1QBKC 1W4BA 1ONNA 3STHA 1U0LA 1K5DA 3IXLA 5LA6F 1IPFA 3RSZA 2OENG 2YUTA 2Y1DA 3UH1A 2WPNA 5K0FA 4WZBE 4EPRA 2K87A 3NHZA 3Q1KA 5CLQA 4FWBA 2AFRA 1T1RA 5J3JA 3UJ3X 1BQEA 3E23A 4FMPA 2GCPA 3DCIA 3FMPB 4CKZA 3W6UA 4RHUA 3OA0A 3HCOA 1KY2A 2JFXA 4CQJA 1XX6A 4K5QA 4PXSA 1D2EA 2C4MA 2NYRA 3CEMA 2P5TB 5J5AA 4TN1A 4GZMA 3H9UA 1KYYA 2VWPA 2J5QA 2R6DA 2PMDA 4KCGA 4IWNA 4AU1A 4RKFA 2A5JA 1NRWA 2B94A 4B6RA 2R4QA 1U2TA 4P5EA 3W77A 1Z5GA 4Q3BA 1H6CA 5ITSA 4EKNB 4ZK6A 5BVHA 2DOKA 2JZNA 1Z16A 5A5DA 1EVYA 3C4QA 1PR3A 2EU8A 3IULA 1ODCA 1M8PA 2DAPA 4K6HA 4M7RA 3MGAA 1VDMA 1W0KA 2VWGA 2OM2A 1WVGA 5K3EA 1CZRA 5JR3A 1IOZA 1ZQ9A 3V2UA 1FSPA 3B6IA 4EF5A 4PPFA 1JNYA 1GV0A 1NF2A 3RYHB 1NNLA 4PEVA 3THWB 4MS4A 2CK3A 3BMOB 3GEMA 3O4HA 2QTCA 4O33A 2W93A 4DV5B 1MAUA 3N2KB 2I8AA 1Q74A 2W2KB 4DV7B 1AUVA 2W22A 5KNDA 2H1VA 4MP6A 2AJCA 5IKEA 3SLGA 2MYTA 3JQ8B 2X41A 2XHZA 2XUDA 5K0ZA 3QVSA 4H7EA 3QSYA 1VHWA 2BEWB 3IMGA 3JR3A 4RTSA 3H84A 1CIJA 4MVCA 2O05A 1NDQA 1NJGA 4KQGA 5FL7D 221PA 2WWWA 3ZV5A 5LXTB 3K72B 4N3NA 4DCGA 2JI4A 3OOWA 3ZCPA 4CMKA 2VSYA 2VA9A 2DC1A 2GBPA 1O95D 1GPJA 3QUQA 4GX0A 4D80A 4TV9A 2AKYA 1W59A 4A5OA 1P2SA 1C41A 1E79A 2KQUA 5JV5A 3K2IA 1H5NA 1SBHA 2EYUA 5KWSA 2ID9A 4OQLA 1IWBB 3CNQS 5IDQA 1XFAA 1KK1A 2IHBA 3AR2A 5CLGA 5EINA 3VX4A 3FNEA 1OREA 2NZWA 2EQAA 1OX5A 3IIJA 1JR2A 1DC4A 3N28A 3VJRA 2UKDA 2ZTSA 2GN0A 3PUVA 4YA6A 3DTYA 3NH6A 3PIIA 4OXYA 4BASA 1PWEA 2QK4A 3UK6A 4PNHA 1NOIA 5J59A 3SHQA 1WKVA 4LXQA 4PRLA 2WINI 4PINA 4REQA 4TMTA 5JVDA 4MLZA 5I51A 1FIUA 2BR4A 4EYQA 4RBNA 2Z04A 3KPWA 5CD9A 2XCSB 3A4VA 1AKRA 2E82A 3OOEA 3RIGA 1JXQA 3FMVA 4KUHA 3M3DA 1ZONA 1U2DA 2XZPA 1TA9A 1W1UA 4XGKA 5KREA 1T24A 4IQ0A 4WRRA 1U0TA 2HRQA 1JLSA 4EY5A 3ZE6A 3JQ9A 4P32A 2VDNB 2QRKA 4JBXA 1VP3A 4OV6B 2OFFA 3HH8A 4KIUA 3PNYA 5K20A 1IUKA 1UINA 1VZ3A 3V9AA 1UFQA 2ZYTX 3D3WB 3C3CA 3LVFO 4PSAA 4EHAA 3PEYA 4LPSA 2P9YA 1N6NA 3T7RA 1E9DA 1MNQA 2X0IA 5T5QA 4JI7B 1UXOA 4F12A 2P65A 1VJCA 3VYSB 2A9KA 2H4WA 3LIIA 2IPXA 3L43A 4DYDA 5LQNA 5CA0B 3OJXA 1L3IA 3IUSA 4Q6BA 3DH0A 4KKVA 3MT9A 5AI4A 4HVCA 3MINB 4LJLA 2M1ZA 4NRDA 2X4IA 4GOOD 3ZD9A 2XMGA 1YA4A 1XGKA 2JATA 2XUZA 4AZSA 4DQLA 4CXMA 1BFKA 3H4VA 4FR2A 4LI3X 4E5UA 4Q7MB 4F4DA 2EJBA 3PUWA 3ZDDA 4Q1CA 4C43A 5TF4A 1KDTA 3C3JA 1INLA 2WJWA 4G1UC 4EA9A 1HQKA 5K3DA 4PGHA 3BJEA 4HWGA 4YO8A 5J9FA 3X1DA 2PXHA 1GUBA 2H8KA 5EVCA 1MOPA 3U17A 3PC3A 2X0RA 5A02A 1MN6A 3UT0A 1AQUA 1MT3A 2X5JO 4FC6A 3HJCA 3QXCA 4ZJPA 3A1WA 3WISA 5CBPA 1A77A 2B8WA 3BRWA 3BGSA 1C9MA 5JYDA 1UBCA 3HCEA 1MLDA 4YTEA 3OPYA 4FUQA 2VK2A 1UBNA 1F4LA 3ESCA 3K0HA 4MV6A 5EPUA 4P7GA 1GZVA 1XXHA 3VXKA 2BFMA 4N49A 1EXVA 1SOMA 2X4DA 1U8AA 5EWMA 1E7YA 1RQRA 1R5BA 4YMVA 2V97A 2WJPA 3UA3A 2G71A 2AC4A 2NU7A 2AXNA 1S3IA 2W6ZA 3GRPA 5DTIA 2ZRHA 3HU5A 3IPYA 3NM4A 1Q22A 3TOZA 1JQDA 1JALA 1QHSA 3KZMA 1IB6A 4LOAA 2CLLB 3GJ0A 4RD2A 5AJHA 2B3DA 2C3UA 3FCAA 4GOJA 1ZR2A 4M36A 3DZKA 4TYPA 3VR2A 2O2DA 2F8TA 2ZJFA 3KUCA 4R8MA 4H0FA 3VZPA 4D0RA 5AUQA 2OSBA 2QAJA 4M49A 1Z82A 3LH5A 2ZTUA 2K7FA 1M34B 2G3YA 1TVCA 1JJVA 4JLMA 4GYYA 4NEHB 1BHO1 1Y9JA 3NW9A 1WY7A 2NXCA 4O2BB 4RMIA 3TKLA 5B1YA 3DMPA 4QPCA 5C3UA 1PR5A 1RRKA 2QNBA 3C1UA 2O0JA 5KOHB 1KXJA 1X8LA 5AXDA 3NH9A 3UOWA 4I50B 2OD9A 2R8XA 2RAVA 3TOVA 4PG4A 1WV0A 4NIMA 4RADA 3UOGA 1FQWA 1EDBA 2QXTA 3H1FA 4HRAA 1VPLA 2LGJA 4EI7A 3Q0TA 1SURA 1JIVA 4PQFA 5CHYA 5BOSB 2WTXA 4QBTA 1BYIA 1S1CA 2J5BA 1QUEA 2ZBRA 3CRVA 4J0QA 1KFKB 1N3BA 3G1TA 3NNSA 3HM2A 4ZV7A 1OZ0A 3PKZA 3QMPA 3RFVA 4YXWA 3UUGA 1HZZC 4I6EA 3Q8LA 1SXIA 4R51A 5F9HA 4P22A 4LY6A 2Y9MB 1HDYA 5ENZA 3RD5A 4M89A 5EUBA 4EQ6B 3Q3VA 4BYGA 2O07A 5LKRA 1MJFA 2PN1A 5BRNA 3C6MA 3JYPA 3QV2A 3GVHA 1ML3A 3VNAA 4HSGA 4F1KA 3URMA 4Y2VA 4EYEA 3PKJA 1FE8A 1V7QA 3CLHA 3AJ9A 2HN9A 1KAMA 1XTIA 2FTKE 3BDIA 3ICPA 4RY9A 4S1OA 2OFOA 1E0JA 4R2MA 5E3IA 5JAOA 4EJMA 2WHYA 2UAGA 4NJEB 1A9XB 1SKBA 3D0QA 1IY8A 1JEAA 1QYIA 1YR7A 2Y9PB 3A1SA 4YN3A 2Z6VA 2B7BA 4L8GA 1N6HA 1U4NA 2DCUA 2JEYA 3FNFA 1DRJA 1YE5A 4ROTA 5FHQA 2GO1A 1NMZA 4BJ3A 2ZJ2A 1N7HA 2CLSA 3DZDA 5AI8A 3OFND 3VNRA 4I1RA 2C7GA 4G24A 1F2TB 2IXTA 3F73A 2ISQA 1VI2A 4URYR 4Y0NA 4C29A 5JYEA 3IKLA 3JYQA 4DR5B 5GV7A 5SYNA 3L6UA 2ZWIA 3MGBA 1T1SA 3DNMA 4QYWA 5EIBD 1PT9A 5EZYF 1K08A 1H2XA 3A37A 4CLDA 1Y1QA 4W9NC 1G5IA 4XUDA 1G20E 1ZNXA 1XZAA 3A4LA 1C8LA 3DBRA 1GPWB 1JHQA 4X1IA 3UWKA 3VPSA 1FUUA 4LVCA 5EMLA 5AW7A 1U1EA 1UQRA 4FI3F 4YFYA 1GRNA 3ILVA 5E2IA 3TLZA 1I10A 1RC1A 4XLTA 5E0KB 3MTIA 3ZEIA 2LP4Y 1RJ9B 3W5HA 2HY7A 2VF4X 1VLMA 3Q3HA 4AY5A 1T25A 4POAA 3A6PC 2QYOA 3CF6R 3K9FC 1BVHA 4DLYA 1DKMA 3GMIA 4M1ZA 1WHSB 2MINA 1T3GA 4LFCB 4NEQA 5CJPA 2VNKA 3CSSA 2FEOA 4KQFA 1S7CA 1J23A 1V1JA 3DEKA 4CMAA 3SZ3A 1HF3A 1W88A 3ETJA 1RLMA 5E6SA 2X5XA 1ADJA 2HF2A 3IOMA 3JPWA 2R8PA 2XYRA 5K7SA 3STUA 3H19A 5K3AA 4ND2A 1GNRA 2C07A 4LQCA 2YY7A 3HKEA 1DTEA 1F06A 1AO3A 5IMBA 2VIIA 2HXGA 3KSZO 1L5FA 1GITA 2B8EA 3HBAA 5D5HA 3LQFA 1XU7A 1EA5A 3VV2A 3OQIA 3DBLB 4UW9A 1KE2A 5CLJA 4ZQIA 4JLDA 5JSZA 4DIUA 2M9MA 1NM5C 1I30A 1YJ8A 2X8WA 3PSAA 2DHCA 3G9ZA 1KHHA 1JPJA 5GWXA 1EUQA 2QX6A 3HJUA 3X44A 1XQWA 1D0IA 1TCCA 1CD5A 1R4MA 5L45A 1A82A 3SSAA 2A7QA 2PT9A 3GLHE 5CT5A 3BXZA 3CFYA 1V2GA 3B9BA 5TNXA 3TCKA 3U80A 1G21B 1USVA 4NMWA 1RWQA 2YJ4A 3ZIAD 4EZEA 4R2WA 3K8QA 3QPAA 2GT1A 2LWIA 4OGFA 4PHCA 3C7TA 1PKEA 1OWMA 2C4WA 1CVIA 2FHPA 3CWQA 3DKIA 5JAHA 2AEJA 3BQMB 3JQQA 4Q3NA 1PQUA 4H17A 2Z8ZA 5CTJA 4W5NA 2W2TA 4RU1A 5FNVB 3L41A 3G7SA 4F2PA 1A8IA 5TV2A 2XB8A 3V97A 4A03A 2P90A 2RK6A 4AZVA 4BGVA 2O23A 4PRZA 3OJCA 3HI6A 3RS4A 3TTUA 1GD1O 3FZEA 2H59A 5KWEA 4UDYX 8LDHA 1IK6A 2IF2A 2QN6A 3AF3A 3HCPA 3PNLA 1E1LA 4PWZA 4WLUA 2P9HA 3BYZA 1Z07A 4FYXA 5CFZA 3SC3A 3U2QA 5LUBA 5JY1A 4J7UA 2X14A 1ES9A 2IHZA 1VRWA 4ROSA 5EFOA 4NARA 4AYWA 1EI9A 4YBRA 3GVPA 4YHHB 3LQRA 2RGDA 3BXFA 4DMCA 1US8A 2AWOA 3GD5A 3K0EA 3PKIA 4XB1A 4ZHQF 4KNYA 5HFNA 3L77A 5C1BA 3THXB 3OURA 1FZQA 2E18A 2D59A 3QKWA 3U61B 2PU5A 2GM5A 3AEKB 3E8SA 1U99A 1VGRA 2JH9A 4IP0A 1QP0A 2II6A 4OEHA 1W94A 5JASA 4ND4A 1AZWA 1UM9A 1XDBA 3C3BA 3SX2A 3WGNA 1RFGE 3CQ9A 3L0IB 2ZB8A 3L04A 5IKMA 3S7TA 1X1DA 3TLAA 3O3MB 1HL7A 1LPOA 3UBMA 4M8NE 5CT6A 4LV6A 3RIXA 4S05A 1A5BB 1NSTA 3CXUA 1ZGCA 3RTCA 4PLCA 2IHUA 1ZW6A 1KFCB 1ZN7A 1RP1A 1QIHA 4HDNA 1I7PA 1Z2EA 4Z8XA 2PX2A 1FSFA 2H5EA 3AKCA 4ZV9A 3TIVA 2YHSA 3E9EA 3EJWA 3N8IA 2J7KA 4O2AB 4U5QA 2ZSBA 4DW8A 1RWVA 1E63A 2RMKA 4EARA 2GETA 5I9IA 1NN3A 3T9FA 1E1MA 1IEXA 2XDQB 4WH0A 4WGFA 1F8XA 3ZDRA 5EE5B 3ABOB 4CCYB 1HDEA 3AFOA 3WDSA 4TXNA 1EINA 3AV3A 5EHIA 4Q34A 3DMRA 3SCZA 4B7XA 5FOWA 1T4MA 3A0UA 4V3CA 3B60A 4K9LA 1FMCA 1VBNA 2AZTA 3JRWA 2G04A 3A06A 4M60A 5F7XA 4KB5A 1IH8A 2QW8A 2RGGA 1KJIA 1UWLA 4GRAA 3WLTA 1HXHA 3I05A 5CIYA 3D2CA 3Q98A 4JYPA 5C51B 4RHTA 3KNZA 3A4IA 2PMKA 3DZBA 4DR1B 3AL0C 2UZIR 3LVRE 1KNXA 2Y71A 1UEXC 3LK7A 1GR0A 2I7CA 1LNZA 4GMXA 5EWJA 3N53A 6REQB 1PHRA 4CIWA 3B48A 3MWGA 1G19A 1G8PA 1AHHA 3VKVA 4DWOA 3C85A 3L9WA 3N6RA 3VI4B 2AUMA 4ZPJA 2M6LA 4MQFB 4OOFA 1G3QA 3MW8A 5JPCA 4RK6A 1RVDA 4UMEA 3L3BA 2QTWB 5HF5A 2Q5LA 3K6JA 4JC0A 5LZ8A 1EFCA 1Z2OX 1YZFA 2A1TS 5AHOA 4XGQA 1EFVA 1I14A 1NJ2A 4YK7A 5AIAA 5G3ZA 3PXAA 3U4HA 1DHTA 4LFAB 4U4AA 3QH4A 2QXYA 3DV0B 4LOJA 1J99A 1RWMA 5KNCH 3ZG6A 4B82A 1V3TA 3OJWA 2F3PA 2HWXA 4CN9A 3HVRA 4B6OA 1MTZA 1OFUA 2X0JA 4JX9A 1MO6A 1Q1AA 4RY2A 1L7MA 2XWJI 3TJZA 4ZZ3A 2FW9A 3W2IA 3EHDA 5AVOA 3A6JA 4FYVA 4RSRA 2QTBA 2O0MA 2B2NA 3AY0A 4NBUA 4RF2A 5DGCA 2WY2D 4AY6A 1UDBA 1ZH6A 2JDID 3QZUA 5FJIA 2EF0A 1Z2CA 3FHCB 4P4SA 2GNAA 3RUEA 2WHEA 3QTBA 4ZEWA 1W87A 4Y18A 5E4TA 3P2KA 3HVKA 4LOHA 2JFHA 1QYWA 4G63A 1L5KA 2CE7A 4CR7A 1U0FA 3TSZA 3UB3A 3MPUA 4UBMA 1FP2A 1K2WA 1A2QA 5AM0A 4MS1A 2CSXA 3HO1A 3EVFA 1LJUA 1P2VA 2AOTA 1FMTA 4NOJA 4Y2QA 3VBEA 2PIAA 4DSUA 1FMLA 2IOHA 3FCUB 3V2GA 3W78A 5HSGA 3PNOA 1U3DA 2UYYA 2C00A 3I2HA 3IS3A 5AQ1A 5JFGA 1CQPA 2ZWVA 4Q1EA 3D6JA 1DWUA 2GBLC 4O5OA 1ISFA 4CIYA 4E2FA 2P6OA 4IDBA 2B99A 2AR7A 3AF5A 4X44A 4YVFA 1R6BX 1N75A 4E2WA 3U9LA 1PL0A 3SXUB 1K0UA 3ADKA 4GI3A 3OCUA 4W9MC 2XXBA 3FVVA 5G3YA 3FBWA 3K9HA 1Z0JA 4MLPA 4GLOA 2JLXA 4MVXA 4AN1A 1C1XB 3ERCA 3O2JA 2I2XB 1LNSA 2GCOA 3SBOA 1I0IA 2J46A 3LPLA 4KX5A 4Q9IA 2PBRA 3GLFB 4JLJA 3DOIA 4O2LA 5A1TA 2VPYA 5B3LA 2OZLB 3ZDEA 1XK6A 5B3JA 3L7NA 2C31A 4JB0A 1OH7A 1GNVA 3ZV7A 2XGGA 1BJRE 2MYNA 4MVWA 4D96A 5J4VA 4LFBB 2WP8J 1B73A 4DDHA 3GJ7A 2WM9B 3IIIA 4WLFA 1VI5A 3E5NA 3D8HA 2GKOA 5LMUB 1GCGA 4CU2A 3BIWA 3JQFC 3COJA 1P9WA 5BYBA 3NP9A 3ED1A 4KQ1A 4RFSA 1QKIA 5AYVA 2E85A 3LC2O 2YZNA 4UTZA 2PH1A 1ZLXA 1JDBC 4FFNA 4TQ9A 2OMKA 1LK0A 3NTUA 1S8OA 3PD1A 3TF5A 1E9VA 4ZCPA 1OVGA 4QGGA 3QE3A 4JJIA 2B0JA 3ACDA 4B71A 1KY4A 2G72A 2O8VA 2PKQO 4BMXA 3THSA 1PNTA 3MT8A 2RHBA 4EIWA 4ENRA 2R5NA 1GCUA 4R83A 2VOJA 1BMFA 3DYIA 3GFSA 2PLAA 1NPDA 4IXNA 1TTTA 4S1WA 2FX3A 1YGPA 1EQ2A 2QV0A 3PXXA 3PA8A 5THQA 2NP6A 1NJ1A 1PJ2A 4FOOA 1K89A 2DVMA 4F56A 5K6AA 2B78A 4ZVUA 4GSLA 3PEWA 3I64A 1E9SA 2R7AA 2WICA 3OI7A 1WCWA 4BNJA 2HJWA 5MGBA 3WYNA 4GWKA 2XUQA 4P0QB 3FWHA 3BAZA 4AAYA 1E62A 1E9EA 2C5AA 1DBQA 4V1CA 2AOUA 3O1IC 2H0RA 1CUWA 2EYQA 1P0FA 4AT1A 2R48A 5E9JA 1DC3A 3F3KA 4R84A 4Z54A 2NU8A 3EWSA 2IEIA 1ZVMA 2MIIA 2WKPA 3PZBA 3A7DA 4NK5A 1B14A 3SZOA 3WE7A 4E33A 3U7FB 2VUUA 1OW3B 5JROA 2PKYX 2ZIAA 5TQ2B 3KUKA 1OFHA 5AMXA 1PJTA 5AI0A 1GAXA 2A2ZA 1K9VF 1ODKA 3JS5A 4MUYA 4QO8A 3KL2A 1L8XA 1ENZA 3FOCA 2JA2A 1JQLB 1PYGA 3AHDA 3ENKA 4X20A 4XWYA 5ELXA 4FSDA 4MYDA 5GADl 3JWIA 3C8HA 2YYAA 1V8ZA 2WRZA 2V6FA 1CF2O 1CVLA 4YAFA 2WHQA 1ZIXA 1Z0UA 4KLZA 2CYBA 3F97A 3NS7A 4FGSA 4HNAB 3SYRA 2V6MA 1KQFA 1IBKB 3RVMA 1FNMA 4NBSA 4XGNA 1U3GA 2CMDA 2JI7A 2PRZA 2ZBEA 1EGAA 1WBBA 1UKCA 4EMTA 1Y5IA 2OCDA 1UUFA 4HYYA 3ABSB 4RIFA 1E2BA 4F3CA 4I4NA 1KEEA 1I2ZA 4M88A 1YU9A 3HDTA 1ENOA 1HE4A 2C98A 5JSKA 1XLTA 3AFIA 1X1SA 3CIOA 3ETLA 3IAAA 2F3QA 3AX6A 4G5XA 5T8KA 3TMAA 1Y1RA 3W5BA 3E84A 3QRWA 5JO9A 2H17A 3CURA 1IIBA 2AJ8A 3MJFA 3KTFA 5J5CA 1WXFA 3T7KA 1PGJA 2QD4A 4A6XA 4IEIA 4KN8A 5JQWA 2GJ9A 2A9JA 4IZOA 4UNNA 1SVLA 2BFDB 5E6UA 4PTYA 3AF0A 2NZ2A 4DLTA 1QV7A 4KDEA 4QUEA 3UGJA 1VYTA 1LPAB 2VF8A 1Q57A 4YRNA 4F93B 2XRZA 4H08A 2R6GA 3EIEA 2QMYA 1W5AA 4PZDA 4N7BA 4FZVA 2JEZA 3DJFA 1YDGA 3HJTA 3GB9A 1C7IA 1RE0A 1SUEA 2P9QA 4ZI7B 2HMAA 3DVSX 1BG6A 1NBWB 1FP1D 3QU9A 2DPXA 3SC2A 3LW8A 1NY5A 1BOFA 5EKDA 3WBKA 4M9CA 4EGFA 1APBA 1ADYA 3JY6A 1HNNA 2FSUA 3NBYC 3O38A 4F0JA 5TMBA 4BQFA 2TECE 2O4CA 2XUHA 3Q5GA 3JAKA 3HFSA 1L5HB 2QN7A 3LX8A 4QXMA 1THGA 4YRZA 2Q99A 3JR7A 3U1TA 1RBYA 4WV3A 4XYBA 1XYVA 1UKVY 2Q3BA 1VE7A 3SVZA 5HS4A 3CEJA 3AI1A 3BAFA 3BK2A 1HDXA 3DL7A 4HEA1 5EP3A 3WLJA 4NDAA 2KSQA 3UHAA 4JP2A 1I3OA 3N70A 4BVHA 4AL4A 5JIBA 2JFUA 1ZNQO 1E7MA 3BJMA 3NYWA 4RVGA 2XKBA 1NFFA 3AB8A 3EEYA 5IC4A 3AQIA 4L3OA 2NWQA 4LRSB 3H8VA 2BSQA 2A1UA 3Q7EA 1QQ7A 1CDOA 3MVEA 4KC0A 1WSDA 3OPNA 2IV2X 5LP6C 3RG8A 2HX1A 2ORYA 3JSAA 5TC4A 1FQKA 3NMUF 1R1DA 3DOCA 2AOXA 4QT0A 3LCVB 4EM6A 1LBIA 4PLTA 3S2GA 2OP1A 5BSRA 3LFTA 2ZAYA 3IVRA 1EUCB 2YV2A 3OPXA 1CB0A 1C81A 2NN3C 5BO5A 3H65A 1JH9A 3UH0A 3O4FA 4P4UA 2ENUA 1VKZA 1BVRA 3HBMA 1JILA 1VPEA 1OU0A 3FTNA 4JJ6A 4KHZA 1EJ0A 4QXOA 4FGJA 1C9KA 3V46A 4DM4A 3S4YA 3GFGA 4D42A 1QIEA 1X7YA 4FLMA 3FHLA 1GNLA 2BE9A 4RLQA 2FRDC 4JUDX 5DN6D 2ZYGA 1JBKA 1Q44A 1BXGB 1EESA 5JXHA 3REGA 1H4VB 5CX1B 3UXEA 3A9SA 4B7CA 3VH4A 1I1OA 3LBHA 1NKVA 2G5PA 4YRLA 3OOJA 4YMSA 5IW8A 4LHZA 5KJEA 4WOCA 2WHXA 1V3UA 2I91A 5F7OA 3T3OA 3ZWVA 4AUNA 1M83A 1DI0A 1TO6A 1QYVA 3L0PA 1L5NA 4ESEA 4IJWA 4Q3AA 1NX6A 2XTZA 3SC4A 1Q6ZA 1YXMA 3KZOA 4U00A 1FP4A 2PU7A 2H0QA 2QE7D 3I0ZA 3I9V6 3HFGA 1U2EA 2VJDA 1XNQB 1B74A 1XQVA 2WBLC 3RJZA 2W2OA 4EEXA 2QBYA 1XT6A 3LBNA 4MCHA 4Z1OA 2VXYA 3NX4A 1SUCA 1QVAA 1U5BA 4MWSA 1LSOA 1XQ1A 1KEKA 4ZP1A 1XA3A 1YUMA 1C1DB 2VDWB 5CW2A 3ZLJA 2M1XA 1GPMA 4PGGA 1FVXA 2JFNA 1CDEA 4Q3DA 4DVGA 3PWSA 2X15A 2PGLA 4TMXA 3UF0A 5B6JA 4KFSA 4S0ZA 3B6ZA 3BJZA 3C3YA 2HO4A 2QPAA 5EJFA 5ARCA 4BNTA 4YJFB 4TKUA 4X62B 2O1WA 5EL0A 3VR5D 2QTFA 4PQYA 5LQJA 1IQPA 3ZGXA 2G17A 1DKQA 1SK9A 1VRCA 2B1QA 4OHKA 4YQFA 5JQGB 1H4SA 2BDEA 3Q2OA 4XIIA 5G40A 4QWWA 3ZQ6A 2CUKA 4DDVA 3O3NB 3Q9NA 1L3BA 1Q7CA 3KV1A 3UAWA 1Z22A 1TGYA 5E1BA 1SPXA 4REOA 4L6IA 3GJYA 2NO4A 2XWPA 4MQEA 3X2EA 1XLUA 4H7JA 4TSRA 2BGUA 4KGDA 1AF7A 1L2TA 1UKBA 1A4IA 2O7QA 1VLHA 3PDJA 2YYYA 4KYIB 3R7DA 2G82A 3GFRA 3KR9A 4G9GA 4O4JA 3UUFA 2UUPA 1E59A 1T8WA 2IITA 8ADHA 3N6VA 4YDQA 2NG1A 2ZAGA 4YYEA 2FPIB 2P78A 4KQWA 1E6LA 3FG9A 2V1UA 2VAMA 1XVUA 1DGQA 4DC9A 2W6NA 2R6CA 3OCXA 3Q6MA 2FGJA 3U39A 2W90A 1M75A 1G8JA 4WDRA 3MUOA 1PT7A 3KFLA 1YWGO 3E2IA 2IYRA 2AQHA 2R47A 4DE5A 4EVQA 3L0BA 3EEFA 1WXIA 1UDXA 1QK5A 4PNEA 5HGJA 1G6KA 1OOEA 3G8BA 4QPPA 4UPVA 1D4ZA 2Q2QA 1NW3A 4IHAA 1JDVA 4BIMA 3P0RA 3ROPA 4OKNA 1YGYA 3OM0A 2O8EB 2EX1A 3RLIA 4TOIA 1Y80A 1AUPA 4P81A 4MV8A 2XYQA 3IEXA 3KKKA 1T36B 3UTDA 5BORA 1NJSA 1EP1B 3L1UA 1TJNA 3U4QA 3SSOA 3BX1A 3OM9A 1HWYA 1ZCJA 2KLBA 2V03A 3SM3A 4QEZA 2BKVA 2R65A 4I1IA 4DJFC 2Z2IA 3CPHA 2FMIA 1EVKA 2V8OA 1Z5WA 3JD2A 2QVCA 3KR0A 4LRWA 2PLNA 3CBGA 1T4CB 2GPJA 4FFSA 2IBMA 2HLHA 3HFRA 1KJQA 3PPWA 1OU4A 1XFDA 2GXUA 2X3UA 4U2FA 4TMYA 4JSRA 1Y3AA 1WNTA 4RTRA 3DOHA 5I01A 1K7SN 1JP7A 1KO7A 1MA0A 1OUMA 1SXJE 2VHJA 4RXTA 3OZDA 1VDZA 1BH2A 4O6VA 3SPXA 4LDNA 4ZVSA 4TYNA 1RRVA 5F5LA 5AW4A 2C5FA 5KU1A 2XY4A 1TDJA 5T4HA 1DCKA 1ISPA 4YRGA 1DT5A 5D84A 1SHTX 4J49A 4LJ6A 1XNJA 3VKUA 2UZ1B 3ZBUA 1Z4LA 2B83A 3IT0A 1KEPA 3IVAA 4ZPXA 2R3SA 5EJ8A 2QTRA 2MDTA 2XQGA 1KJWA 4G1EB 3SC6A 1CZUA 2R62A 3MOGA 2F1RA 4R1OA 1T4BA 5EUQB 4TMFA 3N74A 3D4OA 3JZFA 4MW9A 5H3LA 3FAZA 4EOGA 2PUFA 2OHXA 5AVUA 3EVAA 3IOYA 3FCYA 2RE8A 4L5AA 2G40A 4PNPA 2JFZA 3BZUA 1R0XA 2WUFA 3UMGA 4G84A 4ZZ2A 3RRFA 1YRHA 2BRUA 2QRVB 4O0LA 5IFKA 1FVOA 3EVBA 4M53A 2NO1A 3GP3A 3UWMA 4FEYA 2NPFA 1JHZA 1KOFA 1N5DA 1PVVA 3EZ7A 3QVWA 3EA0A 3O21A 5DO9A 5FPKA 3WA7A 3RRJA 1RC0A 4LBZA 4I9UA 5IBRA 5CH8A 3GT4A 4O1HA 4F7DA 1X0VA 3GCXA 2YWBA 3NVDA 1SUDA 4K9QA 3MLEA 3PL1A 3QE4A 4D4HA 4E3WA 3EXG2 5I8PA 1Z8HA 1KS2A 2VDMB 4ASUA 2JBWA 2O2IA 1TTPB 2JH8A 2QZSA 4G0QA 4HYQA 1EGHA 5EXEA 3I3SR 3OHSX 2JLBA 3NT5A 2FOLA 5T6BA 1T9GR 2HD4A 2IU4A 2RHRA 2ZTLA 5AXCA 3QQPA 2PUWA 4X64B 4OAOA 1JXOA 3RSFA 1NFQA 1N3LA 1QG6A 2FDRA 1Z7GA 2BZSA 2HA7A 3AR6A 3EXIB 4I3GA 2RJNA 3WYFA 5EJ5A 3LDHA 3LQYA 1CYEA 3FWYA 1N1MA 3U44B 1CDZA 3V4VB 3I9KA 4Q4DA 1X2EA 3ZHSA 1FSZA 2KB0A 3IAM6 4YC7A 1S8AA 1OAOC 2BFOA 4DCSA 2C8KA 3VVMA 1Y4AE 5I7OA 2VSFA 1J39A 2GN9A 2CVZA 3X2FA 4LK2A 5LL6P 2WD8A 1TADA 4Q4AB 2WFLA 1GA6A 1Y8ZA 1KDOA 3MRVA 1J42A 3IELA 3UTCA 2YY6A 3U9TA 5ER9A 3FZQA 1VYHA 3K0CC 4IMRA 4AJEA 4I8XA 3WKEA 1MX5A 1P5JA 2QF7A 1Q0HA 2WAMA 4I5GA 4XLLA 1U3VA 2BYTA 5IJZA 5EZ6B 1MB4A 1RM5A 4CCAA 3ZN2A 1QTRA 1TMOA 1WDTA 4CMCA 3SM9A 4RJLA 2J32A 4Z4EA 3S44A 1YNSA 4DA8A 4NU6A 4LG1A 2GYYA 2J31A 4A92A 5BWMA 2YY5A 5DKFA 1YI1A 5JAQA 4BLVA 4CMGA 3BD7A 3V1NA 2Q9UA 4UZSA 4YBZA 1SCAA 2GM3A 5GONA 2Z9BA 4IJ5A 5I7HA 4DBZA 3JQGB 4Z5XA 3ACCA 4UBOA 3ZWAA 1B93A 3FZYA 4UARA 2DR3A 5KTMA 5L3VA 4OLHA 1YR3A 4GR4A 2CV1A 1UAYA 1I80A 1NATA 2BI8A 4RVSA 1KMMA 1Z5VA 2Q6IA 3LHSA 5CAEA 1C14A 2FN7A 4FYKA 5FOVA 5EKTA 4FN5A 3WWYA 1MP0A 3JQBC 4OLBA 2F43A 4E7PA 3LT0A 1UEIA 4R8RA 4AXXA 3L5KA 2OO7A 3NASA 4IL5A 4IIFA 1Z4JA 3RU2A 5IWCA 2IHNA 1ATZA 3T7JA 1P31A 2F67A 4ND1A 2DECA 2FY8A 2RCYA 4OHVA 4TM7A 3OUZA 4X1YB 1TYBE 3EWAA 2EZ8A 3MEQA 3UAZA 4C2TA 3QTTA 1EE1A 4L27A 2IP2A 3KQYA 2IPMA 3MUFA 5C5DA 1AGNA 2O8CB 2DQ4A 2ODNA 3C8UA 1JAXA 1JDNA 1OYYA 1SVOA 4IV5A 4JKIA 2NSYA 2G06A 1EIZA 1AQ6A 5DDIP 2FUG6 4OVKA 3ZHYA 1ZX1A 2X6RA 4ARAA 4RX1A 1RYMA 3L1IA 2GTPA 3KDSE 2PVSA 3ONVA 4BO6A 5A06A 1U0OC 1VCNA 3TX6A 1GSAA 4XZ3A 1TM3E 2V6IA 3HKCB 4QLOA 3QW2A 1UC5B 3L2OB 1KHTA 4UM5A 3M5PA 3OMXA 3FYUA 3WWDA 3JATA 4IIUA 1FDTA 1ZYUA 1MVLA 4JUFA 3T7SA 3V8RA 1OKKD 5I7UA 1U9YA 1UBGA 5JPIA 1UADA 1D3AA 2BBOA 2FNAA 2FZVA 3KDPA 2VQDA 1M1ZA 1RXIA 1VSUA 4BBAA 3AHHA 1BXRA 5BV0A 2GK7A 4NENB 3EVNA 5FTNA 1AQJA 1EJ6A 1F60A 5JANA 5BSTA 4KDFA 4UASA 3WS7A 5HF6A 3UPUA 4WFKA 3RK0A 1HI9A 5ICFA 1P29A 1TYZA 4V1CI 4EHDA 3DLPX 2RCNA 3T5PA 1SR8A 1AHPA 4H3VA 2PNFA 2WUEA 3LCMA 1YR8A 4GWLA 1P4RA 1Y4DE 1YMQA 2CJFA 4RPKA 1GTL1 1ZAKA 4ZO6A 3M4JA 5DM2A 4CUKA 3VZSA 4D8VA 5CD1A 1N0IA 3VU9B 4HN2A 1PJ8A 2VH2A 4Q9AA 4TGLA 3EPKA 1ID8A 2XTJA 2A4KA 4UHJA 2FP4A 4MXDA 1CF9A 3C8DA 3NEYA 4UEOA 3G13A 10MHA 4EVRA 3IALA 5HIJA 3RK1A 1J1IA 1L8QA 4HD8A 4PFSA 3EDYA 3CV3A 5EP4A 4YUXA 3W5DA 5HKLA 2CVFA 1PZGA 3LC1O 4GL2A 1RCUA 4WADA 2Y27A 5ALFA 1G0OA 1VMIA 3KVRA 2C2GA 2O59A 2OD7A 4UBNA 2A58A 1W4ZA 1HLFA 1CY6A 1L5MA 4B7ZA 4G67A 5I7RA 5LOVB 4EQ6A 2H6EA 4TZ0A 1W1WA 5G1NA 3AM1A 4ZDWA 8OHMA 1QJ4A 2XTNA 3A9RA 4NAHA 3I2YX 1YK0A 2GO7A 1M6HA 2ZU0C 3QI7A 4X71A 1QG2A 4ZC8A 4BTLA 4C7VA 4DA6A 2C77A 3P1JA 2IY7A 3VZQA 3BRQA 5DNCA 4LW8A 5GGYA 3Q12A 5KVAA 3KZKA 5F3WB 5KOJB 5KMGA 1UT5A 3TECE 3V8QA 1I3MA 1Z62A 3I01A 3ZNQA 1NVMB 2A3RA 4H16A 3ZLUA 4OOEA 3FMFA 1HX7A 1UMCB 1Z8DA 3UJCA 1JHUA 2IZ5A 1BW9A 4IDFA 4DHEA 3ACBA 3TW0A 2OZVA 3WB2A 1A7JA 4DR4B 1CZOA 4MSUA 4ZO7A 1RAEA 1AM4D 1ZCBA 4QUKA 4QOHA 1QVZA 3A8TA 4ER0A 1UJCA 4KV9A 1P0MA 1Q0QA 3O2NA 1K8XB 1SXJC 3GNLA 4PGMA 4H60A 5B7QA 3AZQA 5JI3E 2A9FA 2PVCA 5LKAA 1E3IA 3EXFA 3VBCA 1S3GA 1WSBA 2C59A 3R5HA 4LV8B 3COVA 3PC4A 1IN5A 2ADOA 4LY3A 3ZWXA 5DNEA 3ER8A 2PX8A 4KLRA 2YN0A 1XZQA 3AUSA 2GJSA 3ZDXB 5JISA 4CEIA 2WV7A 1T5SA 3VMFA 4NZPA 1Z15A 1TRKA 3L8YA 3QYJA 2C97A 3RRBA 2PBFA 2VHEA 3ZH9B 3L7IA 4NBRA 2QZZA 2D54A 4BOYA 4TMZA 2RHHA 4NKRA 1NXPA 4YCMA 2A5YB 4KN6A 2C5LA 4J7AA 3ZZUA 2BHRA 2QN3A 1M2NA 3KPUA 3VUFA 5AUNB 2UUBB 4L74A 4B3RB 5F9FA 3MJRA 1ORHA 2IP4A 3PEVA 5FFFA 3VTAA 1NXVA 2WIKA 3BH0A 3I4LA 1LC3A 421PA 3DZCA 3ASUA 5GJCA 1Z88A 5KSZA 1RT9A 4JT8A 4ZMBA 2PUAA 3FTEA 1G8AA 2Z1NA 4P34A 1KAOA 1M1XB 1TW3A 3GAMA 4ALJA 2JGLA 1YOVA 3EIHA 2FSVA 1VMKA 2PQ0A 5DHPA 1DAEA 2GD2A 3GRCA 2PQ2A 2ID7A 3FM9A 3DNPA 3UHJA 2QV7A 2YWRA 1V7CA 4X6YA 2P27A 2REXB 3DYVA 2M6KA 3GUVA 3PPVA 4XPIB 1HLGA 4FR5A 2OBBA 2HBQA 4PZ9A 3E3OA 1Z56C 1BOOA 4W8OA 5FLYA 1DV1A 3QEKA 3TE7A 4E5VA 4MCAA 1GLVA 1VZ2A 4PTZA 1ZZGA 3K0BA 1U98A 4B4DA 5AD1A 1X1QA 4NPCA 5BR7A 2OZPA 3VSCA 1DQNA 1BYUA 1OI7A 3ELWA 5ER6A 4FMCB 4WVLA 3GGDA 4N8EA 2WPDD 4L2IA 3PQDA 3T4UA 3GXBA 3L0ZA 1RD4A 1XPOA 4KR7A 4Q7LA 2CFSA 3IRUA 4ISBA 2JLCA 4RCZA 1M54A 3UCEA 2YWHA 3AR4A 3QE9Y 3LUDA 3MD9A 4X1KA 4IHJB 3B1JA 4GP9A 4UUAA 3RE1A 2C3OA 1TJ5A 2WU4A 3OZXA 5HWSA 2JBAA 2Y05A 3KKEA 2GRUA 2QPLA 3AY6A 3R09A 2IS2A 4C4YA 2GCGA 2RAPA 4EB6B 3C2QA 3N05A 3A1EA 4G36A 1YTUA 1H0RA 5FLEX 3D3EA 3G1WA 1K2VN 5EAIA 2J33A 1TU4A 1HTTA 3ZWMA 2ZRLA 5KYXB 3CUVA 3VVLA 3MA0A 1CS0B 1GG5A 4JQCA 16PKA 2B4KA 3GLRA 2WHPB 3AY3A 3FF1A 1A50B 1XVAA 1M0SA 3GP5A 4B9EA 3GC6A 1N5MA 1L0BA 2FR0A 1MR3F 2VWQA 4Z6KA 5C37A 4LF9B 4PPQA 4TV8F 1IM2A 3II6X 4OJKA 4DSAA 1PV4A 1AHNA 1M8JA 2CHVA 3KBBA 3KQVA 4GR5A 5FP0A 3FKSD 1M2JA 4AN4A 4BVEA 2V5UA 3FHTA 1EFPB 2LR0A 2D2XA 3TQRA 5EIFA 3OX2A 1O96B 2K2WA 3HMKA 3VQTA 3UWDA 4FCWA 1DPGA 2QRJA 3DNFA 3T8YA 4HLCA 2FZCA 4GM1A 4E08A 2DFNA 4LY0A 3ORFA 4DMFA 5L7TA 1D4FA 1P33A 2HRZA 1RABA 4YJ3B 5I4KA 2AXPA 4X8OA 3MMPA 2AMYA 4E4TA 4R0MA 5AQEA 1GGFA 1QQBA 2BSAA 3S81A 4PG7A 1F14A 4WQMA 4DNFA 1YAJA 1T4DA 3IKMB 3IIEA 3ZCUA 1JTVA 4L4ZA 4GRIA 1GDTA 4GL4A 1OMOA 2AG0A 2I1WA 1O9HA 1ZCZA 1TF5A 1YSCA 2PANA 2GF2A 1SUWA 3OCJA 2QSUA 3R20A 4P98A 3ZZ1A 4E5YA 1SIOA 3DEHA 3SX0A 3CVWA 2EBFX 2OAEA 4GP7A