1OOKG

Crystal structure of the complex of platelet receptor gpib-alpha and human alpha-thrombin
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
284
structure length
282
Chain Sequence
HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLDYPEEDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human Alpha Thrombin
publication title Modulation of alpha-thrombin function by distinct interactions with platelet glycoprotein Ibalpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 282
sequence length 284
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01462 LRRNT Leucine rich repeat N-terminal domain
G PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1ookG00
4B8CD 4BV4R 1SQ0B 3RGZA 5GQRK 1M0ZA 3ZYNA 2Z66A 4YEBB 4XOSA 3E4GA 4XGOA 4LI1A 4M7EA 4Q62A 3C6PB 5GS0A 4KXFB 4AW4A 5LFNA 2V9TB 3C6OB 4R08A 2XWTC 3KJ4A 1P9AG 1PGVA 4FHOA 4RCAB 1H6TA 1U0ND 3RIZA 4LSXA 2WQVA 4TZHA 3OGKB 4U06A 4HQ1A 4Z94G 1K5DC 3OJAA 3UL9A 4WP6A 2XOTA 4FDWA 3ULAA 4R6FA 4XSQA 3SB4A 4Q3IA 2O6QA 4V2DA 4GLPA 4Z61C 2Z65A 4P91A 1P8VA 3A79B 4FD0A 1ZIWA 1XCDA 2P1QB 3CIYA 5IJBA 1XWDC 5GMGA 3WN4A 2FT3A 2OMVA 4P8SA 3GOZA 2JQDA 5IYXC 4ECNA 3W3NA 4R6JA 2JE0A 2WFHA 3W3JA 1FQVA 1XEUA 3RFSA 1OOKG 4Y61B 4CILA 3RJ0A 4U08A 4CC4A 1P8TA 1WWLA 4LXSA 4NKHA 3REZA 4BSUA 1XKUA 4LSCA 4CNCA 1OGQA 1DCEA 4L3FA 4LXRA 2P1MB 3BZ5A 2O6RA 1W8AA 3M18A 3WPGA 3RGXA 3RFEA 4RCWA 5FTTB 4PQ8A 3CIGA 4C2BB 1FT8A 4L3AA 4R07A 3FXIA 2Z82A 5HZLB 1FS2A 3VQ1A 4BSSA 3W3GA 4MN8B 4I6JB 5AWAA 3W3LA 5AZ5A 4CP6A 5AWDA 5B0NA 3P72A 4R58A 3ZYJA 4J4LA 2OMUA 4V2CA 3PMHG 3CVRA 3G04C 1OTNA 1D0BA 1OTOA 2BNHA 1QYYA 5HDHA 4PSJA 4R5CA 1FO1A 3E6JA 1IO0A 2JE1A 4KT1A 4FS7A 4QXEA 4CNMA 2RA8A 3ULVA 4RWTC 2OMWA 1M9SA 1O6SA 5GMFA 1XECA 2IFGA 2Z64A 5AWCA 3WPBA 2ASTB 3E3ZA 2WQWA 1Z7XW 5IJCA 3G39A 2WQXA 2V70A 2P1NB 3ZYOA 3M19A 2Z7XB 3WPCA 1LTXA 3OGLB 4C2AB 4QC0A 3DZEA 4U7LA 2Z63A 1G9UA 4M7EC 4V2EA 1OZNA 4H09A 5D3IA 5CMNA 4R0AA 3G3AA 3RW7A 4Z64C 4IM6A 4LSXC 4G8AA 4FMZA 3W3MA 1OTMA 4J0MA 4OQTA 4NKGA 1K5GC 2OMZA 4LSAA 1DS9A 5B4PA 3TSRE 2A0ZA 4LI2A 2WQUA 3UL8A 1YRGA 2Z62A 1O6VA 4KNGA 4FCGA 3JB9j 1KOOA 2UZXA 2Q4GW 2Z81A 1A9NA 4R5DA 1H6UA 3G06A 3WPEA 1M10B 4PKIG 3WPIA 2BEXA 4U09A 2O6SA 3WPFA 3VQ2A 3OJAB 5CMPA 2CA6A 3C6NB 5IJDA 3O53A 5AWBA 2P1OB 2OMXA 3OGMB 2R9UA 3RFJA 1GWBA 2OMTA 4R6GA 5GS2B 1JL5A 4AY9X 3RW6A 3WPHA 5B0TA 4PEQB 2ID5A 2ELLA 4GT6A 1M9LA 2V9SA 4WYKA 4PERA 4BSRA 5GMHA 5A5CA 3UL7A 1O6TA 2UZYA 4UFRA 4Z79A 4R6AA 4CC4C 3O6NA 4ECOA 4K17A 4R09A 2P1PB 4QBZA 4ARRA 3E2JA 4EZGA 4Q3GA 3UN9A 2Z7XA 2ASSB 4Z8GA 2RR6A 3G3BA 1DFJI 1A4YA 4ARNA 3ZYIA 1KOHA 2Y5QA 4MQWX 2OMYA 3ULUA 3WPDA 3W3KA
chains in the Genus database with same CATH superfamily
4B8CD 4BV4R 1SQ0B 3RGZA 5GQRK 1M0ZA 3ZYNA 2Z66A 4YEBB 4XOSA 3E4GA 4XGOA 4LI1A 4M7EA 4Q62A 3C6PB 5GS0A 4KXFB 4AW4A 5LFNA 2V9TB 3C6OB 4R08A 2XWTC 3KJ4A 1P9AG 1PGVA 4FHOA 4RCAB 1H6TA 1U0ND 3RIZA 4LSXA 2WQVA 4TZHA 3OGKB 4U06A 4HQ1A 4Z94G 1K5DC 3OJAA 3UL9A 4WP6A 2XOTA 4FDWA 3ULAA 4R6FA 4XSQA 3SB4A 4Q3IA 2O6QA 4V2DA 4GLPA 4Z61C 2Z65A 4P91A 1P8VA 3A79B 4FD0A 1ZIWA 1XCDA 2P1QB 3CIYA 5IJBA 1XWDC 5GMGA 3WN4A 2FT3A 2OMVA 4P8SA 3GOZA 2JQDA 5IYXC 4ECNA 3W3NA 4R6JA 2JE0A 2WFHA 3W3JA 1FQVA 1XEUA 3RFSA 1OOKG 4Y61B 4CILA 3RJ0A 4U08A 4CC4A 1P8TA 1WWLA 4LXSA 4NKHA 3REZA 4BSUA 1XKUA 4LSCA 4CNCA 1OGQA 1DCEA 4L3FA 4LXRA 2P1MB 4NZTM 3BZ5A 2O6RA 1W8AA 3M18A 3WPGA 3RGXA 3RFEA 4RCWA 5FTTB 4PQ8A 3CIGA 4C2BB 1FT8A 4L3AA 4R07A 3FXIA 2Z82A 5HZLB 1FS2A 3VQ1A 4BSSA 3W3GA 4MN8B 4I6JB 5AWAA 3W3LA 5AZ5A 4CP6A 5AWDA 5B0NA 3P72A 4R58A 3ZYJA 4J4LA 2OMUA 4V2CA 3PMHG 3CVRA 3G04C 1OTNA 1D0BA 1OTOA 2BNHA 1QYYA 5HDHA 4PSJA 4R5CA 1FO1A 3E6JA 1IO0A 2JE1A 4KT1A 4FS7A 4QXEA 4CNMA 2RA8A 3ULVA 4RWTC 2OMWA 1M9SA 1O6SA 5GMFA 1XECA 2IFGA 2Z64A 5AWCA 3WPBA 2ASTB 3E3ZA 2WQWA 1Z7XW 5IJCA 3G39A 2WQXA 2V70A 2P1NB 3ZYOA 3M19A 2Z7XB 3WPCA 1LTXA 3OGLB 4C2AB 4QC0A 3DZEA 4U7LA 2Z63A 1G9UA 4M7EC 4V2EA 1OZNA 4H09A 5D3IA 5CMNA 4R0AA 3G3AA 3RW7A 4Z64C 4IM6A 4LSXC 4G8AA 4FMZA 3W3MA 1OTMA 4J0MA 4OQTA 4NKGA 1K5GC 2OMZA 4LSAA 1DS9A 5B4PA 3TSRE 2A0ZA 4LI2A 2WQUA 3UL8A 1YRGA 2Z62A 1O6VA 4KNGA 4FCGA 3JB9j 1KOOA 2UZXA 2Q4GW 2Z81A 1A9NA 4R5DA 1H6UA 3G06A 3WPEA 1M10B 4PKIG 3WPIA 2BEXA 4U09A 2O6SA 3WPFA 3VQ2A 3OJAB 5CMPA 2CA6A 3C6NB 5IJDA 3O53A 5AWBA 2P1OB 2OMXA 3OGMB 2R9UA 3RFJA 1GWBA 2OMTA 4R6GA 5GS2B 1JL5A 4AY9X 3RW6A 3WPHA 5B0TA 4PEQB 2ID5A 2ELLA 4GT6A 1M9LA 2V9SA 4WYKA 4PERA 4BSRA 5GMHA 4NZRM 5A5CA 3UL7A 1O6TA 2UZYA 4UFRA 4Z79A 4R6AA 4CC4C 3O6NA 4ECOA 4K17A 4R09A 2P1PB 4QBZA 4ARRA 3E2JA 4EZGA 4Q3GA 3UN9A 2Z7XA 2ASSB 4Z8GA 2RR6A 3G3BA 1DFJI 1A4YA 4ARNA 3ZYIA 1KOHA 2Y5QA 4MQWX 2OMYA 3ULUA 3WPDA 3W3KA
chains in the Genus database with same CATH topology
4B8CD 4BV4R 1SQ0B 3RGZA 5GQRK 1M0ZA 3ZYNA 2Z66A 4YEBB 4XOSA 3E4GA 4XGOA 4LI1A 4M7EA 4Q62A 3C6PB 5GS0A 4KXFB 4AW4A 5LFNA 2V9TB 3C6OB 4R08A 2XWTC 3KJ4A 1P9AG 1PGVA 4FHOA 4RCAB 1H6TA 1U0ND 3RIZA 4LSXA 2WQVA 4TZHA 3OGKB 4U06A 4HQ1A 4Z94G 1K5DC 3OJAA 3UL9A 4WP6A 2XOTA 4FDWA 3ULAA 4R6FA 4XSQA 3SB4A 4Q3IA 2O6QA 4V2DA 4GLPA 4Z61C 2Z65A 4P91A 1P8VA 3A79B 4FD0A 1ZIWA 1XCDA 2P1QB 3CIYA 5IJBA 1XWDC 5GMGA 3WN4A 2FT3A 2OMVA 4P8SA 3GOZA 2JQDA 5IYXC 4ECNA 3W3NA 4R6JA 2JE0A 2WFHA 3W3JA 1FQVA 1XEUA 3RFSA 1OOKG 4Y61B 4CILA 3RJ0A 4U08A 4CC4A 1P8TA 1WWLA 4LXSA 4NKHA 3REZA 4BSUA 1XKUA 4LSCA 4CNCA 1OGQA 1DCEA 4L3FA 4LXRA 2P1MB 3BZ5A 2O6RA 1W8AA 3M18A 3WPGA 3RGXA 3RFEA 4RCWA 5FTTB 4PQ8A 3CIGA 4C2BB 1FT8A 4L3AA 4R07A 3FXIA 2Z82A 5HZLB 1FS2A 3VQ1A 4BSSA 3W3GA 4MN8B 4I6JB 5AWAA 3W3LA 5AZ5A 4CP6A 5AWDA 5B0NA 3P72A 4R58A 3ZYJA 4J4LA 2OMUA 4V2CA 3PMHG 3CVRA 3G04C 1OTNA 1D0BA 1OTOA 2BNHA 1QYYA 5HDHA 4PSJA 4R5CA 1FO1A 3E6JA 1IO0A 2JE1A 4KT1A 4FS7A 4QXEA 4CNMA 2RA8A 3ULVA 4RWTC 2OMWA 1M9SA 1O6SA 5GMFA 1XECA 2IFGA 2Z64A 5AWCA 3WPBA 2ASTB 3E3ZA 2WQWA 1Z7XW 5IJCA 3G39A 2WQXA 2V70A 2P1NB 3ZYOA 3M19A 2Z7XB 3WPCA 1LTXA 3OGLB 4C2AB 4QC0A 3DZEA 4U7LA 2Z63A 1G9UA 4M7EC 4V2EA 1OZNA 4H09A 5D3IA 5CMNA 4R0AA 3G3AA 3RW7A 4Z64C 4IM6A 4LSXC 4G8AA 4FMZA 3W3MA 1OTMA 4J0MA 4OQTA 4NKGA 1K5GC 2OMZA 4LSAA 1DS9A 5B4PA 3TSRE 2A0ZA 4LI2A 2WQUA 3UL8A 1YRGA 2Z62A 1O6VA 4KNGA 4FCGA 3JB9j 1KOOA 2UZXA 2Q4GW 2Z81A 1A9NA 4R5DA 1H6UA 3G06A 3WPEA 1M10B 4PKIG 3WPIA 2BEXA 4U09A 2O6SA 3WPFA 3VQ2A 3OJAB 5CMPA 2CA6A 3C6NB 5IJDA 3O53A 5AWBA 2P1OB 2OMXA 3OGMB 2R9UA 3RFJA 1GWBA 2OMTA 4R6GA 5GS2B 1JL5A 4AY9X 3RW6A 3WPHA 5B0TA 4PEQB 2ID5A 2ELLA 4GT6A 1M9LA 2V9SA 4WYKA 4PERA 4BSRA 5GMHA 5A5CA 3UL7A 1O6TA 2UZYA 4UFRA 4Z79A 4R6AA 4CC4C 3O6NA 4ECOA 4K17A 4R09A 2P1PB 4QBZA 4ARRA 3E2JA 4EZGA 4Q3GA 3UN9A 2Z7XA 2ASSB 4Z8GA 2RR6A 3G3BA 1DFJI 1A4YA 4ARNA 3ZYIA 1KOHA 2Y5QA 4MQWX 2OMYA 3ULUA 3WPDA 3W3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8C D;  4BV4 R;  1SQ0 B;  3RGZ A;  5GQR K;  1M0Z A;  3ZYN A;  2Z66 A;  4YEB B;  4XOS A;  3E4G A;  4XGO A;  4LI1 A;  4M7E A;  4Q62 A;  3C6P B;  5GS0 A;  4KXF B;  4AW4 A;  5LFN A;  2V9T B;  3C6O B;  4R08 A;  2XWT C;  3KJ4 A;  1P9A G;  1PGV A;  4FHO A;  4RCA B;  1H6T A;  1U0N D;  3RIZ A;  4LSX A;  2WQV A;  4TZH A;  3OGK B;  4U06 A;  4HQ1 A;  4Z94 G;  1K5D C;  3OJA A;  3UL9 A;  4WP6 A;  2XOT A;  4FDW A;  3ULA A;  4R6F A;  4XSQ A;  3SB4 A;  4Q3I A;  2O6Q A;  4V2D A;  4GLP A;  4Z61 C;  2Z65 A;  4P91 A;  1P8V A;  3A79 B;  4FD0 A;  1ZIW A;  1XCD A;  2P1Q B;  3CIY A;  5IJB A;  1XWD C;  5GMG A;  3WN4 A;  2FT3 A;  2OMV A;  4P8S A;  3GOZ A;  2JQD A;  5IYX C;  4ECN A;  3W3N A;  4R6J A;  2JE0 A;  2WFH A;  3W3J A;  1FQV A;  1XEU A;  3RFS A;  1OOK G;  4Y61 B;  4CIL A;  3RJ0 A;  4U08 A;  4CC4 A;  1P8T A;  1WWL A;  4LXS A;  4NKH A;  3REZ A;  4BSU A;  1XKU A;  4LSC A;  4CNC A;  1OGQ A;  1DCE A;  4L3F A;  4LXR A;  2P1M B;  3BZ5 A;  2O6R A;  1W8A A;  3M18 A;  3WPG A;  3RGX A;  3RFE A;  4RCW A;  5FTT B;  4PQ8 A;  3CIG A;  4C2B B;  1FT8 A;  4L3A A;  4R07 A;  3FXI A;  2Z82 A;  5HZL B;  1FS2 A;  3VQ1 A;  4BSS A;  3W3G A;  4MN8 B;  4I6J B;  5AWA A;  3W3L A;  5AZ5 A;  4CP6 A;  5AWD A;  5B0N A;  3P72 A;  4R58 A;  3ZYJ A;  4J4L A;  2OMU A;  4V2C A;  3PMH G;  3CVR A;  3G04 C;  1OTN A;  1D0B A;  1OTO A;  2BNH A;  1QYY A;  5HDH A;  4PSJ A;  4R5C A;  1FO1 A;  3E6J A;  1IO0 A;  2JE1 A;  4KT1 A;  4FS7 A;  4QXE A;  4CNM A;  2RA8 A;  3ULV A;  4RWT C;  2OMW A;  1M9S A;  1O6S A;  5GMF A;  1XEC A;  2IFG A;  2Z64 A;  5AWC A;  3WPB A;  2AST B;  3E3Z A;  2WQW A;  1Z7X W;  5IJC A;  3G39 A;  2WQX A;  2V70 A;  2P1N B;  3ZYO A;  3M19 A;  2Z7X B;  3WPC A;  1LTX A;  3OGL B;  4C2A B;  4QC0 A;  3DZE A;  4U7L A;  2Z63 A;  1G9U A;  4M7E C;  4V2E A;  1OZN A;  4H09 A;  5D3I A;  5CMN A;  4R0A A;  3G3A A;  3RW7 A;  4Z64 C;  4IM6 A;  4LSX C;  4G8A A;  4FMZ A;  3W3M A;  1OTM A;  4J0M A;  4OQT A;  4NKG A;  1K5G C;  2OMZ A;  4LSA A;  1DS9 A;  5B4P A;  3TSR E;  2A0Z A;  4LI2 A;  2WQU A;  3UL8 A;  1YRG A;  2Z62 A;  1O6V A;  4KNG A;  4FCG A;  3JB9 j;  1KOO A;  2UZX A;  2Q4G W;  2Z81 A;  1A9N A;  4R5D A;  1H6U A;  3G06 A;  3WPE A;  1M10 B;  4PKI G;  3WPI A;  2BEX A;  4U09 A;  2O6S A;  3WPF A;  3VQ2 A;  3OJA B;  5CMP A;  2CA6 A;  3C6N B;  5IJD A;  3O53 A;  5AWB A;  2P1O B;  2OMX A;  3OGM B;  2R9U A;  3RFJ A;  1GWB A;  2OMT A;  4R6G A;  5GS2 B;  1JL5 A;  4AY9 X;  3RW6 A;  3WPH A;  5B0T A;  4PEQ B;  2ID5 A;  2ELL A;  4GT6 A;  1M9L A;  2V9S A;  4WYK A;  4PER A;  4BSR A;  5GMH A;  5A5C A;  3UL7 A;  1O6T A;  2UZY A;  4UFR A;  4Z79 A;  4R6A A;  4CC4 C;  3O6N A;  4ECO A;  4K17 A;  4R09 A;  2P1P B;  4QBZ A;  4ARR A;  3E2J A;  4EZG A;  4Q3G A;  3UN9 A;  2Z7X A;  2ASS B;  4Z8G A;  2RR6 A;  3G3B A;  1DFJ I;  1A4Y A;  4ARN A;  3ZYI A;  1KOH A;  2Y5Q A;  4MQW X;  2OMY A;  3ULU A;  3WPD A;  3W3K A; 
#chains in the Genus database with same CATH topology
 4B8C D;  4BV4 R;  1SQ0 B;  3RGZ A;  5GQR K;  1M0Z A;  3ZYN A;  2Z66 A;  4YEB B;  4XOS A;  3E4G A;  4XGO A;  4LI1 A;  4M7E A;  4Q62 A;  3C6P B;  5GS0 A;  4KXF B;  4AW4 A;  5LFN A;  2V9T B;  3C6O B;  4R08 A;  2XWT C;  3KJ4 A;  1P9A G;  1PGV A;  4FHO A;  4RCA B;  1H6T A;  1U0N D;  3RIZ A;  4LSX A;  2WQV A;  4TZH A;  3OGK B;  4U06 A;  4HQ1 A;  4Z94 G;  1K5D C;  3OJA A;  3UL9 A;  4WP6 A;  2XOT A;  4FDW A;  3ULA A;  4R6F A;  4XSQ A;  3SB4 A;  4Q3I A;  2O6Q A;  4V2D A;  4GLP A;  4Z61 C;  2Z65 A;  4P91 A;  1P8V A;  3A79 B;  4FD0 A;  1ZIW A;  1XCD A;  2P1Q B;  3CIY A;  5IJB A;  1XWD C;  5GMG A;  3WN4 A;  2FT3 A;  2OMV A;  4P8S A;  3GOZ A;  2JQD A;  5IYX C;  4ECN A;  3W3N A;  4R6J A;  2JE0 A;  2WFH A;  3W3J A;  1FQV A;  1XEU A;  3RFS A;  1OOK G;  4Y61 B;  4CIL A;  3RJ0 A;  4U08 A;  4CC4 A;  1P8T A;  1WWL A;  4LXS A;  4NKH A;  3REZ A;  4BSU A;  1XKU A;  4LSC A;  4CNC A;  1OGQ A;  1DCE A;  4L3F A;  4LXR A;  2P1M B;  4NZT M;  3BZ5 A;  2O6R A;  1W8A A;  3M18 A;  3WPG A;  3RGX A;  3RFE A;  4RCW A;  5FTT B;  4PQ8 A;  3CIG A;  4C2B B;  1FT8 A;  4L3A A;  4R07 A;  3FXI A;  2Z82 A;  5HZL B;  1FS2 A;  3VQ1 A;  4BSS A;  3W3G A;  4MN8 B;  4I6J B;  5AWA A;  3W3L A;  5AZ5 A;  4CP6 A;  5AWD A;  5B0N A;  3P72 A;  4R58 A;  3ZYJ A;  4J4L A;  2OMU A;  4V2C A;  3PMH G;  3CVR A;  3G04 C;  1OTN A;  1D0B A;  1OTO A;  2BNH A;  1QYY A;  5HDH A;  4PSJ A;  4R5C A;  1FO1 A;  3E6J A;  1IO0 A;  2JE1 A;  4KT1 A;  4FS7 A;  4QXE A;  4CNM A;  2RA8 A;  3ULV A;  4RWT C;  2OMW A;  1M9S A;  1O6S A;  5GMF A;  1XEC A;  2IFG A;  2Z64 A;  5AWC A;  3WPB A;  2AST B;  3E3Z A;  2WQW A;  1Z7X W;  5IJC A;  3G39 A;  2WQX A;  2V70 A;  2P1N B;  3ZYO A;  3M19 A;  2Z7X B;  3WPC A;  1LTX A;  3OGL B;  4C2A B;  4QC0 A;  3DZE A;  4U7L A;  2Z63 A;  1G9U A;  4M7E C;  4V2E A;  1OZN A;  4H09 A;  5D3I A;  5CMN A;  4R0A A;  3G3A A;  3RW7 A;  4Z64 C;  4IM6 A;  4LSX C;  4G8A A;  4FMZ A;  3W3M A;  1OTM A;  4J0M A;  4OQT A;  4NKG A;  1K5G C;  2OMZ A;  4LSA A;  1DS9 A;  5B4P A;  3TSR E;  2A0Z A;  4LI2 A;  2WQU A;  3UL8 A;  1YRG A;  2Z62 A;  1O6V A;  4KNG A;  4FCG A;  3JB9 j;  1KOO A;  2UZX A;  2Q4G W;  2Z81 A;  1A9N A;  4R5D A;  1H6U A;  3G06 A;  3WPE A;  1M10 B;  4PKI G;  3WPI A;  2BEX A;  4U09 A;  2O6S A;  3WPF A;  3VQ2 A;  3OJA B;  5CMP A;  2CA6 A;  3C6N B;  5IJD A;  3O53 A;  5AWB A;  2P1O B;  2OMX A;  3OGM B;  2R9U A;  3RFJ A;  1GWB A;  2OMT A;  4R6G A;  5GS2 B;  1JL5 A;  4AY9 X;  3RW6 A;  3WPH A;  5B0T A;  4PEQ B;  2ID5 A;  2ELL A;  4GT6 A;  1M9L A;  2V9S A;  4WYK A;  4PER A;  4BSR A;  5GMH A;  4NZR M;  5A5C A;  3UL7 A;  1O6T A;  2UZY A;  4UFR A;  4Z79 A;  4R6A A;  4CC4 C;  3O6N A;  4ECO A;  4K17 A;  4R09 A;  2P1P B;  4QBZ A;  4ARR A;  3E2J A;  4EZG A;  4Q3G A;  3UN9 A;  2Z7X A;  2ASS B;  4Z8G A;  2RR6 A;  3G3B A;  1DFJ I;  1A4Y A;  4ARN A;  3ZYI A;  1KOH A;  2Y5Q A;  4MQW X;  2OMY A;  3ULU A;  3WPD A;  3W3K A; 
#chains in the Genus database with same CATH homology
 4B8C D;  4BV4 R;  1SQ0 B;  3RGZ A;  5GQR K;  1M0Z A;  3ZYN A;  2Z66 A;  4YEB B;  4XOS A;  3E4G A;  4XGO A;  4LI1 A;  4M7E A;  4Q62 A;  3C6P B;  5GS0 A;  4KXF B;  4AW4 A;  5LFN A;  2V9T B;  3C6O B;  4R08 A;  2XWT C;  3KJ4 A;  1P9A G;  1PGV A;  4FHO A;  4RCA B;  1H6T A;  1U0N D;  3RIZ A;  4LSX A;  2WQV A;  4TZH A;  3OGK B;  4U06 A;  4HQ1 A;  4Z94 G;  1K5D C;  3OJA A;  3UL9 A;  4WP6 A;  2XOT A;  4FDW A;  3ULA A;  4R6F A;  4XSQ A;  3SB4 A;  4Q3I A;  2O6Q A;  4V2D A;  4GLP A;  4Z61 C;  2Z65 A;  4P91 A;  1P8V A;  3A79 B;  4FD0 A;  1ZIW A;  1XCD A;  2P1Q B;  3CIY A;  5IJB A;  1XWD C;  5GMG A;  3WN4 A;  2FT3 A;  2OMV A;  4P8S A;  3GOZ A;  2JQD A;  5IYX C;  4ECN A;  3W3N A;  4R6J A;  2JE0 A;  2WFH A;  3W3J A;  1FQV A;  1XEU A;  3RFS A;  1OOK G;  4Y61 B;  4CIL A;  3RJ0 A;  4U08 A;  4CC4 A;  1P8T A;  1WWL A;  4LXS A;  4NKH A;  3REZ A;  4BSU A;  1XKU A;  4LSC A;  4CNC A;  1OGQ A;  1DCE A;  4L3F A;  4LXR A;  2P1M B;  3BZ5 A;  2O6R A;  1W8A A;  3M18 A;  3WPG A;  3RGX A;  3RFE A;  4RCW A;  5FTT B;  4PQ8 A;  3CIG A;  4C2B B;  1FT8 A;  4L3A A;  4R07 A;  3FXI A;  2Z82 A;  5HZL B;  1FS2 A;  3VQ1 A;  4BSS A;  3W3G A;  4MN8 B;  4I6J B;  5AWA A;  3W3L A;  5AZ5 A;  4CP6 A;  5AWD A;  5B0N A;  3P72 A;  4R58 A;  3ZYJ A;  4J4L A;  2OMU A;  4V2C A;  3PMH G;  3CVR A;  3G04 C;  1OTN A;  1D0B A;  1OTO A;  2BNH A;  1QYY A;  5HDH A;  4PSJ A;  4R5C A;  1FO1 A;  3E6J A;  1IO0 A;  2JE1 A;  4KT1 A;  4FS7 A;  4QXE A;  4CNM A;  2RA8 A;  3ULV A;  4RWT C;  2OMW A;  1M9S A;  1O6S A;  5GMF A;  1XEC A;  2IFG A;  2Z64 A;  5AWC A;  3WPB A;  2AST B;  3E3Z A;  2WQW A;  1Z7X W;  5IJC A;  3G39 A;  2WQX A;  2V70 A;  2P1N B;  3ZYO A;  3M19 A;  2Z7X B;  3WPC A;  1LTX A;  3OGL B;  4C2A B;  4QC0 A;  3DZE A;  4U7L A;  2Z63 A;  1G9U A;  4M7E C;  4V2E A;  1OZN A;  4H09 A;  5D3I A;  5CMN A;  4R0A A;  3G3A A;  3RW7 A;  4Z64 C;  4IM6 A;  4LSX C;  4G8A A;  4FMZ A;  3W3M A;  1OTM A;  4J0M A;  4OQT A;  4NKG A;  1K5G C;  2OMZ A;  4LSA A;  1DS9 A;  5B4P A;  3TSR E;  2A0Z A;  4LI2 A;  2WQU A;  3UL8 A;  1YRG A;  2Z62 A;  1O6V A;  4KNG A;  4FCG A;  3JB9 j;  1KOO A;  2UZX A;  2Q4G W;  2Z81 A;  1A9N A;  4R5D A;  1H6U A;  3G06 A;  3WPE A;  1M10 B;  4PKI G;  3WPI A;  2BEX A;  4U09 A;  2O6S A;  3WPF A;  3VQ2 A;  3OJA B;  5CMP A;  2CA6 A;  3C6N B;  5IJD A;  3O53 A;  5AWB A;  2P1O B;  2OMX A;  3OGM B;  2R9U A;  3RFJ A;  1GWB A;  2OMT A;  4R6G A;  5GS2 B;  1JL5 A;  4AY9 X;  3RW6 A;  3WPH A;  5B0T A;  4PEQ B;  2ID5 A;  2ELL A;  4GT6 A;  1M9L A;  2V9S A;  4WYK A;  4PER A;  4BSR A;  5GMH A;  5A5C A;  3UL7 A;  1O6T A;  2UZY A;  4UFR A;  4Z79 A;  4R6A A;  4CC4 C;  3O6N A;  4ECO A;  4K17 A;  4R09 A;  2P1P B;  4QBZ A;  4ARR A;  3E2J A;  4EZG A;  4Q3G A;  3UN9 A;  2Z7X A;  2ASS B;  4Z8G A;  2RR6 A;  3G3B A;  1DFJ I;  1A4Y A;  4ARN A;  3ZYI A;  1KOH A;  2Y5Q A;  4MQW X;  2OMY A;  3ULU A;  3WPD A;  3W3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...