1OP3H

Crystal structure of fab 2g12 bound to man1->2man
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody domain exchange is an immunological solution to carbohydrate cluster recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB 2G12, light chain
total genus 41
structure length 224
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2003-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op3H01
3IKCB 1W0VA 1OAXL 3TN0A 4JGMA 1Q9LA 2BNQA 5FYKE 1RUQH 1UH4A 2R0LH 1BJ1H 4GKOA 1XR8A 3MCLL 5C0ND 2YSSA 3OHXA 4M7LT 4BQ8A 1JVKA 2QHRL 4LCIL 4IRJC 1DANU 3SO5A 1KTKE 3CFKA 5I16B 3V6OE 2WANA 4PLKC 1A5FH 1FZJB 2PTVA 4KKAC 2CK0L 4YDJA 2CMRL 1MJUL 4KJYA 5HTSA 3S37X 2VNCA 3MQIA 4ONGL 2VIRA 3RKDD 4WNQB 5DD5L 3WO4B 4PJ7E 5C9JB 4ZPVB 4M62H 3ETBF 1LDPL 3AUVA 4M6NL 3CC5A 3N85L 4IMKA 4ZYKA 4MAUL 3VXOB 2ITDA 5D7IE 2JIXA 4UIKH 1NGYA 5D7JD 4YHPB 3DECA 1FGVL 5ABDE 1ORSB 5SWZD 5L8KB 3ZT7A 4NKIL 3DMMD 1P6FA 2P45B 2H3NA 2Y07L 1NC2A 4LARL 5D1XA 3CGTA 4WFFD 1Z6JT 2R0WL 5K59F 2N7AA 5GS0C 2MSPA 2G9HB 1UKQA 4MVBD 1UVQB 1XH3A 2R56H 2AEIT 4M9PA 1U92B 1KIRB 3ZDYF 3EJYD 1AP2A 1FZMA 1NBZA 2AXGB 1T03L 1YN6A 2BMKA 1RHHB 4JFEE 4Z7UE 1INQB 1ZOXA 5MI0C 4WW2B 2GT9A 2ORBH 3WS3B 5CD5D 2ZWLT 4O2CB 5EBLB 5BRZB 5C0JA 2C4FU 5IF0A 4G8GD 4LKCB 2OJEB 4NNXB 1RI8A 2EXYC 3VFNA 2V17L 4KRPB 2E8YA 3KPLB 3ULUF 1CWVA 2J1KA 3MLYH 2DJSA 4R90H 3RVUD 3PP3K 3W0WE 1NKOA 3KHOA 3SDCD 3BP6B 3MCLH 5F71A 1KV3A 4Y4HB 5T5NG 4JAMB 1KIPA 2VDLH 4NBXB 1D9KD 1S9XB 3MRJA 4PYGA 4PGCA 3LPFA 1U8QB 1NDGA 4FXKB 3PWJA 1JHKL 3CNKA 3WLWD 2DDQH 3MBEA 4TSBL 5D71H 4MX7B 4ELKA 3QJFB 5DD5H 2PNDA 4JFZL 5LGJA 4UIMA 4DGYL 1LDPH 1JGDA 2HRPL 2KDGA 1BFTA 3JTSA 2DQEH 2DWEA 5IBUB 5CWSA 2DQDH 4FQIH 3TPUB 1S9KC 3PGDA 4BZ1H 4U7SA 5E7BA 2NY0B 3KPRD 1BM3H 4TRPH 3ZKNC 3DBXA 2NQCA 2XG4A 4UU9B 4JG0H 2D7QA 3EYUH 4BELD 4X99A 1ZA3A 3DYMA 1F00I 4KDTA 1CXKA 3O2WH 3MACL 2O5YL 2R8SH 4G9DA 1RJZB 5DUBA 5C0CE 1X5LA 3MROA 1YEDB 4RSVA 1A7BA 1QKZH 4L1DA 3MLWH 4ZUVB 4FZEL 3OAZH 1YEIH 3DI2B 3MV9A 1S7SA 4ZD3L 1INDH 5EOTB 1K5NA 2FATH 2FZ3A 5DRNA 1G9NH 3KPSD 1HI6B 1F90H 3VXRD 4JFXB 5D7JA 5SWSD 3MBED 1OQXA 1B90A 1UGNA 4XBEL 1Y6MR 1YPZF 4IRSB 4A6YL 3HE6C 5D1ZA 3IETB 1RZ7L 2XZQH 4P2RE 3GSXA 4I5BA 3LKNB 4MA8H 4UZGA 5D7LE 2Z31D 4QRSB 3DRTA 2P8LA 3G9AB 2Y9RT 4ZNEA 4P5TC 3AFLA 4PV8A 3Q5YA 4H20H 4JO4L 4L4TA 1JF1A 4ONOA 3T3PF 1MCPH 3TO2B 4LCYA 2QJDA 4P5MB 4DGYH 2WBJC 3TNNA 1YQVH 4K94L 5EZLB 2JF1A 5INDB 4Y16B 4NGHL 4IMLB 4V1DE 1NUNB 2QADD 5FYJE 5SWSE 3IDIB 4XCEA 4JFDA 1GZQB 1P5UA 5FYKU 4MB5A 1CICC 3DX8B 1WBZA 4K8RD 5D2NB 4HS6B 3QPXH 5ALCH 3EYSH 1CXIA 1SJHB 1S7QB 4K7FA 4R9HA 5F9OL 4PY8I 1U8NA 2AJ3B 4KJWC 2AEQH 4H0GA 2GJZB 4DN4H 2VXUH 3BDYH 4U1GC 5AZEL 4XHJD 1FFNB 4EIGB 5I8KL 4KTEL 4KXZH 1T7WA 2BSRB 2G60L 3CPLA 3L3JB 4TYUA 4PREB 4YBLB 4MMXC 2F19H 1IQDB 5I66A 1L7IH 5C0GB 4PJHE 2DBLH 5DT1H 4PJ8C 5GS0H 1WT5A 1XZ0A 2DBJA 1NFIB 2C5DC 1YECL 5TFSL 4U1NA 2BFVH 4NN5C 2PXYB 3WS3A 1JGEB 3MGOA 3S36X 1T66D 3Q48A 2WUBH 4TSCH 3Q5OA 1SHMA 3VXUD 2DM2A 2NZIA 5CZXC 3CZFB 3SO3C 4URTB 5ALBH 2JIXB 4ZXBC 5EORL 5CKAA 3MRHB 5DD1H 3QDAA 5DHVA 4NDMA 4RGNB 1NC2B 5CEZH 5IB3A 3BI9X 1QBML 4YGAB 5C09B 1KXTB 5ETUB 1JHLL 5EO0A 1YQVL 1MY7A 3K80A 4PB9H 3PHQB 1AC0A 2Q1EA 4EOWH 5IB4B 5GZOD 2KBGA 5TH2B 2AXGA 2O5ZH 3R06A 4JVWA 3M1BA 1HHGB 4M5ZL 5D1QC 4IRSC 3S9DB 4AT6A 4X83A 3QJFA 1RFDH 4MQ7B 2PW2B 2IQAB 1P9MC 4PV9A 4PJXF 2XWJB 3RA7H 4MMZC 2DQTH 3HUJA 4L9LC 2HMIC 3QQ4B 1QSEE 5GRUL 1HXMA 5DMKB 4ZO8A 2VXTL 5J12B 4RMUA 2X4NB 3MO1A 2AEQL 4JDVA 4QYOB 3RWFA 4Z7QE 4HS8L 2HA1A 2OJZL 3E1F1 5E8OA 1FNGB 1OAQH 2DICA 4E42A 1BZ9B 1AR1C 5BQ7A 3MXVH 1CXHA 2W9LA 2LU3A 5IEHA 1MNUL 3S96A 4OLZH 3QXWA 1FNFA 1QSZA 2HYMA 5MHSD 5HVFB 4MYWB 2DBLL 3NCFB 3FB6A 1T0MA 3H2WA 3O0RL 4K7PX 4WUKL 3GSNA 1BVZA 5TE7L 2BFVL 1Q9WA 3U0TB 5GRZA 5ID1A 4J23A 3MUGB 4LSSH 1AE6L 5DD3L 4NO3B 2OL3A 3BO8B 1TPXC 1PLGH 3ZE2E 1FFPB 4PJCF 2V7NA 32C2A 3TEUA 3CFJB 2P1YA 2NW2B 4RAUA 3RUGF 2V5MA 4PJ9B 3BUYA 4Q9RH 2G75B 1QBMH 3LB6D 2X9YA 4ISVA 1LO5B 4LDLB 3HE7C 2X4RA 1EHAA 1VESA 3P4OB 4LNRB 1T89C 2VXSL 4A2LA 4YAQB 4CMMB 5T1KA 2AQ3A 4GW1B 1BVKB 4HJ0D 2B1AL 2R0KH 3VXSB 1OP5H 4P5MA 1A47A 5IQ7H 4LVHC 1BVLB 4S1SH 4RZCB 4N8CL 3WKMH 1M7IB 4TUKL 5EZLA 4YHKH 3WFHA 3EO0A 1MAML 4G8EA 4Y2OA 1QR1B 5D7JB 3LRHA 4G80B 1DVFD 1HILB 3D87B 4QF1A 2Q20A 2V9QA 1R3JB 4KHTH 1A9BB 4KY1H 3C09C 4NQCD 2YD4A 3WUWA 1QUNA 1TIUA 5FGSA 2ZUYA 2J5LC 2UY6A 3LKNA 1UCBL 4Y1AB 2Y23A 1VEOA 4LIQE 3JVGA 3SKMB 2RGSA 1V8HA 3QQ9D 3O4LD 3HAEB 1F5WA 1I1FB 1K5NB 2FZ3B 3KXFD 4TNWF 1HI6A 3SJVB 3ARQA 1CDBA 2DTMH 4MJ5A 3RWHB 2LV4A 1CBVL 1UZ6F 4G3YL 2L0DA 4PY7A 4X7CC 5INDA 5F7EL 3TO4C 4P23C 1EVUA 3FN9A 3T2NL 2LU4A 3BOVA 1A14L 2ATPB 3FZUC 3BP4B 1EFQA 4RBPH 2NTFA 2WUCH 4PRDB 2FJHB 3RVUC 3V6FA 4UDUA 4Q9RL 3A67H 5CHNA 2BNQE 1ZT7B 3DX8A 4KJQD 5TF1H 4NN6C 4QTIL 1X7QA 2AI0L 1S78D 2DQGH 1MCIA 1AJ7L 4UDTB 1MFEL 4XP6L 1IILE 3GBLA 4P5KB 1CFVL 1U9KA 4JREB 4U1JA 2NY1D 1A6TA 2D9QB 2MPAL 1CLZH 3UTZB 2MMXA 2SEBB 3QNXA 1TQCB 5FYKD 1K8DA 3TESA 4XNYL 5IVXE 4R7NB 1BZQK 2HFTA 1QRNB 2AEPL 3MV9E 4TVPE 2HVJA 3NIDF 1BBJB 4P99A 3MJ7A 1DTUA 4DQOL 1I1AA 4N8CH 5I1GH 4B53A 1ZA6A 4YHKL 1LK3H 4M3JA 2LVEA 4HUUA 1Z0MA 2XOTA 2IBBA 1N4XH 1MI5D 4AM0B 3MV9D 1DLFH 5C7XH 3LKSB 3KYMB 4HK0B 2B2XH 2DL2A 5I1CL 3RDTD 2AJ3A 4YEFA 2A74B 4RGMB 4PG9A 1HWGB 3E6HA 1FFOB 4LCCA 5E1AB 2PO6D 3O4LB 2A83A 3BEWB 1V7MH 3CZFA 5IHBA 1OD9A 4HKJB 5C92A 5AUMA 2J6EL 1ACYL 3OR6B 1O5DT 1AXIB 4XZUA 5IESL 5DHVB 5E0QA 1R3HA 2E9IA 4RMVA 2FO4B 3MRRA 5F1KC 4PB0L 2Z93A 5DK0A 1ADQA 3ORJA 5CINL 4TOYL 5I76B 2HJLB 2NR6C 2AJYH 2R2BB 5DJ0A 4EDWL 1RIVL 4ZTPH 4RNRA 5IUSA 5E2TL 5I1EH 2H6PA 1OTUD 2EDWA 3S36L 3QIUB 5T3XL 3QULA 5E2UH 3SO3B 2R0LL 4FHBD 1KLFA 3O6LL 4ZODA 1Q9WB 1R5VA 4R97C 4YXHL 3X14A 5IHLB 4GS7B 2RBLA 4ENED 3GMOA 2VDKL 3HE6D 3SY0A 2IC2A 3DHJA 3WMSA 1UEYA 4MA3A 4W4OC 1TFHA 1A5FL 4UUJA 1FFPA 2Z92B 2DWDB 4KK5D 3UTOA 4XNYH 4TQEH 5EZJB 3D0VA 2E7CA 4OF7A 3K2UL 4XMPH 4LPUA 5E6ID 1M6OB 4YBLC 5EU5B 2Z8SA 2AVGA 4X9IA 4X8XA 2ZOKA 3O9WB 4RMSA 1HKLL 2DJUA 3DVNB 2E8ZA 3ARRA 1VFBB 3GJFA 5I1GL 2VR4A 3Q2CA 1YMHB 4TULL 3MTRA 4F7PA 1F4HA 1VFAB 5E94A 2YC1A 3EDDA 3SPVA 4PJIE 4OZIE 3EAKA 3HUJB 5CJQL 4ODHL 5I1LB 4AZ8A 2IQ9L 5I8EA 4U3CA 3EYVA 5DRXA 4ZFFA 5FB8A 4Q74A 1IM3A 3QDGD 5C2UB 4Z7UA 3O6FA 4MXWH 1XF2A 2F74A 1M7IA 3HNSH 4NHUB 5GGUA 3TZVB 1E6OH 3X12A 1IL1B 4OZFA 1KBGL 1A1MA 1GGTA 1G84A 4Z7OF 3UZEA 1AGFB 3B5TA 4OLYL 2FJFB 4JFYB 5T5FL 5JO5B 3MRQA 4TOYH 1BFVL 4KK8C 2PETA 4KRPD 1CVRA 2ICES 2NY4D 4GBXC 4X4YA 4OM0H 1BP3B 1FN4A 4XH2B 5EU4A 1K3ZA 1U8KA 5B4MC 2XKUA 5FO7A 4XVJH 3W2DL 4C55A 3O6LH 1JZ2A 4L5FL 2O5XH 1TCRA 4U6XA 4QNPF 1WC7B 4OCRL 3OKKA 5BS0B 3BQUA 5F3HB 4FQXD 4ODUB 4R7DA 3B9DA 1CIDA 3UBXG 1CFQB 3MLXL 2AJZB 1CDIA 4KQ3L 1QFWI 1SEQL 2DDQL 3LSOB 2XKSA 4JREC 3V4UL 3K2UH 1K4CB 1CDHA 4HIEB 2NNAB 5I1AA 4Y1AA 4POYA 4YIQA 1MFCH 5MERA 3E8UH 4U1JB 1LD9A 3O81A 1BVLA 4HZAA 3CXHK 1QSED 5J11B 3PGFL 3F7PC 2BY1A 3BJ91 2EDJA 1JYNA 3Q0HA 2PF6A 2FBJL 1BBDH 1K9TA 4H1LB 3MLTA 5JDSA 5HJ3B 5E6IA 3C8KB 3D2UD 4RQQA 4QHKJ 1VHPA 3KYOA 1FGNL 4C83A 5JNYA 5FYJD 2VQ1A 5DR5H 3OKLB 2O5YH 2WW8A 1MREH 4X6FB 1SM3H 3TBSB 2ZOLB 1SVCP 3W9EA 3IJYB 3SGJC 1NMAH 2CK0H 3F65A 1SBSL 4LRIA 3K4AA 1Q0YL 1Q72L 3DSFH 4M7LL 5F44A 3GSRB 3SCMD 2LAAA 5IMOB 4XWGL 4HXAL 3ZHKA 1JZ5A 4HKJA 3TPKA 5KVDH 1R24B 2XZAH 5B38B 1UCTA 4DGVH 3OR6A 4NO2B 5IJKA 4NKQB 2WMPA 2X4OA 3N85H 2F58L 2IFGA 4NQTA 4N1EA 3NA9H 4PRAB 3VD7A 4GW5A 3UTQB 3GRWH 3ZDZF 1F3RB 4NC1E 5IHUH 2CDGA 2C9AA 4RMQA 3TIEB 4F7EB 1ZHKA 2QADB 1OAKL 5F96L 4HGWB 3RPIA 3N9GL 3ZE0E 4WV1A 3V0AC 5KN5A 3LN4B 3MLXH 4YBHA 5D6DA 2OR7A 1MAKA 2LAGB 2GTWA 4XVSH 4LPVA 4JO4H 1G0YR 3RL2B 2EEBA 2IG2L 3QSKB 1KN2H 3UJJH 43CAB 1IEBB 4EN3D 2H3NB 4L3AA 3SOBL 3OJDB 2XTLA 3BN3B 1MRDL 2BXZA 1X5FA 3FQXA 3KR3H 4NGHH 3RWCA 1IKFH 1JNNL 3ZKSD 2OI9C 4J3UA 4AG4L 3QI9D 3QFJD 3EYOB 4HUUB 2ZSWB 5IIEA 1A2YB 4YDVB 4LCUB 3D39B 1B0GB 4XPFH 2W60A 4ZSOE 1ND0A 1CGSL 5DUPH 1N5AA 4RNRB 4P46C 3TBWB 4LLQA 3QIBA 5EZIH 3HRZA 5IWLC 3QO1A 1BQSA 4HC1H 5DJYB 4WI4A 5IVNA 5AUMB 4APQD 1RZJL 4NQEE 1R5VB 5SX5K 1JHKH 4APQA 1PEWA 3P9WB 3RBGA 3O6FB 5BW7A 5E24E 3GJEB 2GSGA 2VDRL 1EXUA 1HOCB 4HXAH 5KVDL 3FRPA 2DWDA 2FSEA 5KAQF 4N5EC 3G5VA 3Q3GA 3AAZA 3T0EA 9CGTA 1NGZA 3C87A 5GSRA 3GRWL 4Z76A 2QEJA 5IHUL 4GUPA 1J10A 3VXOA 3CDFA 5HHOD 4N8VG 3T8XB 1ITBB 2YUXA 3P4MA 4TTDD 3LMJL 5FK9B 4I13B 4W6YB 5HHMD 3JWDH 3QXAB 4WHTB 1YEEH 5JHDB 5E8NA 4NCC1 3U7YL 1EZVY 2G2RB 2XTJD 3NAAL 5CJOH 5DXWA 2XZZA 1KEGL 4MQXC 4PRID 3FZUD 5T3ZL 4DEPB 2NY6C 2HKFL 4L9LA 1HHHB 1A7OH 4M43H 1D6EA 3ARBD 2ADIA 3G5XB 4H25B 1QKZL 1WTLA 3BE1L 3GSUB 3B4NA 1U41A 2X41A 4N8VA 1KPUB 4MS8C 1ZTXH 1IKFL 1JNNH 1INDL 3FB5A 3WD5L 2MHAB 4LOUC 1GZPA 4M5ZH 4K3JH 3O6FD 1G6RH 1XGUB 1DN2A 4HKBB 4M6MH 1NMCB 4NRXA 5ESAB 2HVKB 3VXSD 5C0JB 4XC3H 3RIFF 3ZTNH 5A16B 2QSVA 4E0RA 2ICWB 5EDXA 5EZIL 2ZUWA 4X4MA 3LDBB 2VXTH 5EZOL 3KYKH 1JN6A 5HI5D 1WCQA 4KDWA 3F62A 4ZOEA 4HS8H 3O6ML 3BH8A 5K59E 2GY5A 4MQTB 2CK2A 2CIKB 3QUMH 1Y18B 4XAWL 1M1SA 4TUJB 1TCRB 3QI9B 5DZOA 1DBAL 1LNUB 1S7TB 3K1KC 1OWWA 1MCPL 2PO6C 3OKKB 2EKJA 2VR5A 4C83B 5BS0A 3EOBB 5HGGS 1RUPL 2J88L 1R5IA 1PYWB 2P4AB 5ADPL 1D5XB 1A64A 5FO9A 2VDML 3I50H 4WUKH 3VG0L 3JXAA 4LRNL 5LGJB 3MRKB 3I6LD 3KPOA 1OGAD 2P8PB 1I85A 3BH9A 3ARFD 2J8UB 3U82B 2Q86A 4C54A 3LMJH 3QFDA 3JWDL 3MLZH 4NKDA 4XNXH 1PLGL 2C3GA 3QA3A 1HHJB 2D31B 2PYEE 4X6EB 2X4OB 4FQQA 1WC7A 3NAAH 5CJOL 3QIWC 4JVUA 4Y4KC 4JKWA 1HH6A 2V2WA 2V2XB 1ZA3B 2VABB 2CXGA 4FABH 4XXDA 1GAFL 2XV6B 5GGVY 4H1LG 5AZEH 3ARDC 5IG7B 1AKJB 3UTSE 4M1CC 3FFDA 1FNHA 1HHIB 3L6FA 5IMLB 1DCLA 3DYPA 3CH1B 3RL2A 2KKQA 4J12A 3PGCA 2AJSH 4PGZA 4AIZB 4OZ4A 4OCSH 1CL7L 3WFCH 1J5OL 3UPCA 1XR9B 4OD3H 2X1OA 1R24A 2X09A 4E5XA 5L8LB 1SY6H 3X11A 1HQRB 5DFVC 4YHNA 1WBYA 3KDMA 4LHJB 4QRPA 4OZIF 4OFYD 4I3RH 1I7ZA 4MSWA 4EI5C 5JLZA 3FT2B 1HIML 2O93L 4IRSA 35C8H 5AAWA 2B1HH 4P2CG 4B5EA 3BP7A 4FQCL 4UINL 3RGVC 3TBWA 4G9FD 5HPMB 3SE8L 3DIFA 4N0RA 4D2NA 3GMNA 1LILA 5KN5B 2JIXD 4HHAB 4L4TB 4PJCB 3I50L 3CK0H 3QIBD 4JLRA 3DMMA 1PJ9A 4WFGD 5JR1H 3VXUA 1F2XK 3GUTB 4JPWH 4QOKD 4LCCC 4A6YA 4WY7L 3SGKC 1T4KA 4G9FE 4PRAA 3MZGB 1WZ1H 2HN7A 1RFDL 2X9WA 2F5AL 2DS4A 2EDYA 5DJXB 4UQ2B 2EDOA 3UYRL 1G0DA 3QNYA 3RWCB 5IP4A 4HIJB 2DQTL 3UBXB 3WN5A 2VDNL 5EIIA 1FZKA 4X98A 4R8WL 5TH2A 5EIVA 1P7KB 2GJ6A 4MJ4A 1YEGL 1AGBA 3PWUB 3NCYP 4MXVF 4OIAA 1BPVA 2VOTA 4O2FB 4AEFA 4DZ8A 5KSBB 4UTBL 4AK1A 4LLDA 2IADA 5BRZD 4JKMA 4XPBH 1KJ2B 4LSPH 4OV5A 1DBMH 3JTTB 5EPMA 5E8OB 3GEWB 3H3KA 1AO7E 3BQUD 4FQ1L 4UQ3B 1SY6L 5SWQB 3EYFA 1JUFB 4ZQKA 4HFUL 4KMTL 2GAZA 1FL6B 3RVXD 4CVWA 3AAZB 4JR9H 1NC4A 1GZPB 1JGEA 4CMHB 1P1ZA 2DQIL 2A6IB 4D0CA 5DS8A 1S7UB 1N59A 1S8DB 4F7MA 2B1HL 1NMBL 5IV2B 5F3BB 2CIIB 3OKMB 3T3ME 1P4LA 3X17A 2J2ZA 2J3SA 3MRCB 3CLFH 3SKJL 2Z4QB 3IKKA 1T83A 1QA9B 2M1KA 2VE6A 1P4IH 2D3VA 4JFOA 5L2JA 1A6WH 3L3KA 4CJ0A 1IARB 1DANT 1T04A 1CGWA 2OMNA 5IBTL 4K3DL 5I17B 1OAZL 5JPNA 3D2UA 1PW3A 5CILL 3WFBL 3VWJD 1QO3A 5FEBA 4M03A 4Z8FH 3TM6A 1ACZA 2VYRE 1E6JH 2AJUH 5E2UL 2UWEF 1TENA 3LHPH 1TETL 1UWGL 5FYLL 43C9A 4OI9A 3TA3B 4FQJL 4ETQA 3BGAA 3ME0A 3MRIB 1H5BC 2Q86B 4AYFA 4MNQA 4BKLB 1G7PB 5I6XB 3CFBB 1IMHC 2EYTB 5B21A 4GKSA 3WFEL 4NQEA 1BZ9A 4FQXA 3KGRA 3BESR 4P2YA 5IQ9A 3HNVL 3H9SB 3BH8B 4P9ML 1NFKA 3R1GL 2IANB 3IVKB 3CUPA 1TJHH 4OFKA 3UTPE 4Z7WA 4AENB 3DO3A 4RX4D 2R1XB 5F7WC 5KAQG 2AW2A 3ZL4L 3HFML 1I1AC 2NX5A 3LV3B 2ICWA 4G3YH 5KZCD 4IJ3C 2YD5A 4PJEF 5F7EH 3IXAB 3QEHB 4XMLH 3MRKA 4GG6B 4NO3A 4U1MB 3OB0K 3MRNA 1MSPA 3ALWA 2OL3B 4OF6A 2FB4H 1RUQL 4UT7H 3I2CL 1RK1B 1JNJA 4P46D 4NQCA 5KOVC 4NKDB 1KTRL 1A7NL 1F13A 2GSIB 4YFLF 4RAUB 4EUPG 1IT9H 2W38A 1EJOH 4YC2B 4O00A 4FTVB 3RX8A 4AH2B 2KPNA 3SDCC 4GH7B 3VRJB 5MEND 1WFNA 4KFZC 3DHMA 5I1DA 1MJUH 5T3XE 1D5MA 2X89A 3V9FA 3VFOA 4CRPA 3OR7B 1I7UA 3PWPE 1Q9LB 2BNQB 4WUUA 5J1AA 3F8UB 2NY1B 2MQCA 1QBLH 5C0DA 5FYLD 5LCVL 4Z8FL 3G6DH 5DMGC 4N5ED 3T08A 2UVFA 1TNMA 5DQ9B 4XI5D 1RJLB 4K23H 3IFLL 5IMKB 3AB0C 4ELME 4FQJH 3VI4E 1SQ2N 4HPYH 4RIRB 1FL5A 3UZQA 2DRUA 2Y07H 4PRHA 2B2XL 1NFDA 4TNVF 4DK3A 4JHAH 5DRZA 1A21A 1DQJB 4PRHD 2B0SH 1I1AB 4YHNB 4KZDH 5C0IA 1Q94A 2APVA 3H9HB 3E2HB 2HT4C 3HKFA 3NIGE 5EC1B 2QHLA 4Z0XA 3NIGF 5EIIB 2Y5TA 2EIZB 3LQZB 4POZD 1HZHH 3GMRB 5GS1A 3QEGL 4MCZA 3CH1A 1KJMA 2XN9B 3IDUA 1FFRA 1FV1A 5F7HA 3S37H 1T1YB 3CLEH 4HHAA 3S98A 4IHOA 3LZFH 5EFIB 3PQYD 5I1EL 2ED9A 3RQ3A 4E5XB 2RR3A 1H5BB 4YFLI 2DI7A 1RZKL 1BD2E 4M7ZC 4XZUB 2YPLE 4PP1D 2FBJH 2BX5A 5GGRA 1UB6B 3O9WD 4D0DB 4TSAH 3UJIL 5JW4M 5C07D 4YXHH 4MNGB 5DJXA 2BMKB 3MV7B 1BIIB 1FL6A 1PBYA 3CIQA 1FO0B 2LFGA 4K94C 2VR9A 2FX7H 4U05A 5ECJE 3VGBA 5C07E 3T65A 4OLXH 2R4SH 4H0IA 1J18A 4F57L 5D6CA 5D71L 4GW4B 3DX7A 2CRIA 1UH2A 4I48B 3BZ4B 4W68A 2W0FB 4Y5YA 1QFPA 3DMMC 1QBLL 2MKLC 4X9BA 4JFOB 5BS0E 4JAMA 1A3QA 4ZS6C 4LLWA 1KIPB 2DQEL 5TF0A 2EDXA 3TO4D 1FBIL 1FG2B 3L3DB 3IFLH 3MSPA 4K23L 3MX0A 4GKNB 3ZDXF 1IKNC 3MRGA 2KH2B 4R96A 1FZKB 3LKRB 5CP3A 4PJFB 2KUTA 3GIZL 3C2AL 4JY6A 3HNSL 1IGFL 1EIBA 2EICA 5C8JA 1JRHI 2YUZA 1OTTC 4O2CA 2YC1B 3RZCA 1VENA 3J7HA 4U1HB 3ZHDA 1NCDL 2PTTB 5JW3H 3RDTB 2F8XC 3O3EA 1UWEH 3V5DB 1JRHL 1WWAX 1KJ2A 2RQ8A 3JTTA 1IVLA 1YPZB 3KR3L 4QRQA 3IXTB 2BVTA 3FMGL 4KJWD 4PJXA 4P5TA 2QLVB 2C4XA 5DJDB 4UU9A 2CDEA 2VLJE 4OZIA 1WCBA 3DURB 2EIBA 3V6ZB 3C60B 5DJ0B 3REWB 2DIBA 1LQSR 1HEZB 3VCLB 5IBUG 2OK0L 3VGHA 1NC4B 4LHQB 1BX2A 2Q8AH 1FE8L 2ARJB 1CDCA 5J6GA 1JPGA 2IFFL 4JFEB 3UJIH 3S7GA 4YGVB 1YY8B 2EZ0C 1C5BH 4CN6A 2F53E 1ORQB 1E0OB 3ILPA 3ROLB 1XIWC 4HWZB 4MJ6B 1YYML 2GJ6E 3MNVB 5C2BH 5C0RL 5KSAC 3V7MA 3G08A 4LHUA 4P4RA 1F4WL 5C6WH 1JP5A 4YPJA 4KQ4H 4NN7B 1V3LA 2C7UA 3H0TB 1WFTA 4MDIB 4X8JB 5JOFA 4HMDA 4CNIB 2GI7A 3N06B 1DEEA 1BOGB 1A4KA 1FBIH 3EOTH 5JHLL 4QOKB 2YXFA 5HGHA 1C08B 1RJYA 4Y5XC 3SPVB 2DN7A 3PNWB 3NFNA 1G7MA 43C9B 4M5YL 3PF2A 5I1LA 1N6UA 3MRIA 3OWEA 2ZG3A 3P0VH 3S34H 1A7QH 4JPKH 4LFHG 4JY5L 1K85A 4U1MA 5HD8C 4XNQA 3GSVB 4KUZH 1CGUA 4RFNC 5GGUB 4YHML 5IQ9B 3RJQB 3UJTL 1A7OL 2HTLC 1NMAL 3I6GA 4I0PB 5I8KH 3BPNC 1YNTA 1FCGA 1FYTA 1YDPB 5DJ2A 2G60H 5DUMH 1T6VN 2R1XA 2XXCB 2CR6A 4BFBD 4Z0XB 2HT2D 3WD5H 3P9LB 2LTQC 3IJSB 3GMMA 4F2MA 1YEDA 5DT1L 5GS0L 3UAJC 3TO4A 4KK6C 3PWNB 1CZ8H 4S0TD 3I75A 1AXSA 4XH2A 1TPXB 3UTSD 4GG6A 3UTTA 3DRQA 4NM4L 4TNWK 3EJZC 3IFOA 4GG8A 4QHKI 5DVOA 2NY4B 3I6KA 5IB1A 4NKOA 5D1ZC 4NO2A 4V1DB 1P9MA 1OQOA 2WWKO 4XAWH 1UB6A 3WE6A 4UV7H 1A6PA 5L6YH 5C0GA 3QFJA 5HY9A 1F4WH 3PL6C 4XVUC 4J1UA 4KQ4L 5DRZB 4ZAKC 2P43B 1ZAGA 1UXWA 1JHLH 1SVZA 1U3JA 2DLFL 4HJJH 4OLVL 5IKCA 4KPHL 1DDHA 2CRZA 2HT3C 5KANI 2JJUA 3IDGB 3PWPA 5GS1B 1K2DB 3PV6A 4BFGA 5DQ9A 5F1NA 2M26A 4B50A 3AS3A 3BXNA 3VWJC 2B20A 1FYTD 1WLHA 1A7QL 4JPKL 3FQXB 5GRUH 3B43A 3FCTB 3P2TA 3MXWL 4FQXC 4IMKC 5C0CA 4UILH 4YHMH 4LU5H 5DJAB 3FOLB 3MUZ1 1OAQL 1ZANH 3FO9A 3PHOA 5EBWB 1ZK9A 3CFIC 12E8H 1PG7X 1EBPA 1ZGLA 4WIQA 1S7QA 2VDRH 1NEZG 4LLQB 2PW2A 2H32B 5HYJA 3D48R 3RUGE 1LO3L 2YS4A 2Q3ZA 1F6LL 1ZT4A 1A7PL 1MH5B 2FH6A 1QSFA 5B8CB 7CGTA 1FFNA 5CJXA 3WFCL 1J5OH 2YUVA 1FNLA 3RDTA 1Q9KA 4GAFB 1WIOA 1ZLWK 2QSCL 1IGJA 1MCWM 4RISL 4J3VA 2AXFB 2VXQL 3LQAL 2I60L 2GK0B 2H2PC 1XZ0B 3B9KD 3U4EA 1BQHB 1WWCA 4FFYH 5DHYB 4JE4B 4XBGB 2H9GB 3RVWD 5AYUL 1CFTA 4E41D 4N9OB 4P23D 3DJ9A 2ENYA 3WS6A 3CSYB 3ILPB 2DLFH 4OLVH 1DP0A 1U95B 2D7OA 4M7KL 4GOSA 4U31A 5BZWA 5KJRL 3KLAB 1U93B 1IC5L 3VH8B 2G2RA 1X4XA 1KPVB 5GGTL 5IB3B 4MDJA 4IOIB 3T0WA 4YHIB 4P4RB 1HN1A 1MI5B 4K2UH 2B1AH 3NCJL 1MCOH 2V9TA 3M17A 1D3CA 3ARXA 3K8MA 4XC3L 4XCNA 2GITB 4Z95L 3MRGB 1S7WA 1WFUA 3CFEA 1BWMA 1F4XL 3HR5B 1VEPA 2DKMA 2XWBA 3BGMA 1BGXH 2C1OB 3IFPB 4NC0B 4G7VL 2NY0C 3B6SA 4X0KB 4HQQH 2ADGB 2BP3A 2EO1A 2RCSH 4IS6A 4LBEB 5C86A 3QIBB 1Z5LA 2P7TB 3F7YA 3O6KH 2JELL 3LCYA 2QBWA 1FO0L 4JKPL 4NQED 1G7MB 12E8L 1A4JB 3PP4L 3BGFB 4PJIF 2ZNWA 3ULUC 3DUSB 3HI6H 1RUMH 2HT4D 3QDJA 1YPZA 3QUYB 2VSCA 4XNQB 3OGCB 2BY3A 2VERN 2Z9TA 5I1HH 1DBML 2YN3A 4M6OH 3X3FL 4LRNH 3MA7A 4HAGA 4YHZH 1VKXA 3AVEA 3ULUH 1HEZA 3LEXB 2DTML 2NW2A 3EDKA 3HE6B 3TGXA 1PQZA 2I60H 2IH3B 3GMPB 4MNGE 4M4PA 3LB6C 4KVNH 4FFYL 2BVPB 2VLRA 2JB6A 4LPCA 2X4RB 4Y5XB 3ROLA 3F6IA 5ID1B 2AERT 4PJ5A 1QLRB 3EOAB 4QTIH 4YR6B 4OZFH 3V5KA 1S7XB 3QUZA 3HPJA 1A1OA 2VN4A 2YUWA 2MPAH 1K6QL 2YD9A 4NN7C 3Q1SH 3CVHB 5EUOA 1K3IA 2P48B 5C07A 1Y6KR 5D9SB 2VLJD 4GFTB 1S9VA 1ZKAA 3DWTA 3FFCA 4OM1L 1MCBA 2GKIA 4XCFH 5ICXB 1KIQA 3FRUA 4OD3L 5TE4L 4S11A 1BGXL 4PJBB 2IPKA 3T77B 4F2MB 4Z0BH 3T3PE 2VDPH 1GHFL 4LSTH 2VN7A 4LGRB 5HHNB 3PJSA 1K2DA 3PV6B 4YPGB 1L0XA 1J0HA 4Q9QH 3I75B 1Q9OB 3RNKB 1TZHA 3DRQB 1BAFL 5I74C 3GSVA 1ZVSA 1I1FA 4WI6A 2VLKA 5DVKA 2IPTL 3GJFK 1QR1A 1MLBA 3SE8H 3HNVH 3FO0H 3MBXH 4QXUH 3SEPA 1W72L 3BSZH 3L3IA 5F1SA 5DJ6B 5JW4N 3FT2A 3WE6B 3EOBA 3WUWB 2OX5A 3H3PL 3UMTA 4OFYA 4NRZB 4UMGA 3V6FB 3TCXA 1WZ1L 1MCHA 1N8ZB 2A77H 4J6RL 1WV7T 3BW9B 2WSKA 3N0PB 5CHNB 4YXLH 3U7WL 1IQWL 4OCWL 3UTTB 2Z35A 2DQJH 2IAMB 4KJQC 1A3LL 1UACL 4FP8L 4OLUH 4V2BA 3ZSSA 1B4RA 1B4JL 4KRPC 1ADQH 1JFQH 5TDNA 1Q1JH 3I2CH 1J1OL 1YMMD 2ZUTA 3GUTA 4OIBA 3NGBB 4FQQB 2FWOA 2FO1A 1Q0XL 4A6YB 3ARGB 4WO4B 3TT1L 4UNVA 5I76A 4G9FA 3SDAD 5K9QI 2IBGA 3CVHH 4I3SL 1KCRL 3VXRA 4HIJA 3WN5B 4FN0A 1NQBA 1BOYA 2VL5A 4MA7L 5FGCE 2EE6A 1T7ZA 4XMPL 1H0DA 1VGKB 4HK3N 2P49B 2NYYD 2YD7A 4Y1AD 1HHIA 1KYOK 3UP1A 5IMLA 1CQYA 5LQBL 4NWTH 4XCCL 1F3DH 4FQ1H 5IEKB 1U93A 1MIMH 2QQLH 5HHOA 5TQ2L 1NBQA 5DQDH 2VDPL 2ZUSA 4JR9L 3BHBB 4G8FA 3TH3T 3FJTA 2ED8A 4QRPB 2XNAA 4GBXA 3SDDD 1IGML 5EZJA 2GITA 2AV7A 1T3FA 3SKOB 4FRWA 3FO2B 1NGWA 1FORH 5A3IC 4OBSA 3KJ4B 1G7QB 2V5SA 1FLRH 4CGTA 4Q2ZA 3ARDD 2FNBA 3LKSA 5CEYB 4GG6F 1X4YA 4EXKA 4QNPE 5EH1A 4LVOB 4J2XA 2AEWA 3GI9L 4PPTA 4X6CF 2CH8A 2OM5A 4PJCA 3W9DA 5F3BA 3OJ2C 4D9QD 3CLEL 3ABZA 4OZHE 1UJTA 4BFIA 2NY3D 3DXAA 1WISA 5GGSB 4K7PY 2XQYK 2GFBA 4HDIB 1MY5A 1T4KB 4POUB 1NEUA 1QA9A 2VE6B 2AXFA 3SE3C 3VH8G 2HJLA 3TLRA 3SGJA 1IL1A 5K9JH 1MELA 4FFZL 2OBGA 3L95B 3AB0B 2V2TB 4N9GB 1W0WA 2R0ZL 3KPMB 1NSNH 2VISA 5D2LE 3VFVA 1P7HL 5DDHA 4ZYKB 5CCKH 2ZOKB 4G6KH 3CDYA 1RIUL 4HWBL 1F97A 1H9VA 4WVRA 1Z5LB 1S5IL 5C0FA 1T89A 2L7UA 2IAMD 4U1SB 3V4UH 3VH8A 1Z9SA 3R1GH 3QHTC 4U1LA 3KPSE 1MJ7H 2KZ1B 2NY5C 4XVUD 3VD5A 4GRWF 4Y5VA 2Y36H 4S2SB 15C8H 3BWAA 4O02L 3DI3B 2PW1A 5DURB 3MRFB 4NWTL 4PJ5D 4XCCH 3HUJF 4P9HL 1QLEH 3E8UL 3QRFM 5JIKA 3D0VB 3QWOB 3E3QC 5LXGL 4JRYD 1J86A 3VXMD 1JYWA 5F3HA 5EUOB 4LAQL 3NGBC 1X4ZA 3EGSA 3V95A 5FDWA 2DD8H 2FJGA 5F8QC 3ZZ1A 5JO5A 3MR9B 1JPTH 3F7YB 3KJ6L 4PJGF 5FV2A 5BRZA 4PTUA 1J1XL 5I71C 3M45A 3O3AB 2YPVL 4XPTH 3LS4H 1MI5E 4ONFL 5D93B 1IM3B 5D7KE 3QEHA 1LEKA 2IEPA 4F3FA 2EDNA 5E8EA 4Z7UB 5JW3L 1AHWB 4NHUA 3QG6A 3K8KA 4J3TA 4XBPB 1JPFB 4Y2DA 4Y4FD 4XWGH 5C0BB 2BSSB 4KROC 3MRJB 3PDOA 5C0AD 5F6IB 4G43B 5EU6D 3C8KA 5D96C 2G5RA 3L3OB 2E7BA 3QUXC 4KTDL 4X7SH 4Y4HD 4HUVB 2X1XR 4GMTH 3NA9L 1FE8H 4U7KA 3ARPA 5D4QA 2BVPA 3KPRA 3FONA 4OTXH 5E6YA 4ONHB 1E27B 2ESVD 4NQSA 5C08E 1GVIA 2NXZC 3QEQB 5CCKL 1TTFA 1JGVL 3MGTB 5I1AB 3V52L 4BKLA 4HS3A 5HHNA 3QUZB 4X7EC 1LD9B 3GM0A 2HAZA 1EERB 1U6AH 4Z7QF 4LLUA 4JPIB 1IJ9A 1ZHBA 2XXMB 4FXLA 5HHPA 3RZWA 4AEEA 4PRHB 3U4BH 2B8OT 3C5JB 2ZG2A 4X99B 2GW5A 4DUWA 3PXHA 3QBTB 4ZSOA 2BOCB 1OY3B 2A73B 2IBZX 4H88L 2X4UB 4NQDB 3C09B 3KYOB 1WF5A 3ILQC 3FT4B 1I9RL 3LV3A 3ARGC 4WO4C 1IFHH 4JO2H 2ZOLA 3P30L 3QXUA 5SWZB 3PP3H 3OAYK 2R1YB 2A9MH 3TJEH 1JZ7A 4QT5B 4LGPB 2ILLA 2IMMA 3HMXA 2OSLA 2Z35B 5ESQB 1ZVSB 3BZDA 3P9MB 5IMOA 4YDLB 3QR2A 4PLNC 2BVUA 1HINL 3BHBA 4G8FB 5F7DA 5F9JA 3F6LA 2NTSP 4X5WB 1RZJH 4CUCA 4WJ5A 2R4SL 2H26B 4RQQB 4D0DA 1KTDA 4MAYB 3U0WL 3FO2A 4XTRC 4DZBA 5I18H 3U1SH 5CGYC 5FGCB 3I02B 4QTHA 5FM5M 3INUH 3PWLB 1KLUB 3KXFA 4AEIH 1GGIL 3VXMA 5HI4D 3BW9A 4MJIB 4LAJH 3UDWA 2W9EL 5HDBF 2R15A 1MFDH 4CDGC 2BSTA 4NNYA 4EZMA 4K7PH 4HW6A 4JHBA 2DQFA 2XQBH 5BV7L 4KK9C 3Q6GL 1AKJD 3GJEA 2MFNA 4U1KB 4KVCL 3PDDA 2V5RA 4Q9BA 5L6YL 1I7RB 1X5AA 3VXRB 2XNAB 1DVFB 2WBJA 3VD9A 1OW0A 4L8DB 1YJDL 3S3SA 3OTTA 3QDHA 2H2SD 4LLYB 1JRHH 3EO9L 4PRPE 4KKNA 5TDPB 2YD6A 1CE1L 4JJ5B 1T20B 4GAJL 3AU1B 4HSQA 3OAYH 3ARFB 3RPKA 1QFOA 1N5YH 3VD3A 3AREA 1UYWL 4MD0B 3T1WA 3ARYA 4C59B 3O3EB 3CAFA 4L9LB 4PREA 4OZFG 1K8IA 3F12A 4HZLA 3E6FA 4OFIA 2XWTB 1JF6A 3C5SB 1WCBB 3C60A 3REWA 1NFIA 5C9KA 3ROOA 5C0RH 1N5AB 1NPUA 3VCLA 5FDWB 2FL5A 4NQVA 2F54B 2WBWB 2I07B 4Y89A 5AWNL 4MNQE 2PYED 5FHBH 1RZIA 4PR5A 1FNSL 4CU6A 3U30B 4XX1E 5DLML 1WIUA 4RFOH 1KN4H 2PYFA 5FK9A 2MOVA 3U0PB 3IU3A 3IS0X 3RGVD 4BZYA 2YKLL 2ESVE 2WZPD 1YN7B 2NX5D 4DTGL 1EXUB 3PUCA 3K3QA 1X5GA 3NIDE 4I1NB 4J3XA 1NCUA 5JA8B 3OB0H 2BSSA 3ZE1F 1QACA 3QIBC 2FX9H 3G5XA 4B7LA 4KGLA 5CEZE 3BYYA 3S34L 5C09D 1HHKB 2W0LA 4NKMA 5DDHB 2VZTA 1TLKA 4WTZA 1D5XA 2YOCA 4FNLH 4OFDA 4NO5B 1F11A 3DO7B 3OG4B 4MS8D 4WTWA 4PRIB 3RZCB 3OL2A 4PTUB 1IGIL 1CK0L 1IC7H 4ZS7H 1NUGA 3RWJA 1RVFL 5D7KD 3BH9B 4BSVA 3FB8A 2AK4E 2OYPA 1MCJA 4G8IA 1CE1H 5E8EB 3MLRH 5CP7A 4BZ2L 1QFHA 1ZHBB 6FABH 2X1PA 5D8JH 1KLGB 2DLHA 4QXTB 5GJTL 4XP9H 3SQOH 3KLHD 4HH9B 4L29A 4HWEL 1R6VA 1CICB 1AO7A 4AMKH 2DM3A 3G04B 5ENWB 3QEQD 4WFHD 3BVNB 1NEZA 4X7DC 3N1GC 1ROWA 2D7MA 2GYSA 5DRWB 1XIWA 4PJEB 3SGDH 4AL8H 2KQMA 5I1KL 1C7SA 4FQCH 4UINH 4F3FB 2CKNA 1JN6B 1GC1C 1NCNA 3LN5A 3ZHLA 1J0ZA 3LEVL 3MGTA 4Y2DB 4NKOB 5FYJH 3QA3B 4V1DA 5HGBA 1CXEA 2H26A 4JFHE 5EULV 2EXWC 1NCWH 5KSUA 5HHPB 1QQDA 1T1WB 3FQRA 4Y4KD 4XPHL 3V0VB 4OZGA 3D3VB 2E9BA 1J05B 2ATPA 1UXWB 4C56D 1KLUA 1AY1H 1BQLH 1IBGH 2R2EB 1VGEH 1YMMA 1F3DJ 3PNWA 1FCCA 3BKJH 2HJKB 1KC5L 4P5KA 3VGDA 1BLNA 2DIAA 2R2HB 3WXWH 5HI3D 1OW0C 1IGIH 2PO6A 4FQHA 4NJAH 1CYGA 3HHRB 1T0NB 1ODAA 1RY7B 1HH6B 4HLJA 4LVNB 1KG0B 5JMOC 5MEQB 2J6EA 4UQ2A 5H8DA 1IGCH 3HMWL 3HS0B 1SYVA 3OXSA 4WW1B 4AY0A 2HLFD 1A7PH 4LCWA 3GSNL 4CW1B 3U36B 3LH2L 3ARTA 4DZBB 3FFDB 3VDBA 1BQHG 2VLKD 4HFUH 1F6AB 1D6VL 4QHUA 5CIPA 1HKFA 4HK0A 3NPSC 1AXSB 3RP1A 1U8MB 3P9MA 1AI1L 2YSSB 1XR9A 4RDQG 4DCQA 5B8CA 2IADB 1MFNA 1MVUB 4GMSL 4WWKA 2FDBP 1DUYA 3ZSTA 3FQUB 3FRPG 4PJHF 1PKQE 4ZD3H 4OIIL 1W72H 4M1DH 3NCMA 3BRGC 3GI8L 2P5EE 3GO1L 4M7KH 3OPZL 4X6DB 1HNGA 4DFIA 3VXPA 4OCYL 1YNLH 2XPGB 5GGTH 4PLJD 4YFDB 3TN0B 3UO1L 3NH7H 1OAZH 1CXFA 1YMME 1N59B 5HGDA 4F7MB 4PJDA 5CS7A 3B83A 1IAIH 1LEIB 3AC0A 2DQJL 1IGTA 1RMFL 4JJ5A 1L9NA 2SEBA 1T20A 1ZLVH 4K71B 5ISZE 1JFQL 4ZUWB 2NLJA 3HG1A 5B39A 1XCQA 5EIQA 4BH8B 3AS0A 3QPQC 3TN0C 4OI8A 1XH3B 3BDBA 2Y4SA 4RMRA 4J7RA 4RGOL 1B2WH 4I3SH 3B9AA 3CFEB 5I17A 4JZNA 5C9JA 4CVUA 1U8QA 5ADOL 3HI6L 3S4SB 1I3RA 3M8OL 2A38A 3QUMA 4WI5A 4RBPK 4IDJH 4MA7H 5DF0A 4LK4A 2FL5B 3M07A 4ODSL 5GQBA 1T2XA 4PJBE 4O2FA 4WWKD 5FECA 1T21B 3BD4A 4OLWH 3MJ9H 3TA3A 2UVEA 3ULUL 1JK8B 2CIIA 4OT1L 1MIML 4O58L 4P3WA 2Q7YA 3CFBA 3N50A 3SKUD 1XGPA 3PHSA 3U9UA 4OF0A 3L5WA 4YDIH 4DN3L 5L2JB 1JZ3A 1G9MH 1FJ1B 1A1MB 3IDXH 4LCWD 1INQA 1WQVT 2QQNL 2A0LC 1TJIL 3SE9H 3D85A 4OSUH 3WO4C 4PP1C 1C1EL 3OPZH 3KPQA 5FAAA 5J8OA 4WWID 1AQKH 3OKMA 5E2VL 4C4KO 1FDLH 3F58L 1T1XB 1YNLL 4PGBB 4NZUH 3KVQA 1S7SB 2X4SA 3RWJB 3QO0A 1AHWC 4ETQB 3JUYA 2NW3A 5L0QC 4K3EH 2DWEB 4P59L 4F9PA 5DGQA 2DQCL 5I15L 5TE4H 1CI5A 4LLAA 1NUFA 5CSZB 1N6QL 3RGHA 4LF3B 5CP7B 3N1MC 4F8QA 4H0HB 3H9YA 3U46B 3ZLQC 2QKIA 3QUKB 4LSTL 3H9SA 3O2DH 4HULB 1NSNL 2BNRE 4M93C 3D3VA 4MA1C 1PX4A 1OTSD 4YX2L 1BAFH 5ISZB 1TNNA 3DVIA 1AR2A 3TYGH 1AO7B 4PRIA 2ZCKL 2IPTH 5E4EC 3W0WD 3M8OH 4PJBA 2O5ZL 1I7UB 1IM9B 4HIEA 4WRLA 3S35H 1HDMB 1YPZE 4KWUA 1OM3L 2EDFA 4U3XA 4WCYL 1MRCH 3H3PH 4NZTL 3O41B 1KB9K 1DN0A 1KFAH 4G6JL 5DRNB 1KCUH 2H8PB 3OXRB 4L4JA 5HHQA 1CGYA 1TDQA 2FD6L 4NCC2 1A6AA 1A6ZA 1JZ8A 4BK4A 3UPRB 4X80L 4Z7WB 3WLWC 3MRQB 4LSQL 4YDIL 4DN3H 3SQBA 3DX9A 3KNBA 2BCKB 1J05A 3IDXL 1U3ZA 3MOBH 3R0MA 4CN4A 3QDGA 5MP6L 3IJYA 4S0SD 1MQKH 1CTOA 2F5BH 4PV8B 5FCUH 3LAFA 3MRNB 4JQXC 5E7FA 3SE4A 1V7NL 1T1YA 4Q6YA 4MJID 2X70B 3F58H 1E28A 4M8QA 1BLNB 1D5ZA 4HIHA 5CSGA 1KCVH 4M3KB 4DUVA 1J7VR 2GSIA 4OCXH 1YY9D 4ERSL 4ORGB 1IQDA 4P2OC 5AZ2L 1QSVA 3HCVA 4HMCA 2NPLX 3CVHA 1P7QD 4HG4J 5LAXA 5JOEA 2EDKA 1GOHA 1BD2A 1NFDB 3L7FB 1KCKA 5C07B 4OZGB 3LPGA 4S1DC 2DIJA 5I1DB 5H35A 4OZGE 4NM8H 5D1XC 5IMMA 4HGWA 3P73B 4EQ3A 4OTXL 3GMRA 1P84K 5C0DB 2VZSA 3KPTA 2DAVA 1FORL 2YWYA 3BKML 4XXCA 4MHHI 3OG6B 3QWRD 4WUUD 1G9MC 5E9DA 5KW9H 1X9QA 4XRCB 5EA0L 2E9JA 3IDIA 5FKPA 3U4AA 4DKFL 3WKML 3PWVB 5J4MA 3BD5A 5GGTA 5T1MB 1IGYB 4G7YH 4YO0B 1UQSB 5DJ8A 1GXEA 3U36A 4JCLA 4XXCC 1NGWB 4X6FA 1WBZB 4WGVB 4MNGA 3QUMB 3WN5C 1DQDL 1I8LA 1L7TH 2XIDA 3KS0J 3I3DA 1W72A 5KVGH 1TJGL 4HUMB 2XPGA 1NUDA 3GSOA 4LSQH 1UB5B 1ZT1A 5B22A 4G6AD 8CGTA 3MV11 4XC1L 2IAMA 1C16A 1D7FA 2VQTA 1I4FB 5J9PA 1UCBH 5EFIA 4EUPH 3VE0B 2EDTA 1WAAF 3QRGL 2XFXA 2UZYB 2BNRD 3EJYC 4OV6F 4WU7A 4DVRH 5CIPH 3VXME 1EHNA 2PYEA 4TNVK 4CADA 2VJXA 3EJZD 1LO0H 2OXGA 5IK3A 1UM4L 3NFSL 4P2RA 3TV3L 4PJAB 4PUBL 4ERSH 4NBYB 1OSPH 2C3HA 5HYSG 2VL5B 3QCTH 2W0PA 4Z76B 3MRDB 4HAFA 4P9HH 3TT3L 1YY8A 3DXAD 2JB5L 1A14H 2Q87A 3GSNB 2XTJE 4I0KA 3IRZA 1IGTB 3VU2A 4NM8L 4GQPH 1FIGH 1OGAE 3FL7A 5E8NB 4PRNA 5DVMA 4XHJC 1MFEH 5FXCH 4F7TB 3IAQA 2MWCA 4JVPA 1T2QL 3LKQB 4P23B 1J1XH 2BDNH 1FG2A 3L3DA 3BKMH 1CD8A 1OPGL 4NQCE 1N64H 3PHQA 3IXTA 4JY5H 2ADIB 4DUXA 1N0XH 5C0AA 4QEGA 5IB4A 3GSUA 1RULL 3ZE2F 2UZIL 4JRWA 1UJ3B 4GRLB 4EIZC 4JZOB 4F15B 5I1IH 1C12B 1N7MH 4G7YL 4S1QL 3MREB 2ZSVA 1BQUA 1H3PL 5DUML 1DR9A 1EAPA 1KEMH 1RJYB 5CZXD 5I0DA 2EH7L 4CMMA 5ILTL 3KWWB 4P4KA 1JK8A 3NMEA 5E8PA 1MJ8H 1ORQA 1FLTX 2P5WE 5I1CH 2BNUA 4RGNE 4OF5A 1FVDB 1MPAH 4HIIB 2OQJB 4QY8B 1EGJA 4JO3H 4HJGA 1V7ML 5JA9A 3U6RB 4WEUD 3RWGA 7FABL 1J9CT 4I0PA 2F54D 5CJBA 3HG1E 4ZFOB 3SGKA 2CGRH 3LOWA 5I8CA 1CFNA 3B8SA 4L8SA 3VFTA 1NCCH 4K71C 3SKNA 4JFPA 5IFJA 1OVZA 1J0JA 3QJHA 1DEEB 4UV7L 3TBYB 5AWNH 4DGIL 1RIVH 3ESUF 1U91A 1FL3B 1OGAA 5E2TH 3U0TA 5DA4A 1LK2B 5LGKA 1J8HB 3SCMA 2NY2D 4OD1H 4KRMB 3QEQA 4B7IA 2JB5H 3OJMB 4P0DA 4GW1A 5T1KD 5IJVA 1YNKL 1EMTH 3VMNA 4NYLA 2BXYA 3VWKB 2EDHA 2APTA 3ULSA 1Z9MA 1FVEB 3L1OL 4OGYL 3U46A 2JCCE 5DZNA 3KS0H 1OAYL 3FN0H 4PRBB 2BDNL 1OPGH 2BNRA 5A2KH 4X6DE 4MHHG 4FNLL 3MR9A 4JPVL 4PJAE 4K07A 3O3UN 1HINH 4QRRD 1S3KH 1DSFL 1RZKC 1IM9A 4ZG1A 4ZPTA 3VXTB 4U3HA 2CO6B 3QQNA 2WNGA 2XA8L 1PY9A 2GUOA 3HPLA 1DUZA 1C5DB 5FHAH 2C3XA 3GNMH 1HYSD 2ENSA 5ITFA 1TITA 4G6FB 3INUL 4FQPA 2Q6WA 4LQ1A 6CGTA 3OKNB 1BBJA 4XWOD 1D5ZB 4HIHB 1J0IA 1ZWIA 4F33B 1CICD 3QEUB 4JG0L 3QI9A 1R3JA 5HHOE 4QXWA 4L1HA 1EHLH 3AXLB 4RISH 4AMKL 3QZWG 1GIGL 3WKNA 4O51A 1GGUA 3LDBC 5DD0H 1I85C 4TUOA 3KXFB 1CD0A 5AYUH 2OP4H 3TNMA 1FZOB 3S3PA 1F02I 4L4VA 4HKZB 2ICEB 4LKXB 3VFGL 3CFCL 3QNXB 4OD1L 3CMOH 1MUJA 4IBLT 4C56E 5CEXA 2ADFL 1BD2B 1AIFB 5H2BB 4K2UL 3T4YB 3T4AB 3LEYL 1NJ9A 1B3JA 1DVFA 4XPHH 4NQDD 1CIUA 3IDJB 1M4KA 1ZT7A 2P5ED 4GXVH 2XN9E 4QRPD 5GHWH 4GXUN 2JTDA 3JSSA 2A6JA 5TDPA 3BKJL 3T0AA 3ZE0F 4HLZH 3V7AE 1DSFH 3GMOB 2V6HA 3QQ3A 3PQYE 3CFDB 1BHGA 2Y06L 3DX6B 2IBZY 3WEXB 2ID5A 1B0RB 5J9PB 2ORBL 5GS2H 1OTSC 4KKBD 4YHIA 4JG1H 1G0XA 4KKCC 4S10A 3M17B 3T0ED 2VLKE 5DLMH 5JQ6L 5C0BE 4PTTB 3MLYL 4XP5H 3BAEH 1IZKA 2HFEA 3GSNH 2YA1A 1MCCA 2I5YL 4L8SC 4ZQKB 4AM0A 2BY2A 4PD4J 3MLUL 4X6CA 5FA3A 1Z0NA 1S78C 1CFTB 3BPLB 3MODL 4MJIA 2A6KB 2VDLL 3NIFF 4ODVL 2VQUA 3VFNB 5GSVB 3WFZA 2C3VA 4HMEA 4PGDA 5E03A 3W0WB 2AK4B 2O61A 3CDGA 3HMXH 1AC6A 4NSKA 4GMSH 1IGJB 3NZHH 1ITCA 3TZVA 5DWUL 1MCNA 1MCKA 1A7RH 1ETZB 4Y16C 1L7IL 5BRZE 4S1RL 1NBYA 4WI2A 4JFFD 2WBJB 1NKRA 5DFWH 5CKGA 4GRLD 4Z7UF 1CFNB 5JPNB 3QDJD 4OCYH 4R0LC 1NDGB 4FXKA 5IFJB 2CRYA 4BZ1L 4PGJA 4G5ZH 3WO3B 3WJJA 4LBEA 5L7XL 3VFRB 1C12A 1F3JB 1OAKH 4F7PB 2D0GA 1EEZA 1PZ5B 1QFUL 3C5ZC 3SCMB 4DAGL 4FMFA 5DURD 5GJTH 4ODWA 1JGDB 4P4KB 1LHZA 5GHWL 5T5NF 4ACPA 1KJ3H 3NN8A 4HFWB 4QHLA 1YEFL 3ULUD 2LU7A 2EYTA 1XF2B 4IRZH 2NR6D 4AL8L 5HYJD 5HPOA 3B2VH 1CE6A 4JRXE 5FUCC 1M6OA 3HE7D 5EU5A 2F54E 5C0CD 3CSPA 1B2WL 3C5SA 5DZLA 2A6DA 2GAZB 1TMCB 3QH3A 1VKXB 1D9KB 2VH5H 4XHQA 2CKBL 4YHLL 5KVFL 5EO1A 2DI9A 4AENA 2ZUVA 2J4WL 1HSBA 4XVTL 3SDYL 2EYSB 3BAEL 3QJHB 4XPFL 2ZKHL 2YMXH 1U2HA 1II4E 5CLWA 5LG1A 3RWDA 4JHWL 5E8PB 1U91B 4M6AA 1FAIH 4Y5XA 3PJSB 1GPOH 3QHFL 4OT1H 1KXQE 3NA4A 4ORZC 2OLDA 2XZQL 3O11B 4F15C 1DVFC 1RK0A 4YZFE 2W65B 4PRPD 5LGHL 5FUZH 1H3GA 2I9TA 1IBGL 1VGEL 4JDZB 1BIHA 4MCYB 2HMID 5TE6H 4Z7WF 1IAIM 2FJFA 4G6AC 1J1OH 3S5LB 3TP4A 3RAJH 3VFTB 3O4OB 4LDOB 1GCFA 3JV6B 5J11C 1CFQA 1QO3B 4F8TA 4ELKB 1MOEA 4L3CB 1I9JL 4NRZA 1HXYB 3MNWA 2OTWA 5T1DL 4P3DA 5JOPD 5DHVH 4FFWD 2IPKB 3T77A 4LEXL 5F9WC 1EUTA 3TPUA 3V5KB 4UAOB 4YHYC 3TO2A 3NZ8B 1H3VA 1XF4A 1FC2D 4K3EL 4P59H 5LQBH 2YRZA 5E99H 4PD4K 4ZO9A 2QQLL 5B3JE 4IMLA 1ZXQA 4JFED 1H3WM 2HKFH 2JKXA 2QADC 4MGXA 4YK4C 1YEJH 5GISL 3IDJA 1DL7H 1JV5B 4PJHA 2P46B 1TZIA 5DUBB 2Y5TB 4F80A 3C9NA 1CL7I 3MROB 2AGJH 3QYCA 5D2NA 2FLBT 1NBVH 1NDMA 5FYKH 1ZTXL 1QSFD 1QBAA 4K8RC 3QUYC 1G6RA 3S35L 1FLRL 3MV9B 3B2UC 4OBRA 4X9GA 3SDYH 3TWCH 4CJ1A 5BXFB 3HC0A 5DO2C 4JM4L 5IVXB 4IHOB 4ZNCD 4G42A 5TDOA 3QHZL 1FZOA 4LPYA 3E3QE 4GT7A 5E95B 2ICEA 5SWZE 5CD3B 4EVNA 4R26L 1MUJB 1L6ZA 3JZ7A 5FM4A 2ATKA 3D5OF 5DJ6A 1IAIL 2G5BB 1T3FB 2CLVA 3TCLA 5EORH 4D94A 4YWGH 3KLHC 3H9SD 5K9JL 4FFZH 1KNOA 4GRWE 3T4AA 4F7EA 4JY4B 4LLMA 2EC9U 5CEYA 4UV4L 5EBGA 5FA3B 2EKSA 1JWMA 4O2EB 1UA6L 1T66C 2X4QB 3JWDC 5ELIA 4HD9A 1I9JH 1N2RA 2C4FT 2R2HA 2QQKL 1LO2H 3SBWA 1KB5L 4NDMB 3WLBB 1A1NA 5F6IC 2WIMA 1T0NA 3F7RA 2BVOB 1B0WA 2HG5B 4EUPB 4ODSH 1A02N 4LLWB 4LVEA 5MEQA 4XCEB 3VGEA 4NFBA 3Q3GB 4NT6B 4OLWL 4X9FA 3HA0A 4CU7A 1WJ3A 2CJUL 5TGBB 4IRJB 4N0YH 5LXGH 2VISB 4PTTA 5BOZG 4U1IB 5EU3B 3E2HC 5TF1L 1G7QA 1I75A 1SJHA 4K7FB 3VFRA 3GMLB 5C8JB 2XWJA 1YEKH 4QCIA 4LSDA 2AGJL 3BJLA 2NY7L 3BWAB 3VXSE 3ULVF 2BSRA 4XCYA 1VA9A 4CAGA 2AJSL 3TWCL 3AROA 3GSWA 2NY1C 4XPGH 5GGRB 4Y4KA 1FDLL 2PTUA 2FR4A 4YDVA 3OX8A 5DJDA 2VITA 3C6LA 1V5JA 4OJFH 1SJEB 4I3RL 3FB5B 1AQDB 4JQXA 5T1LB 1WZLA 3SE4C 5I15H 5DJYA 4P4KD 1T0MB 5HVWA 1MIEL 1A22B 3K8LA 4FG6D 4GMTL 2GQHA 5FO8B 3WDIA 1EEZB 1RUAL 3ECBA 1TZGH 4OFPA 2MTPA 5E56A 1U8PB 3GM8A 4U1LB 5E5RB 3V0WH 2Y72A 1KJVA 2MKWA 3CK0L 4LHUB 3I6LE 4HFWA 5FUCE 2FIKA 2ZCKH 5I75C 3VXQB 1VADA 5CSZA 4GKNA 3WDHA 2DLEA 5IW6A 1LO0L 4G43A 4BH7A 4WENB 5K93A 1IAOA 2YK1H 5D7IF 3FHQA 4IOSD 4JQVC 4YFEA 3QH3B 5CUSL 1CLCA 5C0AE 1WEJL 3O3DA 4KI5C 4E9LA 4PV9B 3MNWB 1DQLH 1WGOA 5HGHB 3BDXA 4NRXB 5ESAA 1GJIA 3NFNB 3KPOB 1YEGH 4R6UA 1RZJC 3OF6D 4NZRH 2CSPA 4LEOB 4JO1H 2B5IC 5DC0A 1QBBA 1OAUH 4GS7C 3WDJA 1XF4B 3MO1B 4JJHA 1JJUA 1FNGA 1W2KT 3QWOA 4OGZA 4WGWB 1F4AA 3MMEA 1GC1H 3MUY1 3H3BC 1AGDB 1N0XL 1FJ1A 3DV4B 1A6AB 1A6ZB 2F5BL 2KZWA 3EGSB 4YQXL 5CZVL 2XRAL 1LNUA 2MCG1 2P5WA 3VGGA 3KPPA 3L3GA 1BZ7A 4I0PC 2UV3A 5JHDE 3KLSA 4JRXD 4LP5A 4S1QH 5I18L 3HZMA 4EBQL 5GIRB 3IRPX 2MCPH 3NCBB 3RL1B 1U8JB 1XCTA 2X05A 3ZMRA 3G08B 1E4XL 4M4RA 5F88A 1LO4H 2AV1B 3I85A 3GBNH 3BRFA 5C0BA 4CVZB 1RUAH 1TZGL 5ITBL 4EVNB 1HQRA 3B9VA 1E6OL 3UC0L 2W59A 4LASH 1KBGH 4J3SA 5K9QG 4Z78A 3RX5A 4XP6H 1E4XI 2N4IA 5T5FH 2CGRL 1H3TA 1PYWA 4J1UB 1A4KB 3AREC 5JW5B 3PWLA 4KTYA 4GAYA 3BT2H 2BOBA 4PJHB 4I18A 4XNMB 1N3NA 2ZPKL 4KUCD 5BW7C 4QRTB 3D9AH 4W4OA 3ULVL 1TQCC 2AJUL 3R0NA 2HFFB 2YZ1A 1S7VB 1U8IB 4GRLC 1UJ3C 1U58B 1TETH 1UWGH 4KU1A 4OZHA 1DQDH 5SV4A 3O41A 4JPIA 3HC0B 4PS4L 4L5FH 4PY8J 1CLYH 2WWMD 4NN6B 3G6AA 4OUUB 1U0QA 1XF3A 3RHWF 3U83A 1DE4A 5EOCH 5GGSY 4ELMA 4MAYD 1MCLA 3PWVA 2ZCLL 1KTDB 4MAYA 3FOLA 3QXTA 4Q9CA 3ZYIA 4PGEA 1F4YL 3P3YA 1AKJA 4K9EH 1GGYA 4NBZB 2OTUB 3NPZB 2I24N 3QDMD 4WFEE 5SWSB 4OAWB 5E6ZA 4PJ7F 3DUUA 3RZCD 4M00A 3VXMB 2EKSB 1ZT1B 5M94B 1KELL 3PGCB 2NXYC 2OSLB 4LCCB 5E1AA 4EDXA 1KYOJ 1JTOA 1ZT4B 4DKDC 2BSTB 4O4YH 1FNAA 3PGFH 5D72L 2XFXB 5ICZA 2V17H 3ARWA 4OUOA 1EEYB 3QIWD 2DQFB 2ATKB 4MSWB 4YE4L 3A6CL 4UBDD 3I9GH 8FABB 2YKLH 2X44D 1ZGLP 3FAXA 1FIGL 5EN2B 3K81A 1OP5K 5IFAL 5ITBH 1FGNH 1NAKL 4NO0A 4OCLC 3VWJA 4P2RB 4NQDE 5HHXH 3EHBD 1EJOL 5J6HA 4M1CD 2L4OA 1P1ZB 5DFTA 4N5UA 4EI5B 5KG9A 4Q6IA 1SEBB 3CSGA 3S88H 1N2RB 3DMMB 2OP4L 5FO8A 5AG8A 4LVHB 5JIPA 5I30L 3X14B 5BZWB 2APFA 1QTYT 3IDYB 2X10A 3WIHA 3EFDH 2Z4QA 3NFPB 5E5MA 4HX1A 2BVOA 5LCVH 2PXYD 4TULH 3SCMC 5C08B 2VDOL 3OKDB 2GK2A 4EI5D 4P2OD 5F9DC 2HRLA 3SE3A 5ILTH 1T04B 3UBXA 1HSAA 3PABB 5KSVB 3DARA 4NZDA 2VITB 4U1IA 2Q76A 3PHOB 5E6IC 4YDKL 2HJFA 5EBWA 6FABL 1RHHA 4PJ9C 4RGNC 4GXVL 1ZGLB 3EYUL 4JO3L 2ZCLH 2EDBA 1W8NA 3QDGE 2PKDA 1YEHH 4G8GE 4HIXL 2BZDA 3WXVH 3LD8C 2F53B 3FO1B 1VDGA 1DBBL 4QCIB 1H15A 1HZHL 3KWWA 1MH5A 4MD0A 3L5JA 4YZFF 5F89B 1SMAA 1H3UA 1G7PA 1BFVH 1A6VH 4WFHE 5I1KH 4KAQL 4J3OC 4JG1L 5DEFB 4HIIA 3K0WA 2XZCH 2XWTA 4JKKA 4OZHF 4Y4HA 5DMIL 3OX8B 4I18C 4PIRF 4UQ3A 5D5MB 2E6PA 1G9NL 3C8HA 1YN6B 3QUYD 1XFPA 2IANA 3IVKA 4WW2A 4N0UB 2BK8A 1JBJA 3BP5B 3LVEA 5FYJL 4L8SB 1IAOB 3SKNB 1BZ7B 5T1LA 5FDYA 4D0CB 1HHKA 3CXHJ 3DSNA 1WVZA 3TBYA 3QI9C 4MX7A 5I1JH 1T22B 5D6DC 3VFUB 5L88H 3KLAA 5J12C 5A2LH 2C1PA 3WSQH 3LN5B 1U8PA 2RB8A 1QLRA 1QD0A 1AXTL 3F7VA 4MB3A 5B4MD 5I30H 4ETYA 1R0AL 2BHYA 2R23B 2OL3L 5GZNC 4XCNB 1S7WB 4Z18A 3BQUB 5FHAL 3WNLA 5J13B 1LWRA 3IYLW 4M02A 3RVXC 3T0BA 4KDTC 4L8BB 5D2LB 1FVCA 5B8CC 1ERNA 2BNRB 3J8F7 3PQYB 4RAVB 4X6BA 3QPQD 1AFVL 1Y0LA 5C1MB 2P7TA 1JTTA 5CSBA 4UIMB 3WUWG 2DM4A 3I84A 1BF8A 4G8GB 3C6SA 4C58B 4U6YA 1HNFA 1C5DA 1IGFH 3MLSH 3EYSL 4M93B 1D6VH 2P5WD 4GKSB 2L7JA 4OZHB 2CUIA 5IMKA 4KH2A 4L4VE 3TFKC 4FQXB 1T03H 2NCMA 3U6RA 5ERWA 2VXUL 5ESVA 3MA7B 3GKWL 1X5ZA 3H7BB 2VRAA 1AGFA 4H1LA 4L29B 5J0BA 4LCWB 4GKZB 4MWFA 1JWUB 3P77A 3BKCL 1G6RL 1IE5A 4ALAL 4P2OA 2F58H 5KTEH 1YA5A 3IAPA 4ZUVA 2FECI 3ZTNL 2XI9A 2YMXL 2D4DA 1NLBH 2RJMA 3GK8L 2BHUA 1RZGA 1I3VA 1VFOA 4BK5A 4X9HA 2HJKA 3NH7L 3RJDA 4DCQB 4OGXH 1BFSA 1KUMA 5F96H 4HKZA 4KZEL 3O6MH 1ZV5A 1M05B 5EU6B 3TNNB 3FQUA 4NQXB 2D9CA 2NY5H 3FB7A 1QFWL 1IC4L 2DTSA 4TSBH 3U7AA 1KN2L 1AIFA 1R0AH 2OL3H 5B3JF 4NJ9H 4JFDB 4Y4FA 3SDCA 5GRVK 1FO0A 3DVFA 4MD4A 4OB5H 5JDJA 3A6BL 1MRDH 4RGOH 2HKHL 3TJHC 4OD2A 1YC7A 4EKXA 1F58L 1VGKA 4HS6A 2EE3A 3VJ6B 1NGQL 3FT3B 2UUDK 2HH0L 2NY2C 4RDQF 1UADC 1VPOL 4L8CB 3DX6A 2NLJB 3RA7L 5E5MB 2X89D 3MLUH 2V5TA 1XGTB 3TBVB 4F33A 3VRIA 3MACH 1EEYA 5HGAA 1OF2A 2E6QA 2K1MA 1UM5H 1CLOH 1AD0B 4UB0H 3WCYA 3S4SA 2WLYA 3MLVL 3GKWH 4FOMA 3MJ9A 4YDLC 1OWRM 4TUOB 4RRPA 5ACLA 3NZHL 3BIAX 1TJIH 2FATL 3SE9L 4ZDHB 3T65B 4ALAH 4U1HA 4MXQC 2PTTA 2OZ4L 4WW2C 2AK4A 3GK8H 4L4TD 1WTGT 2GFBB 4HDIA 5F93C 4QXGH 4LSSL 5HYJE 4BQ6A 4RX4A 3TIEA 2DQCH 3MV8D 5EU6E 4DKEL 1ZHKB 3T0EB 2K9UA 5BVPL 4R96B 2WM0A 1YY9C 3QXVA 2IGFH 4NUGL 1YEFH 5DSCB 1UEMA 4KKLC 1ZEAL 1UA6H 4OB5L 1QHOA 4OI7A 4PGBA 4TTDC 1VFUA 3P11H 1H15B 1U3HB 2HFGH 5D1XD 1YZZA 3WEXA 4U6TA 4UOW1 1MCWW 2VH5L 5CLTA 4YHLH 2AQ2A 3OAZK 5B39B 3WJLA 1NGXB 3NN8B 3CH8A 3THMH 3OKDA 4N1HB 2J4WH 4LSRH 2NY6D 1ONQB 5CGMA 3HN3A 5EO9A 2EDLA 3UX9B 3VDCA 1FAIL 1T5XB 2Q76B 3D39A 3RTQC 2CJUH 2HJFB 3EUUA 4Y5YC 1I8KB 4QOKA 4UILL 4X5XA 4PJ5E 5D93C 3MCG1 1J1PH 2XTJB 5SX4H 4G8GA 5TE6L 1QP1A 1YC8A 5DEGB 1UZ8B 3BMVA 4HBQA 3RAJL 5C3TA 3LRSA 3ARZA 5HHMB 3SDXF 4JFQB 5MP6H 2C1PB 3C60D 5A2FA 3DPBA 3GJFH 3JWNC 2VDMH 1V7NH 4KKCD 2MQ0A 2CO7B 3DURA 1KT2B 1Y18A 4F37F 4LSUH 1I1AD 1ZVHA 4MDIA 3ARBA 4TSCL 4X8JA 2VXQH 5GSRB 1F42A 2XG5A 3MLZL 3DLQR 3KPQB 4GUPB 4UT6L 5ALBL 5F72S 5IGXH 1CN4A 5KSBE 1K4DB 2H1PH 5ID0B 3BQUC 5J13C 3QIWB 5E99L 4NUJB 4X6BB 2YZ8A 1T22A 5HYFA 1LEGA 4P48A 1UC6A 2QR0B 4XP4H 1OCWH 1NAML 3W81A 5HHME 5E9DE 1LP9A 3DTXA 5CJXC 3VMPA 4XGZA 4QGTA 2XT1B 2XN9D 4TPRH 4UT9H 3IGAB 4QHLB 3QNZA 2A2QT 1Z9OA 1CLZL 1D6EB 3RVTD 1MEXL 1UFUA 3BN9C 5E00B 1EA9C 2OMBA 4FA8A 4GJTB 2X7LB 3HLAA 3QFJB 5IBTH 5HY9B 3TF7C 1LO5A 4NWUH 2A6DB 5GGQH 3H7BA 5HBBA 1MCOL 5ACZB 1S5HB 1BWWA 3MNZB 3CXDL 3WFBH 2APWA 4U49A 4DQOH 4P2QA 2IWGA 1X5JA 1JV5A 1C08A 2XQYG 4RWHA 1EAJA 3C5ZA 1BVKA 1OOAA 4EEEA 4P2OB 1R3LA 5DI8B 3QDGB 4ZNEE 4NZRL 1TJGH 4YWGL 3UYOD 3WNMA 1FO0H 2ESVB 4JHZA 5TQ0L 5IFHL 3WHE1 4NPYA 2DLTA 4ZO7A 1RZ8B 3UCRA 5DTFA 2I9TB 4UV4H 5ESVB 1VB9A 2VB5A 4X5WA 4TUJA 3KDMB 1GSMA 4TTGA 5JLZB 3UYPA 4YQXH 2VAAB 3T0EE 3TCLB 5HVGB 1OGTB 2W91A 3JWOC 2NTFB 4PRDA 1QZ1A 4R4FH 3ZDZE 5HDBE 4JY4A 3H6JA 4LLMB 1UM4H 5IVXF 4Q0XL 5HYJB 3DGGA 4JGJA 1ZE3C 1E4KC 1X44A 1W0VB 3B9EA 4GAGL 3MRPB 4DEPC 1G7JA 4HWNA 3QFDB 1JL8A 4MJ5B 4J8RA 4XP4L 2WBKA 5B3NA 1NAMH 5FOJA 1T6WA 4L8CA 3BEVA 1I9IH 2HTLD 3UC0H 2VDKH 4C56A 4RGMC 3G6JF 4Y88A 4LASL 4U7MA 3CU1A 4KV5E 1JPST 1YUHA 5E4EB 4I9WD 3MOAL 2FIRT 1I7RA 3L5XL 4D0BA 5IHZA 3DVGA 1MEXH 4MA1B 5IMMB 3D69A 4B0MM 1N64L 3FT4A 2VWEE 4XPBL 1JZ6A 3STLA 3CSYA 1A6TB 1MQ8A 1G6RB 2VLME 4HKXA 2Q8BL 4OZ4B 3BXNB 1H3PH 1PY4A 4ZS6D 4DW2L 2A83B 5E70A 1QSFB 3RX7A 4LLDB 1MRFH 5ISZD 4ODHH 4HPYL 3W11D 3RTQB 2NXYB 4KHTL 1MJ8L 2G9HA 5DMGD 1MIEH 5T1MA 1K8IB 5DJ8B 1IAKA 2APBA 1SYSA 1AP2B 1FZMB 2HWZH 3S97C 2CLRB 1Z3GL 4K9EL 1I8KA 4XWOC 1P53A 3TA3C 2P8MB 3N1PC 1PG7H 5A43C 2PR4L 3QIUA 5JXEA 5BVJB 3VWKC 3MUJA 2NY3B 3QULB 4MXVE 4YEEA 5E8DL 3BEWA 3MRMB 2QV2A 5DC4B 3RU8H 1T0PB 5CILH 1BJ8A 4J6RH 2GHWB 2ZCHH 3HTLX 5EBMA 1RZKH 3TH4T 1PSKL 1SJVA 2OQJA 2X4TB 3GMQA 2C3WA 3LQMA 3O3BA 1OAXH 2E27L 3A6CH 1IEAA 1O7SA 5I8OH 4MQSB 1SBBA 2J5LB 1DBKH 1NAKH 3FFCD 3T04D 2AI0H 4TVSa 5HHXL 5BOPA 1WITA 2IH3A 4Z7VF 3L9RA 1WFOA 4JZOA 3O3DB 1FL3A 1MWAB 4PRHE 3UROR 1MLCA 1QG3A 5I2IA 3EO1A 3ZDXE 3F5WB 1QEWA 4F7TA 4LEOA 1MCQA 1I1CA 4XGZB 1KPRA 5CP3H 3GNML 5JHDD 2CLZA 5K9OB 2OR9L 4HUKB 1NC4D 1KGCD 1QLFB 4LMQI 1GGBL 3TJHD 1A0QL 5JXEC 4HZLB 5DQDL 5SX5H 3BGMB 1N4XL 1DQQB 3EYFB 1DFBH 2ADGA 4OGAD 3V4PH 4N0FB 3KG5A 3QZWB 4HWBA 2EDDA 1VFAA 5E94B 1AQDA 4JN2A 3C2AH 5DEZA 4HIXH 1YEHL 1LP9F 4QWWC 1ACYH 4HPOH 1IT9L 2JB6B 4FMKA 4V2CB 4X4YB 1G6VK 1ZS8A 2DQHH 2F15A 4PB0H 3KPNA 1YN7A 2ESVA 3GI9H 5HVHB 3WNNA 1NH6A 3V5HA 4O5LH 3OKNA 1S7XA 1EZVX 5FM5O 2ZPKH 5DYOB 1VADB 2BERA 5MEOB 4O9HL 1OSZA 4PJXE 4QRUB 1PSKH 5JIHA 3G6DL 1M7XA 3HC4L 4ODUA 3MFFB 4PJFE 4R90L 4N0UE 2D4FA 4OQ1A 5IT2H 2ADFH 3OV6A 2Q8AL 2IH1B 5C3LD 2R0ZH 4QRSA 4FTVD 3LEYH 1N3NB 5I71B 3VRLE 1F8TL 4IM8A 3EDEA 1JF1B 2EDQA 2YR3A 4JM2D 1RAMA 4PFEA 1AXTH 1IKNA 2VLRD 1KOAA 3BKYL 3C5ZD 3MV7D 4R7DB 5F1IA 1HKLH 2QSQA 3IU4L 2YWZA 2FYYA 4LMQE 1FC1A 5GRJH 3HS0A 3OMZA 3L3IB 1NJ9B 4P2QB 4D3CH 3H9ZA 4PG2C 2DQDL 4FQIL 4WHCA 2OR8A 1JYXA 2R9HC 3TC9A 4RWYH 5CJQH 1AFVH 1K4CA 2VUYA 1OGTA 2IQ9H 3N1QC 1Q38A 4P57A 1BM3L 4TRPL 5D7IB 3TZVC 4POZC 3UEZA 4YE4H 4M5YH 2I5YH 1UXSB 3GHEL 4PJGE 3ULVD 1IAMA 3O8XB 5IEKA 1U8MA 4DFHA 4EI6A 3IF1A 4ODTL 2BRQA 3G6JA 5EOTA 3TH2T 3MODH 2AV1A 1NCAL 3LS4L 5J3HD 4QHMA 2FX7L 2R69L 4BSJA 3NIFE 3QEUA 5A2JH 3TBTA 1JTPA 1J0YA 5JORB 3MLWL 2ITCA 4C56B 1QQDB 4CKVX 3AXLA 3O9WC 3MYJB 5EN2A 4NN5B 3QUXA 2EO9A 4O51B 3VWJB 1BIIA 4OM0L 3BKCH 3HNTL 3TVMA 1NAMA 4ZXBA 1H0DB 1NLBL 4PJEE 3IAGC 3K46A 1SEBA 1G7JB 2CQVA 3KXFE 3MRMA 1LEIA 2K7QA 5T33H 4G5ZL 2O5XL 1V05A 4BFIB 4GRWB 1PVHA 4MA8L 4YDKH 4JFFB 5FA4B 4KGJA 4RIRA 4KZEH 5HHOB 1QRKA 4QRRA 3IJHA 1XCQB 4BH8A 5L8JB 3X13B 2YA2A 5T3ZH 1BFOB 1U6AL 1KIUA 4CVXA 3BKYH 5MEPB 3W39A 4M43L 4M48L 2DMBA 3IU4H 1I3RB 4I2XA 4K94H 4PJGA 1N6VA 1HHGA 1MCRA 1ND0B 3VFWA 4Q97A 4WUUE 5DMIH 3ZKMC 4ZFGH 5DHXB 5F9AC 4BYHA 4XB8A 1MHEA 5JIIA 3G6JE 2OK0H 3REVB 1VPOH 5ICZB 3GGWB 4D9RE 4EJ1C 2FEEL 2AV7B 2ICWI 5DR5L 3VFPA 4P5TB 1NCAH 3U30C 1FH5H 3QCVH 4GRMB 3AY4C 4CN1A 4KKAD 3MRBA 3ULUE 1UM5L 4YH6A 2O26U 2ZZUT 5KS9A 3P40A 4HH8A 3BP5A 5EO1B 1B88A 1HSBB 2J8HA 3GSQB 4YGVA 3HZVB 2FRGP 4PJIB 4DGVL 1MF2H 1XF5B 2C3VB 3HNTH 3BZ4A 4I48A 4W4NA 3VFUA 4HWZA 4MJ6A 4C57C 1PZ5A 4Y5YB 4U1SA 5D5MF 1J8HD 2APXA 1CDYA 1HYRC 2GSGB 5JHLH 3HG1B 5T33L 3MV8B 2R23A 3PDOB 5D1QA 3NABL 5DD6A 2QKIB 3L3OA 2QSTA 4HF5H 4JZJB 4PG2A 1U3HC 4L8BA 4GQ9L 4KMQA 4RAVA 5AG9A 1YEJL 1XGUA 5M95B 5L2KE 4BJLA 3G5YA 2R29H 3EO9H 4Y8AA 3O3AA 3KYNA 3RWDB 3MBEC 4U4BA 4CU8A 4JQIL 3V5DA 4AG4H 1EX0A 1O7VA 3DUHA 1C7TA 4QYOA 4JZJC 5FF6A 1LE5A 2DYPB 1F90L 5DEFA 4DVBA 3VI3E 3EO0B 3V5HB 3ZT6A 3O2VL 4P3CH 3JV0A 3MJ6A 3UPRA 4ZSOB 1YNTB 4A6YH 5D7SH 4UNTA 1P2CB 2BY0A 1D9KC 2E7MA 2RHEA 1BD2D 1KGCE 1FH5L 3MFFA 3QCVL 4PJBF 4UOJA 3X3GL 2EYSA 2VLMD 4CL7A 2CKBA 4XPAL 1QFWH 3MXVL 3UAJD 1CU4H 1ZS8B 2X4SB 4LSVL 1QPXA 2A1WL 3QO0B 3K1DA 5IVXA 2W65A 3WYRA 4GG8B 3IFOB 2AP2A 1E28B 4P4KC 3NACL 5E2WH 4DJMA 32C2B 4ZUSB 1G7LB 1ZLVK 3OKEA 2QQKH 2YD2A 5D1ZD 5JR1L 3UPAA 5MEOA 1P6AB 2FBOJ 4HBCL 4CNIA 4XP1L 3FB7B 1NGQH 3HE7B 2JLLA 4JFFE 2D03L 2V2WB 2V2XA 4AQOA 5BCAA 5MENA 5HYIA 1ZHLB 1D5BA 2UYLA 4R0LB 2PCPA 3CVIL 1FQ9C 1YEEL 3ZYZA 4WI3A 5IGXL 5D70L 2NY2B 1TZIB 3P0YH 1RJCA 1JWMB 1XGQB 3PWPD 4HJ0C 5F9OH 5IB5B 5D7IA 1RZFL 2CDFA 4U6YB 3TVMD 1UXSA 4ZUUA 4QKXB 3BDYL 25C8L 2R29L 4KI5D 1CK0H 1IC7L 1VERA 5ESQA 1YEKL 5IBLD 4K9EC 4PJCE 4PLKD 4BQCA 5DO2D 3VFMA 3DROB 3HZYB 2NXZB 1JWSB 4JQIH 2BOCA 3VFSA 1BFOA 5DJ2B 4BZ2H 2R0KL 1IGYA 4YO0A 4IRJA 3CXDH 1W8OA 1HH9A 3QUXB 4P3CL 1CCZA 4P57B 4PJGB 4XP9L 3SQOL 4FZ8L 4LDEB 3SKMA 2NXZD 3GSOB 5HPMA 3GMLA 1RIHL 4OQTL 4PG9B 3LPWA 1MCSA 3O4LA 4DKEH 4DWHA 3REVA 4QHMB 5BVPH 3STZB 3F7QA 4OQTA 3WHXB 1NFDE 5GS0D 3K7UA 4LSVH 2IGFL