1OP3H

Crystal structure of fab 2g12 bound to man1->2man
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
publication title Antibody domain exchange is an immunological solution to carbohydrate cluster recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 224
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2003-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op3H01
4P4KC 3VXUB 5CINH 2F53D 3RJQB 2NY4D 4KKCC 5JW3H 4UAOB 1PKQA 2OXGA 2QEJA 3O2DH 5C0AB 1FYTB 3AAZA 2F54E 3TA3D 5IW3A 2YD9A 4G8FA 4LEXH 3VH8B 1T21A 5F6HI 2VXVH 3QUZA 3WEXB 1IE5A 4UILH 2YEZB 3LRSB 4KJYA 2FO1A 2CXKA 5I6XB 4XBPB 3NTCH 1FNSL 1TZGL 1IKNC 4HMEA 3WXVH 2XTJB 4EVNB 2QBWA 1JZ6A 2MHAA 4GLRI 2ERJB 1TJHH 3Q6FA 4XNMA 5T1DL 1C12A 5C1MB 1WCBB 4WVRA 5I1GH 4H25B 3R8BB 5IF0A 4LU5L 5D1ZB 2YD1A 4FFVC 4EXKA 3GMQA 1T7VA 2DLTA 4J3OC 2VLJB 1LK2B 2XZCL 5KVEL 4JZJB 1MCFA 2IG2L 2FX7H 4NQEA 3ARZA 3T2NH 4JRXA 5FHBL 3EO9L 5DSCA 3QRFM 1QSFD 4P9HH 4M3JA 4PRIB 4JDTH 5FYKE 3UTSA 1U2HA 2BCKA 2R2HB 3HKFA 2X7LB 3QIWC 4LLWA 3VFNB 1S3KL 4UB0L 1U8IB 4HUMB 4JFED 4H1LG 3MFFA 4OZFH 2HJFA 2QQLL 4MAYA 4XPAL 1S7RA 3CFIC 4HCRL 4HWBL 1KCRL 1AD0B 2EH8H 3X3FL 2ZG1A 2C3WA 1Q9LB 4QY8B 5ID1A 5JXEA 3EFFB 2VB5A 1J0HA 5D71L 3PJSB 5TGBA 4Q6IB 1MLCA 4HX1A 3J7HA 1E4XL 1QOKA 5DFVC 3SDXA 4GRWB 3B6SA 5E5RB 3T4YA 4MD0A 1LEGA 1OTSC 2VC2H 2X70B 2OL3H 3ZE2F 5C0EA 4OCRH 2F5AH 3UO1L 4HS3B 4XC3L 5C2UB 1AC6A 5DJXA 3ULUC 3RHWK 1RZ8B 3HHRB 4ZOCA 3BRGC 3RX7A 3B9VA 1CFQB 2BSSB 3LQZA 2VUOA 5HDQL 2VZ3A 2R1WB 3HN3A 4LP4A 1A6TA 3KHQA 4FP8H 3O3BB 5F1NA 1MFCL 4QF1A 3VXSB 3BAEL 4HCRA 4WW1B 5HPMB 1DTUA 2O26U 4KK9D 4L4JA 4MMZC 4X99A 1FDLH 2VR9A 4QHKI 2ZUUA 5T3ZH 5BOPA 4WJ5A 1MCEA 4WWKB 3O3AB 1YN7A 3UPRB 3M17B 3UTZA 1C16A 5DT1H 4XP5H 3P0VL 4M4RA 2WLYA 4GG8B 3TO2B 1FAIL 1KF9B 4MAUH 2CSPA 4WI6A 5CBAA 3SEPA 4CVXA 3MLYL 4JFQB 1IAKB 3MTRA 3O6LL 4QRSB 3SGJC 5DJ6A 4MQSB 1FIGL 4PLJD 1UKQA 3KYMB 5TF1H 3NFSH 3Q5OA 4JKKA 2J88L 1SEQH 3NZ8B 1UXSB 1B88A 1OAKH 4X9HA 5J8OA 5EUOB 5GS0D 3GSVA 1XGTA 5JMRA 4LCIL 2YXFA 3K1DA 3NIFF 2C9AA 3UC0L 1T6VN 1UWXK 1IGFL 3SE3C 1OQOA 3DVNB 1T04A 5T3XH 1QFWI 3C6LB 1KB5L 5I15L 1W0VA 4HS6B 1GGYA 5F7EH 1MHCA 2IC2A 4J23A 3UTQB 5B39G 5HHQA 2BJML 5D1XA 3SO5A 4XPTH 1NMCC 4XI5C 3IFPA 3P4MA 1ACYH 2HFFB 3HNVH 1BFOA 1KJMB 1TJIL 2XZAL 1G7MB 1LO2H 2B1AH 1FRGL 5I1EH 2B1HL 3KLSA 4Q0XH 5I73B 3CGTA 2WIIB 5IVXA 4Q97A 1UA6L 2X9WA 3QUYC 3U6RA 3FT2B 4M7LT 3B9KA 5C0ND 2I07B 4XCEB 4O58H 1AE6H 1MHPL 4LSRL 4XTRC 1EAPA 3BN3B 3GHEH 1JPFB 1RURL 4NQDA 1SQ2N 3GRWH 3TZVB 4FFZH 4P46B 3MMEB 2AXFA 3WYRA 3ZKMD 4R96A 2NQCA 5HI3C 3PE9A 4JFZL 1YPZE 1K8IB 3MYZA 1FZKB 5BS0B 1X6NA 3GMLB 1YNKL 4PFEA 1MCRA 4Y88A 4GS7C 3CK0L 4M9OA 1BEYL 3I2CH 1MWAA 4LSVL 1IT9L 4GQ9L 4WI2A 3R4DA 2P5EB 4ZUTB 1GGCL 4N0CD 3QEUB 1QRNA 1U58A 5ITFA 3OMZA 2OJZL 3IETA 4DUWA 2X89D 1KCUL 4KKBD 1G0YR 3LN4A 5B22A 1EMTH 3QXDB 2KUTA 4HULB 4P4KA 4G80B 4BFBD 2FGWH 1WFTA 3L7FA 2FIKA 3MV9E 1HH6B 1T22B 5DD5L 3I75B 3H7LA 3QRGL 4HMDA 5I2IB 4YHKL 4O2CA 1FCCA 2BP3A 5K9OB 2CLZB 2ZG2A 3VFWB 1FNSH 1G7IA 1TZGH 5JW4N 1NC4A 4UNVA 1YMME 1H3PL 3WHXA 5MEPA 3FT3A 1P4BL 2X4UA 3PDGA 3QWOA 4OD1L 3RY4A 1IKNA 4OD2A 1VSCA 4F15B 4JREB 2I24N 1FSKC 5T1DH 5EZJB 4BH8B 5DO2C 2OJEA 5AZEL 3HR6A 5DMKB 4OLUL 3FQWA 4M48L 3EDEA 2VLMD 2FLBT 5E9DE 2I9LB 5IEHB 1CXKA 3RJDA 5D72L 5FYJE 5AG9A 2AJSL 3CFDA 4FQCL 3TM6A 4N0FB 5KVEH 2XZCH 3C60B 4GO6B 5DEFB 4WEBL 3GSWB 3PNWB 5FHBH 3EO9H 4ZSOE 5C08A 4L8SB 5FO9A 3WDJA 5JW5B 4EI5B 1S3KH 1HKLL 5TDPB 4UB0H 4WV1A 4HMCA 1FVEB 3H9SA 2P24A 2EXWC 3QIWA 1BP3B 3V2AR 2QQLH 4XPAH 2RFXB 2IALA 4RAHA 2YD8A 4HCRH 4HWBH 4U1GB 4HGWB 1DUYA 3VXPA 4D9RE 1KCRH 4LCUA 4BFIB 1LGVA 5MENE 5E70A 1UJ3B 5CZXC 3ZO0A 3SE9L 1INQB 1I8LC 1NGPL 3IJHB 3MREB 5LXGL 5E8OA 2X4TA 2JJWA 3O8XC 4WUKL 3ROOB 1E4XH 4PJEF 3TCLA 3UP1A 1JJUA 1QZ1A 4XPGL 3S4SA 4IRJC 1A4JB 5A16A 2NXZD 1NBVL 3WN5A 1BZ7B 3UO1H 4Y0GA 2X6MA 3Q3GA 2YKLL 4D9QD 1NCTA 1UH4A 1QO3A 4ZFZB 4DKAA 2PW2A 4G6JL 2CDFA 4Y5VC 4Q7DA 5D5MB 1KSRA 2R2EA 5HDQH 4QHMA 2J4WL 4LHUB 1MFCH 3BAEH 4MZ2A 1P1ZA 2WQ8A 1HXMB 3M8OL 4P2RA 3K80A 3HE7C 4KK5C 1HQRB 4KRNA 1N2RA 1K8DA 4FXKB 2Q6WB 3WD5L 4KROC 1ZXQA 4RDQF 4PP2A 2VQTA 2X1OA 2BRRL 2QV2A 2LQRA 4MX7B 2Z8WC 4JRXE 2ICES 5E08L 4ETYA 2VISB 3UTSE 3AGVA 1PFCA 2W65A 3DECA 3EUUA 4KK6C 3P0VH 1MUJB 1MVFA 5C0BB 1FAIH 1KCKA 1BOGA 2IPUK 2NPLX 3MLYH 2FZ3A 3O6LH 2C1PB 2Z93B 1CFSB 1FIGH 3DYPA 4XXCC 4ZUWA 1UJTA 4M1CC 1MCOL 3SGEH 3SGJA 2J88H 3FONA 4Z78B 1EFXA 4G8IB 1DBAL 5IW1B 3U83A 5F7YC 1QVOB 4P5TB 2HKHL 4LCIH 1AXIB 2ATPB 4W6WB 3UC0H 3GMPA 3SDXE 2HH0L 5JW4Q 1IGFH 5SV4A 2OZ4L 2VXUL 4MJIA 2DWEA 1KB5H 2BC4B 5I15H 2X4SB 3VD4A 1MCSA 4TPRL 4HIHB 5FGCB 1U3YA 3SE3A 3D1MC 3QUKA 1I1RA 1P4IL 2IH1A 3RTQB 5DMGD 1TCRB 3LCYA 2CKBB 3O4LB 4LLUB 2BJMH 4DVRH 4XHJC 4XP9L 1T03L 5DLML 1GC1H 3TVMC 4BQ8A 4GW1B 2NR6C 3WO3B 4QRPA 4U31A 1TJIH 4Z7UF 2XZAH 5CWSA 1SM3L 1FRGH 4OLXL 5I75B 2B1HH 2JJUA 2PTVA 1I85C 1LVEA 1A9EA 1UA6H 2Z92B 3TNMB 1NEUA 1MHPH 4LSRH 3KPRD 5IVNA 1KLFA 3QUYA 2EDJA 4NNPL 1ZKAA 5FOBB 4BYHA 1RURH 1SJEB 3BIKA 4GMSL 4NWTL 5LWYL 4L1HA 4HKZA 3S97C 4GFTB 5DJYA 4I0CC 5I9QC 1YQVL 3QEQD 1ZHNB 1VFBA 2W60A 1BVLB 4JFZH 3BP6B 2DYPA 3DXAA 3W0WB 5J89A 1F5WA 1YNKH 4PY7B 4OFPA 4J7RA 3CK0H 15C8L 4NP4L 2PTUA 2B0SL 2P8MA 2YD2A 4LSVH 4CGTA 3G6JB 1IT9H 4GQ9H 2PCPA 4LLDB 1M7XA 2NY3D 5SV3A 2N1KA 1GGCH 3VFUB 2OJZH 4J4PC 1CE6A 3IJYA 5MHSE 1KCUH 4G6ML 4K3GA 3L3HB 2IADB 3G5XA 2NY1B 3WFHB 5ADPH 1CVRA 5LGKA 1KPVB 3GK8L 3H2WA 3N0PB 5I74B 3VRIA 5DD5H 2VN4A 1QLFB 4OKVA 3QRGH 4HBQA 4Y16C 1UADC 1D5XB 1GIGL 3QFJB 4ZO6A 1MIEL 5ID0A 1KIQA 4P5MA 1OB1B 1QYGL 3WLBB 1H3PH 1FFNA 1JNHB 1P4BH 3MCKA 2VZSA 4OD1H 5T1LA 3P0YL 1CFTB 1N59A 3RVTD 1KFAL 5A2KH 4M02A 2D4DA 5C6PB 1F45A 5AZEH 5IVXE 3TT3L 4Z7OF 4OLUH 3ZKXC 4M48H 3IDYC 4PJBB 4AZ8A 2KZWA 4P2YA 1A6AB 1SMOA 5FGRA 5D72H 3J8F7 4GKSA 4FQCH 3EHBD 4Y7MA 4NDMB 5ACMA 5HI4D 3W39B 3QNZB 2P43B 3CFKA 2IAMB 3BUYB 4WEBH 3PQYB 1T0NB 1BVKA 1Y0LA 2XZQL 1YNTA 3VFMA 5I1DA 4YHPB 4L29A 2ADGB 4Y4FC 4OLEA 1U8NB 4PG9B 4LIQE 1RK0B 2Q1EA 5HYEA 1HKLH 4UI2A 4S10A 3ES6A 1X5IA 4AL8L 4U6HB 3QULA 2KQNA 2C4FU 1ZWIB 3GJFA 2GCYA 3D3VA 4HS8L 5DR5L 1VHPA 3MLSL 2BNRB 1ZT7A 1ED3A 2AQ1A 4FTVD 2WBJB 4X5XB 3T1FA 2HA1A 3WS6C 3SE9H 1NGPH 4M8VA 4TNVF 4E42A 5LXGH 2EXYD 4MHHI 3DYMA 5IV2A 4DEPB 1R24B 1WZKA 1MREH 4NOFA 4XPGH 3BVNB 3O8XA 1F90L 4Y1AA 1OW0C 3TBVA 3RX5A 5IGXL 3OGCA 4NBZB 3PL6C 1BBDL 1NBVH 4L4VD 5J11C 1JPSL 3MR9A 3QR2A 4IRJA 3T0EB 2YKLH 4Y19A 1Q0XL 5F7NC 4G6JH 3KPTA 2PYEA 1I9RL 5A43C 3IDGB 1ZV5A 5AYUL 3U79A 4GG6B 1FG2B 2HLAA 4F7TB 2J4WH 4Y5VA 1I1AC 5CJQH 1ZHBA 1OD9A 3CSGA 3DO7A 3M8OH 5C07B 4NKMA 1A7QL 2F8OA 1TZHB 3WD5H 4R0LB 2ZOKB 4HUXB 1KN4L 2BRRH 1MEXL 5JPNB 3UYPA 5E08H 1T3FB 3C5ZB 1M71B 5C08E 3C87A 1M7DB 2AJZA 3QDAA 5BZWA 1S7TB 1FZJA 2AK4D 4ENED 5BZDA 1PJ9A 4BSVB 5FHAL 3FAWA 3VH8G 3H9HA 4MNQA 3MRDB 1EDQA 1M6OB 1VERA 5DYOA 4QCIB 3EJJX 4XXCA 1EEYB 4X6FB 1DBAH 3STBA 4AQ1B 3ZT6A 5E24E 5F9OL 5B3JF 4ZUSA 4KRPB 1MI5A 4PV8A 2HKHH 3LN9A 3CZFB 1E4WL 3Q2CA 3RVUC 2HH0H 5HHVL 4ODXB 2X4PA 4P2OC 3CPLB 4M03A 5ESAA 1IC1A 1BD2B 2OZ4H 2VXUH 2MQCA 4ZOAA 2D4FA 1ZVSB 3R06B 3UYOD 4TPRH 4HUNB 8CGTA 1LD9A 1P4IH 2GJZB 4ZXBD 1IL1A 1M4KA 2AJ3A 4XP9H 1T03H 4PJ7E 5DLMH 2DQEH 3D39A 2PW1A 4RZCB 5I0ZA 1B0RB 3HI5L 3PWVB 3ULUE 4PJ8D 1U8PB 1SM3H 3QA3A 4KKAC 3L5XL 3QDJA 3TVMA 4OLXH 3VJ6B 3HZMB 3DTXB 4TRPL 43CAB 3D48R 3CAFA 1ND0B 1P6FA 5HYSB 1SVZA 5EOCH 1T66D 4N1EA 4PGJA 3DETC 3NH7L 4PJGB 2NXYC 1A2YB 4M61A 3KPPB 2R56H 4L4TE 4NNPH 4JFFD 4ETQB 4LPWA 1NGWA 4XWOD 3RWDA 2A9NL 4GMSH 4NWTH 5LWYH 1IFHL 5I19L 4AIZB 3VRLE 4F9PA 2Y72A 3N1QC 1YQVH 1KACB 1T7YA 3MXWL 3BIBX 2L7JA 2IMMA 1JMXA 1Q9WA 1KULA 3LRGA 2ED7A 2GFBA 15C8H 4NP4H 1WWBX 5JNYB 2B0SH 1AD9B 3TN0C 3L5IA 2GK0B 4PJXB 3SKNB 2NY4C 4G6MH 5IHZB 1CT8B 5I30L 2VLRA 2XG4A 4J4PA 2C26A 5IJVA 1AJ7L 3GK8H 5IBTL 4K7FB 4I18B 1S7WB 1XCTA 5DJZA 3L6FA 4MJIE 2BHYA 5ENWA 3IDIA 3JWNC 3DHJA 1HQ4B 3LKSA 4OZFB 5K9QI 3DRQB 4XRCB 1QFOA 4RWYL 1GIGH 3UJJH 1MIEH 4DJMA 1D5BB 3UZVB 4PJAA 5DURD 2Y25A 1QYGH 3ZT7A 3MCLL 5DD1L 4WHCA 2Z31D 4UT7L 3NCBB 1W0WA 1U8HA 3BWAB 2ZUWA 3DSNA 3O4OB 3P0YH 5JTWA 1NFKA 1KFAH 1N3NB 1H8OA 5F7FA 5J56B 3FQUA 4WUUB 4IRZL 3W81A 3MOAL 4U1IB 1JGUL 3HTLX 1OT1A 3REWB 2FR4B 3TT3H 4OF0A 3MLTA 3JWDC 4J1UB 3CC5A 2ZUSA 1FPTL 3CXDL 3IS1X 3OKDA 4Z7QE 2OL3B 2BVEA 4U1SB 4JANB 2VITA 1XR8A 2HFGL 5J1AA 5FDWB 4HJGB 4WU5B 2E7CA 2XN9A 3U46A 4L8DB 5JIKA 5HI5C 1WQVT 1YEJL 1G1YA 2XZQH 3GSQB 3OB0K 3DXAE 1VKXA 3ECBA 4Z18A 4TYUA 4UOW1 5F7DA 2Q76A 2FECI 1KXVC 1ZLVH 2V2XA 4KGLA 3D69A 4Y4FA 1Q38A 4AL8H 4NZTL 1HNFA 2OTUB 4HS8H 4NRYB 5DR5H 2CXGA 5DRZB 1L6ZA 3BPOB 4Y8DC 3ARBB 3T08A 3FRUA 5ANMA 3HZVB 3L3GB 4U1NA 4NKOA 3LKOB 4V2CB 3VWJC 1N8ZA 2HJKB 3NGBC 4I2XA 4OLWL 2V17L 3GJEB 1A6ZA 5KVDL 4YIQB 3CMOL 5CJ5A 3KWWA 3RWFB 3D0VB 4NO0B 2DTMH 5EIVA 1MJJA 2X4QA 1F90H 3BMVA 1FORL 3VXRA 5IGXH 5E8NA 1BBDH 5FV1L 2NX5A 1CK0L 1OSZA 3ARGB 1I1FB 4H26A 5KW9L 2BXZA 4HK0A 3PL6A 1Q0XH 5IMMA 2BK8A 2YK1L 2D03L 3VDBA 1I9RH 1GPOL 2H26A 5AYUH 3X3GL 4O2EA 1BLNA 1OGTA 2GK2A 4YAQA 2R39A 2QTEA 2NY6B 1K5NA 4EN3A 4DKFL 2CUIA 1JV5A 1V3MA 4R2GD 1A7QH 4A2MA 5CEZE 1I1AA 1XH3A 1G0DA 1QEWA 1MCIA 3ARRA 4NSKB 2IGFL 1KN4H 4YXHL 1MEXH 3VMOA 4OUOA 5L8KB 1S7VA 2WIMA 3JV4B 3DV4B 5IQ7L 1QSEB 1AIFB 4JPIB 3I3DA 2FBJL 1MH5A 4G42A 1SYVA 3JV6B 4QRQA 1PKQB 4KMQA 4NO2A 3SE4A 1NGXA 3C8KA 1TVBA 3AAZB 4F2MA 5FHAH 4G8FB 1T21B 1CGSL 4PV9A 2FSEA 2X42A 5HYJE 2J8UA 4KJYB 1EEUA 2FEEL 3BSZL 3MRFB 5GS0C 4G3YL 3NFNB 5DRXA 5F9OH 4NQVA 4XXDB 3WV0A 1E4WH 3LV3A 5HHVH 3MV8E 2WBWB 1MFNA 3ZHKA 3Q6FB 4Y1AE 2X1PA 4XNMB 4P2OA 3DX7B 5IF0B 5FUOL 2CR6A 1YECH 5J1TC 3WL9B 3QIUD 3GMQB 2WSKA 3W9EA 1U8LA 4JM2D 1BZQK 4G9FD 2X40A 3HI5H 3O2VL 5D7KE 5SWSA 4NQEB 1ZHLB 2J5LB 3QNXA 3L5XH 2ED9A 1BPVA 3T77A 5IMLA 1CN4A 5JPMA 4TRPH 1JK8A 4OF5A 4DVBA 4IDLA 4EKXA 4LLWB 2Z9TA 1HINL 1X5ZA 2LABA 3RWHA 3MV11 4E41B 1JZ3A 3NH7H 4YHNB 3WHE1 4OAWB 2HJFB 2BY1A 4MAYB 4MA1B 4MNHB 3UEZA 2A9NH 5FO7B 4RMTA 1IFHH 1U91A 4Z6AT 1AR2A 2YC1B 3IFOB 4KAQL 3ZKMC 3PIQB 4JDZB 3MXWH 1HWGB 4TVPE 2P5ED 3NZHL 2B20A 5TGBB 4RGNC 3BPLC 2A6KB 5B4MC 4N0CC 4QHUA 5DD6B 1UYWL 3RWIA 3B6SB 4GXUN 1EX0A 3PP3H 3T4YB 1LEGB 5I71B 2A0LC 1N0XL 4KKBC 4QOKB 3TN0A 5IMKB 3SDXF 2Y5TA 4FQ2L 4TUJB 1MI5E 5DGRA 5I30H 5HHOD 3RNKA 2UYLA 1AGDA 4G8GA 1AJ7H 3FQXB 5IBTH 5FYLL 4FG6D 1B4JH 1EBPA 1SYSA 3L3JA 2ZCKL 3BXNA 3LQZB 2ENYA 5KANG 3TA3A 1A6TB 4GRLB 5HJ3B 3QSKB 4RWYH 1AGCA 4QF1B 4Q9RL 1SJVA 1YEGL 3ALPA 3MBXL 3MCLH 5DD1H 3SJVD 3KLAB 4UT7H 3MRBB 3D39E 3OR6A 3QXWA 5TE4L 1HI6B 3NPSC 1FL5A 4WJ5B 1A5FH 2XXCB 3MOAH 1JGUH 12E8L 1YN7B 4U2ZA 1PW3A 1N6UA 1FL6A 1FNEA 5FA3A 1C16B 2FEDD 4C55A 4MVBD 3RL1B 3ULVE 2R1XB 4N9GB 5DA0B 8FABA 1FPTH 3NCEB 2XKSA 5FF6A 3CXDH 3W5NA 1FFPB 1LHZA 5TDOA 4NRXB 3H42L 3MJ9L 2HFGH 3MRLA 5CBAB 3AU1A 1AKJD 1U93B 4DK6A 1VFAA 4WTZA 2HJLB 2VWEC 1YEJH 2DJSA 3WIIH 4M93C 4QRUA 1BQSA 3BD5A 1QSFA 4HKBA 1XGTB 3ARUA 4YHIB 2APBA 4HW6A 3BUTA 4XPFL 1T04B 4JFEA 1RI8A 2VNCA 1L0YA 2GTWA 4G7YL 2YOCA 1CBVL 3RVXD 1W0VB 3VRJB 1U95A 1ODAA 1TIUA 1MHCB 1VGEL 2V17H 5CD5D 4KFZC 2DIJA 3G5YB 1OQXA 5KVDH 4YPGA 5HHQB 3CMOH 3PWLA 2FO4B 3VWJA 3DROB 4ZODA 3QI9D 3IFPB 4JE4B 1FORH 3WXWL 1NCDL 2R23A 5D2LA 1NFDB 4BK5A 1CK0H 5BRZD 4KU1A 5KW9H 4NQCB 2A6JA 2YK1H 1Z6JT 2D03H 2NCMA 5IVXF 4YFLI 1N64L 5EU7C 4RA0C 1GPOH 4X7CC 4I3GA 2M2DA 3X3GH 1M7IB 3JTTB 4NQDB 3MLWL 3HE6B 2VE6B 4MDIA 1KB5B 4DKFH 1J88A 5GS0L 5C71A 5HPOA 2JJSC 1YEKL 5F9WC 5C0JB 1Z3GL 1C5DB 3DGCR 4RAUA 1FVDB 2IGFH 4YXHH 2XN9E 3I6KA 2YD5A 1QRNB 2JK5A 5FKAB 5IQ7H 2EDOA 5D2NC 1D5ZB 2FBJH 3SKOB 1TDQA 2H6PB 1CIDA 4W4OC 3UZQA 4KDWA 4K2UL 2EYSA 2XACC 4PYGA 2DQDH 1J0IA 1MRDL 2XT1B 3L7FB 1WIUA 2CIKA 1ACZA 3GMRA 4N0UA 5ANME 5E6IC 4P9ML 3U36B 4Z7VA 2EKJA 4O2CB 4U3CA 2HVKA 5IB5B 1KLGA 3BSZH 4TOYH 1G7IB 4G3YH 3HZYB 1NC4B 2E27L 5BXFA 1E27A 1T7ZA 5MEPB 3FT3B 4UZGA 2X4UB 1IM9D 3QWOB 4MA7L 2GT9A 3RQ3A 5HY9A 4WTXA 3HR5A 4GBXD 2E8YA 1Q9OA 3O4LD 2VIRA 4M5ZL 5EIIA 2GTZA 2NX5E 5FUOH 5DMGC 1CFVL 4HC1A 3CFDB 1H3VA 1UZ6E 4L1DA 5L8LB 4S2SA 4DUVA 3MUJA 4G8EB 1K6QL 3WLWD 4JPKL 5SWQA 4GAGL 2X1WL 1LP9F 2P44B 5T1KD 4CW1B 1GYAA 1Y6MR 3ETBF 2ZUTA 4MQXD 5D4QA 3O11A 5MI0B 2ICCA 2IH3B 1HINH 1QNZL 5IB1A 4WV1B 1AO7B 1U0QA 3H9SB 5A2FA 3LPFA 3QIWB 3WUWA 2IALB 5H2BA 4IS6B 1TJGL 1DUYB 3W0WD 3VXPB 2NLJA 2D3VA 4KAQH 4LSUL 3L7EB 4O02H 4Y2DD 2DM3A 1KENL 1N5YL 4TUKL 1A22B 3NZHH 4XNYL 4YFDB 2Y6SD 2X4TB 1X7QA 5B38A 5JHDE 4I5BA 2NY3C 4RNRA 1T83C 4DZ8A 1UYWH 3U7WL 1UWEL 3Q48A 1JPGB 2XG5A 4LLAA 4M6AA 2R2CA 1N0XH 5F1OB 1G7PA 4KV5E 1H5BC 3B5GA 4RGOL 4FQ2H 4LLQB 3WN5B 3ARTA 4OF6A 3Q3GB 2X89A 3S8WA 4F37F 1ZA6A 3MRNA 3AS2A 4KWUA 2H2SD 5FYLH 4UIKL 2PW2B 3QFJD 1CICB 5KVGL 1LK3H 2ZCKH 4R97C 1DCLA 3FFDA 4PJ9D 4QHMB 1R0AL 2CPCA 4N68A 1JWMA 4Q9RH 4PJ7F 4P2RB 1CDYA 4K8RD 1GL4B 4U2YA 1NANI 1N2RB 3MBXH 3ULUF 3CDYA 3KDMA 1S7SA 4IMLB 3WIHL 4A6YL 1MRCH 4ODTL 2GEEA 4PP2B 1OCWL 1H3GA 3P4OB 2VLKB 3MGTA 12E8H 2W1NA 3I3BA 4FZEL 5EOTA 3WNNA 5ESQB 5F7UA 5HHPA 1MQKL 4R3SA 1VADA 2W65B 1ORSB 4HWEL 1UH3A 4TQEL 5D7LD 3H42H 2P8LB 1QHOA 3MJ9H 3VRLF 4K3JL 2AV1A 2FZ3B 3E0GA 4XMPL 4C59B 1PY9A 4R4BA 1FGVL 4WCYL 2Y07L 1AGFA 3FONB 3D5OF 4Q58C 5HHMB 2XA3A 4ZDHA 5E7FA 2F19L 2WBJD 1UVQA 3KS0J 3I84A 4A6YA 3WIHA 4XPFH 4G7YH 5IVZA 1CBVH 1QFUL 4NUGL 4DUXA 4XGZB 5M7QA 2BOCA 2IH1B 1VGEH 4G8GE 4TSAH 4LCCC 4KQ3L 3MNWA 3EJYD 5JZ7D 1TTUA 4QRPB 1A9BB 1S7QA 3VGFA 4ELMF 2VKXA 1UWGL 4F8QA 3ZYZA 3WXWH 1BAFL 4NKQB 1WCQA 3TWCL 3ZTNL 3REVA 2DM4A 2BMKA 1VCAA 2VABB 1OP3K 5HYSG 1I8MA 1CU4L 5DQ9A 2DWDA 4HGMA 1CGUA 4O51B 3X11A 1N64H 3S35L 5C07D 3RGVC 1L7IL 3KPLA 3GI8H 3BIKB 4Z7QF 3KR3L 4HKZB 3MLWH 5DJYB 5EBMA 1VFBB 3E6HB 1JTPA 3RWEB 5GS0H 1TFHA 3HAEA 2DYPB 3EYVA 3VFSB 4WW2C 1YEKH 4XWGL 3C5ZD 1S9KC 4BSJA 5ADOL 3JTSA 1Z3GH 3LDBC 2XI9A 2P8MB 3H0TA 3OX8B 2JJSA 1RULL 4K9EC 3BE1L 1LE5A 5ICYA 1F3RB 1B9ZA 4OCXL 2BNQA 4ELKA 3FB8A 5L2JA 1T6WA 2AABL 3E1F1 3MA9L 4ZFOL 5C3TA 2EDTA 4OLVL 4R7NA 3G5XB 4ENEC 4M1GL 1BECA 4K2UH 3GSNL 3HC0A 2YZ8A 3QIBD 1MRDH 4JFEE 2E6JA 2VERN 2YZ1A 1OAQL 4P9MH 1QFWH 3SOBL 3T0BA 2VAAA 1NC2D 2BY0A 2ZUVA 2CRMA 4FQQB 4X5LA 2E27H 3UZEA 3BRDA 5C92A 2YRZA 2EYTA 1FFNB 1F2QA 3MCKB 2DJ4A 3G6DL 3I6GB 1UB6A 5T1LB 2NW3A 4FXGB 1N59B 4MA7H 1R3LB 2DM7A 1KJ2L 1NMBL 1KTDB 1NLDL 1S7UB 1WBXB 1AFVL 4M5ZH 2OQJA 4D3CL 3BQUC 1YN6A 4HHAB 4ZXBC 1CFVH 1CXIA 3FTGB 4ZFOA 2D31B 2XFXA 1OVZA 3O6FD 3MLRL 4WFHE 5F1IA 4YH6A 5HGDB 4LSTL 3BH9B 3TF7C 4PJ8C 3U2SB 1DEEA 4NN5B 3S36L 4KTYA 1K6QH 1WBZB 3GSNA 1ZS8A 4JPKH 4DZBA 4GAGH 2H9GA 4X5WA 1BVKB 1Y0LB 5I1DB 2DQGL 4HPYL 4KC3B 4L29B 1NGQL 4YQXL 1T66C 5HGBA 1QNZH 4UDTA 3ES6B 3V95A 3QULB 4U1JA 4HPOL 3KYNB 3D3VB 3KPRA 5DMIL 2YR3A 5JDJA 5JLZA 4ZTPL 1TJGH 3PDOA 4LSUH 3OKNA 3IXTA 2AEIT 1KENH 1N5YH 2GAZA 3ZDZE 4RGMC 4Z7UB 3L3DB 3B2UD 4XNYH 3QEQA 4E42B 5SX4H 5IV2B 1CGYA 2I25N 3RAJL 4N0UE 3W2DL 3TBSB 3U7WH 1UWEH 3R0NA 3CIQA 2R2BA 3O8XB 7CGTA 2XKUA 2C4XA 1T83A 4RGOH 5IIEB 4OQ1A 4S1DD 2FB4L 1DJSA 3MR9B 3HPJA 3FFCB 2X4RA 1DP0A 2GY7B 3ZYOA 5I6XC 4Y19B 5BW7C 4UIKH 2PYEB 1FAKT 5KVGH 5LKNA 3BKML 1OF2B 3QG6A 4XCFL 5LGHL 2HLAB 1R0AH 2ZZUT 1UM5L 2ERJC 5I66A 4Y5VB 1ZHBB 3JUZA 3DO7B 2MPAL 1J5OL 4PRAA 4Y4KB 2BOBA 5EZLA 5KG9B 4X4XB 1OLZA 4A6YH 5CEYB 3WIHH 1EV2E 3BO8A 1P7KA 4ODTH 1T80A 1A21A 2VDLL 5C6WH 1OCWH 2FRGP 3PWPD 4AH2B 2YWZA 5EC2A 4FZEH 3CD4A 5DZNA 1MQKH 1E0OB 3S98A 3WJJC 4JZJC 4KRMB 4QRRE 4HWEH 4TQEH 1FZJB 1SEBA 4Q2ZA 4PRHA 1JHTA 5DVMA 5BZDB 4K3JH 3INUL 3QB7C 4OB5L 4XMPH 4HH9B 3H9HB 4MNQB 2ZJSL 5DS8B 2PO6B 4NC1E 4ODVL 1FGVH 2QADD 3UTOA 2Y07H 4ZO7A 4PJDF 1CD9B 5CD3A 3KPSB 1C1EL 1RZJC 4LRNL 4ZUSB 3MA7A 4PV8B 2F19H 4ZPTB 3KPOB 4O5LL 3SDAD 1KXTB 5ESAB 1CXHA 5HDLA 5IB4A 1NGZB 2OTPA 4RGNE 4Q6IC 2VO5A 2VUYA 3O6KL 2EE9A 1TQCB 2R15A 1QFUH 4NUGH 4ORGB 3LZFH 1Q0YL 2F5BL 1LD9B 4FTVA 1J12A 3VXTB 2BDNL 1IL1B 2Y5EA 1KC5L 2FWOA 3BMWA 4KQ3H 2GUOA 3IVKA 3W82A 5EOQL 2H2PD 2WANA 4BFEA 4LCCA 3ARGD 3X14B 5I1JH 3QA3B 1UWGH 2LV4A 3QDJB 3TVMB 4HKXA 1BAFH 4P3CH 3OF6D 4YDKL 4YXKL 2R8SL 1HZHL 1CGXA 3HB3D 3TWCH 3ZTNH 2HFEA 1CDGA 1CU4H 4L4VA 1YY8A 4ISVA 2OBGA 2R0LL 2X9XA 4ZQKA 1B6UA 2NY6D 3ULVF 4X9BA 3S35H 1L7IH 1IBGL 4AIOA 2E3VA 4OM0L 5E2WL 4MD4A 1CG9A 5HD8C 1Q9WB 5J0BA 4XWGH 2GFBB 2ICWJ 5ADOH 1BBJA 3NFPA 1J0YA 1QSED 3DX6A 2MKLC 3BE1H 4WW2A 1HHIB 2OR9H 2QLVB 4OCXH 1JF1A 2IPKA 2Z35B 2AABH 3MA9H 3GBML 3RUGB 1WAAE 2GJ6E 2VWEE 1MJUL 4OLVH 2VLRB 5H94A 1UACL 3O45A 4M1GH 4QHNA 4YUEL 2EICA 5GXBB 5FM5O 3GSNH 2D7QA 3L6FB 4X6DA 3IDIB 1A6VL 5D9SB 3UCRA 5C0DA 3O3EB 2X05A 3SOBH 1F8TL 1H8SA 2ID5A 4G6AD 1C5CL 4U7MA 4PJAB 1CD1A 3C6LC 5FA4B 1EBAA 3F5WB 5HVHC 3G6DH 4G7VL 1W0WB 5K93A 4LAJH 1FC1A 3IGAB 1JN6A 1P4LA 1KJ2H 1NMBH 5DFWH 3FQUB 1NLDH 4ONGL 1H15B 3T4AA 4Z0BL 5GRUL 4D3CH 3MLTB 4ZS6D 2Y06L 1BZ9A 3CC5B 1SBBA 5JR1L 3DBXA 4NQUA 3HG1E 1OM3L 2E9WA 1BGXL 3MLRH 3QDME 5I73C 4ZXBA 2VITB 1XR8B 3IDYB 3MRIA 4LSTH 4N8VA 5J1AB 3F65A 3S36H 2HVJA 3U46B 2CDGA 2AGJH 3EJZC 1RK1A 4N0YL 4PJ8A 2DQGH 1K9TA 1WV7T 4HPYH 1NGQH 1ONQA 4F7CB 1TXKA 4YQXH 2P5WB 4F3FA 3HI1B 3NVQA 4PG2C 5EU6D 1HNGA 5F71A 4YR6A 5C9KA 5L2KA 1LNUB 1KN2L 3HUJA 3L3OB 3TZVC 1PDKA 4Y4FB 2COQA 4P46C 4NCC2 4Z76B 1CYGA 4HPOH 5ACZA 1BQHA 2BNQE 5DMIH 3W9DA 5A3IC 4ZTPH 1MCBA 3FRUB 4JFFA 4NKOB 3QJHB 1N8ZB 4I2XB 5D2NE 5DJ2A 1A6ZB 2J12B 3V8CA 1D9KB 1JYVA 4QOKD 2YBRA 3RAJH 5BQ7A 4OZIE 1NJ9A 1DSFL 1OT2A 1RQ5A 3BD4A 1MJJB 2YRPA 4PLKD 3VXRB 4H88L 3EYQD 1X4YA 4U4BA 1OSZB 4MZ3A 4FG6C 4POZD 5J11B 3QFDB 1KIPA 3BKMH 2YEZA 2H26B 4GUPB 4OF7A 4XCFH 5LGHH 1BLNB 4NQSA 1UM5H 4FQ1L 3K4DA 1OGTB 4EVNA 2MPAH 5D7JB 4F15C 1K5NB 4EN3B 1J5OH 2HRPL 4UUJA 2VLLA 3ARFD 1I1AB 1XH3B 3U1SL 1T1XB 2VDLH 2WW8A 4OGAD 2Z31A 5KSBA 5J13C 1WCBA 3JVGC 1S7VB 4H25A 2FEDC 4OFDA 3CFEB 3AB0B 4DFHA 3ARYA 1Q94A 1I7UB 4PJ5E 4G42B 4ZTOL 2VLJA 1EVTC 4QRQB 3EGSA 3WJJA 1LK2A 4JZJA 5IEKA 4L8SC 5J3HD 2Q20A 1NGXB 3C8KB 4F2MB 3INUH 4OB5H 1AP2B 4EI5C 2JB5L 4UNTA 2ZJSH 4PV9B 2FSEB 2J8UB 1FC2D 4O2FB 4ODVH 2X7LA 4CADA 3VFNA 4JZOA 4LCWE 3QEQE 5DRXB 2AAVA 1U8IA 1C1EH 4LRNH 4U1GC 1G7JB 4KMLB 4MLSA 5F88A 3VGAB 1UJ3C 4O5LH 2PUQT 4YE4L 4KV5F 3FQRB 4X4ZA 3QEGL 5KSUA 3B4NA 3RVXC 5D6CB 4PJHA 1E28B 3O6KH 1LO0L 5C09E 1Q9LA 5CD5C 1Q0YH 5I16A 3PJSA 2BDNH 4Q9CA 2BSED 1KC5H 5GS1A 3QI9C 3V6BR 1U8LB 2EIBA 2DQCL 4WI8A 1GHFL 2C5DC 4Z5RB 4JAMA 5EOQH 3GMMB 4P57A 4XVUD 3PWNA 5GGQL 5SWSB 1ZSDB 5CIPH 3MGAA 4L3EB 2CRYA 3QNXB 3KXFE 4HS3A 4NQCD 4YXKH 3T77B 4YDKH 1HZHH 2YUVA 5EU3B 5GJSL 5JPMB 1JK8B 3QHTC 4KJPD 1RZ8A 4N1CA 3NIDE 3RWJA 2CQVA 2R0LH 3HE6D 5GRJL 2R1WA 5F7KC 4JFHD 4B41A 1NAML 1IBGH 3VXMB 3VDCA 1UG9A 4HJ0D 4OM0H 3ROLB 4WW1A 1YEDA 5HPMA 5E2WH 3SY0B 2DQIL 5CSBA 1YEIL 1INEL 5ISZE 4PRHE 5E2TH 1JIBA 1EEZB 3O3AA 3LB6C 3M17A 4QHUB 4KVNL 2E9IA 1D5IH 3RWIB 3S4SG 4E0RA 1AC0A 3TBYA 4R7DA 4W81A 3GBMH 4GG8A 4TVPH 2EKSA 4YDIL 4WO4D 3TO2A 1MJUH 4PGBB 3RNKB 1UACH 2UYLB 3V4PL 5INDA 4JFQA 1IAKA 1AGDB 1N5AB 4YUEH 1U8OB 4Y4HB 2F53B 2NY4B 3DURA 3L3JB 3BXNB 5EPMB 3PF2A 1A6VH 4P5TC 3TA3B 1F8TH 3NZ8A 1AGCB 3H3KA 1C5CH 5FO8A 1ROWA 2IQAB 1L6XA 3I6LE 3OR7A 4G7VH 3OR6B 2QJDA 3DVNA 2K1MA 3GJFK 1HXYB 2HTLC 5DK3A 4ONGH 4Z0BH 5GRUH 1Y18B 4KTDL 1FL6B 5HYQA 5FA3B 5IHBA 2EE2A 5I0DA 1WFNA 5IFJA 3F7VA 4PRDA 2QSTA 3UTQA 2A2QT 2Y06H 1I75A 4IOIB 5E8PB 2C7UB 3IJSB 4PRBB 1BGXH 1GOHA 5DDHB 5I75C 2D0GA 3MRLB 3QIUA 1KJMA 5BJTA 3AU1B 3WLWC 1JFQL 2ESVE 2ZUQC 1Y6KR 4JM2A 1VFAB 4FQJL 5EN2B 4N0YH 3LHPL 4MQXC 1AO7D 1NLBH 4QRUB 4I77L 4S0SD 4BZ1L 4XCEA 2HFTA 1QSFB 4KMTL 1KN2H 4FZ8H 3NCMA 1DQLL 4X4YA 1L9MA 3K74B 4PG2A 3V5KB 4JQVC 3VD9A 4RBPK 3VG0L 3MMEA 4Y2DC 1J18A 3CXHK 4OT1H 4P2QE 2APTA 5HDOA 1K8IA 1U95B 1FZKA 5D7IF 4X0KA 2Y6SC 3VD3A 4DOHE 4YPGB 4BFGA 2P5EA 4X6DE 4TSCL 2NY1C 4CAGA 4CDGC 5GHWL 5SWZD 3MFGB 2NMSA 3OJDB 5I74C 2R23B 1DQDL 4KHXL 5D2LB 4H88H 4NJ9L 2IFFL 3PP4L 1CICD 4WI5A 5I1LB 1DQML 1G9NL 4MNGA 4EDXA 2H2SC 4RAVB 2O5ZL 4YFLF 1QFHA 2A6JB 5HHOA 1HH6A 1T22A 3I75A 5I2IA 3VFWA 1WBYA 2K7QA 1TPXC 3SN6N 1YUHA 4K8RC 4KVCL 4MDIB 1XCQA 2HRPH 3OAYH 2VLKD 4JZNA 3V7AG 4KKLD 4PJFA 4R9HA 3PUCA 3U1SH 1ZAGA 4RRPA 4RAUB 4NOBA 3SJVA 4NHUB 5IM7B 5EZJA 4BH8A 3I6KB 5GRXG 1IGML 3WNKA 4AY0A 3DI3B 4K7PH 2I9LA 1MHEB 5DMJB 3JVGA 2DL9A 5L2KE 2IAMC 4N0FA 1JVKA 5F44A 2EYSB 5LQBL 3F7RA 5DEFA 4LARL 2PNDA 4HUWA 3GSWA 2YPLD 2JB5H 5HHMD 4WI9A 4Z7VB 3ZDZF 1AKJA 4L8SA 1NCWL 3BD3A 4P23D 3CLFL 1F4YL 5EBWA 5KSAD 4OZGB 3DGGA 1ZVYA 5BXFB 1E27B 2WBJC 4EDWL 1U8MB 2VSCA 3MRPA 3E8UL 4N90D 2RFXA 1C7SA 5GRYA 3KYAA 3QEGH 3BN9D 5MP6L 5HY9B 4BFIA 1B90A 3HR5B 3QWQB 4U05A 3VXUE 1A3LL 1Q9OB 3OV6A 1UJ3A 2VIRB 5KOVC 1LO0H 4DEPC 5EIIB 2GTZB 3ORJA 4X6CA 4PYHA 2HLFD 3IJHA 5C0AE 1FYTE 1ORQB 2P1YA 3IAPA 5EZIL 5DRWB 2DQCH 2B4CL 1GHFH 5A2LH 5T1MA 3UTPE 2KQMA 5GGQH 3Q1SL 2EDYA 5HHNA 1A4JA 3QI9A 3B3IB 1KJ3L 2XTJE 2VAJA 4XBEL 4XMKL 4N9OB 5GJSH 3LQAL 3O11B 4ZS7L 3UBXA 4IOFC 5IQ9B 5IB1B 5BRZA 2BHUA 4Z8FL 3KLHC 5GRJH 1NAMH 4HZAA 3GB7A 3QXVA 3LAFA 4R0LC 4MGXA 1HXMA 2NLJB 3NAAL 1J8HD 3VFGL 4FXKA 2Q6WA 1EXUB 1NCBL 4JEGB 4LLMA 2DQIH 2VLJE 5KANI 1YEIH 1INEH 3C5ZC 4JRWA 2P48B 2X10A 4ZFFB 5B38B 4MX7A 4QXGL 3MROB 4OCMC 1FZOA 4RNRB 1HSBA 4DZ8B 4KVNH 4JFDD 3LIZL 2VISA 4PRIE 1IZKA 4WENB 4S11A 2RGSA 4V1DD 1G7PB 3HNTL 4HEPG 1ZA6B 3V4PH 2C1PA 2Z93A 1A3RL 3GMOA 1CFSA 4KRPC 3QT2A 1J1PH 3FFDB 3LH2L 4NUJB 4Z78A 4WDIB 2OR7A 4G8IA 4Y89A 4YBQD 3VGHA 3EKCA 5KBNC 4B5EA 1QVOA 1XEDA 2ATPA 5DD0L 4GRWE 4IIQB 1S7SB 2DIBA 1H9VA 3P73B 5C0CD 1JWUA 2BC4A 2IEPA 3RDTD 1WVZA 3QUML 2JTDA 3MGTB 1EHNA 4C56D 5HHPB 5EOTB 4KTDH 3NPSB 4F9LC 1VADB 4IMKC 1TCRA 2DLGA 5TDNA 3WFDL 3O4LA 4AK1A 3O6FC 3SQOL 3FOMB 1S8DB 5GIRA 1A8JH 1R5IB 4HXBL 4QNPF 5F7WC 3MRRA 3NPZB 1JFQH 2AV1B 3VXSE 2AKRA 4R4BB 4FQJH 2GQHA 3LHPH 3DNKA 2AJVL 4JDVA 4KK8D 1AGFB 4I77H 3T09A 4BZ1H 3CUPA 3NCFB 4ZDHB 4KMTH 4GH7B 1DQLH 1MCHA 5FOBA 3EDDA 1WAAF 4A6YB 5DGQA 2CR3A 3PABB 4JO4L 2JCCB 2V9RA 4BKLA 1J1OL 4EIZC 5J6GA 3VG0H 2DI8A 4XH2A 4OBRA 3OAUL 3QUMA 5CGTA 2BOCB 3W0WA 4ZD3L 4JQVA 3B2UC 4PY7A 2DS4A 1S9WB 1YA5A 4Y2DA 3ZE1E 4IDJL 3ARXA 4FABL 5GS2H 1LP9B 4TSCH 3IKCB 4P9HC 5GHWH 1S7QB 2VXTL 1IAOB 4LVNB 5EUOE 3ARDD 3AS1A 4S1DC 1G0XA 3QPXL 4KHXH 2IADA 1CL7L 3ZE0F 4NJ9H 1CDBA 2IFFH 3PP4H 2EIEA 3OHXA 1DQMH 1G9NH 3REVB 1KPVA 2BMKB 2WWMD 1KBGL 2NXZB 4RIRA 2Q87A 1EHXA 5DQ9B 2O5ZH 4PRPB 4LPCA 2DWDB 5HGHA 2Q7NA 1QLFA 3QXTA 3GM0A 3BEVA 5JO5A 3QFJA 4Y4KD 1II4E 4NZJA 3SE8L 4AJ0A 1QG3A 3IRPX 32C2A 4KVCH 1J7VR 2A77L 2J3SA 5EBMB 1JNHA 3MLVL 2IAND 3SBWA 3P11H 2EDFA 3EYVB 1T4KA 1FLTX 3QCVL 2G2RA 2AXJA 5GGVH 5IK3A 1ZHKA 1LE5B 3OKOA 1IGMH 5E6ZA 5F9WB 4OFYD 1BIIA 2VDQL 3PHOB 5HBBA 4ELKB 5L2JB 5L7XL 1A6AA 3SGDI 1C7TA 4R7NB 1RUAL 2VZUA 4NDMA 2PO6D 5DC0A 4HWNA 3STZB 1PSKL 3BISA 5GRVL 3HC0B 5D7LA 4NN7B 4X8JB 1A1NB 3KPSD 3RHWF 5KSVA 3CXHJ 2VAAB 4W6YB 5I1AA 5BS0E 4PG9A 1NCWH 1RK0A 3CLFH 4M7ZC 1F4YH 4W70A 4OZIF 4YHML 1HHGB 3BPOC 3ARBC 1RAMA 1CIUA 3A6CL 3QUXD 1A6WL 2P5EE 3V0AC 4EDWH 3E8UH 2NW3B 2BNRA 4URTB 5IBUB 1TVHA 5MP6H 4H8WC 2WBJA 4WU7B 4X5XA 1A3LH 5H37H 5J06A 1F4AA 1YN6B 3KPQA 3LRHA 4KDVA 4ZFOB 2XFXB 5EZIH 1PX4A 5F1IB 2B4CH 2A83A 2H2PC 3IXAA 3BVNA 3ARGC 3Q1SH 3WFZA 3GKWL 2WINA 3LKRA 3GSNB 2NY0D 1B0GA 1KJ3H 1O0VA 3WJLC 2H9GB 3MRHB 4XBEH 4XMKH 1A14L 2V7HB 3LQAH 1I9IL 4GAYB 2F54D 4ZS7H 1F3DJ 2JKXA 5HGBB 3ZKND 3QISA 4UDTB 5C86A 2DICA 4OIBA 2NY6C 3MRKA 3IDGA 4Z8FH 4K23L 4GG6A 1FG2A 4F7TA 3KPRB 1JZ8A 5JLZB 1CVSC 2ZG3A 1KJ2B 3N06B 3RKDC 5C07A 3NAAH 3VFGH 1TZHA 4AEFA 1NCBH 1FLRL 5M94B 3WMSA 1UH2A 4R0LA 2ZOKA 4HUXA 3TJEL 4ELMB 4HIEA 1A1MA 2JIXD 5JPNA 4QXGH 1KLUB 5EORL 1XF2A 3C5ZA 1M71A 1TNNA 3RU8L 4XPBL 4YEEA 4HH8A 5DHVH 5TE7L 1FG9C 1HHKB 3MBED 2NY3B 2X9YA 3S35X 1F4WL 1EAJA 4LKXA 1K4CB 3HNTH 1O7SA 1DUZB 4BSVA 1A3RH 3MRDA 4NRZA 1M6OA 1T5XA 1QTYT 3MO1A 3OZ9L 3AXLB 3QG6B 5HYIA 5F7MC 4G6AC 4X6FA 4H1LH 1OY3B 5JA9A 3ARWA 4OCNC 1DR9A 1NC2A 2IWGA 3CZFA 5DD0H 5EZLB 2EDLA 5IESL 4UV4L 2VDML 3BO8B 3CPLA 3VG9B 1P7KB 1QBAA 1U3HD 3LVEA 3NBNA 1ZVSA 3R06A 2AI0L 4LOUD 2EIDA 3QUMH 2D7OA 3IFNL 5I17B 2GJZA 5BV7L 3NIDF 2DQJH 3VWKB 1I1CA 2DQUL 3WFDH 3ZYIA 5D5ME 3SQOH 2J5LC 2LTQC 1SEBB 4F9LA 4Q2ZB 4HXBH 1JHTB 3O2DA 4IMKA 1FNGA 4BQ6A 3O6FA 2EO9A 3BKYL 2P5WD 2J6EH 4ONHA 3HZMA 1UM6L 2AJVH 4MA1C 3T04D 3FN3A 4CVZB 1G7QA 2HP4A 4FQIL 4JO2L 5CD3B 1T0PB 3K1KC 3IDXL 4PJGA 3T65B 3IF1B 4ETQA 1XR9B 2QKIA 1RZFL 1QLRB 4JO4H 1J1OH 4AIZA 3TYFA 5IB4B 3ALXA 3OAUH 3S36X 5C0BE 2E7BA 1MELA 4X83A 4ZD3H 4FTVB 5IOPB 5JNYA 1AD9A 4IDJH 5I71C 4FABH 1NEZA 2VQUA 4OZHA 3ZMRA 4WGWB 1HHJA 2GK0A 3UJIL 1LO4L 2APVA 3CCHB 3EAKA 4U1MA 2IQ9L 3SPVB 2VXTH 4QGYA 3QQ9D 1CT8A 3EYQC 4HKXB 3QPXH 4ZYKB 5LBSL 5IG7A 5KOMC 3WIFB 1AGBB 3C2AL 1NANH 1Z9OA 4TTDD 4K7FA 2OI9B 4POZC 1HEZB 1S7WA 1KBGH 3MRCB 4GRLC 5E99L 2AXGB 4L4VB 1YY8B 3TT1L 3DSFL 1RHHA 4ZQKB 5FGCE 5D7JD 1I7TA 4OZFA 1BJ1H 3DRQA 1JYNA 2AJUL 3SE8H 1D5BA 4XP6L 4X7EC 4X80L 1JGEA 3O4LE 2P47B 2A77H 2EC9T 2EDEA 3ARFC 2VYRE 3MLVH 4MD4B 1UCTA 3BWAA 5FGSA 4NWUL 3QCVH 4OGAC 5L0QC 1BBJB 1N3NA 4LFHD 2D9CA 4U1IA 5J1SC 3REWA 2FR4A 4WW2B 1CGTA 5EO1B 5K59E 3MNZB 4H8WL 2VDQH 1JF1B 3G08A 5L7XH 5CIPB 1DEDA 1CI5A 4JGUA 4L3CA 3BIAX 3C9NA 4TNWK 4U1SA 3F12B 5DF0A 5E2UL 1RUAH 1FNAA 4Y5YB 5FDWA 4QHNB 4GXUM 3EZ8A 1A7NL 4HJGA 2VDNL 1PSKH 2FH6A 3C5SA 2AK4B 4X6BB 5DUPL 5F1SA 3DUSB 3TBWB 2BNUA 3GSQA 5C0DB 2X4NA 3RI5K 1YQ2A 3W0WE 5CZVL 2V6HA 1OAKL 4X6DF 2Q7YA 4YHMH 1CD1B 4FHBD 4N1HB 4CJ0A 3G6JE 3A6CH 1A6WH 5TH2B 2OTUA 3QNYA 4LK4A 4NRYA 2NY7L 5DRZA 1JN6B 4PJIA 2B8OT 3HZVA 3SDAA 1LMKA 3T4AB 4KGJA 4OI8A 4KRLB 2EE6A 1BZ9B 5IJKC 5CBEA 4MS8C 1ES0A 4L3ED 4UOW0 3HMXL 4XVUC 3MRIB 2EDQA 2QQKL 1NAKL 3QFJE 3V7MA 4PJDB 1KEGL 3GKWH 2HVJB 4WTZG 3PHQB 5CGYD 3BYTA 2ICWI 3P4LA 3ARGA 5K9JL 3WNPA 1KTRL 1ONQB 2OS7A 3F8UB 4KJPC 1I9IH 4F3FB 3T0WA 3OF6A 3MV9D 3WJLA 4YR6B 4FMKA 3HUJB 3HE6C 4K23H 2MKWA 3GGWA 4WY7L 1U36A 1OWWA 5ACZB 4YDLC 2YUZA 2F74B 3RVVD 4PJBE 3W9DB 1XIWD 3ZLQC 4C83B 5DZOA 4JFFB 1EO5A 1X4ZA 3WE6B 4AENB 5H35A 4OI7A 1FLRH 1U41A 1RZIA 1GC1C 5BO1L 4NSKA 1IGTA 4NFDA 3VI4E 2YBRB 5BQ7B 1MSPA 3PQYE 5EORH 4Q9QL 3DV4A 1WWAX 4OSUL 4RGMB 3RU8H 1NJ9B 1XF3B 4XPBH 1QSEA 1ZE3C 1AIFA 3C8HA 4JPIA 5E9DD 5TE7H 5AD0B 4M5YL 1UB5B 4QEGA 4Y4HD 5FYJD 3JV6A 1F4WH 1KEML 1EMTL 3FN0L 2EDXA 5DVLA 1I3RA 1RZKL 2FGWL 2BNRE 5JQHC 1X5GA 1YNLL 1KIPB 4MWFB 1E4KC 3DUHA 3OZ9H 5TJWK 3MRFA 2JELL 4NQSB 3NFNA 1IC5L 3TBTB 3GRWA 1FV1A 4YXLL 3Q6GL 2NY2D 2W0KA 5JDSB 1FGNL 4XXDA 4UUJB 2VLLB 5IESH 4W6XB 4UV4H 2EDRA 3K8KA 5DURB 2VDMH 3JWOC 4HIJB 4JFOA 1UENA 3VU2A 5C8JB 4D9RD 2Z31B 5KSBB 2AI0H 5MEND 1INDH 1FFRA 1ZA3A 3DX7A 3IFNH 2OXHA 2D7TL 3T0EE 1XAUA 5BV7H 2DQUH 3WL9A 1Q94B 4JO3L 3QQ4A 5FYLD 1U92B 2MQ3A 3QUZD 3EGSB 2JJTC 2UWEF 4GG6E 2OK0L 5IEKB 1EZVX 3WFBL 1ZHLA 5MI0C 3LS4L 3BKYH 2VDKL 2XIDA 1CLOL 5C07E 4WV1C 1UM6H 3NCJL 1EUUA 4M4PA 1EJ6A 1QA9B 1UWXH 4CADB 1JZ7A 4JZOB 3EYSL 2HKFL 1ZLUK 4FQIH 4JO2H 4E41A 3IDXH 4YHNA 4OAWA 3CLEH 2ZPKL 4PB0L 5F88B 4MNHA 3S3JA 5FO7A 3RZCD 1RZFH 5KSUB 4JPVL 2YC1A 3IFOA 4XCYA 3PIQA 2UZIL 4JDZA 2X1QA 4PJHB 2RJMA 4YWGL 2MFNA 5I16B 3RBSA 4QWWC 3GFUA 3VFTB 1X44A 1FYHB 5GS1B 4HLJA 2A6KA 5DD6A 5DK2A 1NPUA 3WN5C 1QBLL 4JAMB 4P57B 1LO4H 3PWNB 3UJIH 1C5BL 3DO3A 4FFYL 3WHE0 2DBJA 4QOKA 5IMKA 1EFQA 2IQ9H 4GRWF 4K3HA 2LFGA 4TUJA 1CICC 3IDMB 4LL9A 5LBSH 5C6TH 1IAIL 3C2AH 4ESKA 4LAQL 3FQXA 1BD2E 5E99H 1KTLA 1AHWA 3TT1H 2YD3A 3RWJB 4CMMB 3DSFH 5CHNA 4BZYA 3GMNA 3S3SA 3WUWG 4GRLA 4HF5L 5HJ3A 3V0VA 2AK1L 2AJUH 4XP6H 2DIAA 2QQNL 4HWBA 4P5KB 1YEDB 4S1RL 4X80H 4LBEA 5J4MA 3KLAA 2E5EA 3MRBA 1X9QA 5F8RC 4NWUH 1HI6A 4BUHA 5B38G 4R2GB 1PG7X 5DJCA 3ARFA 4F80A 3BKCL 3U4BL 3MZGB 4OJFL 4H8WH 4E0RB 3TBYB 4R7DB 3RL1A 5IBLD 2R1XA 4N9GA 3JSSA 5L88L 2EKSB 3MGOB 2Z0BA 1FFPA 4BQCA 3RA7L 4NRXA 5CGMA 4PJGE 5E2UH 3N1FC 1A47A 5INDB 1A7NH 3JZ7A 2VDNH 1U93A 3WNOA 3VGEA 3K81A 3DURB 2HJLA 5DUPH 1ZANL 1JGLL 2L0DA 2DOCA 3SHSA 1ZEAL 4RX4A 1WISA 3ZE1F 2NW2A 1NAMB 1EO7A 5CZVH 1FNFA 3DMMD 4CU7A 2ZWLT 5FO8B 1I3UA 4JQXC 4YHIA 3MLXL 4M62L 3OR7B 5KS9B 5I1IH 5EUOF 4M6OL 2NY7H 1X5HA 4LPYA 4PJXE 5ICXA 1JTTA 3CFBA 5HVHB 3BH8A 5LJYH 5F21B 3NA9L 3VRJA 4ODHH 2HLFC 1NSNL 5HYQB 5IFJB 3F7VB 4PRDB 3G5YA 5TPWL 1DN2A 4I8DA 2FO4A 4TSBH 3DROA 4DVRL 2EEBA 3HMXH 3ZYJA 1GC1L 4Z7WB 1T5WA 3OAZH 4KJWD 3QIUB 5BJTB 5IJKA 2QQKH 1NCAH 3BPNB 1NAKH 5MHSD 1KEGH 4JM2B 4G9FB 2EEAA 1NFDA 2GI7A 1JHLL 1P69B 3JUYA 5K9JH 1D6EA 2W92A 4NQCA 3MRMA 1QP1A 2L4OA 4WUUE 3MLPA 4X4YB 5E00B 1L4IA 4WY7H 1J8KA 1M7IA 1EPFA 3JTTA 1Q9KB 4DGIL 2L7UA 3HE6A 2BSTB 2MJWA 2VE6A 3CDGA 1KB5A 3PV7A 4X9FA 5D1XD 3ILQD 1K2DB 4PGDA 2NZ9D 4X0KB 5FB8B 5C0JA 5BO1H 1C5DA 1FVDA 3KHOA 1MCKA 1GZPA 3B5HA 4JN2B 3JWOL 4ORZC 4Q9QH 3NCYS 4OSUH 3A0OA 5FKAA 1PD6A 5IHUL 1Z0MA 4HDIA 3B9KD 1D5ZA 1UEMA 1ZMYA 4M5YH 3SKOA 4KI1A 2H6PA 3IAGC 4MYWB 1KEMH 4QHLA 5ADPL 3FN0H 4MNGB 3UMTA 5F6IC 1RPQA 4EDXB 1N6QL 1RZKH 5ESVA 4LCYB 4ZFGL 4IOSD 5HHOB 1XGYL 1IEAA 1YNLH 3U36A 5T3ZE 2C1OA 1WBYB 5IB5A 1YMHA 2JF1A 2JELH 4YBQC 4NM4H 2O93L 1DQTA 1IC5H 1YUHB 3HZYA 4YXLH 1CLZL 3Q6GH 1E4KA 3VXOA 1IEBA 5CZKA 1FGNH 1XCQB 3OXRB 3HNSH 1BQLL 4JZNB 3HAEG 4PJFB 3RDTC 3SJVB 3G5ZB 3MJ7B 4JG0L 5GZNC 1IC4L 3SGKC 1W2KT 2D7TH 5FM4A 2KKQA 4HGKC 2D9QB 1PBYA 4NN5C 3VD5A 5J13B 3ULSA 2VR5A 4LASL 1JE6A 4JO3H 4LSPL 1QUNA 4HV8A 2OK0H 1R5VB 4G8EA 3WFBH 3KGRA 3LS4H 4HUWB 5T3XE 2VDKH 1CLOH 2JJTA 3IRZA 4DW2L 3FQTB 4CW1A 4NQXA 5BVJB 3LKPA 3NCJH 5E94A 1AKJB 3FRPA 5CSZA 4KK8C 4JFPA 2P45B 1S9XB 3QWRD 3EYSH 2HKFH 2IH3A 5EBWB 1IILE 3DGGB 1AO7A 1XF5A 3ARPA 3S88L 2ZPKH 4PB0H 3MRPB 1J10A 2CLRA 2AP2A 5IBUG 1QSEE 5EC1A 4IS6A 4JPVH 1WTGT 4NCC1 3L7EA 1Z5LB 2UZIH 4HLZH 1KCLA 3I85A 4MA8L 3RWGA 1PKQE 4X6CB 4X6EB 1QBML 4YWGH 3AMLA 3GSXB 3MLUL 5GS3A 1EK3A 1T1YB 1MCCA 1BFSA 1CE1L 1MREL 1QBLH 1JPGA 5T1MB 4K94L 1C5BH 4FFYH 4EEEA 3WBDA 5HHNB 1S5HB 1A7OL 5LCVL 3QI9B 3ARDC 3FB7B 4JO1L 4LLQA 1MFBL 4PRPD 4TTGA 1DLHA 1IAIH 3P4NA 4LAQH 4R8WL 3UBXB 3JV0A 4MDJB 1CICA 3LOWA 1EEQA 5D6DA 5BRZB 3U7AA 4M7LL 4Y4KC 5D7IB 4HF5H 1H3WM 3FB5A 3GB7B 2AK1H 4OFVA 4W4NA 5CJQL 5D5MF 1J1XL 2QQNH 2X2YA 4S1RH 2WMPA 1A0QL 4LLMB 4IMLA 1AH1A 3FQNB 5GRWA 4DCQA 1JZ5A 1P2CB 1URLA 2CKNA 2VLKA 3OPZL 3P4OA 4NQEE 5DFVD 1FZOB 3HLAB 3BKCH 1YDPB 3U4BH 1HSBB 1VEMA 2HG5B 5ESQA 1W72L 3BZEB 4GW5A 4OJFH 2DLFL 1OTSD 1FO0H 1FNLA 1ORSA 1MFEL 1CQYA 1GGTA 3EOAA 5L88H 5EO0B 5ETUA 4E41E 3RA7H 2P8LA 2PO6C 5HTSA 3ULUD 3LS5H 3D25A 1KG0B 5DQDL 3BESR 3GMOB 1ZANH 1JGLH 1ZEAH 1VGKA 3WUZA 3BJLA 2YPLA 3BW9A 2EE3A 3QUXC 2V9TA 1XGQA 5F97E 4L4TD 1AR1D 3MLXH 4WFGD 5KSAA 1TQCC 4M62H 4M6OH 3FO2B 4JQXA 1JWUB 1WT5C 4CRPA 4QOKE 1IM9B 3QAZB 3NA9H 4L9LC 4XGZA 1NSNH 1W72A 1PG7W 5TPWH 5C9JB 5TDNB 4GBXB 5DHVB 2ZSVA 4KTEL 2DQEL 4H0IA 5GIRB 1ZGLP 3MRRB 1A9BA 1LILA 2AKRB 2NNAB 2HN7A 9CGTA 3P77B 3VXNA 5A40E 4YNYA 2APWA 2W0LA 5E1AA 2Y36L 2VABA 1JHLH 4JDVB 2ZUQB 5ERWA 2HMID 5EOCL 1JYXA 3ZKNC 3CUPB 1EGJL 4PR5B 4MJID 5T1KB 4H1LB 4O51A 4YK4C 5K59F 4OD3L 2R56L 5EWIL 4F9PC 2MSPA 3P3YA 3GSOB 1J05B 4OGXL 1SJXA 1FL3A 4CVUA 1L9NA 4BKLB 4I3RL 2OZ4A 2Y23A 2KH2B 4DGIH 5J6GB 2HWZH 4XH2B 3F7YB 3E6HA 3QUMB 3RWEA 5CJBA 3VFSA 1J8HA 5KVFL 1OTUD 4UIMB 4Y2DB 1R3JA 2J1KA 4AT6A 3OX8A 4XI5D 3JWOH 5CJXA 5C0IB 2BZDA 5IHUH 5FK9A 3G6JF 1WF5A 1F6AA 5IVOA 3SDYH 3QUYD 3OHXB 4JY5L 4V1DA 1N6QH 1YZZA 4ZFGH 4RIRB 3CDCA 1XGUA 5HDBE 5HGHB 1XGYH 1EGJA 4MJ4A 3C5JA 3MYJA 3EDJA 1MAJA 3T8XB 3BEVB 5ILTL 5JO5B 3PWUB 2R0KL 2WQRA 2IBZY 5F3BA 4JLRB 5AYQA 3UJJL 32C2B 5D96B 1CLZH 4FQQA 4PJ9B 3IU3A 4D8PA 1BQLH 3I6GA 1TPXB 1T4KB 1U3HC 4FXGA 5FEBA 1R3LA 1X5JA 1RIHL 2G2RB 1X5LA 1KTDA 3VWKD 1S7UA 1RZ7L 3D2UD 5IK3B 1WC7A 1WBXA 1NFDE 4JG0H 2CMRL 1ZHKB 3OKOB 1IC4H 4NKDA 4HHAA 1BIIB 3RDTA 3QXAA 2DKMA 4F7PA 3FTGA 4NQCE 2WM0A 2D31A 4LASH 3TO4D 3SGKA 1XZ0A 3MV7B 5HGDA 4LSPH 4EIGB 3SO3B 3BH9A 4PJBF 1P6AB 1B2WL 3U2SA 1KPRB 1DN0A 4NQDE 1RZGB 1WBZA 2EEDA 1I7ZA 5D7LB 3NACL 4JFHE 4DW2H 2GKIA 2ED8A 5KSVB 4P48A 5I1AB 5I8CA 3QDHA 3VI4F 4HAFA 1T7WA 3UJTL 3S88H 1F58L 3KYNA 1QRNE 1I7RA 1GVIA 1WWWX 1L7TL 2VDRL 2YSSA 1TVHB 1MCDA 3WFEL 1D9KC 5DO2D 3DIFB 2WUCL 4MA8H 5CEZD 4NFCA 1QBMH 3KPQB 4Z7UA 3L3DA 3MCG1 3MLUH 1NCUA 5AAWA 4R4FL 1CE1H 2Y4SA 2VH5L 2GJJA 2IPUG 3TBSA 4N8VG 1D7FA 5TQ0H 2DTML 2A83B 4NCDA 3IXAB 3G5VA 2PTTB 4K94H 2YMXL 2WINB 3LKRB 3QQ9C 1A7OH 5LCVH 4AMKL 4JO1H 5IIEA 1B0GB 3DRTA 4MQ7B 1MFBH 1G1CA 3O41A 3FFCA 4TTDC 3ARDA 4R8WH 1MAMH 4O00A 5F7LB 4M9PA 5D7JC 5HYJD 3MRKB 1CF8L 4JGMA 4EN3C 1OF2A 2CIIA 4M7LH 5KJRL 1MCPL 4U6YA 1BQHG 5GSVA 5DK0B 1LO3L 1J1XH 1QQDA 5EB9A 4GG6F 3Q0HA 5CZXD 4Y4KA 5KG9A 1A0QH 4X4XA 1C08A 5CEYA 3MV8D 2XICA 4KI5C 4K3EL 4Y1AD 4HIEB 1A1MB 1J11A 2IANA 3OPZH 3AB0C 5F7HA 4AH2A 3NIFE 2V5RA 1XF2B 4OF8A 1W72H 4IRJD 4EQ2A 4LSSL 2DLFH 5C70A 4JY6B 3SE4C 1BVZA 1MFEH 4LVHB 3LQMA 3EIFA 2YHGA 4OFYA 1AO7E 3GSRA 4XCCL 3H9SE 4LKXB 2SEBA 1AGEB 2O61A 5DQDH 5GISL 4HH9A 1GAFL 3C6SA 4J3UA 5DS8A 2PO6A 4NRZB 2DBLL 4UU9A 1T5XB 5EUKB 1CFNB 3IS0X 3MO1B 3VGAC 3QIBB 3QO0A 1P5UA 1E6OL 4JCLA 1PY4A 3HE7D 3KPSA 4KK5D 3UAJD 1LEIA 1NC2B 4ZPTA 4JHWL 3KPOA 3RY5A 4M7KL 4NO5A 3F7QA 1NGZA 3QUXA 3RVWD 1ZLSH 4R26L 1WZMA 3S6CA 4ORGA 4HG4K 3PXJA 4TVPD 3UDWC 3T0XA 3WDIA 1WT5A 4EXPX 3D85D 4KK6D 2B5IB 1YECL 3VXTA 3NN8B 4RQQA 2ZCHL 5HVFB 3TJHC 4L9LA 4KTEH 2CLVB 4RFNC 5DC4B 4HD9A 1FNGB 3D0LA 1JUFA 3X14A 2VDOL 3CVHL 3O6FB 3OB0H 4APQB 4P2RE 5CGYC 4M1CD 4ONHB 1MI5D 3PWJB 2Y36H 3N9GL 5DMYA 1G7QB 1QSVA 1RJLA 1EGJH 1J9CT 2G5BA 3IU4L 2VLKE 3GZKA 4ZUVA 5MEQB 4OD3H 3DJ9A 1N6VA 5EWIH 1Z9SA 2F54A 4OGXH 1IAIM 2QKIB 5L9DL 3RVVC 4I3RH 3LN5A 3DVFA 5FYKL 3TCXA 5EIQA 3TYFB 2EDDA 4PJGF 4CKVX 2V2TA 4PY8I 1NQBA 1EUTA 4X8XA 2ZUXA 3KG5A 3SDDB 4IHOA 5JOPD 5BV7B 5KVFH 2EO1A 1G6RL 3OKKA 1NEZB 4NHCL 1QFPA 4OZHB 1HHIA 4OV5B 1HHJB 2DKUA 2Z35A 1JL8A 4MD5A 3ULVD 3JV5A 4U1MB 3HI6L 1HH9B 5HHME 4Y4HC 3RUGA 4G6FD 1PQZB 5C0GA 5IG7B 4JFXB 3HPLA 4PJXF 4GRMB 4JY5H 1X6LA 2ICEB 3MBEA 3TA3C 1NUNB 1B4JL 2FYYB 4PGCA 1XGRB 5D9SA 1RHHB 1AI1L 1T20B 3E6FA 4WHYH 3O3EA 1I7TB 2YUWA 3VXQB 5ILTH 2D0HA 1IGCL 1N26A 2R0KH 5F72S 4PTUA 2NY2C 4X98B 1JGEB 1PYWA 5FA4A 3GM8A 1M05A 1HWHB 3F5WA 5D8JL 5CEXA 4FOMA 2C3XA 4YGVB 3QCTL 4QRPE 3IGAA 1RIHH 2H3NA 1A5FL 1G6RA 1RZ7H 1H15A 2CMRH 1U3HA 1S9YA 3UYRL 3PWPB 4U1HA 3G08B 4JJ5A 4JKMA 3TPKA 2R0WL 4L3CB 3C9NB 1P5VA 4E5XA 4UT9L 1F3JA 1A7RL 5IMOB 1B2WH 5I1CL 1A3QA 3C5SB 3L9RB 1YPZF 3LEXB 5DQJA 4ZO8A 3NACH 3WIIL 2BNUB 4Y16D 1VACB 2X4NB 4F7CA 3V7AE 2P5WA 2XRAL 3HI1A 2E6PA 2Q7YB 1DLFL 1LNUA 3L3OA 4ONFL 2QADB 4LPUA 1EHLL 5AAMA 3UJTH 4Z76A 2OM5A 3MOBL 1F58H 3QNYB 4M7ZB 3RZCC 1H8NA 1WFOA 3KJ6L 1L7TH 3BP7A 2VDRH 4KXZH 4PJIB 3WFEH 4U6XB 1JCKA 3SDAB 3QJHA 4LMQI 3IFLL 2WUCH 4LGSB 3O9WD 2WLZA 5H8DA 4C54A 3UPAA 4OCSH 1D9KA 1TNMA 2XN9D 4R4FH 5CBEB 3OKMA 1ES0B 2LU4A 2VH5H 3U9UA 1YYLL 2VQ1B 4BH7B 2YMXH 1KGCE 4AMKH 4Q9BA 1EH9A 2FCBA 2WUBL 3KAAA 4YFEA 3MX0A 3RRQA 3QFDA 4JVPA 3BEWA 5DA4A 3UTTB 1CF8H 4GUPA 2ITCB 4OV6F 5KJRH 1MCPH 3GGWB 3ARED 4UV7L 1LO3H 5D7JA 4AG4L 1HYRC 4KK9C 1R3HA 1S5IL 2MWCA 1QPXA 5H35B 1T1XA 3BRFA 5DXWA 1RZIB 3MV01 3SGDH 4K3EH 1IGTB 3ARVA 2VRAA 2CGRL 2GSIB 2NX5D 3MRGA 2KZ1B 4ONOA 4G43B 3CFEA 4LSSH 1T1WA 3PL6D 1I7UA 2EDKA 1OP5H 4XCCH 4CU8A 1JGDB 1I3RB 2DQDL 3D3VE 4PLJC 1AP2A 1T2QL 5GISH 1GAFH 3BZ4A 2DBLH 4X7TA 4ERSL 3P9WB 4O2FA 2Q3ZA 4TOYL 1E6OH 4Z7UE 3TESA 1HE7A 5DTFA 1FV1B 2AV7A 1G7JA 3E2HB 1OGAB 1IGYA 4JHWH 3ZZ1A 3FQRA 4JFOB 4M7KH 1DANT 1NCNA 2QR0A 2BVPB 5D6CA 1E28A 4OFIA 4R26H 2EIZA 3DV6B 1ZA3B 1WFUA 1DQJA 1T2XA 3FFCE 4PJCB 1RJZB 3IKKA 2W0FB 4HUVB 4Y19E 2ZCHH 5JHDD 5DUBA 2PYEE 1MLBB 1QKZL 4JGJA 3QQ4B 2VL5A 4PD4K 1KUMA 2CDEB 3UDWA 4Z5RA 4KJWC 1U3ZA 3GMMA 2DMBA 1V3KA 1ZSDA 1G7HB 3V4UL 4L3EA 3CSYA 2MQ0A 2VDOH 3CVHH 1S7XA 2LTQB 4HWUA 1K4DA 3IDNB 4M6NL 3N50A 5EU3A 1A1OB 5M95B 2PKDA 3GSUB 4HUUB 5FYJL 5C0NC 3N9GH 5DRNA 2GHWB 1IJ9A 4LKCB 1TLKA 2O5YL 1BJMA 3IB4A 1AY1L 1GZQB 2ZP0T 3IU4H 5K9KB 3GKZA 3P30L 3RVUD 4P2OD 3SDCB 3BZFB 4XX1E 3VXMA 5EU6B 1M1SA 5L9DH 2FEEI 4MJ6B 2XTLA 3ROLA 5FYKH 4XCYB 4O02L 4YBHA 3SY0A 1X4XA 1EVUA 4KDTC 2FL5A 3DI2B 4N8CL 5I76B 1EEZA 1G6RH 4IJ3C 4MNQE 4NHCH 1IMHC 4FA8A 5DK2B 5IWLA 1X5YA 3T3ME 35C8L 3I3EA 4KKAD 5F9DC 3HI6H 4JVUA 4U1KA 2W59A 3KPSE 2CO6B 4PGBA 5E9DA 4Z7OE 1N5AA 1U8OA 4Y4HA 2F53A 3UBXG 1KTLB 1AHWB 3DETD 4MXQD 1LK3L 1VFMA 5EPMA 5CHNB 1AI1H 4EI6B 3GMNB 4LHUG 3V0VB 1IGCH 4IIQC 4M43L 2CK0L 4HG4J 3MNVA 4LLVB 2IQAA 5EU5A 1T0MB 4LBEB 1EZVY 5LVEA 1G84A 5D8JH 4Y5XB 5GSRA 5H37G 2G9HA 2A73B 5A2JH 1MRCL 3CSBA 5GS2D 4RCAA 4CJ1A 3QCTH 1HXYA 1TCMA 1R3KA 2YPKB 3TN0D 3DPBA 5DJCB 1FCGA 3ARFB 3QDJE 1IVLA 4NBXB 2MCG1 3OSKA 1Y18A 2VSDA 3GNMH 5L0QB 3FKUS 5DEGB 4G8GD 3X12B 3UYRH 5MENA 3VFOA 4IOIA 3EO1A 5E8PA 5SX5H 2R0WH 2C7UA 3IJSA 4PRBA 5KTEL 1YEHL 5DDHA 4UT9H 4OIIL 1A7RH 1U8JB 1WUNT 5I1CH 5DHYB 1TENA 2APXA 5EN2A 4BJLA 5GRVK 3MJ8A 2FJFB 3N1MC 2NW2B 4XT1C 2XRAH 1J0KA 2F8VA 1DLFH 1UT9A 4BK4A 4ONFH 1NFIB 1EHLH 3MOBH 1LWRA 3V5KA 3KJ6H 5ICXB 1HHHB 3RUGE 3CFBB 3BH8B 4WEUD 3RZCA 3IFLH 2VLRE 4N5ED 2UWEB 4EBQL 4F58L 2VDPL 5HDBF 3KYOA 4TSAL 1FO0B 3K8LA 2WZPD 4LVNC 4J3TA 1YYLH 5GZOD 1BF8A 1OTTD 1T5WB 3QBTB 3MJ9A 1Y6NR 3N85L 2PXYB 3S9DB 2YN5A 2HTKD 2NXZC 3OJDA 4PJAE 5HI5D 3LEYL 1XT5A 3ZTJG 5I1LA 3DX8A 3K2UL 1RVFL 5J12B 2WUBH 4RAVA 3PG2A 1D6EB 3NABL 2Q86A 1FBIL 1NFDF 4OLZL 3MUGB 3MRMB 1N7ML 5F96L 4YLQT 2PYFA 3GI8L 4JB9L 4Z95L 2DB8A 2XYCA 1VFUA 4UV7H 1J86A 1CFBA 2XPGA 3K4AA 2XWJA 4AG4H 3CDGB 4HWZA 5ALBL 3VCLB 3VWJD 4IRSD 4LVOB 1S5IH 4EZMA 4PGDB 4PP1D 2UUDK 4YDLB 4AM0A 1LO5B 3ZHDA 2XY1A 1A6UL 5GGTL 2Q8AL 1GZPB 3JXAA 4NHUA 5B3JE 3IT8D 5IM7A 1PZUB 2CGRH 4C58B 5JORA 2G60L 4HDIB 2P5WE 4AQOA 1MHEA 4K7PY 3DLQR 1HYSD 4NN7C 4WFHD 1JYWA 4LMQE 4QHLB 3BWUC 1B6DA 3QHFL 3EYOB 4P0DA 5ESVB 3SKMA 4WO4B 1T2QH 1IEAB 5FIEA 4U7SA 4CNIB 2UV3A 3FO1A 2C1OB 1QFWL 5MEOA 3QQNA 4ERSH 4I2XE 1YMHB 2VMFA 1OHQA 2UZXB 4OZGA 1I9JL 4TULH 5LAXB 4XNQA 3VXOB 1IEBB 1AR1C 1HCFX 3U30C 3VGGA 1U8MA 3TIDA 2RAMA 3DMMA 3ILPB 3U0PB 2H32A 3VXRE 2UZYB 4OLYL 5GGTA 1NH6A 2BVYA 4YDJB 1T1ZB 3CDFA 1JWSB 3OTTA 4XZUB 3MACL 1ORQA 3ULSB 1KJVB 1QKZH 5DRWA 5DEZA 4HFWA 2ILLA 1CXFA 4HV8B 3EO0B 3KPNA 3V4UH 3B3IA 3BGMB 4QLRA 4M6NH 3MLZL 4ZAKB 1ZGLA 4NQXB 3LKPB 5E94B 5CSZB 2HMIC 3DVGB 4JFPB 5FYJH 5AUMA 2O5YH 1EJOH 5IQ9A 1AY1H 1XF5B 3P30H 1KXQE 5D1QD 5E5MA 1RUPL 1YC7A 4KI5E 1ETZA 2CLRB 5F1KC 3Q5YA 1P84K 2R69L 4GMTL 1N4XL 1X3DA 1A64A 5EC1B 3G04A 3OG6B 4LIQL 5D7SL 1EXUA 1EERB 2DD8L 1QHPA 4NYLB 3RWGB 1MWAL 4XAWL 2CRZA 4N8CH 1OTUC 1DBJL 3SCMD 4ZFFA 4HBCL 1CD8A 3MROA 1TQBB 4KDTA 2DI7A 4YC2B 3I02B 4FQLH 2Q8BL 2J8UE 5E7BA 5HGGS 2R29L 4PBXA 2AQ2A 35C8H 3E3QC 4QRRD 5B8CB 1OP3H 4P59L 5JIPA 4UNUA 5SWZB 3L5WA 2JE8A 1DLHB 2R9HD 3QJFA 3P4NB 3EOBA 3BDXA 4GLRH 1Q72L 3S7GA 1P7QB 4YBLB 3WNLA 2BVQB 1JI1A 4NUJA 3DWTA 3T2QA 4WDIA 4M43H 2CK0H 3FB5B 5TFSL 1DVFB 3VG9C 4Q74A 4NT6A 4IIQA 4CU6A 4PD4J 3DOSA 4DCQB 1S9VA 3P73A 3RVTC 5SWSE 2DTSA 2M26A 4L3EE 4RGND 3VWKC 5B4MD 4U1LB 3P9MB 3PV6B 4J8RA 4UT6L 5IB2A 2V5TA 2BRQA 3MV7D 4GW5B 2A0LD 3K0WA 5FM8A 4MXVE 3F7PC 1XMWA 3TO4C 1H0DB 3EOAB 3U4EB 4UINL 5SX4I 3FOMA 3EHBC 3AM8C 5KTEH 1S8DA 4WFFE 1YEHH 5ETUB 1R5IA 4MSWB 4MCZA 1IZJA 4OIIH 1HK6A 5HI4C 2ATKA 3VXME 3D25B 1DE4B 3CFCL 3S5LA 1UXWA 1GGIL 4QTHB 1VGKB 5D70L 2YPLB 3BW9B 2P7TB 4ZMAT 1P7HL 4JPWL 1WK0A 5DUML 2V2WA 1P9MC 1XGQB 4XMLL 3QWRA 1U8KB 4P23B 5KSAB 3PABA 2JCCA 4YX2L 2DN7A 1CQKA 5DJ0B 3FJTA 1MCWM 4KJQD 5CMAA 3LZFL 3RY6C 4LU5H 4MQTB 2Y7QA 2YA1A 4EBQH 4F58H 2VDPH 1W72B 2EXYC 4R4ND 1S9WA 2F53E 4XPHL 2ZSVB 4NO3A 1LP9A 1I8KB 2IG2H 1ZOXA 3IKCA 1JNNL 5HGAA 3T0AA 1MIML 3IDJB 3S34L 5I1JL 3OAZK 3N85H 2OI9C 1AXSA 1IAOA 2GJ6D 3HCVA 2HN7B 4P4RA 5JA8B 4P3CL 3VXNB 1BJ1J 3LEYH 4YNYB 5E1AB 4HK3J 3K2UH 1RVFH 2QSQA 5ERWB 5T5FL 3RPIA 3NABH 1MOEA 4PRPA 4OLZH 1FBIH 3ULUL 4Y8AA 5FOJA 1N7MH 3DYOA 2YD4A 5F96H 2AJYL 4MA3A 4RISL 4PREB 1FL3B 1IARB 5EO9B 5F9AC 4JB9H 4Z95H 4UDUA 4MB3A 1FN4B 1X5XA 3AMKA 5DJAB 3X3FH 1H3XA 4PJEB 5ALBH 5D93B 3KNBA 4JQIL 1DQQB 5D71H 1RJYB 2H32H 1J8HB 1Z2KA 1OAZL 5GGTH 1A6UH 1R3JB 5FYLE 2Q8AH 1NEZG 4AT6B 5GGVY 1FJ1B 3LPGA 3OJMB 1A6PA 1GH7A 1XGPA 2D7NA 3BJ91 3RWCB 2OR9L 2K3TA 3PHOA 2G60H 4Y5YC 5FK9B 3BHBA 3HG1D 4XC3H 1QSFE 4JJHA 2DM2A 4JFDB 1F6AB 3F6IA 3QDMD 3NIGE 4V1DB 3B8SA 3STZA 3QHFH 3K3QA 1L0QA 1DBKL 4JN1L 4PJ7A 1XGUB 4X8JA 5FYKU 3C5JB 1A1NA 3MYJB 4CVWA 4OZFG 5F6IB 5F9JA 5F3BB 2CRIA 1BM3L 2WNGA 4LDLB 3UAJC 4KUCF 3M07A 1HHGA 1I9JH 3IU3B 3MJGX 5FECA 2J8HA 5A1AA 2XY2A 4D8PB 4I9WD 3TYGL 2BNQD 4JFYB 1VFOA 3RVWC 4L4TA 4WU7A 5CCKL 4OLYH 4KHTL 4WIQA 2ADJA 1WC7B 5D2LE 2E7MA 2FHFA 5C0CB 1NBYA 4NKDB 3RDTB 3RNQA 2VJXA 3MACH 3QXAB 4F7PB 4C56B 1O7VA 1OSPL 3BX7C 2ARJQ 2EDHA 4APQD 4WFED 1XZ0B 4QXWA 4D2NA 1DN0B 3UX9B 2EYRB 1I7ZB 4GAJL 4PPTA 5E6ID 2AGJL 3V4VL 3MLZH 3MRHA 2V7HA 1Z9LA 5I8CB 4GKNA 4GAYA 4YDVB 1GCFA 3GIVA 2A6IB 3FOLA 4XWOC 1NKOA 2AEWA 1RUPH 2D2OA 2D7MA 3OL2A 1I7RB 3HC4L 4Z0XB 2R69H 4GMTH 3SDDD 1N4XH 2YSSB 5DI8A 2QSVA 1KJ2A 2UY7A 4LIQH 3U0WL 5D7SH 5GGSB 2DD8H 2XWBA 2BSRA