1OP3H

Crystal structure of fab 2g12 bound to man1->2man
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
b'EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
publication title Antibody domain exchange is an immunological solution to carbohydrate cluster recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 224
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2003-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op3H01
2E7LC 5DWUH 4J4PC 2ICWA 3MCLL 3RWJB 1E6OH 4I48A 2IPTL 3BESR 4PJBF 1TXKA 3OKDA 5BS0A 3D39E 5EORH 4TSBH 4KZDL 2YN3A 5EC2A 2Y4SA 4HPYL 5TQ2H 1YQVH 4HH8A 4NN5B 5IWLC 3MXVH 5DJAA 1QNZL 1HSAA 1H3VA 4AG4H 1DQMH 4R8WH 2MQCA 4UBDD 2YBRB 1N64H 5A3ID 3P11H 1U58A 4KRPC 1CD9B 4C57C 3PIQA 2B5IC 2NX5E 3TYGL 3V6ZB 1DDHB 5F7KC 3G6JB 5JHDE 4K3JH 1A14L 4G3YL 1CF8H 4S1RH 4DGYH 3HNSH 5JIPA 5LGKA 3G5XB 5CZXC 3BKML 1EEYB 3IXAA 3OGCB 5HXMA 1UADC 3MJ9H 3P77B 2F8OA 3PHOB 2P5WE 2BDNL 1LD9A 3HG1A 2GKIA 1NCAH 1IE5A 3BISA 3O6FA 2EC9U 2G75A 3BWAB 3BZFB 2B0SL 4WFFE 1GGTA 4JDZB 3GSNL 1BFTA 2WANA 5SX5K 3QIUD 4MA3A 4V1DB 5EO9B 4AK1A 3BUYB 2BXYA 3V52H 2BNQE 1FYTA 5FO7A 2DI7A 1UCBL 4G43B 1D9KB 4NQEE 1MHHA 2H6PB 1RZ8A 1JHKL 1ZS8A 4LIQH 3OJDA 4NO3B 3UXFA 3O4OB 4ISVB 3SE3A 1KB5H 4R26L 1NEZA 1MCBA 2K3TA 4N8VA 4Y19D 5IV2B 1BZ7A 4JJHA 1S9YA 1KPVA 3MOAL 4Y4KD 1LO4L 1NEZG 1IAIL 5HI3D 3ET9F 1PD6A 4XHJD 4MNQD 1BM3H 4PTTB 4PY8I 5I1EL 4JRYB 4G8FA 4PJHF 5J1TC 1E28B 5E4EB 4YXLH 2GK0B 4KHXL 3HUJE 3OF6D 2QSCL 1XIWD 4Y8AA 4M1DL 1S9WB 3IT8D 4WFGD 2GTWB 1EO5A 5KW9H 4OD2A 3WJLC 2V2WA 32C2A 1NAMB 5GQBA 4LLUB 1H3XA 5D1XC 3KNBB 4DOHE 2AV7B 4X5LA 2XG5A 5DFTA 4F8TA 2PXYC 1GGBL 4HKJB 4YQXH 2F19H 3D9AL 1JHTA 2WBKA 5KSAC 2EE6A 4X5WB 4CL7A 3QUXD 1NC4A 4HK0B 1HQRB 1UENA 4B7IA 1PG7L 4KI5F 4RGOH 1PQZA 5I1GH 5C0AE 3GMOA 3L3HA 3PGFL 3P73A 5K9OA 2P4AB 2CUMA 3B9KC 3TESA 1U2CA 2AJZB 4JM4L 1FNGB 3UBXG 1W2KT 2ZUVA 1IBGH 5DK0A 3PUCA 3DYPA 4C4KT 1J8HE 4EDWH 2DICA 4G8IB 1KTDB 3MLXH 1FPTH 1X4XA 1S7SB 3UYOD 3GK8L 3WO4C 3GSXB 4HIJA 4RNRB 1Y0LB 4DZBB 3SCMB 2YPVH 1BVLB 4KRPB 4F58L 2Y06H 1T1XA 1MSPA 4QCIA 4WNQB 4Z5RB 3NFSH 3L3GA 2YD2A 3VXPA 3NPZB 4YDIL 1G7JB 1KLFA 1S7VA 3L5XL 4ZFOL 1NCTA 2LU3A 2RBLA 2PYEE 2DQJH 1INEL 2YWYA 4TQEL 5GGTH 2GAZA 1QBAA 3ARXA 3AU1A 1MFDL 1OL0A 4KJYB 5ANME 1HHHA 1KLGA 4DQOL 3RL1A 1A5FL 1UZ8B 1F4YH 1EAPA 4HIIA 4UV4H 1CK0L 4F7EB 4BK5A 2UV3A 1NFDE 3W2DH 1IGIL 5I76A 4HIHA 2EKSA 3NCYS 4JFZH 1TVHA 4KUCD 3WJJC 4M7ZB 5LWYL 4GRLC 4R4ND 4GQPH 1NSNH 2WLYA 1BX2B 3SDCB 4U0QB 3PQYE 5IVZA 3U48A 3BT2L 4ELMF 1FC2D 3SDAC 1RIUL 5L2JB 1VGKA 2FATL 3ZYIA 1DBJL 5F7FA 1HHIA 4O9HL 4JPKH 3HMWL 4DVRL 5KJRL 1N26A 1L9MA 4MJ4A 3GB7B 8CGTA 2HTLD 3GRWA 2XRAL 1UM5L 5INDA 4G6JH 4HJJL 1A6AA 1Q72L 2XPGA 4FMFA 1AXTH 2J5LB 3QUYB 3FB7A 4TUKH 3WE6B 2HVJB 3OB0K 5KANG 3DXAD 1NC4D 5IEKA 1MQ8A 2PO6C 4Q0XH 2XN9B 3W5NA 3BUTA 4FQIL 4FTVE 5C0RH 1JE6A 2VLLB 4KMTL 5IBLD 5IHZA 4TVPE 3BPLB 4HWZA 3V0AC 1JFQH 1T80A 2Q86A 5F88A 5ESVA 5L2KA 3JWOC 3QEQB 1KTKE 5B4MD 5DMKA 5GS2H 1EPFA 4O2CB 5H37G 3MUGB 4UILH 4L4TE 4KI5C 2BOBB 2UZXB 5I30L 1YMMA 3QJHB 1WITA 2GT9B 2X9WA 1FDLH 1B4JL 5HI5C 3GBLA 1J88A 4Z7WB 5E8PA 1IM9B 1MAJA 1YEHH 1A6UL 3RI5F 1DN2A 2OSLB 4X9BA 2VISB 3GMNA 2IALB 1I8LC 4Y16C 4F7PA 3Q5YA 4QHKI 3GBNH 2DD8H 4YIQA 1AFVL 1CFQA 4HG4J 4PFEA 4XAKE 3MRLB 1E6JH 2N56A 4PRHB 4WHYH 3PWPA 4X7TA 5FHBL 4LLWB 3BGMA 3P9MA 4UB0H 2ZSVB 4UT9L 5KVMC 3S3JA 2V7NB 3D3VB 2Y1VA 3SDDB 4Y4FA 3NVQA 4MJIB 1ZHKB 4ZXBB 4PRPB 1R3IH 3ARBA 3EZ8A 2AI0H 4NKOA 4BQBA 4NRYA 1JK8B 2GFBB 1QHOA 3DHJA 3PWVA 4GG8B 3RZCB 3WSQH 2GITA 2Z31A 5HVGB 5D2LA 4KH2A 3NFPA 2CLRB 3MR9A 2YUXA 1OLZA 5DA4A 4YDVB 4UDUB 1JPTH 1U95B 1OM3L 1RY7B 5HPMA 4E0RA 2ZP0T 3TIDA 4RAVB 1Y6MR 1CICC 4YDKH 3MREB 4JCMA 4BUHA 4I13B 2AXFB 2P8LA 4YHOL 1MVUA 1BJMA 3VMOA 2PUQT 4FQXB 4XXDA 1F4HA 4NM8L 5EUOE 1WJ3A 1UT9A 4K23H 5E5MA 2YD3A 4TULL 2GTZB 2RFXA 3TBSA 5A40E 3DNKA 2QR0A 1V3LA 1X7QB 2JTDA 4TPRH 3QFDB 2X10A 1T2JA 3DX9A 1FV1B 3LQAL 4KRNA 5EPMA 3RY6A 3V6OA 4NCDA 2DQIH 4TRPH 4K3EL 5K93A 2BVPA 4P46B 3HR6A 5L2KD 4NBZB 4NQSA 5D70H 2NY6D 3RDTC 3NIGE 1KB5B 3BXNB 3HE7B 5FUZL 5HD8C 2FR4A 2VKWA 4NQEB 5DA0B 1YMMD 1T89A 4HMEA 1U8LA 3ZDXE 3JVGC 4ZNEA 1QR4A 2D7TL 1A9EB 4H26A 4OIIL 4PRBA 3BWUC 1R3JB 3KPPB 1FZKA 1WFUA 4QT5A 3AVEA 1AC0A 2ED9A 1FL6A 1JF1A 2WV3A 5I1LA 1KUMA 4HBQA 3F7YB 3FAWA 3VWKC 2BVOB 3I6KB 3C9NB 3HUJB 5I1HH 2QQKL 5ITBL 3B2VH 4LMQI 4P9ML 3WFHB 5GS1B 4LL9A 3X12B 1JGLL 1TNNA 2DWEA 4PJXA 2DF3A 4CADB 2V5TA 1JPFA 1JN6B 5HGHA 4Y4FD 4NIKB 1D5IL 1UM4L 4AQ1B 2EYRA 3ARBD 1A7OL 3MA9L 5J8OA 4L4JA 3RWGB 3OKYA 4LSRL 4GXUM 4QRQB 1ZTXL 3DLQR 2PTTB 2ZG1A 5CD3B 4TUOA 2Z31D 3RGHA 5CP3A 4S2SA 4D8PB 1UB6A 3DBXA 4MA7H 5C0AB 4LMQE 4K7FB 5E94A 1EFXB 2VLJB 5EO0B 3U7YH 3QUZA 5EBMB 4OFVA 1D6EB 3OJ2C 5IMLA 3U0PA 4B53A 4IRZH 4MSWB 3HI5L 5DJ8B 1Q38A 3RKDC 4NM4H 4AEHH 3QCTL 2YD4A 1J8HB 3MV8E 1KCVH 2E7BA 3PL6B 4POZC 5BO1L 1HEZB 1G0YR 4MVBC 1MWAL 3O6LL 5GRYA 3ZKXC 5EN2B 3GNML 3ZYOA 4X99A 3WIHL 5CGYC 5EG6C 1UVQA 2FJHA 4GH7B 1BZ9A 1OP3H 4YDJB 4OF3A 2XI9A 3V5HA 3NABL 1BHGA 5GGRB 3BOVA 1XR8B 1KIRB 1TQBC 1BQLL 3EYQC 1IC5L 1GPOL 3HZYA 1VSCA 1T04A 2XWJA 4DVBA 1P9MA 5GSRA 1K5NA 5CUSH 5I0ZA 4D0BA 3U6RB 2IQ9L 1EO8L 3WHE0 1QRNA 2V9QA 3UJJH 4M6NL 5ANMB 5IM7A 4LCUA 4F37F 3BHBA 4L3CB 1G7HB 4RDQF 2CGRL 4NZTH 5K59E 1MEXL 3IXTB 1FIGH 1SJHA 1NFDB 3KR3L 1GCFA 2YR3A 3IDIB 2KQNA 4LQFH 3BPNC 2RAMA 2CK0H 3P0VH 4ZAKC 3BPCA 1KEGH 1I7UA 5HY9B 1QPPA 3PQYB 5EWIL 1JNNL 2YD7A 2X41A 1FZJB 2ESVE 2H2PD 2WK2A 4W6XB 4KKAD 1MLCB 3VFRB 3HC0B 1B4RA 2IPUK 2R1XB 1O5DT 5F6HI 3G6AB 1FBIL 1A7NL 2WNGA 2H8PB 4HWEL 2EH8L 1ZEAH 3SDXA 3AUVA 4RAUA 5KVDH 1AO7E 2ZKHL 3T65A 3VWKB 3RGVA 3AM8C 5D1QA 3CFJB 5JTWA 3HCVB 1NFIB 2G60L 5INCB 3WS3A 3QZWG 3FRPA 4JFHE 2CJUL 5B38B 3WFCL 2IBGA 3GI8H 1SEBA 3P4LA 1A6WL 3OJMB 12E8H 3TM6A 4QHUA 5K33A 5E1AB 3S37X 1NGWB 4FXKB 4TNWK 2BNUA 4HIXL 5F1KC 5IGXH 1P4LB 1RUQH 2XNAA 5FF6A 4Z7VA 2UVFA 3L9RB 1KJVA 3P4NA 1A6VH 1INDH 1WTLA 3GI9H 3QJFB 1MHCB 4G6KL 1L0YA 4GFTB 5C0DA 3L3IA 5AAWA 2FEDC 3BZEB 2R2EB 4S1SH 4XNYH 3E8UH 4FTVB 2BSRB 4EI5A 1FP5A 3ULVD 1AGCB 4HQQL 3E6HB 4ZPVB 3IJHB 4DCQB 2YMXH 1UH4A 3NH7H 4FMKA 5FUCE 4CUCA 4O51A 5TDPA 2I27N 1WWBX 2BFVH 4L4TB 3IF1B 3SJVE 3VFUB 4NQDA 4JG1H 4XX1E 2FD6H 4OAWA 2BCKA 3ZKQD 5FA3B 3VXOB 4OCMC 2N4IA 5CSBA 2A6KA 2MNUA 3MRHB 1SM3H 2VDOH 5SX5H 5CEZE 4AH2B 4GW5B 1J5OH 4XP9H 4U05A 1CE1H 2FSEA 4P23B 2H26A 4NN6B 4CDHA 3OKKA 4K2UL 4LU5H 2C3VA 4GG6A 1YEGH 3BKJL 4JFOA 3HKFA 4UT7H 4P49A 2OR9H 4P4RA 1FL5B 3BDYH 3ZKXB 3U9UA 1FN4A 2V2XA 5DVOA 5DJ6B 1NBZA 1DSFL 4ZUVA 2VZOA 4D0CA 3I6LE 5JPNA 1X5YA 3DX6A 4BFIB 1QRND 4RMSA 5EU4A 4P5TA 2ZCKH 4WO4C 3F12A 4LHJB 1CS6A 3C5JA 4O4YH 3VJ6A 5C0GA 1JPSH 4ZFGH 4WY7H 3QNYB 2UVEA 3VGHA 4M43L 1Q1JL 1J9CT 1KBGH 2DM3A 5TH2A 3P4MB 4ODTL 2UZIL 3HZVA 2AQ2A 3IDXL 4QXTA 5LGHH 5DUMH 1FH5L 3OL2A 2C4FT 1TZGL 2VL4A 4RMRA 5K9QI 4KQ3L 4HWBH 3CXDL 2VDNH 4IIQA 1ND0A 2FGWL 1JRHI 2HH0L 1HNGA 4ZAKB 2APVA 4LPYA 1QSFD 3MODL 2X4OA 4GXVH 4CKVX 3ULSA 4PR5A 5GRZA 3MSPA 5TGBB 1K8DB 4J3WA 5EUOB 1RD6A 3N1PC 4Z7QE 1CBVL 3BE1H 3DTXB 2AK1H 3GGWA 4X7SH 3DMMC 1ZT4B 1GGCH 1XCTB 3ARFC 4PB0L 5D72H 2NY5L 1UEMA 4K94L 1AI1L 2A74A 1UB5A 4JJ5A 5DRXB 3TZVC 1IGTA 2WAHA 5DZOA 4BZYA 1CYGA 2VB5A 3FZUC 3NN8B 4JZOB 2E7LA 5B8CC 4NWUH 1X5AA 3DVGA 3IVKB 3TN0C 2R29L 4EI5D 1NMBH 3JSSA 3Q5OA 3I6GA 1Q9KB 3MGOB 1C5DA 2AVGA 3MXWL 1XR9A 2X4RA 4IRJC 5T5FL 3TO4C 1OARH 2VC2L 1D5BB 1NEUA 4KWUA 4CVXB 5T3ZH 2NZ9D 2WUBL 4P57B 4JCLA 4Z0BH 1PEZA 2OZ4H 5F7UA 4I5BB 3V4UH 1UXWA 2L7UA 5IBUB 1NAKH 2NPLX 1OSPL 1T1ZB 5E99H 1F6AA 1CE6A 4HDIB 1JWMA 2PTUA 4URTB 1U8MB 4QLRA 3SDYH 3WXVL 3FN0L 2KZWA 5D2NC 1K3ZA 2DB8A 4LCIL 5F1NB 2BSTB 1BECA 5IB1A 5IFHH 5JOEA 2I9TA 4PV9B 4IOIA 3CZFA 4QTIH 5HYEA 4U7KA 5ETUB 2ADGA 5FYJL 1IZJA 1F2XK 2FGZA 3DSFL 1B0RB 1HSBB 5FCUL 1CTNA 1OW0A 5ESQB 3GRWL 1LO0L 4PREA 4WU7A 1FZMB 5D7SL 1MCKA 5HGDA 4ZUWB 2VLME 1NCCH 4G9FB 4HUXA 2BNRB 3RWDA 1VADB 3SN6N 1A1MA 4EBQL 3S88H 3TWCH 1V7MH 4P2RA 3U7AA 2VSCA 1PW3A 5CEXA 1LEGB 1C1EL 5D7IF 5DSCB 1FZOA 3LN5A 4LPTA 1DANT 1TQCB 5E8EB 4RMUA 4OCWH 2DM2A 4OZ4A 3MCKA 4KRLB 4JPIA 5TDNB 2HAZA 4PJDE 5EOTA 1KCUH 3OB0H 4KROD 1ZHNA 1TNMA 1YNLL 4EVNA 5GGUB 4RAHA 4Z7NF 5AYUH 4U6HB 2FYYA 1A7QL 5D6CA 1PDKA 5C8JB 2HG5B 1FCCA 1DQJB 3WJLA 1AKJB 3LMJH 1C16B 2W59A 1C7SA 3TV3L 3C5SB 2PYFB 5D1XA 1HXMB 5CHNB 3AAZA 3L6FA 2PXYA 4XC1L 3KG5A 3WIIH 2OP4H 43CAA 1RK0B 3QIWD 2HJKA 3C6SB 3ES6A 5KSAA 2KDGA 1AXSA 4BSVB 2VR4A 3OTTA 3RUGF 4Y5YA 3F8UB 4PJ8B 3ROLB 3QPXH 4Y1AE 4J4PD 5DEZA 1G9MH 3K4DA 4Y5XA 4PG2C 3TNNA 1S7XA 1D3CA 5DXWA 1J87A 3KPOA 1CDIA 3NCCB 3B9KA 3HHRB 2MWCA 1UZ6F 3MV7E 2DWDA 1U41A 3O2WL 1G6RA 3X11A 3LD8C 1F8TL 1YY9C 4WTXA 4J12A 3DETC 1T7XA 5IQ9A 2PR4H 4XP6H 4MMZC 3O3BA 4C56E 3V2AR 3MJ7A 5HHPB 3KLDA 4QRTA 4PJBA 1W0WA 4KRPD 3PGDA 5DQJA 4J8RB 4XZUB 3WFEL 1QFPA 5EOCH 2ITCA 3Q6FA 2IF7A 5F7DA 3VGEA 5J9PA 4N8CL 4OFYA 4R2GC 2CIIB 4O2FB 3VFTA 3BH8B 2V17H 1T0NA 3CNKA 1P84K 4Y4HC 1XZ0B 2JELH 5E8OB 1F3DJ 1U92B 5CZXD 3WNLA 5C09E 2ESVB 4W81A 1T4KB 1NC2A 1RU9L 4KK5C 1S7UA 1VACA 2VDLH 1G1CA 2O5ZL 4CBPA 4BZ2H 4X7FC 3HNVH 1S8DA 5DHVH 4HPOH 4PLOB 3WS6A 2EYTB 1NCDL 2G9HB 4QHMB 4QRPB 5D2NB 3T77A 3QQ9C 4G80A 4CN1A 1LP9E 5E2JA 3MRMA 1RMFL 3DUSA 1N7MH 4YUEL 4I9WE 2PCPA 2OCFD 35C8L 3MLVL 3CCHA 1DE4A 3NPSB 2BVQB 3UZEA 2DKSA 2KZ1B 4ONFL 4ERSH 4P2RD 4JAMB 4OQTH 4TSCL 3VXQB 5FKPA 3V0WH 2F5BL 2DQUL 3WJJA 3O9WC 3BH9B 1L9NA 4P0DA 1ZGLA 4Z78B 3SDAA 4HF5H 4F7TB 1NCBH 1ZHBA 1LWRA 3LEVL 1YEKL 5E5RB 3TBYB 5JPMB 3CDGA 1B0GA 1BVKA 2YC1B 3TA3B 2VERN 1LK2B 1MH5A 4HKXA 1IVLA 1ORQA 5EA0L 3SJVB 3VGFA 3CMOH 2EICA 1FNHA 1RIHL 4MCYA 3NAAH 2AKRB 1BPVA 2NMSA 3EDKA 5FYJU 3BVNB 4PJHA 3RQ3A 5D1XD 2DQGL 4FABH 3C8KA 2ZZUT 2PXYD 2DQTH 2C1OA 5MEND 4GKNB 5DD3L 3ESVF 3HR5B 5GS0H 5KSAD 5DT1H 2NY3B 2NY7H 4FQLH 5LCVL 4YHKL 5BVJB 1WF5A 2LTQC 4PD4K 1R0AH 3DV6B 5GSVA 5DGRA 4L8CA 2V9TA 1R5WB 5DF0A 1FLTX 4XP1H 1NMCC 2R1YB 4Z7UA 1KN4L 2GQHA 3B9KD 1DUYB 4DAGH 4WI4A 1WCQA 5D8JL 5DD5H 2VXVL 2F54A 1PX3A 3WYRA 3O4LB 4PJGA 3O0RL 1YC7A 1PY9A 4JB9H 4JQVC 1OOAA 3C5ZB 3GMMB 1R3LB 5FYKE 3OXSA 4OZIB 1H5BA 4AEIH 5JR1H 2DLTA 4LSTH 2P8MB 4J6RL 1NCNA 4PJCF 1TETH 1QBLH 4KK9C 5KS9A 4XNXL 1ODAA 4OFYD 2SEBB 4AMKL 3BIKB 4TSAL 1DJSA 3IDYC 4JFPB 5KN5A 4LSQL 1BD2E 2JCCF 3ZO0A 2R4RH 4UZGA 5K9JH 1I8LA 1OAQL 4JPVL 4JY6A 4Y16A 3ULVL 4HK3N 1NC2D 1EGJH 3LOWA 5T1DL 3HPLB 4R2GB 3PHQA 1NGXA 1BWWA 1OP5K 2YXMA 3D3VD 3C2AH 2B4CL 5HHME 3THMH 1BF8A 1HINH 4OF8A 2WINB 3BP7B 3JTSB 3S34H 1EHLH 5KSBE 2FJFA 3SKOA 3G5VA 2UY6A 2Y36L 3UJIH 4BKLA 5JIIA 4UV7H 3REWA 5AWNL 1UA6H 1DEEB 2W07A 4XWGL 1YUHB 2EH7H 5F7NC 3TBTB 3U7WL 1WC7B 1Y18A 1CGSH 2VIRB 3FQRB 3DUUA 5I66B 3MBEA 1ZANL 4YO0B 1ES0B 4JHBA 1R24A 3QO0A 4MAYC 5I18H 3WUZA 1NGPL 3MV9E 4P3WA 3FCTB 3RVWC 1MIEL 4GRLD 1J05A 4ZD3H 4XNQA 3LKQB 1I9JH 5E6ZA 5HSFA 3SDAD 1F45A 4U2ZA 4WHTB 4PP1C 3FO2B 3O9WB 4GJTB 1RUML 3K80A 4NRZA 2R15A 3T3MF 3LKSA 4QRRE 5BRZB 4QKXB 1N8ZA 4P3CH 4DN3L 2YPKA 1CFSB 3VRLE 1HI6A 5GPRA 1K2DA 1K4DA 3S6CA 4ELMA 2HKFH 1OQXA 4D3CL 1A1NB 1J1XH 1LO3L 1OF2B 3ARGC 2DQHL 4NWTH 2QV2A 2NXZD 3C60B 3HI1A 5DK3A 3HAEA 2YSSB 5D7LA 4Q6IA 3FQTB 3Q5TA 2CDEB 3HAEG 1MAML 4R90L 4ACPA 3CFKA 3KS0J 3P9LA 4OKVB 4IRSB 5F97E 3TCXA 2PO6D 3DVFA 1M7IB 5C70A 1JBJA 3C6LB 1WIUA 1EMTH 3VXSA 3S3PA 3SQOL 4BH8B 4NFBA 1ZVSB 4JANA 4RGNE 5HHNA 5GISH 4Z76A 4PUBH 5L8LB 2VLKE 4P4KC 4KI5D 1U8JA 2J4WH 5LBSH 1CD1A 3JVGA 4JVWA 1F00I 3TC9A 5HI5D 1KOAA 4APQB 3U0TB 4BQ6A 4JDVB 1WAAA 3TFKC 1BEYL 3PNWB 5C08A 3VU2A 1KELH 2I9LA 5EC1A 4UIKH 3ABZA 3AREC 4HGWB 4H1LH 1EZVX 3CDYA 4Y16D 1XEDA 1N59B 2XTJC 3I3BA 3WNPA 3RVXC 1HDMA 4YHLL 3EW3B 4NRXA 4YGVA 5GS0C 3U46B 1X5ZA 4M5YH 4LRNL 3QPQC 1MPAL 2XIDA 4Z8FL 3B83A 4PY8J 1BIIB 4JGUA 3BZDA 3OKLB 1K6QL 1A6TB 1KEML 1K4CB 1KIPA 2ICEA 5IB3A 4WUUB 1YJDH 4NKMA 2XQYG 4NHCH 1HHKB 3OPZL 1EFXD 2VLJD 3MBED 3CX2A 3MLRL 1FLRL 1VKXA 5KVFL 2D4FA 3T2OA 1J0YA 1WGOA 4Y1AB 4YPGB 4TNWF 5TQ0L 4XRCB 5AUMA 4AT6A 4JFFA 3PABB 2R0LL 2E7MA 2HA1A 3MV7B 4GMSH 3OGOE 4O02H 4DGVL 1A9BA 5E4IA 1ORSA 1CICD 2X40A 5L88L 2XKSA 4C56B 3MOBH 1J86A 1UCTA 1EO7A 4G5ZL 1VCAA 3KLHC 1OAUL 3OZ9H 3V95A 1WFTA 2I25N 4G42B 4K3DH 3SE9L 5IT2L 4PGDB 1S78C 3QWRD 4HHAB 5IVNA 5D7LD 1XF3A 5DHVB 4YPJA 2OK0H 3S36X 1A4JA 1BWMA 4ODHL 5L8JB 4QNPE 3ETBF 3FB6B 3PDOA 2ITDA 1OGTA 1VGEH 3FT3B 1I8IA 1LP9B 2DIJA 3EYFB 4Y2OA 2YN5A 2FECL 3RDTD 4DZ8B 3EDJA 1OPGH 3VXRE 1AC6A 3S4SB 4YXHL 5IQ7L 4Z0XA 5B39A 3M17B 1CIUA 3N50A 3W11C 1G0XA 5B39G 2EKJA 1AD0A 15C8L 3DVNB 4P4KB 2VOTA 3IJSB 5C08D 1UQSA 2MMXA 3K2UH 2R69L 4KXZI 4X9FA 1GAFL 4EEEA 3IGAB 2IAMC 5CCKH 1NBQA 5CJQH 5HHXH 1Q9LB 3UAJC 4X6FA 3VWKD 3JV0A 1QQDA 3GSQB 5HVFB 3CFEB 3JV6B 4ZTPH 4F7CA 3AREB 1U8OB 2FEEL 1BQUA 1AJ7L 5DRZA 4OSUL 1DFBL 2MHAA 2XTJB 3SQBA 2VDPL 5BQ7A 3RBGA 4JFDB 2HMIC 2IANA 1U36A 2AJYH 4GRMA 1H8SA 4NO5A 1P4IL 2VDML 5EBWA 2X44D 4P2QB 1E4KA 1NBVH 3VXTA 3BGFC 1OTUC 4J1UB 5JW5B 5GS2D 4HS6A 1A8JH 1MREH 1MCOL 1RIVL 4KXZH 5I9QC 2J8OA 3VA2C 4GAYA 1VPOH 3EBAA 3BQUA 1RI8A 1E27B 1HYRC 1NLDH 4HS3A 3WHXB 4PGCA 4MA8H 2QSQA 5TE7L 5DJ2B 1LEIA 3QQ4A 4UAOC 4J3OC 2QBWA 2ZOLA 3RNQB 3RKDD 3NCBB 3MCLH 2IPTH 5FV2A 1T03L 4LLVA 5T5NF 4POZD 5J11B 4KZDH 4PGBA 4JHZA 5ITFB 2O61B 4GUPA 4HPYH 3QEGL 4MVBD 3B2UC 5IUSA 4LKCA 5CGYD 4XBGB 2D9QB 1QNZH 1BD2B 1T1YA 2J8HA 4F2MB 1X6NA 1J0ZA 1WWCA 3BP6A 1YJDC 1MFAL 2BVUA 4OFKA 3MRBB 3FQUA 5DDHA 1C08A 2JB6A 3K4AA 3EYQD 3SPVA 3TYGH 3T4YA 5HHMB 4HZAA 2L7JA 1A14H 5I19L 4G3YH 5JOPE 5EU3B 1IAII 5KSBB 1JWUA 3BKMH 4QHKJ 2O93L 4YHPA 2BDNH 1V05A 3QNXB 1INQA 4PRIA 3V0VA 1QPXA 5ISZB 4WO4A 1BFVL 4JO4L 4U1SB 2B0SH 4R3SB 1RJLA 4L3EA 3GSNH 1C7TA 5J0BA 4L4VE 5J1AA 5F89B 1C12B 2XZAL 3MV9B 5M7QA 2VXUL 1A2YB 4E41A 2A9ML 1QTYT 2UY7A 2VDRL 1G6VK 2ID5A 3S35L 1UCBH 5DO2D 4UTBL 3X14B 3MLTB 1FFPB 1JMXA 3DV4B 3RFZC 1IEHA 1JHKH 5EFIA 4HX1B 1NL0L 3D5OF 4R26H 1X6LA 4WWID 3ARVA 4KKBC 4LASL 3ZYZA 3TIEA 3VFSB 1G6RL 2D03L 3MOAH 1LO4H 1IAIH 5EBLA 5GGSA 3QHTC 4RQQB 4HUNB 1X4ZA 3E0GA 2A38A 1T2XA 2GJZB 3H0TB 2BK8A 3H7BA 4HJGB 4PRDB 5I1EH 1KB9K 4QOKD 4KHXH 1VFOA 1LQSR 3NCJL 2QSCH 4CW1A 4M1DH 3L3OA 2ZUXA 1NFKA 5C86A 4GSDL 5MEOB 2V7HB 5BZWB 4UOW0 1RUPL 2AJSL 2X4UB 4HMCA 5B8CA 5AD0B 3KAAA 4WFHE 4B0MM 5SV4A 3H3BC 3TN0A 1H3WM 2VXQL 5C0EB 2FEDD 4XBEL 1GGBH 4JZJB 3BDBA 1ZMYA 4GS7C 4L29A 1DVFC 4UIMB 3D9AH 3RL2B 2ZCHL 1EXUB 2CD0A 1MRDL 2VQ1B 1CTOA 3TO4A 4RGNB 3O6ML 1PG7H 2C1PA 3STLB 3PGFH 2V6HA 2AXJA 4JM2A 4JHWL 4H1LB 4JM4H 1BBJA 4JG0L 4HAFA 5C0IB 3BKCL 3NIDF 4OI9A 4Y7MA 3E6FA 4YHNB 5FO9B 4M8VA 2RCSL 4R0LC 4FHBD 5F71A 5A43C 5BV7L 4LGPB 4ODWB 1MCWW 4QTHB 4M00A 4Y2DB 1WZMA 5TFSL 2GSGA 1I1AB 3GK8H 1T21A 1C8PA 1CDCA 1D6VL 4F58H 4G9FD 1W8OA 2BNRD 1G84A 3QDMD 3K8KA 5E2TL 4ELKA 2CLVA 4WO4D 1BGXL 4YDIH 3SBWC 1LO5B 3L5XH 1MQKL 1GZPA 1INEH 4TQEH 2X2YA 1MFDH 2FJGA 2Q7YB 1J8KA 4POYA 5MHSE 5DHYB 3F6LA 4DQOH 2OS7A 1A5FH 4ORZC 1GXEA 2RB8A 3ZDYE 1CK0H 1GOHA 1SVZA 2C7UB 1H3PL 1IGIH 2XY2A 1MJUL 3W5MA 3M8OL 5HTSA 3JWOL 1XGTB 1CIDA 4FFYL 4RFOL 5LWYH 1SBSL 2FL5B 4ENEC 4PJEF 1HWHB 3KPRD 5IMOB 4LEOA 3BT2H 3E3QE 1QG3A 1RIUH 2IQAB 3T2NL 2FATH 3ZDXF 1BLNA 3MUZ1 1DBJH 1CFNA 4O9HH 3DMMD 5EOQL 3ARFD 3D0VB 3V4VL 5FEBA 3HMWH 4S1QL 4CNIB 4DVRH 5F9JA 1AIFB 5KJRH 5EZJA 3TZVD 3ARZA 2QADC 3KLAB 2W65A 3WUWB 3FZUD 3W9EB 3TBWA 4LSSL 2XRAH 3BEWB 3TN0D 4O5LL 1UM5H 1LO2L 4HJJH 3UTPD 4HUVB 1Q72H 3M1BB 4ZDHB 1EZVY 3QHFL 3U30C 2AEPL 1YN6A 5DMGC 4PPTA 4IRJD 3TO4D 3TVMC 4XCNA 4I2XE 3WBDA 1OP5H 4WTZA 1P7QB 4LNRA 4FQIH 4MNGE 4RMWA 4WTZG 2AXGB 4NZRL 4KMTH 3IKCA 3HLAB 2ED8A 4NO0A 5I8CB 2OMNA 4DK6A 1CGWA 4LLMA 4KDWA 3T4AB 2VYRE 4Y4HA 4OBSA 2BVEA 3ZMRA 2OJEA 4NKDB 3NZ8A 5F3BA 4LAQL 1U93A 5I30H 3EO0B 4OCXL 3WLBA 3FT2A 4U1MA 3HN3A 3L95B 1B4JH 3JTTA 4XH2B 5FO8A 4LVHC 4HZLB 3CU7A 3VG9B 1A6UH 3QG7L 4HFUL 5MI0C 4PYHA 1M71B 4X4ME 3QEHA 3DX7B 5FYLE 4KMLB 1T7ZA 4EIGB 4MYWB 2XWTB 1AFVH 3VXUD 3ZKNC 2J12B 5F6HJ 3SGDI 1A1OB 4N0UA 4XC3L 1LE5B 2GJ6A 2FB4L 1PZ5A 1HYSC 2HVKB 3VFPB 3GZKA 5FHBH 5DVNA 4RIRB 4WI8A 3FB8B 1F11B 3PV6A 4UT9H 2FDBP 4X4YB 2CO7B 3DI3B 4QGTA 2DLFL 1XF5B 2Z91B 5IMMA 3O3AA 5J12C 1QR1B 5SWSA 2OJZL 4WI7A 2P24B 4AENB 3O3DA 1UEYA 2ATKB 3KPNA 4NUJB 3W0WE 1N5AB 5D7IA 1JWSB 3CXHJ 3B9AA 5I8EB 3ALWA 5K59F 4NOBA 3SGDH 2VABB 2YEZB 3MLZL 1OM3H 4I0PC 4JZNA 3VFGL 1JYXA 1Z6JT 3EOBA 2H32H 3U36B 5JMRA 1DLHA 1S3KL 3GHEL 1I3RA 4YHOH 1QKZL 2XWBB 1OD7A 4LLDA 3AY4C 2Y25A 4JRXE 4M6ML 4NM8H 4H88L 3H9SA 5DUBB 3MNZB 2HJFA 4O2EA 4TULH 5FKAB 3O4LD 4QY8B 2OX5A 2QADB 5JQ6L 3KPQB 4YEEA 1I7TA 4PJAE 1A4KA 2ZUQC 4UQ2B 1UXSA 3C8HA 3GSNB 3G5XA 1YY9D 3RUGA 3LQAH 2K7QA 5T1LB 3CLEL 3DETD 2D0GA 4JQVA 3P77A 1F13A 1I9EA 1S9XA 3PGCA 2ADIB 1SEQL 3H9HB 4NDMA 4X9GA 4K3EH 4L4VB 4NQCE 4YHYC 1SMAA 3RHWK 3BZFA 3I75A 3QUMA 4OGAC 2CUHA 4R2GD 3BPOC 1JZ8A 5DJ0A 4Y4HD 5FUZH 5IG7B 4QRUB 2FWOA 2AXHA 2ORBL 4BQ8A 1MI5E 1H9VA 4KK5D 3FRUA 5KAQF 1TJHL 5IOPA 2D7TH 1OQOA 4RBPK 4OIIH 3ZYJA 3EOTL 4NO3A 3FB5A 4XCYA 5IW1B 4WI2A 1F58L 1Z3GL 2A6JA 4YEFA 5IV2A 4I0KA 4WJ5B 4ZO6A 1H3UA 3ROOA 2DQFA 4OIBA 4ETQB 3QQ9D 4RGMC 2NY0B 5ICZA 2V9RA 4KV5E 1IC4L 3F7RA 5KVGL 1JYVA 2GJ6D 2QQKH 5MI0B 5ITBH 5HGBB 2GK0A 4P9MH 1ITBB 1KNOA 1JGLH 3QWOB 3T8XB 3CVHA 6FABL 1S9WA 3FQWB 2C3WA 3BO8B 1IGML 1NAMA 4X6DE 3ZL4L 1D5IH 1UM4H 1RJYA 3QXDA 3KNBA 1A7OH 3MA9H 4L8SB 5BRZD 3R4DA 4F80A 3D0LB 4LSRH 2APBA 1ZTXH 2VDQL 1DANU 1ACYL 4WTWA 4MQTB 4PJ7E 3GKWL 1WBZB 4M02A 5D93C 2A73A 3N06B 1FNEB 3HS0A 5ELIA 3ARGA 5D7JC 1HILB 2IH3B 3HI5H 5J56B 3OAZK 3TO2B 5I6XC 1E4XI 5DD1L 4Y19E 3QCTH 1CT8A 4K8RC 2EIZB 4I0PB 4PY7B 4Y5VC 5E70A 5BO1H 4IJ3C 2W9DL 3H9SD 4KKNA 3U4EB 8FABA 1MWAH 3O6LH 3GNMH 5E6IC 3WIHH 3HC3L 1KGCD 1ZLSL 1S7SA 2ICWI 5D9SA 2DYPA 3NABH 1CFTA 2XQBL 1CLCA 4WFGE 3HE6B 1BQLH 3I84A 4OZHE 4QF1A 1IC5H 1GPOH 4H25A 5HYIA 1IM3A 1XF2A 1YEEL 2EIBA 4QWWC 3DYOA 3RU8L 5JW4R 2VL5B 2EDOA 2IQ9H 2P5EB 1EO8H 4KK9D 5IVXE 3NBNA 3LH2L 4M6NH 1F2QA 4X6CE 3LKPA 4I4WB 2AJXL 2PNDA 1KJ3L 3MLUL 3RBSA 2CGRH 1VFAA 1MY7A 4KJYA 1T5XB 1ZLUK 1MEXH 4YHYB 4LP5A 3KR3H 1JNLL 2J6EA 4NQXB 1UZ8A 4EI6B 1I9RL 3D2UB 4PJCA 4LF3B 3BPOB 4XPGL 1JV5B 1KIQB 2PW2B 4WUUD 1YQ2A 1XGRA 3FMGL 4HLJA 2EIDA 2K9UA 3VI3E 2J8UF 3X3FL 2QHLA 5EWIH 2F15A 1JNNH 4L9LB 4R7DB 5GRJL 4UDTB 3SDCA 5BW7A 3PWUB 1YNKL 3V79C 3KWWB 2R2BB 3SO3C 2JB5L 1FBIH 1A7NH 1T5WA 4HWEH 2EH8H 4NBXB 4R4BA 3UMTA 2XZCL 1OB1B 3D69B 2ZKHH 4MAYD 5BVPL 3TJEL 2Z8RA 2G60H 4JFXA 3RVWD 2ARWA 2CJUH 3HNTL 1NANI 3WFCH 5IW6B 4QHLA 1A6WH 2LAGB 4YK4B 2JIXB 3G04A 3CPLB 4M7LL 4HIEA 4EOWL 4HIXH 2E9BA 4JFEA 1UWEL 4PP1D 4F9PC 3QUYA 5DUPL 2H45A 1YA5A 3WE6A 4I2XB 4G6KH 4F9LC 2LU7A 4OCSL 4AIZB 1XT5A 1MRCL 1UWXK 3UTTA 4HQQH 3B6SB 3ARGD 2Q6WB 5LQBL 1NGQL 2A9NL 3QEQA 1RJCA 1EJOL 3MUGA 4GQ9L 2OLDA 4G8GB 4WDIA 1MCPL 1YNTB 4PJDF 3C09B 1CXEA 5T1KA 2GT9A 4UBDC 5I1IL 4WWKA 4K2UH 4Z7WA 1IM9A 4UQ3B 2OYPA 4KU1A 3BKJH 1TZHA 4YBHA 2DYPD 2OSLA 1T22B 2VISA 3UTQB 2FX9L 3BGAA 1BOGB 2NLJA 3MMEB 5E6IB 4P4KD 2X09A 1DSFH 5CIPH 4GW4B 3ZT5A 4OJFL 4JLRA 1UYWL 4YX2L 2WP3T 3UTOA 3MRLA 5E7FA 1ED3A 1ZOXA 4N9GB 3TFKD 3UTZA 4D9RD 1PKQE 5I1DB 2KPNA 2ZSVA 2IADA 5CMAA 4P5KA 2Z35B 5DRWB 3ARED 3DXAE 2V7NA 2IAMA 5JXEA 3O2VL 3SDDA 4MJIA 1IGFL 3GBML 3QP3A 4ZXBA 4MJ6A 4TUJA 1OLLA 4JFDD 3RVXD 2Z8WC 4NNPL 1ZA6A 4Q9QL 4M43H 1Q1JH 2AK4B 5IHLB 5GS0D 3W0WB 4CRPA 1U8IB 4P2QD 4ODTH 3QPQD 2UZIH 2YZ1A 3IDXH 3LKRB 1FH5H 2H32B 1JF6A 4U1HB 1TZGH 5AZ2L 4I3SL 2CLRA 2GUOB 3IAQA 4KQ3H 3EFFA 2Z4QB 3CXDH 2FGWH 5CS7A 2HH0H 5F7EL 3WDJA 2EECA 3D39A 4DKEL 1OAZL 3MODH 4QXUL 4C4KO 3TYFB 1I8KB 3T3PE 1J1PL 3MREA 3O41B 4DEPC 4JRXB 2AXFA 3JV4B 1CQKA 3GJEA 1H0DB 4L8DB 3AXLB 25C8L 1CBVH 1Q0YL 1Q94B 3BN3B 4PB0H 5SWZD 4F15C 2NX5A 2NY5H 3F5WB 4ODXA 5LXGL 4K94H 2B39A 4KZEL 1AI1H 3ZE0F 3T1WA 4PJAB 5JHDA 1F4AA 3CFBB 3REVB 1QSEA 2Y23A 4JFED 3V5DB 5EU7E 1A02N 4OKDA 2HJLB 4EXKA 2A6DA 2P5WA 4W4OC 2R29H 1VENA 3ILQC 4U6YA 4NQCB 3CUPA 4HT1L 3KLHD 2ADJB 1JUFB 1TVBB 3KJ6L 3QULA 4EQ2A 5IR1A 3MXWH 3Q6GL 1PKOA 2R2CA 4XMLL 2AGJL 5DJCB 3LKNA 5T5FH 2VC2H 2GIYA 2WUBH 1ETZB 2BNQA 1SY6A 4RCAA 4UTAL 4LPUA 2OTWA 3HE7A 3QG6A 1OSPH 3BW9B 1MF2L 3VFNB 4NQEA 3ZKMC 4WHDA 4HCRA 3IDJB 5T1KD 3FFCB 4PV8B 1A9EA 4WWKD 3QXAB 1IILE 1R3JA 4MLIA 2CDGB 2R2HB 4PJFF 1G7IA 3WXVH 3FN0H 1NQBA 4LCIH 4C55A 3W82A 5I73B 4DKAA 2OXHA 4DKDC 3MRPB 4GLRH 1HQ4B 3GMPB 4NQVB 3DRQB 4NP4L 1KCKA 1N6UA 1IZKA 2R1WB 4AIXA 5FYJH 3W11D 1M1SA 3DSFH 3O6FC 4WEBL 4ZPTB 5E56A 5FCUH 1LNUA 4Q6YA 4EJ1C 3WL9B 2ZCLL 3GRWH 1LO0H 1JZ5A 5D7SH 2ICES 4CADA 2G2RB 2IAMD 4MQ7A 3FO1B 3MBXL 3UAJD 3SKMB 4EBQH 3GSVA 1X5GA 4E42A 1SQ2N 3O6KL 1C1EH 2QJDA 3QIUB 5JOFA 1IEBA 2PTTA 5CD3A 4LVEA 4D8PA 1YPZF 4ZOEA 4D94A 3BYTA 2HMID 4K7FA 1L4IA 2DOCA 4R4NC 5H37H 4WCYL 2NNAB 5DQDL 4Q74A 1AHWC 1YMME 1YNLH 3D39D 3ORJA 4XPTL 3LRSA 4Q2ZB 1A7QH 1KACB 2HT3D 4MSWA 1F42A 1EX0A 1MWAB 3VDAA 4LBEB 1SYSA 4FQJL 4Y4KB 4JFQB 2IH1B 1QP1A 4OZGF 3O3EB 3QFJE 3TV3H 5GRUH 5IROA 4MNQB 2XICA 4HUWB 1M05B 5DURD 3AMLA 4X83A 1WZ1L 4LSUL 5CFHA 5JA9A 1HEZA 4XC1H 5ID0A 1LVEA 3T0EE 1MCQA 1YECL 5JHDD 4I1NB 5GRXG 1QSED 1YEIL 1T0MB 3V4PL 4XGZB 3FOLB 3R1GL 2HLFC 4F15B 1Z5LA 2P5WD 4G9DA 2HKHL 1XR8A 5TF1L 4U1KB 4IMLB 5IVXB 2H9GA 2D7PA 4X6CB 5F44A 4A2MA 4WFFD 2PYEA 3OR7A 1LEKB 3O2WH 3LN4A 1F8TH 3U6RA 1FSKB 5C0FB 1YY8A 5CD5C 4IEFB 1K9TA 2BNQD 4LVOC 3QUXB 2EZ0C 2VAAB 2ICWB 3WFEH 4I48B 3BP5B 5E95B 3WD5L 5IB4A 4N8CH 2FIRT 3OKDB 4ZFZA 1TZIA 2F74A 4KKCC 5EC2B 4KAQL 3D18B 3D87B 3VMNA 1RU9H 3PQYA 1HSAB 2O5ZH 2APFA 2X05A 1QEWA 1U58B 1FVEA 3SBWA 3PIQB 1MLCA 3VFRA 3HC0A 2R39A 4H0IA 1NCDH 5DI8A 2H8PA 4PLKC 4GW1B 1YEFL 1RMFH 3IXAB 3CFJA 2DQDL 4YUEH 5ADOL 5INCA 2IC2A 4G7YL 3MUJA 4BH7A 35C8H 3MLVH 5CJXC 5D2LF 5B38A 2AS5M 3PXJA 3ZE1F 2G75B 2DMBA 4KKBD 4ONFH 3Q48A 5B38G 4TSCH 5E1AA 2F5BH 2DQUH 3IDMA 4MA3B 4GT7A 5LKNA 5KG9A 2NW2A 1RZKL 3QJFA 5FO7B 5KSUA 4WRLA 4H8WL 4R9HA 5LJYH 1WK0A 3VD3A 2R2EA 4MDJA 3LEVH 1YEKH 1MHHB 1UM6L 1RZ8B 1MFNA 1ZS8B 3OJDB 3QUML 2AJ3A 4DCQA 5D71L 5EA0H 5KTEL 4NJ9L 1NEZB 4N8VB 1RIHH 1BZ7B 4U1NB 1S9YB 1MNUL 1KPVB 5I1AA 4L5FL 3IF1A 5IK3A 4NZJA 3ZDZE 1FFNB 1KG0A 5I75C 3OHXB 2N7BA 2DQGH 2D31A 1PJ9A 3JXAA 4G8FB 5E8NA 4F8QA 4AH2A 4EN3A 1VEOA 1P7QD 1AE6L 1DVFD 1WBXA 5I2IA 3VD9A 5DD3H 4P23A 4M1GL 2JK5A 2AV1B 5CIPB 3RWFA 4I3RL 5GGVY 2XKUA 5LCVH 4YHKH 3TVMA 4RBPH 4POUB 1KXQE 4KKLC 32C2B 3MRKA 3FO0L 1IKFL 4PJXE 1II4E 4XNUL 5E8DL 1KN4H 2DLIA 4HH9A 3WFZA 5HYJE 1FE8L 3CVHL 5D8JH 2VXVH 5AG8A 1MFCL 3L5HA 2UWEE 1JHTB 4MD5A 2C3GA 3G9VA 1HCVA 3O0RH 2PN5A 2W0FA 1NAML 3DXAB 2YUWA 1NC4B 4G8EA 3MQIA 5A2IH 4J6RH 1PQZB 2NY6C 3QDGD 3L3HB 3QEUA 4GXUN 3P73B 4U1GB 4Z77B 4XNXH 5FDWA 5EU6D 3ULVE 4AMKH 4TSAH 5CP3H 4D0DA 1A0QL 3QNYA 4JGMA 4LSQH 2ARJB 2JJTC 4JPVH 1OAQH 3ULVH 5DK0B 1UJTA 5T1DH 1I9IL 3SKJL 4I18B 4ONGL 2XFXA 4WI6A 1BFSA 2B4CH 3S5LA 1PYWA 4ZUTB 1QFWM 4RZCB 1QOKA 4J3SA 4OLWL 5FAAA 3P4OB 4HIJB 2Y36H 1UKQA 1P5UA 3PF2A 5AWNH 5JW4Q 3BEVA 1T1XB 4XWGH 5TGBA 4QCIB 3U7WH 5EUOA 3L7FB 1RSFA 1ZWIB 4R4FL 3OAZH 5C0CA 3DTXA 4E5XA 1ROWA 1ZANH 1S7WA 1ZT4A 3VXPB 3VXME 1S7VB 2AEWA 1NGPH 5JLZA 2V2TA 1JMZA 2UUDH 5DRXA 1MIEH 4KI1A 3VGDA 1HHHB 4JZOA 5JW4M 3RL1B 2FBJL 1EAPB 1JPST 3BAEL 3VFMA 1RUMH 5F6IC 1MHEB 4YXKL 3NACL 2X6MA 5I76B 2CPCA 4RFEA 2I60L 2EKSB 4DN3H 1BVZA 1D5BA 2BERA 4CVXA 1JNJA 1RZJC 2J6EL 3UDWA 3IAPA 4D3CH 5HHQB 4I5BA 1LO3H 2DQHH 4UI2A 5F1OB 4EUPA 1CLOL 1VGKB 4EN3D 2RR3A 2OBGA 2I26N 4O58L 4MQXC 1SJXA 3DUHA 3N9GL 4EUPG 1QSFE 4G7VL 4U6VL 3O8XC 5DMGD 1ACZA 1MAMH 2EDWA 4R90H 4GAFB 5E2VL 1E0OB 3TVMD 5JXAL 5C0ND 3MNVB 3MA7A 3LEYL 5F1NA 1P1ZA 2VXSL 3MRGB 4G6FD 4JE4B 3P9WB 4XCEB 3SQOH 4K71B 5INDB 3AFLA 3BYYA 1LK3H 2XPGB 3FB7B 2HLAA 3MLWL 5EZIL 2EIEA 4XPAL 5TF0A 5I1JL 1N4XL 3P40A 5IJVA 1HSBA 1NLBL 1A21A 5IEKB 2VN4A 2YOCA 4N0YL 1AGFB 2FHFA 1VADA 4FFZL 1BEYH 4FQPA 5E00A 2VZ3A 5HI4C 1T89C 4HWZB 1UKSA 2Q86B 1OSZB 2ERJC 5ESVB 5L2KB 3RI5K 2AQ1A 4KJPC 3P0YL 2LVCA 2NY6B 5DMKB 3SKUD 1RHHA 3G6JE 5GS3A 3SDXF 3ZKND 2XQYK 4YHLH 4K9EL 1YMMB 3ULUF 1HYSD 2C3XA 1BP3B 4LRNH 3RTQA 1MPAH 4MXWL 5F72S 4Z8FH 2ZJSL 5HHOD 1TITA 1K6QH 5GGUA 4U6HA 1KEMH 1NPUA 1UWXH 5C8JA 2HG5A 3MO1B 2XZQL 4AY0A 3MV8A 1TMCB 1FORL 5ENWB 4F7PB 1HWGB 3QDJD 4ZYKA 4GBXA 3C5SA 4QXWA 4YIQB 3U4AA 1O7VA 3OPZH 1CFQB 5C0CD 3V9FA 5DVKA 3MLRH 4RSVA 1LE9A 1FLRH 3S9DB 5KVFH 4XMKL 3BGMB 3C6SA 5TQ0H 4BSVA 1FRGL 2R0LH 3GDBA 4Y4FB 5MP6L 3UP1A 4I0PD 4DGVH 3ARBB 3EYSL 4NKOB 4NRYB 2E8YA 5JW3L 4X4XA 3QUZC 5L88H 4JRYE 5C07A 3LQZA 3PWVB 3UPRA 1XF4A 2GITB 2Z31B 4G5ZH 4YZFE 2B4CC 4DKFL 3NFPB 1OAUH 4IM8A 3LZFL 3MR9B 4EXPX 5ESAB 4X6EA 3SE9H 5IT2H 1XGUB 1VFMA 2N7AA 4XTRC 5FECA 5FCSH 5HPMB 3PWJA 4NKQB 4E0RB 4O2FA 3TIDB 2VZ1A 2W60A 4WFED 3IAGC 1KJMB 3WDIA 2P8LB 1CQYA 1KN2L 1KCSL 1MVUB 5HJ3A 3SE8L 1KCRL 2ESVA 2FLRT 4XXDB 3X17A 1UACL 4JY5L 1FL3A 4ODHH 3DROA 1QUNA 5E5MB 3DYMA 2RFXB 4LGSB 5D96C 1IEAA 2QR0B 1AO7A 4OGAD 1G9NL 1P9MC 1OT1A 3IETA 4KK6C 4YXHH 3DX9B 4FN0A 5IQ7H 4P48A 1MCLA 3GJFA 5EPMB 4HG4K 2YHGA 4B50A 2DM7A 4GRWF 15C8H 3ZHKA 4K7PX 1QVOA 3EYUL 3ZE2E 2BVQA 2R69H 3LDBC 3VXQA 1GAFH 4NQSB 1RJZB 1S9KC 2P48B 3ARTA 1U6AL 1FGVL 5CZKA 4R97C 3W39A 1U8LB 4F7TA 5KAQG 2Y7QA 4PRBB 3TBYA 1AJ7H 3RTQD 3TPKA 3BSZL 3TA3A 4OSUH 3W9DB 1FZKB 1SY6L 4QT5B 1DFBH 4JKLA 1S9VA 3SJVA 2VDPH 2ZUTA 5FM8A 1FL6B 2VXTL 1DL7L 3HMXA 5I1LB 1P4IH 2VDMH 2DLEA 4HCRL 4XX1G 3AS2A 4H0HB 1J12A 3PWLA 4HKZA 5D1QC 3RGVC 3ULUC 3SY0A 5IEHB 3IS0X 3D85D 2WBJC 4OBRA 4XVJL 4GKNA 5SWQA 3VH8A 1MCOH 1RIVH 4IMKA 4M9PA 3HR5A 2QSVA 2DWEB 3VH8G 4PJXB 5DD0L 3CVIL 1K85A 3DV6A 5DR5L 5TE7H 4BQ9A 4YHZL 3WXWL 1W72L 4ZFFA 5D7JD 2Z0BA 5TJWK 2IFGA 5C07D 3UX9B 4LVNB 4P2RE 1T03H 4TUOB 3ZDYF 4S2SB 4K8RD 4M9OA 4P99A 3C5ZA 1UB6B 3GMMA 3DBXB 4OLXL 2NZ9C 5CILL 3QEGH 4NBYB 2P8MA 5C0BA 5J13C 4KHTL 4OZFA 5FXCH 1BJ1H 5IMLB 3U0PB 5HYQA 3RVUD 1CL7L 3QH3B 3L3DA 5EO1A 1MFAH 4JFPA 2F53D 4ZO8A 2DLGA 4IOFC 3U0WL 2P44B 3HPLA 5I19H 3VGAB 1R5VA 4QWWD 3WHE1 1B6DA 5DRNA 1TJGL 4X99B 1PBYA 1J18A 1UVQB 2XN9E 5MENE 2WINA 1BZ9B 3BP7A 1AO7D 3JTSA 3VWJA 1B6UA 4JY4B 4F37K 2AK4D 1KV3A 3V5HB 1BFVH 3N1GC 4C54A 4JO4H 1XH3A 5F7MC 3AC0A 1Q9OA 4U1LA 3HZYB 2XWJB 1T04B 5F8QC 1U8KA 3LS4L 4DVBB 4P5TC 1QLFA 5BZDA 2XZAH 5EZOL 5GSRB 1K5NB 5IB2A 2VXUH 5CEYA 4D0BB 4YO0A 2A83A 1XCQA 2A9MH 2VDRH 3OR6B 4GKZB 2MKLC 1QRNB 3S35H 5IM7B 5K9QG 4LCUB 4UTBH 5C0JA 5F9AC 3BHBB 2EEAA 5L0QB 1M7DB 1NL0H 3PP4L 4LASH 1UKTA 2CO6B 3KDMA 1TTUA 1SJHB 4P5MA 1G6RH 2D03H 4H20L 3LDBB 3EKCA 4IIQC 3OJVC 4G6ML 3MRCB 1S7TA 5M94B 5E5UB 1X5XA 5FA4A 2CXKA 2EO1A 3NGBB 5KOMC 2P42B 4LRIA 3NCJH 5CEZD 1YYLL 1OGAD 1CFBA 1Q9WB 1QSFB 4GSDH 1DBBL 3D3VE 1RUPH 1SHMA 2AJSH 5CLWA 1GGIL 4A2LA 3FQTA 4RAUB 4ZSOA 2BHYA 2CDEA 3T65B 2VXQH 3BRFA 4HV8A 2WIMA 4IRSA 4XBEH 5HHVL 5CZVL 3WS3B 1F90L 1I1CA 2B1HL 1M7IA 2EDEA 1YYML 2ZCHH 5CP7B 1MRDH 1SEBB 2WIIB 3ZLQC 1AXIB 4QHUB 3O6MH 4RFNC 5DEGB 1Z9LA 2BNUB 3FFCD 2XNAB 5FF6B 4Z7VB 1SBBA 3KXFA 1KJVB 3P4NB 3OKMB 2GSIB 5C0DB 3L3IB 1KCLA 4JHWH 4JG0H 4EI5B 3BKCH 2I07A 1R3KB 2E27L 4LP4A 3TT1L 2NY4C 3IRZA 5C0BD 2RCSH 2XOTA 4APQA 4PP2B 2RQ8A 5FDYA 5BV7H 4JKPL 4DUXA 4XI5C 3FFDA 4R7NB 1IGYB 4XPFL 5I16A 5DEFA 4AEEA 5TFSH 4N68A 1T1WA 2A6KB 1U8QA 4PJDA 4TVPL 3O2DA 5HVWA 1D6VH 3CSGA 2FSEB 3KPMB 4HUUA 1GC1L 2H26B 5EUKA 1IQWL 3OKKB 5E2TH 4GG6B 3OKLA 1A6TA 2XY1A 1M7XA 4JFOB 3H3PL 3VFOB 1BGXH 4P4RB 4X80L 1GJIA 3U9UB 1MQKH 4LIQE 1FN4B 2V2XB 1NBZB 3V7MA 1OW0C 3BZ4B 4WW2F 4ZUVB 5CJOL 5EH1A 5DTFA 1IAMA 4D0CB 5JPNB 2B1AL 4U31A 3RWIA 5EU4B 3EOAA 4XRCA 3L3JA 1H3PH 4KI5E 3PABA 3CDCA 3F12B 1MJUH 3C5JB 1AQDA 3M8OH 1AHWA 1EEZA 3GM8A 5E6YA 3JWOH 3VJ6B 5CJ5A 4FFYH 4NPYA 4RFOH 1SBSH 4L3AA 1G9EA 3CFDB 2EDXA 1MCIA 3V7AE 1HE7A 3IJYA 1TTGA 1C5CL 5TH2B 1ZT7A 3T2NH 2ENSA 1A3RL 3HZVB 4QXTB 4MHHG 4CVUA 5L7XL 3CLFL 5EOQH 3V4VH 4G42A 4S1QH 4KROB 1T7VA 3ILPA 4ODVL 5D1ZC 4HHAA 3ARWA 4XNZC 2DM4A 3ULSB 4H5SA 4Z7UF 1KULA 3RY5A 1XGQB 3GMQA 4LSSH 5C09A 4PR5B 2R8SL 4KV5F 4O5LH 3DX8A 1LO2H 3QT2A 2KBGA 3ILQD 3QHFH 2AEPH 3BKYL 4PJGF 4YE4L 4Y5YC 4PJ5D 1ZT1B 3GGWB 3QIBC 4YR6A 4Y5XC 4IHOA 3K3QA 2M26A 3V6BR 4JJ5B 2A74B 1UB5B 2C5DC 2VLJE 3QIWB 1IGTB 3UBXA 5BS0D 5KS9F 3L5JA 2HFEA 4X6DF 3KXFD 4MWFB 4NZRH 3DVGB 5DMJB 3ZKMD 4P3DB 2VLMD 1QO3A 1RV6X 3FHQA 4WV1A 1C5DB 2B2XL 2VITB 1U8HA 5F1SA 4LAQH 1PLGL 2X4RB 4P2OA 4M61A 1U0QA 4PJ7F 4OCXH 4QHNB 3I9GL 4O00A 1UXWB 1MCEA 5EZLA 1Q9LA 5E08L 1Z0NA 3QG7H 4HFUH 4OLVL 3VD5A 4ALAL 2B5IB 3JV6A 1T6VN 4Y0GA 1U8OA 3HG1D 1F6AB 4PJFA 3O6FD 3WN5A 1CE6B 4TNVF 4LCCC 1JWMB 3FN3A 3WS6C 1ZGLP 2J88L 4XC3H 1MCNA 2FB4H 3JBG7 5DK2A 3QI9A 1L6XA 3TT3L 3HRZB 4WGWB 5E1HB 5CJXA 3HAEH 5IB1B 5KZCD 4JVUA 2I9TB 1FYTD 4IOIB 4HD9A 1YN7B 5JW5A 2DLFH 2ADGB 4OZHF 1N0XL 1Q0XL 4CMHC 1IGJA 5D5MF 4PREB 4WU7B 2OJZH 1E27A 1BIHA 5BV7C 5IP4A 1KT2A 2UYLA 4HUXB 4WI9A 2NY1C 3RWDB 3FO9B 1TPXC 4P2RB 4C83B 5CEXB 2VSDA 1EVUA 4X7CC 2GI7A 1D5MB 3G5YA 3SKNA 1FZOB 3MLZH 3LN5B 1YPZA 4TVSa 3ZSSA 4WGVB 1IKNA 3VFGH 4OZ4B 3B5TA 3MCKB 4OCRL 3RPIA 1R3HA 3TPUA 1P4BL 1S3KH 3GHEH 4NYLB 5EOTB 1ZHNB 5IHUL 1QKZH 3VI3F 4EVNB 2EDRA 3MLSL 4J3TA 4UNUA 4CVZB 3FQNA 1DBML 5HVHC 2FYYB 2NXZC 4M6MH 1BD2A 5D6CB 3TNMA 4OZGA 4H88H 2APXA 4K7PY 5E24E 4XP5L 5C09D 3G08A 2HLFD 3L7EA 5ID1A 5C6TL 3MRBA 3I50L 2DMCA 5D1XB 4V2BA 4M4RA 5JQ6H 3AAZB 4XNZB 3L6FB 2PXYB 3FT4A 5MENB 43CAB 5IB5A 5KSBA 5JO5A 2VZVA 2HJKB 5CD5D 3CLEH 3ES6B 5KSAB 2UZYB 3S98A 5MERA 1AXSB 2X70B 1NGZA 2EZ0D 3QNXA 1WAAF 4Y5YB 4YFLI 2A0LD 2EDFA 1SEQH 2HT2C 5DJYA 9CGTA 3TNNB 1S7XB 1CGYA 4R3SA 3IDGA 4BSWA 1A47A 3L1OL 3KPOB 1H5BC 3B9KB 1GSMA 4LARL 5I1KL 2J7LA 4NCC1 4KKCD 2IEPA 3MV9A 2DWDB 1G6RB 3X11B 2ORBH 2JJTA 4KDVA 5DJXB 5IQ9B 3FOMA 1TJHH 3O3BB 5ECJE 3X14A 3MLTA 1CXIA 3MJ7B 2CKBB 4MNHA 4U1JA 3EOTH 4QRTB 4PJBB 1W0WB 3EHBC 3PGDB 1F58H 1TCRA 1Z3GH 2ITCB 3Q6FB 3UPAA 4MJ2A 5F7DB 5J9PB 5B3JF 3WO4B 4XPBL 1SYVA 1T0NB 4PLKD 4K8RL 4QRRA 1ZSDA 1CXHA 1IC4H 2HN7A 3NIFE 3S37L 5KVGH 1A22B 1NC2B 1S7UB 1VACB 1NDMA 4ZO7A 1RQ5A 2ZPKL 3A67L 4LLQA 1HN1A 1FFOA 4PGZA 6FABH 5FM4A 2V7HA 1FHGA 3HI6L 3T77B 3ARDC 1J1OL 1IGMH 2ZNWA 2X4UA 3FQXA 3MBEC 3ZL4H 1JGEB 3MRFA 1FYHB 3MRMB 4JN2B 3DUSB 1WTGT 5CBEB 5C0EA 2PCPB 2V5YA 3IDNB 5CGMA 2VDQH 1Y6KR 1DE4B 4KUZL 1ACYH 2VQ1A 5A1AA 3N1QC 3OAUL 3OKEA 2FIKA 4DK3A 1Y6NR 3GKWH 5FKPB 4HFWA 5BXFA 2VLKA 4GRLB 3STLA 3A6CL 5FYKD 4PJIF 5BV7B 1NUNB 1NDGA 5J7CC 1EH9A 3KHQA 1ZGLB 3CMGA 3SDAB 2H3NB 5FYJD 4H1LA 4K3GA 5C0IA 1LDSA 5DD1H 3CDGB 1B0GB 1BVKB 4H1LG 3O8XA 4YHNA 4DW2L 2D7QA 1MH5B 2CLZA 4HKXB 1ORQB 2Z92A 2I5YL 2W9DH 3CAFA 4Q6IC 4KKLD 4MD0A 2W0LA 4HJ0C 3HC3H 4Y2DA 4PJHB 1ZLSH 4QOKE 5I74C 3C8KB 1WUNT 5IF0A 2NXZB 1S5IL 3T3PF 2C1OB 2XQBH 4DWHA 4LCWA 3HMXL 3O3UN 5CEZL 1YEEH 5FOBA 5H8DA 2R0KL 1FGNL 2DTSA 3RU8H 2PO6B 5GSVB 5TE4L 3DURA 1CLZL 1T83C 2IMMA 4JO2L 3LH2H 4JFYA 3O11A 4PRAA 2AJXH 5K9KA 2MJWA 1KJ3H 3MLUH 3MLYL 3T1FB 4J3UA 4FQ2L 2CRIA 3ALXA 1F3JA 4KJWC 1JNLH 2NW3B 5SV3A 3DWTA 3P30L 1I9RH 1KTLA 2DQEL 4EKXA 3OXSB 4LEXL 4XPGH 2VAJA 1H5BB 4N90E 2CH8A 1IFHL 3FMGH 3QO1B 3WNMA 1EFQA 4MXVF 3X3FH 1CDBA 4OM0L 2FL5A 2X5PA 5GRJH 4L8BA 2M1KA 4LAJH 3PWPD 3OB8A 4Y16B 1YNKH 2IQAA 4JY6B 2N1KA 3QXVA 2JB5H 3SE4A 3O45A 3PHQB 1NGXB 1V3MA 1YDPA 2NY2C 2XZCH 2VDNL 5EBGA 5J6GA 1JZ6A 5BVPH 3TJEH 5DQ9A 3R06A 2FJFB 3HNTH 4G9FE 3SKOB 2BNRE 3CSYA 3QDME 5ACMA 2MQ3A 3W9EA 4F7MA 3LSOB 5EIIA 4M7LH 4YC2C 4OD3L 4EOWH 2DBLL 3M1BA 1Y18B 1UWEH 1T20B 5DUPH 3KYKL 3DUUB 3CSPA 3MBEB 3QO0B 1JGVL 1IC7L 5EIQA 5FGCB 4OCSH 3VXRA 2IBZX 1MRCH 2ED7A 1J05B 3FL7A 1BQSA 2H41A 3MZTA 5LQBH 1NGQH 1NMAL 2O5YL 2A9NH 1S7RA 1M6OB 4YWGL 5F7YC 4MQXD 3LY6A 1JRHL 5I8CA 2HT4C 3NCFB 1EJOH 3O8XD 4GQ9H 4NRZB 3UO1L 1CICB 4NKDA 2ZUYA 3LKSB 3KPRE 1N8ZB 2YPKB 1MCPH 4QXGL 1HI6B 1K2DB 4OTXL 5I1IH 1NKRA 4ELMB 4XH2A 3IB4A 1K8IB 3I85A 4HZLA 2MTPA 4C58B 3I3DA 3HI1B 5L8KB 1FJ1A 3HAEB 4RX4A 5D7LB 4Q6IB 2FX9H 5FIEA 4LCWD 2DL2A 2BMKA 3DX7A 3LAFA 2KL6A 5DLML 3CFKB 1NGYA 3P9LB 4QRSB 1CGTA 5I74B 4HBCL 4JR9L 4OJFH 1UYWH 4ODSL 4YX2H 1LE5A 2DI8A 2KKQA 2A77L 4HXAL 4M7KL 5E7BA 5HI4D 4WHCA 2R23A 3BI9X 1IT9L 4X4YA 1RZIA 4JANB 4KJPD 4FNLL 4FQQB 3O2VH 3RDTB 5A2JH 1G7LA 5HHNB 4Z76B 5GGQL 1IGFH 3GBMH 2M2DA 2DN7A 4AM0A 2LAAA 1U8JB 4NNPH 5DO2C 1QR1A 1BFOA 4Q9QH 1CD1B 4NSKB 5JMOC 5JHLL 4AENA 2P24A 3AB0C 1B2WL 3CC5A 2ATKA 3ZTJH 1U3HA 5C08B 5AZ2H 2I9LB 1N5AA 4I3SH 5EC1B 2BSED 5F7EH 2B7DT 2VABA 2YEZA 4QRPE 4DKEH 1OAZH 4QXUH 2LQRA 3A6OA 2FCBA 3QZWA 5D2NE 1KXTB 1HDMB 5CBAA 5DC4B 3L3KA 5ILTL 4NRXB 4YGVB 2WBJA 3N85L 1J1PH 2BX5A 5CGTA 1E4KC 2VLRA 2DLHA 2XWBA 3MFFB 25C8H 1Q0YH 3U1SL 1G7MA 3HA0A 1KIPB 2PF6A 2ICEB 5DUBA 1D5XA 3VXUE 5IB3B 5LXGH 4KZEH 3O2DL 2VZTA 4NFCA 4NKMB 2GCYA 3BQUC 4JM2F 2BHZA 1RAMA 3KPQA 3FAXA 3QUZD 5C3LD 3QXUA 4UQ2A 1T2QL 4JDTL 2VQTA 1T0PB 3VXRD 1I1YA 4HT1H 1HH6A 5AUMB 3KJ6H 4AT6B 4JFFB 3Q6GH 4XMLH 2AGJH 4PLJD 4I3GA 1ZXQA 4JN1L 3V8CA 4YH6A 4JKKA 1CDYA 4XTRD 2YRZA 1F4WL 2OL3A 1A9BB 2W9LA 1ORSB 4UTAH 5JDJA 2QEJA 3LIZL 4QRUA 4WW1A 2Q1EA 1MF2H 4W68A 2FX7L 4WU5A 1H3GA 3F7PC 3EYVB 5DD6A 4MX7A 4MD4A 5DS8A 5FB8A 4DUWA 1N5YL 4WJ5A 1XF3B 1JNHA 1DCLA 4KK6D 3F6IA 5GGRY 3DO7A 1TQBB 3HB3C 1U91A 4NP4H 4BJLA 3O4LE 1MOEA 4WEBH 3QWOA 3T8XA 4LK4A 3RWCA 4OZIE 1QLRA 2YD9A 2ZCLH 3PDDA 2ITDB 1OGTB 4UT6L 3TH3T 3VCLA 3SGEH 1I8IB 3BO8A 5T33L 1RZGA 4FZEL 1ZK9A 3MBXH 2LVEA 3MRJA 3MRRA 1FCGA 3MGTA 4JO3L 4L1DA 1NUDA 3NZHL 3T0EC 4OUUA 3RPKA 1WV7T 3E2HC 3O6KH 5B39B 4LCYA 5AZEL 2UWEF 3BPNB 1AD0B 3QA3B 3SGJA 1UQSB 5IW3A 4HEPG 4OI8A 4WCYH 5DQDH 1RUAL 2IJ0C 4XPTH 1JP5A 4X6FB 1FNEA 3RGVD 5D1QD 4OI7A 3ULUD 1HILA 1I4FB 1H3TA 2NXYC 4FQJH 2WBJD 4F7CB 1VHPA 3OKOA 2VLRD 1CDGA 4LLYA 1HK6A 2MHAB 4PY7A 5BQ7B 1WZ1H 4LSUH 3MC0A 4GRMB 3EFDL 3U4EA 4QOKB 2R56L 4LSPL 4YBLC 5GXBB 1WWAX 5EBWB 1YECH 2GJ6E 3VXTB 4NKIL 1YEIH 4OLZL 1F6LL 3V4PH 5IIEA 1EHXA 4HS6B 3R1GH 2FO1A 5T3ZE 2HKHH 4C59B 5TF1H 4PIRF 4TTDC 4D9LL 2NY7L 4P9HC 3RWEA 4MDIA 5BRZE 4HS3B 4NQDD 43C9A 4PGCB 2X9YA 1I7RB 4JM2C 2P1YA 1LEIB 2EE3A 5ACZA 3TLRA 3BJ91 3EO1A 1RFDL 2ZOLB 2D7OA 2X89A 2XA8L 3TJHC 4IOFD 3R8BB 4LLVB 3WD5H 2Z8SA 4NQXA 4EI6A 2OI9C 4CAGA 4PGBB 3QUKA 3KYMA 4XVTL 1JV5A 1KIQA 4KAQH 2AERT 3CX5J 3UTSA 1UJ3C 2EEDA 1MJ8L 5FYKL 1T1YB 2ADFL 3BP6B 3N1MC 4R7DA 3AGVA 2ZWLT 5DDHB 1C08B 5F7LB 2X4TB 3BD3A 3SPVB 1WVZA 3T4YB 3H2WA 2R2BA 4P5TD 1P69B 1KGCE 1YEFH 3WEXA 2VR5A 1XFPA 4FRWA 4YHPB 2DQDH 5ADOH 3DPBA 3QDMB 1INQB 7CGTA 4G7YH 3RUGE 1AR1C 4WO4B 1MELA 1ZVHA 3AMKA 2PW1A 1U3ZA 1CGUA 1EVTC 5J1AB 4MCZA 3WNKA 1WIPA 1OAKL 1RZKH 3H7LA 1CG9A 2IBBA 2Y5TB 4E41B 3BRDA 4H8WH 4MNGA 4AIZA 1UM6H 3QUMH 5EFIB 3VD7A 1FVDA 3PE9A 1DBKL 5D71H 5KTEH 4NJ9H 2Q6WA 4I77L 3TIEB 4S1DD 4UOW1 1MNUH 4M5ZL 5D1ZA 4WUUE 3QDAA 4L5FH 5EBLB 4NHUA 5GGSB 3HZMB 5CSZA 3KPRB 1JGDA 5HYSA 1U8PA 3G6JF 4JVPA 5HYSG 4KK8C 4X98B 5E9DA 1PSKL 1GVIA 3UZQA 1AE6H 2K7PA 4M1GH 4NO2A 3DMMB 3QIBA 4CW1B 4I3RH 3ARFB 5HDQL 3L3OB 1CWVA 4X4MA 3DVIA 5IHBA 2IGFL 5MEQB 3TZVB 3FO0H 1EA9C 1I7ZB 2A6IB 1IKFH 5GJTL 1V3KA 2DQCL 4XNUH 3PV7A 5CLTA 5B8CB 4CU6A 3MMEA 5E8DH 3TN0B 3QYCA 1FE8H 3CVHH 2YKLL 4L29B 4BFBD 3KLSA 4OM1L 1MFCH 4UINL 1TCMA 2EDLA 2NY4D 4HS8L 3KPSA 1NAMH 1AD9B 4N9GA 3LEXA 4IRJB 3TO4B 4XI5D 5I1DA 4WUKL 3CSBA 1JZ2A 2R0WL 2C1PB 1UFUA 5H94B 2BC4A 1A0QH 1DBAL 2NZIA 1BBJB 1DUZB 1HKFA 2A2QT 1N3NB 2YWZA 3E6FB 3UTSD 3W0WA 5EIVA 3GIVA 1RZJL 3LKRA 4YZFF 1I9IH 3D25B 4LCCA 3SKJH 1GZQA 3WFBL 4ONGH 3RIFF 5I71C 4Q97A 2Z4QA 1HHGA 4PJ9C 2AP2A 5EU5A 5DFWH 1QA9A 2IBZY 5GJSL 1GHFL 1A3LL 2GSGB 2VWEC 2X4SA 4OGZA 4OLWH 3TYFA 3GSOA 1I8KA 2P43B 4U1IA 1FC1A 3F7VB 3O41A 3DGGA 4GOSA 5AEAA 1H0DA 1O7SA 3VXUB 4R4FH 4OFDA 5LGJA 4ELKB 2APWA 4QEGA 3T0DA 3F5WA 4WW2A 3RJDA 4PJAA 3REVA 1S5HA 4XXCA 3V5DA 2FJGB 3GIZL 3IU4L 3QXTA 3T08A 2HJLA 4D9RE 4A6YH 4FOMA 1MFEL 2FBJH 2P45B 3BAEH 2EXYC 3KYNB 1DLFL 3R0MA 5FYKU 4NQCA 3FN9A 3T0BA 1Z0MA 2ADJA 4BUGA 1OT2A 4YXKH 1TVBA 1F3DH 2XTJE 3NACH 4JFDE 3S36L 3ZE2F 5DJCA 2I60H 5D1ZD 1I3GL 2J6EH 2RGSA 4P2QE 1MI5A 4LEOB 4LPWA 1VA9A 2D9CA 3KHOA 4NN5C 2EDBA 2JCCE 1CLOH 4XWOD 5E9DD 3H9YA 3VFNA 5JNYA 1BLNB 4O58H 3N9GH 1B0WA 1CFNB 4G7VH 4U6VH 3QIBD 3QXAA 4U33A 3WDHA 3G5ZA 3GHBL 5E2VH 4N5EC 5F9JB 3L5WB 5EZJB 5JXAH 3HZKA 2CDGA 2R2HA 3VG0L 5FYLD 3WFDL 3LV3B 3LEYH 4OF5A 2VXSH 4FS0A 1MCRA 3TBWB 3MRPA 1SJEB 2JJVA 1HNFA 3DRTA 5BOZG 3GMPA 4NQVA 5SWZE 2DIBA 3KGRA 3HRPA 1L0QA 3STBA 1YN6B 1RZKC 3MLWH 2R1WA 4X6BA 5EZIH 4XPAH 5BJTA 4H8WC 3KPSD 4NNXA 5I1JH 1N4XH 1IQDA 4ZPTA 1NLBH 3LD8B 4KVNL 4XCNB 4X6DA 1FNAA 3SGKA 3RA7L 4LNRB 4N0YH 4HKBA 4FFZH 3FO1A 5D7KD 2OM5A 1TIUA 4XNMA 2J3SA 3B5GA 1YMHA 2EO9A 1D9KC 2V5MA 3F58L 5CWSB 3P0YH 4NO0B 3QIUA 5DYOA 4LLMB 1MJJA 2AJVL 1HIML 4Y4HB 3WNNA 3O4OC 2OJEB 4PJ7A 4CGTA 3NZ8B 5FGBA 5F3BB 1U93B 4WI3A 3ISWA 4K9EH 3T3ME 2ZSWA 3QAZC 3WLBB 3FT2B 4U1MB 3JTTB 4FG6C 5FO8B 4MXWH 1BJ8A 1QBML 2ZJSH 1WISA 2Z93A 3DIFA 5ISZE 4Y19A 5E4EC 4LBEA 2XZQH 5JA8B 3QEHB 4Y4KA 3WIHA 3ARDA 3CU1A 5HDLA 1FORH 3O3EA 2E6JA 1EK3A 3KYOA 4HUWA 4ESKA 3FONA 4N0UB 2GJ6B 1PZ5B 4LKXA 4IBLT 3I2CL 4XMKH 3VFVA 4PRNB 1XIWA 2NY1D 3HPJA 1T0MA 2QKIB 3OG4B 2WP3O 1AP2A 4OZHA 1FRGH 1GOGA 4M8QA 5MP6H 5D5MA 3D1MC 3ZZ1A 3ARSA 3O3AB 4IMLA 3EYSH 3MRIA 4V2CB 4I0CC 1VPOL 5JW3H 4PYGA 5IVXA 3SOBL 4LNVA 1XAUA 1H15A 3O3DB 3H42L 1NBYA 3KPNB 1U8NA 4QYOA 4DKFH 5D7IB 1F97A 3LZFH 4Z7WF 1MI5D 2VAAA 5FOJA 4KY1L 4Z18A 1AGBB 4JQIL 3BP5A 4JZNB 3TEUA 1ONQA 3EOBB 3P0GB 5CKAA 2Q20A 1DLHB 1HZHL 3TBVB 3LQMA 1I3RB 3LHPL 3D18A 1KN2H 1KCSH 5F7HA 1FFRA 4XT1C 2QLVB 3SE8H 1KCRH 4LLDB 5DJDB 3K81A 1UACH 1QHPA 4JY5H 4D2NA 5HYFA 3H9SB 3SCMC 3ULUL 2F54D 2HT2D 2LTQB 3GJFK 4FQHA 2HJFB 2XKNA 4O2EB 1T83A 4XP4L 4ZOAA 3OWEA 1G9NH 1NMCB 1REIA 2G5BB 5C2UB 4FZ8L 4YFEA 1I7TB 1A4KB 4PB9L 4GW1A 1QSEE 4J3XA 1UXSB 4JGJA 3V6FA 2Q8BL 3GMLB 7FABL 3RUGB 2IFFL 3GEWB 5TPWL 1CFVL 1S9XB 2C3HA 3WKNA 3PGCB 4NDMB 3V5KA 1KPRB 3EHBD 3EYUH 1CU4L 1WFNA 3I75B 3QUMB 3MUY1 3IDYB 5DJ0B 1U6AH 2FWOB 1FGVH 2FZ3B 2Q76A 1RURL 2W9EL 1QLEL 5E2WL 4MAUL 3FRUB 4IDJL 4M7ZC 2VTFA 5IOPB 5BW7C 3SDCC 5IKCA 3BSZH 3KS0H 1SY6H 2OL3L 4R96A 3VDCA 3FB5B 4XCYB 4NC1C 1HHJA 1XF1A 2A6JB 3CXHK 2VXTH 4U1NA 1DL7H 3QAZB 3ROOB 2DQFB 4N8VG 3ARDD 1PZUB 4HCRH 1FFNA 1FNSL 3MUHL 3OHXA 5ICZB 1KC5L 4KDTC 3NTCL 4Z95L 4LSVL 3MRDA 4XVJH 1CL7I 1KNOB 3ECBA 1M4KA 2Y72A 4G6AC 2AV1A 5CIPA 2VNCA 3CVHB 3U2SB 4MAYB 4MA1C 5DD0H 4M48L 1ZLVK 3CVIH 2J5LC 3QUYC 3TP4A 4BYHA 5DR5H 1U3JA 1UH2A 3ME0A 4YHZH 3WXWH 1RJYB 1W72H 3QXDB 2I24N 4X9IA 5C6PB 1PKQA 5J6HA 4K9EC 2XYCA 3VE0A 4UUJA 3BPLC 3DXAA 4OLXH 2LU4A 1QRKA 2CUIA 5CILH 4GAJL 4PJIA 3UYPA 4HJ0D 5KOVC 4F33A 2A73B 4KHTH 4NQTA 3HS0B 4Z77A 1MRFL 3ARGB 3IDUA 4IS6B 1CL7H 2Y5EA 3I02A 3U82B 3KPLB 3MRNB 1YEDA 5C9JB 3HUJF 4WWKC 2X4PA 3VRJB 2ARJA 1CT8B 1UGNA 5FK9A 3U0WH 3VXSD 4IDLA 3CK0L 2MCG1 2VH5L 2B8OT 2E7HA 4K3HA 4I18A 3L5IA 1JI1A 3X3GL 8FABB 2CK2A 1TJGH 3VXNB 4ZUTA 1ZKAA 4RZCA 3B3IA 4S10A 3N1FC 4OB5L 3P4OA 5D9SB 5HGGS 4ZQKA 2DYPB 1CFTB 1AGEA 2YS4A 4Y88A 1JJUA 2LV4A 4KJWD 4QF1B 4H25B 1IM3B 1DN0A 1XF2B 1CD0A 3LS4H 4KPHL 3L7FA 1ZWIA 1ZV5A 4OFIA 5EZOH 2HFFA 1EIBA 4UNVA 4A6YB 5J57B 5JXEC 3SDDC 5LAXA 4ZXBC 4RA0C 3LKPB 3S96A 4HXBL 4ONOA 1OTTC 1VFAB 3NCYP 3PP4H 3OAYK 4XMPL 3RZCC 2D7NA 5IBTL 4H20H 2XXMB 2ZNXA 4N5UA 4NZUL 3QDGE 5ERWA 4PJCB 4RMTA 4YBQC 2X4NA 2NY2D 4G6MH 1MHEA 5EU6E 3NA9L 1XGRB 1J0IA 1YZZA 3RWHB 1ZE3C 2HT3C 1HOCA 4ZTOL 4N0FA 1QYGL 2JCCB 1KYOJ 4ZUUA 1ZHLA 5HHQA 1YYLH 2J1KA 5DVMA 1G9NC 1DBBH 1FO0A 4FQXC 1T5WB 1A6ZA 1GGIH 4R4BB 4JFFD 4U2YA 4NC2B 3BJLA 2X1PA 3SHSA 4JFXB 4X0KB 5HHVH 5CZVH 4PGEA 3MNVA 1F90H 2B1HH 5C1MB 1YYMH 1NCWL 4X5XA 4YAQA 5SWZB 4QHLB 5DC0A 3MRGA 5JORA 1T6WA 3G04B 3UJTL 1ZA3A 1IARB 4HIEB 4XCEA 2RJMA 4MA1B 4WEMB 3VA6A 4KTDL 4JFEB 1NFDF 4MJ5A 2DJ4A 3MYJB 2HT4D 1G7QB 4P46C 3PHSA 2E27H 4AYFA 3UTTB 1W0YT 3TT1H 3OV6A 1XGPA 2E8ZA 3OX8A 3RNKA 4ONHA 1RULL 3HE7C 1AGFA 1KLUA 4JKPH 5F7WC 3NCEB 1OSZA 4XPFH 4M6OL 3PP3K 5MEPA 4NC0B 5DZNA 4TVPH 4GKSA 3FTGA 3CDFA 1R6VA 4WDIB 3MRQA 5T1KB 1GC1H 2J2ZA 4WWKB 3UZVB 2ZOKA 4UMGA 3SEPA 1IQWH 3PWNA 4H0GA 2AEQL 3DO3A 3VFWB 1TZHB 3H3PH 3QFJA 3MO1A 4X80H 5GS1C 3IFOB 1IAKA 5ENWA 2NLJB 4N1HB 5T3XD 1J0KA 5SX4I 5CJOH 1T66C 4K55A 3T0EA 4JLRB 1JPGB 3NMEA 1JCKA 3QQ3A 5FYLL 2B1AH 4R6UA 1ED3B 3IFLL 1A6PA 3UTZB 4MS8C 5FUOL 2DTML 5CMAB 2IADB 4P5KB 4NT6A 1W0VA 3OXRA 1WCBA 2Z8VC 2IAMB 3CH1B 1P7HL 1A7PL 2CXGA 4MJ6B 4TUJB 5FV1L 2IAND 2VE6A 1N2RB 1ZA6B 2OMBA 1LGVA 5KSVA 1C5CH 3NIDE 3MNWA 1A3RH 5L7XH 3CLFH 3EFFB 5I17A 5ESAA 5SX4H 4YNYA 5IROC 3D39B 1XGUA 4ODVH 4YFLF 4ZS7L 3BGFB 3PL6C 1NKOA 3BQUD 1MUJA 5HHOE 2R8SH 1KJMA 3NIFF 3GJEB 1CDUA 5F3HA 5I9QB 5DURB 3BKYH 4YE4H 1XMWA 5C7XL 3QDJE 2EYSA 1RZFL 2NX5B 1VFBB 2R0ZL 4ODXB 5C0CE 5JHDB 2VDKL 1I3VA 1QSEB 2CRMA 2FX8L 4UAOB 3NFNB 4U6XA 4B7LA 2A6DB 2P5WB 5A16A 1P7KA 1QBBA 4U6YB 3CUPB 3QULB 5IR1B 2B2XH 1PLGH 5JW4N 3LKNB 1UJ3A 3IU3B 1WEJL 2HFGL 3I9GH 1KPUA 2BNQB 2FO4A 1RJZA 3WMSA 4PJEE 5GZNC 1PG7X 4NZDA 2OTWB 5E08H 3QG6B 2HRPL 3ESUF 3ALPA 4OLVH 4X9HA 4ALAH 3UC0L 3HB3D 4PRID 3LKOB 1CLYL 4CMMA 5EUOF 2Q7NA 1KXVC 3W9DA 2WW8A 3U83A 2J88H 4L3ED 1G7IB 4WFEE 3QFJD 5IFJA 1JYNA 2P5EE 4HGKC