1OP5H

Crystal structure of fab 2g12 bound to man9glcnac2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody domain exchange is an immunological solution to carbohydrate cluster recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB 2G12, light chain
total genus 30
structure length 225
sequence length 225
chains with identical sequence M
ec nomenclature
pdb deposition date 2003-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1op5H01
1YEIH 1A7QH 2EDEA 2ZKHH 1W0VB 3PWPD 2VLJD 1HHKB 2V17H 3HG1A 3RRQA 3PP4H 4GW4B 4DGVL 5HGDA 2Z91B 2QSQA 4UNVA 2VDQL 1WZKA 2COQA 1HNGA 2ZUXA 1S9WA 4Q9RL 3MRIA 1Y6KR 1B0GB 1FORH 4LCYB 1VGEL 4RFEB 2R2BB 5CJBA 1WIUA 1F2XK 4C56E 1LP9A 1NGYA 1NMAL 1KGCE 3PWPE 1DQJB 3AU1B 4UT9H 4EOWL 2OS7A 1VACA 1UACL 1KCVH 1I7TA 5C08B 1MY7A 3LN9A 3V4PH 1BREA 4G42B 3FMGH 3IDUA 5C0RL 4BYHA 1FL5B 1X5HA 4TYUA 3HNTL 2CKBH 2XRAL 4Y2OA 5ELIA 4X6EB 1B4JL 5D2NE 4IRJC 5D1QB 1OM3H 3MOAL 2VDKH 6CGTA 2R23A 3F12B 4DN3L 1EXUA 4XP9L 4P49A 4EI5C 4ONFH 1XH3A 2VLJE 3U82B 5KZCD 1CWVA 4DGIL 3NAAH 4MCYA 4QCIA 2OP4H 2HTKD 3O6FD 1BWWA 3IJSB 3MFFA 2WNGA 3CSPA 2CR6A 5ENWB 1QEWB 3BDXA 1OD9A 4N0UE 2YC1A 1TQBB 3M1BA 1OOAA 1RZGA 1PZ5A 4Q9CA 4KU1A 4P5MA 1AKJD 4MX7A 3PV6B 5E6YA 3LB6C 2Q8AL 4P57A 5E94A 4ZS6C 5BZWA 4Q6IB 1SEBB 1WFTA 5FV1L 1ULVA 3BKYH 4HUUB 1ZXQA 3ZL4H 3N1QC 4P9ML 4LLDA 4I48B 3HTLX 5IEKB 5CGYC 3U4EB 2PO6D 3QDJB 2F5AL 4G8EB 4HMCA 4NUJA 4X6CA 2EZ0D 4NQEE 4Z7NE 5L2KA 3IFPA 4L8BA 1F97A 3DO3A 2O5ZH 2HFTA 4PBXA 3CLEL 2R4SH 5FGCB 2Z92A 3EYSL 1HHIA 2ESVB 5J56B 1TCMA 5D1ZC 5MERB 5TQ0L 3C2SA 5T3ZH 3SJVD 2W1NA 1MCRA 3U9UB 5JDSA 2PKDA 4QXTB 2R56H 3LKQA 3DYMA 5DTFB 2R2HB 3L3DA 2AI0L 2CIIA 5HVHC 5HYEA 2FX9L 2VDPL 4O2EB 1GH7A 2CH8A 5DJYA 3MLYL 1OB1A 1GOFA 4PJ8D 1RUAH 4O51A 3ZYOA 1UKSA 2E7MA 3BKCH 3IDYC 4PJ5B 4D8PA 1IAKA 2EDTA 5BW7A 5KTEH 1QBAA 5I1GL 1SJHA 5I17A 4JZJA 1QACA 1RZFH 3MRFB 2DQDL 5E2TL 1KIRB 1J1PL 1LEKB 3SGDH 1AD0B 3QI9B 4GLRI 3EAKA 3FRUB 2BVUA 1OTSD 4P3DB 4IIQB 4LP5A 2AEIT 5EIIB 1JF6A 2DLHA 3LQZA 2YS4A 5DWUL 5DJXB 5C0DA 1U95A 1YY9D 2VNCA 3QJHB 4M6NL 4NC0B 1WIOA 4GMSL 4R97C 1ORSB 3GMNA 1G6RB 4NQEA 3CFDB 4JDZA 5GRYA 4G8IA 1W0WA 3NZ8A 2VAAA 3OR7B 4IMLB 1MFAH 3MV8A 3PDDA 3RVTD 4OSUH 5DQJA 1CVRA 4QHUA 2NPLX 3ARVA 1ETZB 2IALB 1XGUA 2Y9RT 3HR5B 4ACPA 1YEIL 5EWIL 4OBSA 4DEPC 4ONOA 1GHFL 3PL6C 1K8DB 2JELH 1CFSA 4U1HB 3WHXB 3NCYP 4HXAH 4XXDB 3L3GA 3PDOB 1VA9A 4PS4L 4PRDB 3VFVB 4FTVD 1CLCA 1ZTXL 1QSFA 2X05A 5JO5B 5T33L 2ITDB 3ARBD 5SWZD 1IZJA 2QQQA 3Q5OA 1C1EH 3D2UA 5HGAB 5TGBA 4OZ4B 2A83A 5IQ7L 2GIYA 5TF0A 1GOHA 4FZ8H 4NZJA 1GGYA 4NQTA 3MCKA 2BHUA 3O2DL 4GKSB 2XACC 1BQLH 5SWSB 1WCBA 4P2RD 3E6HB 4QXGH 3FQXB 3BDBA 4GBXB 5E99L 4AJ0A 2P5WD 4O5LL 1T20B 4XCFL 2P5WB 4DKEL 3TJHD 4W4NA 4D94A 1DUZA 4NKIH 4UOW0 4G6KL 3FFDA 1DVFC 5E9DA 1JNJA 1BPVA 1U8KB 3IB4A 1CLZL 3NCBB 1MJJA 3HUJA 1ZVYA 4NO3A 4S1SL 3RWFB 1BWMA 5GGSB 3WLWD 1W0VA 1XF4A 4M9PA 4LLAA 4DCQB 1BGXL 1Z5LA 2W9DL 2VDLH 3VXSB 1FVCB 5E70A 1HEZA 2OP4L 4BFBD 1FVDB 3L6FB 4JCMA 5MEPA 3EFDH 5D6DC 1CFQB 3E1F1 1QEWA 2WBJA 5L88H 1M7XA 5DFVC 1UKQA 1R5VB 4TSCH 3RAJH 5JOPE 5IVZA 4CAGA 1KB9J 3MOAH 1YQ2A 3MBXH 4HZLB 5E8NB 3U7WH 3O9WB 1CQKA 1JF1B 3VDBA 2CSPA 3RWGB 3T08A 4QNPE 3C8DA 5J6HA 4ZXBB 3JWNC 1E6OL 1LP9B 4HS3A 4DFIA 3TBYA 4X0KA 3CFCH 1WIPA 3KGRA 4X99B 4QHKI 3MXWL 5J1AA 5F9JA 4YDIL 3MV11 2DMCA 5D5MF 3ALWA 4GAFB 5IFJA 5FCSH 2Y5EA 2NY6B 5EBMB 3GSWB 2ZG3A 4Q0XL 1G7PA 2MKWA 5E6IC 1ZHNA 1QNZH 2I60L 4P2OD 3TN0D 1WITA 1YEGL 1T4KA 3FHAA 4HKXB 3ZT6A 4H1LG 2H26A 3VWKD 5GS1A 1VFBA 2NY7L 2FR4A 2FSEB 3DVIA 2IQ9H 1EIBA 1OWWA 2QKIB 3VD4A 2X2YA 4P3CL 1JBJA 3QCTH 2GI7A 5E9DE 1G7JB 1W72L 5CFHA 5JW3L 4WFFE 2V6HA 2VSDA 3NACL 1OM3L 4IRSC 5J4MA 2UWEA 3CFKB 5C0AB 3SDAC 4AEHH 4D9QE 4R8WH 3OKLA 1U6AL 1TVDA 4OZFA 5FYLD 5IESH 4R0LC 2J3SA 3ZYIA 4JM2A 5HHXL 4NQDB 3HCVB 4OQ1A 4U6YB 4PV9B 2YZ8A 4Z7WA 4BZ2H 3ZE1E 5IR1B 4I77H 1XR8A 5HI3C 2F58H 2CMRL 4XBPA 1N59B 3W39B 43C9B 2NY3C 4JRXE 1FC2D 4ZG1A 4OFYA 2VQUA 3BPOC 4RGMB 3ARWA 1T1WB 4PJIF 2EDWA 4ZTOH 1EFXA 2IGFL 2QHLA 3WS6A 3LKRA 4U6XA 4X7SH 1YNKL 4ZPVB 3UEZA 2DWEB 3DVNA 2IALA 5IV2A 4PV8B 2AJSH 1NDGB 3LH2H 5ISZD 1MHCB 5GGRB 3F7YB 5I1CH 4LKXB 3BZEB 3MLTA 3WFHA 5KAQF 2DTML 1EEYB 3MRRA 4TUKH 3MRDA 4I0CC 2XY2A 4NHCL 5DJ2A 3BD3A 4LVOB 1QFUL 4XTRD 3V7MA 1JI1A 1NGXA 2EEBA 3SDAB 3GJFA 1YEDA 4PGBB 2YD8A 2UY7A 5SWZA 1RU9L 4Y19E 3B9KC 4X9BA 3D2UD 5HYJA 4LNRA 5D1XB 1A3RH 2A73B 3CD4A 5EH1A 2ZJSL 4QHLA 1A7PL 3PDOA 2WBKA 1UJ3C 5C0CB 2GEEA 2YD5A 4WTWA 1QSEE 2ADJB 1JHTB 2YA2A 2ATPB 2ICEA 1UJ3B 1EA9C 1FLRH 3PABA 3ARTA 3GSRA 2G2RA 4G6MH 5CWSB 4HJGB 4O2EA 1KFAL 4NRXA 1AJ7L 5FUZL 3ULVC 1TQCB 4HAFA 3ROLB 3QWOB 3GSOA 5GIRB 2VUOA 3EYFA 2VISA 5DZOA 3H9SE 3TIEB 4EIZC 1WAAF 3KJ4B 4F7CB 3P4OB 4KPHH 1N0LA 1RVFH 4LSPL 3DGCR 4PJGA 4XNXH 3DIFA 1UM5L 5EBGA 2LE9A 3SO5A 4IRJA 4PJXA 2BVOA 1LDPL 4M7LT 2JB5L 4MNGE 4HDIA 1XIWA 3RNKA 3QYCA 1CFTB 4S1SH 2W92A 2G5BA 5IEHA 1BD2D 1NJ9B 3KXFA 3TN0A 5LJYH 2YPKB 1JL8A 1B9ZA 4WU5B 2IPUK 3KPMA 4H25B 1DQTA 4RGOH 1I85A 3KG5A 4K9EH 3QH3A 1M05B 1U8LA 1JI2A 4MGXA 3ZKQD 4ZTPL 4MSWB 1JYWA 3RWJA 3EOTH 3MFGB 4LRNL 2VLKB 4MB3A 3PJSA 3G08A 1AIFB 1U8HB 1FGVH 4EEEA 5BOPA 4KMQA 5F9OL 2K7QA 4CMMA 4HMDA 3F7VA 3I3EA 4YPGB 4LCCC 1A5FL 4GXVL 3U4BL 3Q6GL 7CGTA 5CS7A 4DKFH 5EU5B 3V0VB 1NC2D 4J8RA 2H2SD 1KYOJ 1ED3B 4PD4J 4BUGA 1IM9B 4R6UA 2LVCA 5T1KB 1M7IB 5KSAB 4JHAL 3MNZB 4FFVC 3FO0H 3B6SB 4DGYH 4M7ZC 2G5RA 3MNWB 2J8UF 2L4OA 2QQNL 1QHOA 2VL5B 3ROOB 1ADQA 5FV2A 4GKNB 3MJ9H 3GMOA 1XGQA 4ODVH 4QRPA 4ORGA 3FQXA 3RWIA 3CFJB 1UXWA 4JKMA 2H32H 4YDVB 1X5GA 5DK3A 2GQHA 5C0CD 1NMAH 2CKBA 1BFTA 2CUMA 2VDLL 2XA3A 5DVOA 2WBJB 2H2SC 5CGMA 4WNQB 2VZSA 1KN2H 4H88H 2X4SA 1OQOA 1NFKA 5FAAA 2BNQB 1YUHA 2IBBA 1P7KA 3L3GB 1M7DB 3RY6C 4PRIB 5A40E 5CINH 3SDXF 4HF5L 5EBLB 2Q7YA 3HFML 1JRHI 5MHSE 5CD5D 4TVPL 5I0ZA 1FPTL 4DTGH 5J1SC 4DK3A 1MRCL 3P9MB 5ID0B 1CU4H 3WN5A 3QNYB 4M62H 3LN5A 1LHZA 5E8NA 4AL8H 4NYLA 3NA9L 4PIRF 1PSKL 4U2YA 4ZQKA 2ICWB 4HUWA 4DAGL 1N8ZA 2MHAA 4G6FB 3ES6A 3L3OB 4JQIL 3I84A 4AIOA 4HQQL 4UIKH 4Q6YA 2PTTB 2X1OA 3O3BA 4PLOB 4F3FA 4I0KA 3IDXL 1MIML 4LDEB 5GSRA 1A7RH 5EOCH 1JN6B 1EEYA 1FZKB 1TNMA 1GGBH 1BOYA 3QIBD 3WJJC 1DSFL 4BA8A 5C2BH 4OQTH 5TDNA 3G6DL 5LKNA 4G8GB 2AXHA 3NCEB 4L4TB 3QZWA 4ODUB 3OKMA 3BP7A 5ITBL 4NKIL 1NANI 4N1CA 3IFLL 3UYRL 1UB5B 4OLYL 5E99H 1DUYB 4N1HB 5DJDB 4K9EC 2F54B 3SGDI 3BKYL 1T1XB 3DBXB 3REVB 1H3VA 3X11B 3FOLB 5TJWK 3DV6B 1WAAE 5HVGB 2ADIA 3UBXA 3HPLB 5BS0A 5E8OA 4PY7A 3V0WH 1MCBA 4KHTH 4Y89A 5J8OA 3KPSE 4M00A 4PJGB 4Y16D 5J6GB 2Z93A 1UB6A 4IS6B 2HT3C 2OLDA 4MXQC 1FN4B 2EDLA 3ZDZE 1AHWB 2QBWA 1OAZH 2G75B 4M48H 3MJ9L 5HSFA 4AQ1B 4FTVE 3IJYA 2R0WL 1LE9B 32C2A 1S3KH 4NDMA 5EZJA 5IJVB 4Y4HD 1AQKL 4WHTB 4M1GL 2NTFB 2FIKB 3ARSA 1OCWL 1S7TB 1LQSR 1K5NA 1PEZA 4DFHA 2OQJB 4URTB 2BVYA 1XCQB 4NOBA 2NTSP 4CL7A 2O5XL 1R3JA 3WUZA 1HHHB 3FQWA 4JKPH 4AT6A 3ARRA 4WW1B 2WANA 1OY3B 5T3ZL 4OCSH 4PJ5D 4F7EA 1KLGA 3SE3C 2Y72A 3SPVA 3PWNB 2O61B 2X4RB 2OCFD 1Q9OA 4OFDA 4XCCL 4HC1L 1FRGH 4FQXD 4M61A 5JNYA 4ZOAA 4GG6A 4QRRE 4Z0XA 3RL1A 4NZTH 5FUOH 5FFLA 2H41A 4NQXA 4NSKA 3WIHL 5IM7A 2NY6C 1INDH 3ELAT 3PHOB 5EN2A 3QNZA 2CDGB 1D5MB 2AKRB 2DYPA 2ADJA 1ORQA 1RUQH 3ZE1F 3HPJB 4PG9B 1FNEB 3GBMH 2V2TB 3DRTA 5JQHC 1PJ9A 1LMKA 2OI9C 4DWHA 3WS3B 3KPRA 4E41A 2DQFB 2QR0A 3IU3A 1XZ0A 4NN7C 1FYTA 4BQCA 2CRYA 4NFBA 5HHPA 2O5ZL 3SDCC 2FJFA 3EOBB 3MNVA 5GS2H 3MJ8B 4OKVB 4Y4FD 1J10A 4GAJH 3ALXA 5E8DL 3BH9B 4XT1C 5D6CA 4OT1H 3VWJC 3GSVB 2BC4A 5MEQA 2IJ0C 4MD5B 5BXFA 4OIIL 1EAPA 1BZQK 3BW9B 3PF2A 4Z7QF 3WKNA 3T0EA 3QNYA 3HZMA 1ES0B 3G5YA 5MHSD 5J7CC 1DQLH 2CO6B 4H0IA 1T1XA 3REVA 1P2CA 2PF6A 1G7QA 5D7LA 2LV4A 3ZTNH 4WCYL 4LIQH 1A6WH 5TE7H 2HLAA 1CR9L 4LKCB 1MCDA 4XPAH 3RNQB 4DVRL 1U3HD 1H5BB 2J5LB 4K8RC 1RFDH 5JHLL 3SKJH 1ZT4B 3VFPB 3K2UL 3L5IA 1BFVL 2JJSA 1OAQH 4HLZG 2GJ6D 1NCTA 5F3HA 1H8NA 3OX8A 5DRZA 5DDHB 3GHBL 3ZSSA 3BISA 4WFFD 3UPRA 3WUWA 3FQNA 4G42A 3QRFM 2Q7NA 4JHZA 3LY6A 1FL3A 3OWEA 1AGCB 4NN6C 3IKCA 3GMLA 3O4LB 1DLHA 1I1AA 1UXWB 4YDVA 5IGXH 3WFBH 2XG4A 1DJSA 4HIIB 2A6JB 4PRBA 3HKFA 3MA7B 4DGVH 4FQXB 3TN0B 2G9HB 3QQ4A 5F3BB 1MFCL 5KG9B 3W0WE 3G6AA 3AAZA 1F3DH 3UTQA 2XWJA 4JJHA 2GJ6E 4P4RB 4AT6B 4ODSH 1MJ7L 4S1QL 3TV3L 4MNGB 1BIIB 4OCSL 2IC2A 3UTSA 5CJOL 5EU6A 35C8H 5DMGD 2EE6A 1R3HB 1YN6B 2ATKA 5CD5C 2E6QA 2W9LA 3C5ZB 5GGVL 2EH8L 3JUYA 1MCNA 5SWSD 3ZKND 5CCKH 2BJML 4BKLA 1YMMD 1BVZA 1CCZA 1FZOA 1I3VA 2EO9A 2KZWA 4GG6B 3B2UD 4KRPB 32C2B 4YBQC 1I7UB 3SN6N 3NZ8B 5JHDA 3FOMB 4YXKL 2FEEL 5DEFB 2V7HA 2OR9H 3BKJH 3WD5L 2PYED 1PKQA 1SVZA 3PJSB 5F1SA 4PRNB 4H1LB 3EOTL 1BQSA 1PYWA 3MBED 1KPVB 2CRIA 1SEQL 3BN9C 4UT6L 2R8SH 4U1JA 4PB9L 5C08A 3NIDE 3CSGA 5IBUB 1J1PH 3VXNB 1RJZA 3AVEA 3VU2A 3OKKA 4E5XB 4JO2H 2N7AA 4XXDA 5CUSH 5CSBA 4CMHB 5D8JH 3P9LA 1Y18B 3QDMD 3RVXD 4XAKE 2DQUL 5DA4A 1RMFL 3OG4B 3BEVA 4JQXC 4JRYE 3X17A 5IVXF 3BGMB 1OTTD 1UYWH 5FO7B 5L88L 3VMPA 5E8DH 3TO4D 4WTZG 3U83A 3MRMA 3VFTB 1KPUA 4Z0XB 1N5YH 2V7NB 3MRNB 2XZCH 4N0CD 3VXUB 1MPAH 3TBVA 1KELH 1NL0L 1A6AB 3HAEG 5C0FB 3VDCA 3H0TA 4HFWA 5FGBC 3PGDB 2VR5A 4LHUA 3QO1B 4PJEA 3BYTA 1D9KA 2BY3A 1UZ6F 5E2VH 3TO2A 3TVMA 4F7PB 3OKNA 5AYQA 3STZA 2YC1B 5CUSL 1KENL 2Z4QB 4P5KB 1VKXB 3N9GL 2HWZL 3KS0J 4JRWA 3C9NA 4WFHE 1MVUB 2YKLH 2H32B 5L7XL 4TPRL 2C3VA 5JLZA 3D6GA 4R90H 4L3CA 4BFIA 3VXTB 1J0IA 1WBXA 3ESVF 5MP6L 3RGVB 5DTFA 4IHOB 1AP2A 4YHMH 4UTAL 3N85L 1E27A 3KVQA 3QCVH 5KOMC 3AB0C 4JG1L 1OAYL 4PTUB 4BM7A 3QDJD 5E08H 3R0MA 3BIKB 2BJMH 2EXYC 4IOIB 4XCCH 5IJKC 4LHUG 2NXYC 5J89A 4WO4A 5MEOA 4NRYB 5E4EC 4JRXD 1FO0H 4N9GB 1V7NL 5FKPA 5BVJA 1XGYH 2IPUG 1AD0A 4NNYA 4Y5VC 3KPPB 2QJDA 3T2NL 2ATKB 2ZNXA 4XMKL 2O5XH 1IAKB 4Y2DC 2R29L 3ARBA 3DSNA 1AD9A 3JV4A 5AG8A 1RURL 3UXFA 4WV1B 1G7MA 2X4TB 3JV6B 1RD6A 4K2UL 3ULSA 5CBEB 1JWSB 4FABH 4CU8A 2VDNH 2BCKA 2ZUYA 3MV8D 2E7LA 1F4XH 3TNMA 2A74B 3QUYB 2G9HA 2W60B 3QQ4B 4HKZB 2FWOA 25C8L 5F3BA 3HE7B 1CD1B 5JW4N 5GRUH 1DE4A 4J3OC 3WO4C 5GGRA 4XH2A 3QI9A 3U36A 3EDFA 4WI2A 1INEL 1ITBB 4GXVH 3U4BH 1EEZA 5ACLA 4G7YL 4KGLA 4XPAL 3QEUB 3FB5B 2DM2A 4Z7UF 4FQIL 3BPCA 3HUJE 1GL4B 3BKCL 4DQOL 5B3JF 2HMIC 1G7LA 4FQ2L 4J2XA 1I9EA 2HFEA 3TBWB 2VKWA 5HYSG 1BIIA 3CX5K 2LAGB 3BP5A 3MV01 4K9EL 1JHKL 3F7RA 3F65A 3GI8H 3D18A 4OV5A 1MCLA 3RUGE 3GJEA 4WV1C 1AFVL 3CAFA 3ZDXE 3ZYJA 5IHLB 3FN0L 4JPKL 4M7KH 4XAWL 1TCRA 1HYSD 4FQCH 3G6JE 1CL7I 1NLDL 2HKHH 4Y4KC 2P5WA 4QTIL 4PRID 5F7EH 1OSPL 3AS1A 5AZEH 4HX1A 3EYOA 5HY9B 5EO0B 1QBBA 4FTVB 2PYFB 3P4NA 2DL2A 4YHZL 3QXTA 3CIQA 4OCNC 4GRWF 3U46A 2BOBB 5C71A 5TE6L 5KSAC 1G84A 5HHPB 2MWCA 1WGOA 3QIBB 1DBKL 4TNWK 5EBMA 2GTZA 4YHKH 3HUJB 2DQFA 3CX5J 4N9OB 1LO3H 4NNPH 3AAZB 3C6LC 4PR5A 4ZS7L 4LPYA 1N26A 2XQBH 3M45A 2ESVD 4PRPE 1DL7L 2VLRA 5DQ9B 3TYGL 3QIUC 3MJ8A 4YC2C 4HIIA 1S7WA 2FX7H 1JCKA 4Z76B 5E2WH 5CD3B 4NKMA 4WEUD 2ZOLB 4NCC2 2VZTA 1PBYA 5HYSB 3KPRE 2YN3A 5MEQB 3D1MC 4KZDL 1BX2B 2FB4L 1N3NA 3I3BA 2C4FU 5B39A 3GRWH 2ZUQB 4N0CC 1NLBL 4LHUD 4CW1A 2D7TH 3FO9A 4XVTH 4D0DA 25C8H 3QUZB 1F6AB 3PHSA 3ZYZA 4X5WA 1Z9MA 3E2HC 1QRND 5DJYB 4JREB 3TWCL 5I1JL 2AW2A 3MLXL 3S96A 1UM6H 4BH7B 3EBAA 4LEXH 5I73C 1ZVSB 1EHXA 4ZUWA 3RIAF 1S7UB 3OKDB 2NW3B 1MHHB 1QFHA 2F58L 2AK4A 4XPFH 2HRLA 5ESVA 2X4OA 4F9LC 4X7EC 2YSSA 4YDLB 3BRDA 4IMKA 5ISZA 2Z35A 5IB3B 5DRXA 1BFVH 4KKCD 4CNIB 3D85A 3EOAA 3I9GL 2I5YL 4JRXA 1RZ7L 1GRWA 5CJQH 2CD0A 3LAFA 3BZ4A 3S5LA 3I6LE 5TPWH 5CZXC 5J57B 3BZFA 4LSRH 2A6KB 1WZ1H 1B0GA 4LCYA 4EN3C 3RU8H 3X13B 3HI1A 3MREA 2YKLL 3GJFK 3SDXB 1UWEH 3FT2B 4HCRL 4OLXH 2AI0H 4JPVH 3KHQA 4DUXA 5HYJB 1QZ1A 1RIVL 4OM1L 1CDUA 4KJPC 3T65B 1LE5B 2IAND 3SKMB 2AJZA 1EHNA 5I1GH 1GPOL 2DKSA 4EXPX 1TETH 1JPFB 2NLJB 2F53D 4DOHE 1DSFH 2UWEB 2O26U 2VABB 4JZOA 5F72S 3UO1H 2WP3O 4G9FB 1J1XL 4LCUB 1XF5B 3STBA 4G9FD 5DJ8A 5C07A 5ALCH 4JFEA 3RDTC 2AJ3A 4P9HC 3UROR 1FZJB 1T80A 1H3GA 4HV8B 5D7KD 1XT5A 3IVKA 4J6RL 3ABZA 3HZKB 3JXAA 3ECBA 4HPYL 2IANE 3IDGA 5DVMA 4KUCD 1TVHA 3WE6A 1JV5B 5AYUL 1IGTB 4KI1A 2DMBA 1MIEL 3B5GA 5GRJL 4JY5H 1ZT7B 4XC3L 2ID5A 2J8UE 1P84K 1L4IA 1T22A 3Q2CA 1TETL 5AEAA 4FA8A 4Q6IC 2D7OA 1JWUB 4NC1C 5B39G 3VFRA 4RMQA 1PG7L 3BP7B 1EV2E 1S8DB 1JGDA 4MJ5A 1PX3A 5DD0L 4BQ9A 3PXJA 2WWKT 3VXMD 4NNXA 5JMRA 1FRGL 3FT3B 3BGFB 4PRIA 5B38A 1UQSA 1IKNC 5JIKA 1UEYA 5FM4A 2YEZB 5FYJL 4F8QA 3QDMB 4P57B 1G0DA 4WW2B 4FQHA 4LPWA 3WKML 5FIEA 3EO0B 4JFDD 1MWAH 4I3SH 1FNGA 2DF3A 3QZWG 4WUUE 1VACB 5IT2L 2EIEA 4PB0H 5BZDA 1S9XA 5D1XD 2R8SL 3K46A 4X9GA 3HA0A 3NIGE 2O5YL 4HX1B 4QXGL 1MUJA 3NVQA 1BLNB 1U8IB 1LEGA 3TNMB 4U6HA 4IOSD 4RIRA 1TTFA 3RZWA 2VJXA 3P11L 4YFDB 1XF3B 4UDUB 5JW4Q 4O2FB 4YXKH 3P77A 2DBLH 1FJ1A 1A9BB 5EIVA 4DGIH 4ORZC 1TDQA 1R0AH 4RX4D 1D3CA 2GJ6B 3QUMH 2Y25A 4HS3B 4HJJH 5DUPL 4JQVA 4BZ2L 5FXCH 4PRPD 3SDCA 2MNUA 2D7MA 1B4JH 4JZNB 4LGSB 3HNSL 5EC2A 1ONQB 3MYJA 1K3ZA 3FAWA 3S37H 3S35L 2VAJA 2WBJC 1L0XA 3CH1B 2Q87A 3LDBB 1U3HB 5JW3H 3GHBH 4ZNEE 4GMTL 4CMMB 1OAYH 1BVKB 3BT2H 3MUGA 4OGYL 3L5WB 2KKQA 3EO9L 3EKCA 3TT3L 5KAQG 1B6DA 2ZCKH 1LO3L 1T2QL 3KJ4C 4S10A 3O2WL 1Q72L 1KEMH 2NY1B 3CDFA 2ICWJ 1MFEH 2R2BA 4ZAKD 3TA3C 4NO0D 1KTKE 3UDWA 4N0YL 3TT1L 4OFKA 3RWIB 3G5XA 1X44A 3PP4L 1EFQA 3B2VH 4GXUN 3ZHDA 4LDLB 3V0VA 4E0RB 1DUZB 2AVGA 2R39A 1IC1A 1ED3A 2PXYD 1I4FB 3FRPG 4ZXBD 4QRRD 4L8SB 1OSPH 4M6OH 1DE4B 5LGKA 3BJLA 4WJ5A 4OCMC 3JV5A 3WV0A 1BECA 3VFUB 3FTGA 1AQDA 3RY4A 4BSWB 3NA4A 2ENSA 2GHWB 1ZSDB 4DN4H 3EJYC 4YEEA 1BJMA 3X14A 1Q9OB 3QXUA 2NY5H 2BSTB 3CDCA 5GGTL 3UJIL 2HT3D 1OPGH 1OARH 4UTBH 3K74B 3DRTB 3TH2T 5C09D 1J0JA 1DQQB 2VLLB 2IH1A 5CSZA 2GJJA 4JLRA 1E4JA 2XICA 3CVHA 5TE4L 3S88H 4AEFA 3RJDA 5SWZB 2BMKB 3PGFL 4X98A 1UVQA 4JPIB 3VCLB 3BO8A 1Y0LB 5HHNB 2HT4C 1NSNH 4I3GA 4F2MA 2WWMC 5DD5L 5EZLB 1B3JA 3T0XA 1X4ZA 4HUXA 4JAMB 1OGAB 2F19L 1YNKH 1N4XL 1H9VA 3PABB 3HLAB 2HN7A 4MJIA 1R3IH 3HZVB 4NQEB 2PN5A 3CNKA 2P8PB 5HYQA 1H5BC 1MCJA 1Z0MA 4TVSa 4D3CH 4XX1E 5GIRA 4XP6H 3M8OL 5I17B 2CMRH 1IBGL 5MERA 2JJTA 2XXMB 1OAKH 1YMMB 3D3VE 2ARJA 2AK4B 3KR3H 5B8CC 4X4MA 1LEKA 4KTEH 4R3SB 4PS4H 1MAKA 4TRPH 2DQJH 1DQDL 1C5CL 3R1GL 1UJTA 5DMGC 4OCRH 4WDIB 5FYJU 1UENA 5DD6B 4WTZA 4AEHL 5KJRH 1CGYA 3KPLA 3FT3A 1DQDH 3MXVL 3DJ9A 1ZS8B 3L3IB 2BHZA 3BWUC 1J87A 2D0HA 3HCVA 5IMLA 2IG2L 5E6IB 1JRHL 3SGEI 3MLZH 1U2HA 5C70A 3LKQB 4U6VL 2EE2A 5C0GB 3QRGH 2CLVA 4FNLL 1SJEB 2V5YA 5B39B 4GKZB 2WM0A 2GITB 1CYGA 1I1YA 1T1YB 1NC4B 5L6YL 2ZUVA 2W07A 1S3KL 5HD8C 5H2BA 3LPWA 5D70L 3BESR 1G7HA 2D9CA 4FRWA 4EN3B 5EPMB 4BH8A 3D85B 1EERB 3IDGB 5F7DB 1B6UA 4FFZL 1A9EA 3SOBL 4OJFH 3O8XA 4KUZH 3EYUL 3DV4A 5IHUL 5K9QI 1GAFH 1MCFA 2QQLH 4UINH 3CFCL 2DJSA 3DTXA 3CH1A 5TFSL 3MCG1 1RJCA 3MOBL 3GMQA 5C0ND 3FONA 4JDVB 3L95A 3G5ZA 3MMEA 4X5WB 3UP1A 3BVNB 4GS7B 3SDCB 5GZND 3ZE0F 4NP4L 1X7QA 5D1ZA 2OYPA 4A2MA 5DD0H 5DHYB 4Z5RB 5HYFA 3SE8H 3NIFF 4HIJA 4YHLL 3RZCC 3DLQR 5FHAH 3QO0B 5DEFA 1AO7B 5JA9A 2R69L 1JUFB 3QUKA 1S78D 4LGRB 2N4IA 3OAZK 3C09C 5CEYB 1TZHB 4UU9A 3EO1A 1RAMA 4HWEH 4Y4FC 3I02B 4K8RD 3ARZA 5FDYA 3VI3E 5I1DB 3QXAA 2QADB 4A6YA 3KYAA 3MUJA 1PSKH 5GRJH 5LQBH 2BNQD 4BZ1L 2N56A 3DMMC 1J05A 5JORA 2F5BH 1G7IB 4PLKC 3BQUC 1EFXB 3ARED 3IETA 3LPFA 4PGJA 1FNHA 5DC0A 4ZAKA 3RWCA 1L9NA 3WS3A 4WWID 4LARH 3VXOA 1A6UL 3U1SL 2MQ3A 5K9OA 1YQVH 2V5RA 5L9DH 4UT6H 3WNNA 3GB7A 1A7OL 4WWKD 1MQKH 3V6OE 3RTQB 3ZL4L 5I1EL 3TPKA 4EBQH 4O2CB 3H6JA 4FS0A 2GJ6A 5HBBA 2EIBA 4XHJC 4IIQC 2W9EL 1YEHH 5C09E 4HK0A 3QHFH 1FL3B 3RWGA 5H37H 5JQ6L 5I8CB 2EEDA 5IVZB 1WISA 3IU4H 4XNMB 4PJEF 3DETD 2X6MA 4PRBB 4H5SB 4PYHA 4QY8A 1LO5A 3MRQA 3SDDB 1N6QL 5GSVA 4P23D 1JJUA 3WE6B 5EFIB 3W81A 4KJYA 3HRPA 4DUWA 2A2QT 1NGYB 4QTHA 4TUJB 5SWZE 4GAYA 4PJAB 3UTSB 1LEIB 3MA9L 1BF8A 1WWCA 3CDGB 4YX2H 3NZHH 5MEPB 1MFCH 1XF1A 4P23C 5J11C 1WJ3A 4GRWH 3FQUB 4OSUL 4JCLA 5L2JA 3LMJL 5T3XL 3VD3A 4PJ7E 4JO1H 4JR9H 2BOCB 4D0CB 3PQYA 3ARDC 3V0AC 1IM3B 2HH0L 1X3DA 4MLSA 3WNKA 4GRLC 4HH9B 1NFDE 4C55A 3P0YL 4UDTB 3IDYB 3UPRB 3DPBA 4RGNE 5AZ2L 1TZIA 5CP7A 2AK4E 3FCTA 4Z7OF 4OI7A 2VXTH 3RVWC 3U4AA 4R4FH 3CCHA 1S9XB 3JTSB 4PJXE 4H20H 5D96B 3CFJA 4GUPA 4YXHH 4BSVA 3KYMB 4K7FA 4V1DB 1MCPL 4TNVK 1OP5H 5I8KL 4NWTL 2J8UB 5IMLB 3ZT5A 3IAPA 4CBPA 4Q9RH 2X4QA 3D3VD 5C0GA 4AENA 4P5TB 4TPRH 5LGHL 4XNYL 3QDGD 3O6LL 4CDHA 5EU4B 2ZCHL 4LNRB 4ODXA 5JA8B 3QFJB 1KB5H 1K5NB 1TIUA 5CJ8A 1A6UH 3U1SH 5IFAH 1H8SA 4XTRC 3Q5YA 2EDKA 3OKEA 5I76B 3HE7A 4OCWL 5DS8B 1NFIA 5EUKA 4LASL 3ZDYE 4BZ1H 5JHDD 2VLRE 2YA1A 3EZJB 5HI5C 5HPOA 2Y7QA 2O61A 3EDEA 5I1AB 1A1MA 3MRHA 2BVQB 1N2RA 2DBJA 3LKPB 4K94H 4HQQH 1FZMA 2FO1A 4M61B 4O58H 2GFBA 4HXBL 5I2IA 1E4XL 3QXDA 5F1OB 4AK1A 4XPTL 4XCFH 5H94B 3OAYK 4WIQA 4DKEH 5JPMB 4PJIE 5KVMC 2FX8H 2EDBA 4XNYH 4MAYA 5I74C 4I0PA 3UC0H 3VXRB 3IDNA 3U9PL 3VXQB 5DGQA 4FFWC 4JDVA 5ID1B 4X4YA 1I3GL 4OF7A 5E0QA 2E5EA 2QTEA 3CSYB 5JHDE 1SM3L 5ICXB 3MLVL 2BRRH 4JM4H 2X4SB 4PJ8C 4APQC 3FT4A 4OI8A 1WWWX 4NIKB 5FF6B 1FYHB 4PTUA 3VGGA 1OB1B 4KQ3L 3RVVD 1FCCA 3TIEA 1CBVL 2NX5E 4K3HA 4QWWD 2EXYD 4EVNB 1TJGL 3VXUA 4NRYA 5E8OB 2C1PA 1AQDB 2G60L 3C6LB 4CVXB 1QRNE 1ZHKA 2GITA 5DUMH 1UB6B 3I9GH 2YA0A 4NBXB 5JLZB 4CUCA 5GRZA 1H3TA 2GT9B 4KROD 4LVNB 4U1KA 5CLWA 3IRPX 5DD3L 3PL6D 3G9VA 4MJ6A 1UXSB 2VITB 4Y2DB 2IGFH 1AQKH 4QRUA 4RGNC 1RIHH 3OR6B 3S37L 4Y19B 1MSPA 4JLRB 1BVLB 1KPRA 1UZ8B 3QIBA 5HTSA 4ZO6A 2J4WL 3A67H 1WT5C 3C8HA 5LBSH 1MOEA 4M02A 1DBJL 4HUKB 4TSAH 5I1KL 4QY8B 4CVZB 2GTWB 4PRPB 1CD1A 3IU4L 3I2CH 2D03L 5I8CA 2DICA 1NUNB 3MJ7B 3OPZH 5L0QC 4UT9L 1FO0L 3CVHL 5IF0A 3LKOA 4PJIA 4N5UA 3LRSA 3JSSA 2B7DT 2LVEA 3MRCB 4X6CF 3EFFB 5CEYA 4FOMA 5J3HC 2HG5A 8FABA 1KCLA 2YK1H 5ANME 4KY1L 1PAMA 1QPXA 2XIDA 2JIXD 2HRPL 3QJFB 4IOFC 3K4AA 3QT2A 3BMWA 4GKNA 4L3EB 4NT6B 1JZ8A 5B21A 5KN5A 2BCKB 2CR3A 5KSBA 2W0PA 2VC2L 3HC4H 5DXWA 3G6DH 1B2WH 4ZAKB 3LOWA 3MLSH 4JFEE 1CK0L 1HXYB 2VZ3A 5DR5L 3VWJA 2XKNA 5C0JB 4ZXBC 4C57C 4LF3A 1YEFH 4YFEA 3GRWA 3P0GB 3KNBB 2OL3A 1YYML 1BBJA 4QOKB 1D5IH 1C7TA 1SM3H 1AGEA 4KPHL 1YPZA 4XGZB 3ZE2F 1G7HB 5GZOC 1PZ5B 1Y6NR 1CFVH 1JVKA 4Z6AT 4YAQA 4FHBD 5DYOB 3NA9H 3FAXA 4LLUB 1XR9B 4HBCH 4K7PL 1XF4B 3EZ8A 3MRPA 4QO1A 1JYXA 4TTDC 2JTDA 5T1LA 2P1YA 3AS3A 1TZHA 5T3XE 2CK0H 2E8YA 4N0FB 1CGUA 5DJ6B 2VXVH 4Y1AE 1X5LA 2XV6B 2P5EB 1XF5A 1YEFL 1YJDH 3KHOA 1QSED 1F8TL 1CGVA 1JNHB 2YOCA 3MGTB 1S9WB 4FQ2H 4NNXB 3MTRA 3RWCB 1NCWH 2B2XL 3D0VA 3VXUD 1FG9C 4JFOB 4KI5D 4NO5A 2VDML 4DK6A 1LGVA 1U42A 4G6AD 4OJFL 4RMVA 2BNRB 3KWWB 2NY3B 2XY1A 4XXCC 2BVQA 1CICC 3PWJB 1ZT7A 1UM4L 3RVWD 1FHGA 1QYGL 3WNLA 4KI5C 5DEGB 4G80A 4X9IA 3MYZA 5HI4C 4YDKL 3K8LA 3V5DA 1QRNA 4PJ9C 2HVKB 2XRAH 2WUBH 4XVUC 3OR6A 4RFEA 1KEGL 1L7IL 3QFJE 4I2XE 2E9BA 5KW9H 3VD5A 2CXKA 4IRSA 4NZUH 2ESVE 3L7FB 2QSVA 3C08L 1FCGA 2R1YA 4X7FC 3T04D 4N8VA 5K93A 1MEXH 4M1GH 4LEXL 4NJ9L 5DF0A 4HIXH 2G5BB 5SWSE 5D7JD 3B9KB 4H26A 2XPGA 1J8KA 1MREH 2MMXA 1UM4H 5FA3B 2EC9T 3LS5H 1M6OA 4X6FA 5C6TL 2NY3D 3L1OL 2PR4H 4JO3H 1PLGH 3UTOA 2ADFH 2IANA 4P48A 1CDJA 4YH6A 2VH5L 2D7NA 1GIGL 2V7HB 3WCYA 3JV0A 1HIMH 4XRCA 1N6QH 4TQEL 1E4KC 4LP4A 3OKEB 3F5WA 5I76A 1CFSB 4U1HA 1G1CA 3FQWB 4PJDB 3BH8A 5F9DC 4LLMB 3LD8B 3QUYC 3KYMA 5EB9A 5ITBH 1FSKC 1D9KC 4X8JA 4NSKB 1KTDB 4LIQL 5C9JB 4JO4H 3D85D 1AJ7H 5FUZH 3GEWB 3DARA 2XWJB 4JRYD 3ILPA 4HUVB 4M3JA 1HZHH 2DQTH 3WHE1 4YC2B 2ZOKA 5I16B 4ZO8A 4K71B 1LP9E 3SPVB 1E6JL 3C5SB 3X3GH 3L3JB 5DJ0B 4QXWA 2AK1H 1EHLH 4P2YA 4PGDA 1FP5A 5DHXB 4KVCL 2HJFA 3I85A 3W9DB 1CDHA 1N59A 4LLWB 2ZNWA 1BM3H 1CF8H 3G6JB 1QKZH 5BV7L 1U58A 1IGIH 2FHCA 1D6VH 4V1DD 1HH9B 4JFQA 3EJJX 4WFEE 4ONGH 3T4AB 3X12A 4HF5H 4XX1G 1X5JA 2WMPA 5TDPB 3PWPB 3DSFL 4JFHE 5FCUL 1M71B 3QEGH 1KXTB 4LQ1A 3BP5B 4M03A 1AY1L 1C16B 1AHWA 3ETBF 2EKJA 1P4IH 1LNUB 1ND0B 1HWGB 1LVEA 4YHPB 1CE6A 3O3EA 1GZPA 4U6HB 1ERNA 3GIZH 4RBPK 3SGKA 4Y5XA 3OL2A 4I4WA 5TF1H 3BKJL 4QYOB 3U2SA 3GKZA 5DFVD 4UINL 5DMYA 1XR9A 2UYLA 5E1AB 4YUEH 3G5VB 4HUWB 1JTPA 2FSEA 3DHMA 3MODH 3NH7H 2PNDA 5D2NC 3BQUD 4FXGB 1N0XH 5GGUB 3O41A 1S9KC 1NMBH 4HULB 5F96H 2XWTB 2OL3H 1FBIH 5GGSY 4HT1L 4YFLI 1CN4A 1IZKA 4U33A 4QGYA 2EDYA 1UCBL 4HHAB 4U0QB 5EUOF 4KMTL 1MVFA 1BLNA 2E7BA 5HVFB 3TZVC 4G80B 3S34H 4X99A 1VPOL 3FB7A 4OI9A 3MRJA 3F62A 3T1FB 1OW0A 1BFSA 2XNAB 4K3JH 3GMRB 1DLHB 5BJTA 4O4YL 3S35X 2WLZA 3WSQH 2RR3A 5F9WC 3WKMH 1D5ZA 5TF1L 1LD9A 4RAVA 1EJOH 5HYSA 3OHXA 4WHDA 1NGPL 4JRYB 3GGWA 3BKMH 2IADA 2VDRH 3D39E 4YDJB 3MJ7A 1O5DT 1E27B 1A47A 2I9LA 3ME0A 2YXMA 4L8DA 3ZTNL 1HH6A 5HHME 5FYJH 3WIFB 2F19H 5MEOB 1SYSA 5ERWA 1IE5A 4ZFGH 1DQML 2FEDC 4MCZB 5ALBH 5BV7H 5BOZG 2X09A 5GXBB 3LKOB 4MD4B 4LSSL 1S7TA 3ARPA 5DQJB 1CDYA 4HXBH 3TM6A 4OTXH 2YD1A 5HHMB 3T8XB 5CEZH 3HAEH 4Y4KD 5J12B 1QG3A 2X44D 4C83A 3CSBA 1NCCL 2JCCB 3B43A 1OP3H 1FDLH 1T7VA 1QKZL 2G2RB 1FAIL 2LTQB 4OM0H 2DD8L 3TVMC 4MNHB 4R2GD 3U30B 4PRHA 3PNWB 5GGSA 5EULV 3VRJA 5EOQH 1IAMA 4UV7L 4X8JB 3QEQA 1OSZB 2DI7A 5E95B 2XZAH 1ZGLB 3TESA 1T83A 2Z4QA 2X4NB 4F57H 1D6EA 5KS9A 2OK0L 5DMKA 3O8XB 1BD2B 5KN5B 2YWYA 2NXYB 4RRPG 4IMKC 5FYLE 3RKPA 4XBEL 3I6KB 3PHQA 5SV3A 1ZHLB 4K3EL 4XVJH 4GQ9H 1FVEB 1C5BH 3LRGA 4ODUA 3MLTB 3WFHB 1A6AA 5C0FA 1KULA 4KUZL 1KN2L 4QXUL 4R26L 5DC9B 5DRNB 3RTQC 4J12A 3BXNA 1L6ZA 2NX5A 3L9RB 3WFCL 4X4XA 5CD3A 3V4VL 5B3NA 3DX9B 4RWYL 1YMHB 4XPHL 3L3HA 4MZ3A 4M6MH 4UB0L 2ZCKL 1KCUL 2BVPA 3GK8H 4O4YH 4OZIF 4OIAA 3EYVB 2HVJA 5JPNB 5LWYL 4AM0A 3MGTA 3IF1A 4HGKC 2PR4L 4YK4C 2YD7A 4ZQKB 2M2DA 3HE7C 4BKLB 2XN9B 4FZEH 4K07A 1P53A 4GW5A 5DJ6A 5CJXC 3T77A 2GJZA 4U0RC 3VDAA 4IRJD 4LK4A 1ZWIA 2NZ9D 4KV5E 5KJRL 3VFNB 1TFHA 1JIBA 1K8IB 5CEZD 1N5AA 1NUFA 3THMH 2UZIH 5GRVK 4KQ3H 3VXRE 3Q3GA 1FGNL 1W8NA 3MRGA 4ZTPH 1T89C 4ETYA 4QRPB 4U1MB 2NY7H 3WFBL 1S7SA 3OF6D 2EICA 2VDMH 3CCHB 3JTSA 1QOKA 1U8MA 5EDXA 4M93C 4L4VB 3BPLC 1P9MA 3FQNB 1BBDH 2CLZB 5HHOD 3TYFA 3MRIB 5KVGL 1QSVA 4X80L 4P2RB 4Q0XH 4B5EA 2RFXB 1UWGH 4OZGF 4EBQL 4M8QB 1XFPA 4CRPA 4I3RL 1S78C 4GW4A 3CFEA 3M07A 2BOCA 3LD8C 3QWRD 4OZGE 2V17L 4LOUC 4POYA 4JFZL 1FLTX 5IB1A 3N9GH 1OL0A 1AE6H 1BJ1J 4LSUH 2FO4B 4D0DB 1A6WL 5TE7L 3DECA 1S5IH 5E2UH 4P4RA 3ULUC 3FCTB 2DQEH 5T3XD 2M8XA 3LEXB 5L8LB 1HI6B 4K7PH 3GSXA 3DX8A 2A38A 4OCWH 1R5WA 2RCSH 1NBVL 2QQKL 1AFVH 2V9TA 2VWEC 2MCG1 3QUZD 4OLUH 1C08A 1Q0YL 2APXA 2CK0L 4EIGB 4M7ZB 1QTYT 4UBDD 1BEYL 1A3RL 5HDQH 1MCCA 4JY5L 4R4BB 1E28B 2HFFB 5CZVL 1ZOXA 4KK6C 5AWNH 4RQQA 4J3XA 3BN3B 4GRMB 4JJ5B 1MQ8A 4V2CB 3PIQA 3O4OC 3T0EE 1JZ2A 5D1XC 1VSCA 5BRZE 1FFPB 4LCCB 3WUWG 1SY6A 3U36B 5F7HA 2Y36L 3LEYL 1V7MH 2PO6A 1II4E 1MRDH 4EUPH 4HEME 4B0MM 3VH8A 2C1OB 4Y5YA 4JANA 1QSFE 4KJWC 1IAOA 1BZ9B 3VI3F 3QQ9C 1O7VA 4X9HA 1K2DA 4JQVC 3LQAL 2ED9A 3P4MB 4TUKL 1R3LB 3QPXL 4HUMB 5HHVL 3VFSB 2XNAA 2P43B 5GISH 3STLB 2D03H 4UNTA 3VG9B 4NZTL 5FUOL 4A6YH 1IGMH 5E8PB 2NY0B 4ZPTB 1E4WH 5TDPA 1PQZA 4I9WD 4GW1A 5C1MB 4FN0A 4FABL 3QG7L 1P1ZA 1FBIL 3B6SA 4UDUA 5F7NC 3QA3A 4DZ8B 2D31A 4BQBA 4WHYH 4ETQA 2HAZA 5EWIH 4WU7A 4TRPL 3GBLA 4RFOL 5E7BA 3T0DA 4GS7C 4CN4A 4JPWL 2OQJA 3LN4B 2EH7H 4DW2L 3NABH 4JG0L 4DKFL 5EU5A 2B0SH 3IT8D 3OB0K 3QCVL 1EJ6A 3QPXH 1HSAB 1NCBH 5ANMA 1KV3A 3SY0A 1KLGB 3T0AA 2FECL 2NX5D 4JDTL 5HHOA 1F5WA 2NX5B 5JZ7C 3GJFH 4HKBA 5TQ2L 3C6SB 4KJPD 4MZ2A 2IMNA 1EGJL 4RAUB 5CIPA 2XWTA 4D9RE 3VW3H 1M05A 3SQOL 2W65A 4IS6A 5ESVB 3MLVH 3WS6C 3O6ML 4QHLB 3JTTB 4JQXA 1ZA3B 5E03A 4LSVL 2NNAA 4HKJB 3I3DA 4YO0A 4FXGA 1HNFA 3RX5A 2AJXL 2NR6C 1G6RL 1NCWL 3T4YB 1WSST 1INQB 4XP5H 2XA8L 2VABA 3DRQB 1A0QH 4OBRA 4QEGA 3IFNH 3WNMA 5LVEA 1S5HA 3EGSA 4MAUH 4F57L 2EYTA 4RA3A 5GGQH 2NY5L 2DTSA 3X13A 5CZXD 1RUPL 1QFWM 3UJJH 4F15C 4HIEB 5D7IF 5DI8A 1SJVA 4FQXC 4PD4K 5CZVH 1B0WA 1U95B 3QJHA 3QDGA 5H2BB 1VEOA 1ZVSA 2I07A 3MRLB 3V4UL 3VXUE 2X9YA 4EDXB 1JGEA 4L8DB 4HPYH 1E4XH 4K7PY 2IBZX 2DQCL 2MFNA 3H7BB 3TFKD 3BHBA 4ELMB 2J6EA 3LPGA 4CNIA 3U4EA 3C2AL 4JFZH 4JREC 2R2CA 1UFUA 3SDYL 2P5EA 1KLUA 4UMGA 2HKFH 3LRHA 4BZYA 5ISZE 2AJZB 3QEQE 3ULVD 1T1ZB 4ELMF 5IW6B 1FPTH 1HILB 2R0LH 1FZMB 3I6GA 4HK3N 2QADD 4L9DA 4PJ7A 3MROB 3WDIA 5I18H 4MHHG 5ACMA 4CKVX 5J11B 1WICA 1AO7E 3O2VL 4CW1B 2ZG2A 2MTPA 1CFQA 5JDSB 4HWBA 2X1XR 5I1CL 4H88L 3RKDC 2BNRA 3KWWA 5EIIA 4K23H 4GMTH 2IH3B 5D7IB 4NQCA 4WI8A 1T66C 5SX4H 2AXGA 3VWKB 2LABA 4TSBL 4S1DD 1YEJL 3TZVA 5EU7E 3CC5B 1INEH 3FQRB 3ZE0E 2D31B 3FFDB 5E9DB 4G8EA 4WO4C 1TQCC 3OAUL 4KTEL 4EQ2A 4KVNH 4JPWH 5DRWB 3O2DA 5J1AB 4MQXD 1UCBH 1U93B 2BX5A 2RFXA 3SE3A 4LLYA 1X9QA 5EO1B 4WHYG 1H0DB 3KYOA 4MYWB 3L5HA 4JO1L 4MS8D 3QIUA 1FL6B 4JZJC 2KQMA 4C56A 2IPTL 3FZUC 3MV9E 3VRLE 5FECA 1R3KB 2EYRA 2YZ1A 2WW8A 3MRKA 6FABH 2YRPA 4ZFOL 4WI6A 4QXUH 3DVFA 5HPMA 1RY7B 3BOVA 1BZ7B 5HHVH 5BRZB 2P8MA 4QF1B 5CEXA 4KK5D 1V7NH 3CH8A 2BP3A 5EZLA 4NM8H 5INCA 1TJGH 4RWYH 4G8GD 1A3QA 1GYAA 1EH9A 5IOPB 2HJLA 5HGHA 1T83C 1RSFA 4I1NB 1DP0A 5K9JH 2VL5A 4KKAC 3BDYL 5JIPA 3QI9C 4RCAA 3K4DA 5MI0C 3CLFH 5IKCB 4MJID 1VFAA 1U8NB 1DLFH 4UTBL 1F2QA 3DXAE 3WFDH 2CIKA 3CFIC 1S7RB 1YNLH 3C5JA 2MKLC 1KTRL 2GT9A 3FQUA 1D5BB 4JGUA 3L5WA 2W9EH 5L0QB 4JFYB 1A1OA 3ZKMC 4JDZB 2RB8A 5DQDL 3QUMA 3PHOA 5EN2B 5IMKB 5J13C 3A6BL 4KMLB 1A9BA 4KC3B 4MD0A 3F7VB 3PGCA 1CTNA 4L4VA 5FB8A 5KZCB 3VFWA 1EHLL 5IQ9A 1JGUL 5E24E 2DIJA 3QUKB 1FIEA 4K94L 4PGCA 4HPOL 2VXUL 4U1LA 5D71L 2M26A 5D5ME 1U8JA 1IILE 3GO1H 4MDJA 4M62L 4AIZA 3JV6A 1A22B 1U92B 1ITCA 4L4JA 2FLBT 4PJ7F 1I9IL 4LPVA 3TYFB 3J8F7 1HILA 1KTLB 1UZ6E 1BOGB 4ODHH 5DJCA 2R69H 4MNQB 1WF5A 3BP6A 2Y6SD 1I1AD 4HWZB 5EU4A 5C08D 3TP4A 1CZ8H 1H3PH 4MQ7B 3IFNL 3ARFA 2DKMA 1OWRM 2BRQA 2HFGL 1EEZB 3MRLA 4NQCD 4QHMB 3RNKB 1I8LA 2CO7B 3B5HA 4G6JH 4Z8FL 4MXVF 1EJOL 2R9HD 3QQ3B 1JK8B 5TH2B 1XMWA 2FL5A 3Q1SH 2EE9A 2FH6A 1QVOB 1INDL 1S7XA 2V9RA 5E6ZA 2P7TB 4LPTA 4NHUA 4XP4L 4PGEB 2VISB 1JGUH 1VCAA 5I19L 1FE8L 3KYNA 5GRUL 1JFQH 1NC2A 4RNRB 4XP9H 3HZKA 3L7FA 5TQ2H 3BIAX 3VJ6B 3BX7C 4LMQE 4Z7VE 3AM8A 4ZMAT 2VR4A 2A6IB 2C3VB 4Q6IA 1J0KA 1PW3A 5C7XL 1RZIA 3V5HB 4Y4HB 2AEPH 1BP3B 4KRNA 4OZGB 4ZD3L 3QO1A 4NNYB 2B0SL 3JTTA 4KJQC 1IM9D 1MNUH 5FUCE 1VFMA 2DQIL 5IUSA 4PJCF 2G75A 4AY0A 5SX5K 5JZ7D 3VFMB 4OIBA 4LQFL 1VKXA 5FYKD 4I18A 4NN7B 4GRLB 1IJ9A 3OGCB 1CFNA 1NUDA 2R0KH 3FQTA 5GSRB 5IJVA 4YHYB 1T21B 1HHIB 2AABH 4JM2C 1AIFA 1U8HA 1WZMA 4M4PA 1SBBA 3BWAB 2DQJL 3MUY1 4UDTA 3VXSE 3D69A 3VRIB 5DMIH 5M7QA 2YWZA 3KDMB 3O45A 5LCVL 4JG1H 4KI5F 3QUXB 4E0RA 4ZFFA 3KPSB 4PJGE 2EYTB 4XBPB 1T5XA 1I3GH 2GCYA 5D7JA 2ARJB 1CS6A 2VXSH 3QIWB 4Z7UE 5TE4H 1N6VA 5CP3A 4KDVA 4LRIC 1F3JB 5K59F 1IC4L 4L8SC 2HKFL 3ZHKA 4TUJA 1MCEA 4HGWB 4IJ3C 3F12A 2NY6D 1D9KD 1ZA3A 4J4PC 3CPLB 5HHOB 3SDDD 5C3LD 1IQWL 4YHNA 5GJTH 4JN1L 5FYKE 3X3GL 3FZUD 4F58L 1KBGH 1Q94B 2DD8H 4YHYC 5FK9A 1JF1A 4ZDHB 1A7RL 4U1IB 4RISL 3MFFB 4ENEC 3EGSB 1R3HA 1YN6A 3TH3T 1IM3A 3BAEL 4DTGL 1J5OH 3RUGB 1IEHA 4GO6B 4I13B 3MGOB 5EUOE 4N90E 4NOFA 3RHWF 1XH3B 2C3XA 4OM1H 4POUB 4F2MB 3UDWC 1T0MB 1YYMH 5DHYA 1DLFL 3RWEA 4QRSA 1I9RH 1FO0B 1QLRB 3JUZA 3GI9L 4MA3A 1M7IA 4KZEL 2P24B 4H1LA 4Z7WE 43CAB 3W5NA 1F8TH 4GRWE 3UTSE 3DYOA 5DHVA 1G7IA 5E5UB 1R6VA 3RKDD 1MFNA 3LEVH 4ORGB 4X7TB 3NGBB 4KY1H 4EZMA 3TNNB 5IQ9B 1IFHH 2VRAA 4KDTA 2PW1A 4KHXH 4U1NA 2XQYK 4LVOC 1EZVX 3VWKC 1YMME 3D3VB 4WW2A 1JGLL 1ZAGA 1I7RA 4LKCA 3TJEH 3ARDD 2BNRE 4Z5RA 1FV1A 1JYNA 1JZ6A 3KS0H 5I1JH 4HZAA 2GY7B 2EC8A 3O9WC 4U6VH 4BUHA 4UAOC 3REWA 1HE7A 3S36X 3R4DA 1OW0C 1QA9A 4MWFA 5SWQA 4P59L 4N5ED 1SYVB 3PWPA 1YUHB 1J0YA 3K3QA 4PJFF 5A2FA 5GGVY 1BAFH 1TPXB 5CJOH 4QRUB 2X42A 2P5EE 3IETB 1I1FB 1MHPH 1U36A 5EFIA 2KZ1B 4LCIL 4YHPA 3QDHA 1Q9KA 4UIMB 4Y5XB 1BQHA 3MOQA 5FGCE 4UT7H 1U8PA 2DQHL 4K71C 3RGHA 3ZDYF 4IRZL 3SHSA 5FA4B 3NCJH 4E42B 4J7RA 4NQSA 4QOKD 2WINB 3PWLA 1K8DA 1KJ2B 5F93C 5FECB 5D7LB 3W2DL 5EU7C 2APTA 4PRHE 4NUGH 4NQDE 1EK3A 2CQVA 3NPSB 3T77B 1G9MH 1Z3GL 3T3PF 3TBSB 5A16B 2ITDA 2DM3A 5EO1A 4F9PA 1NEZG 1Q9WA 3MXWH 2X9XA 3T65A 3HC0A 1E4KA 1LO5B 3MRQB 3G04A 3Q1SL 3RA7L 4XH2B 2XN9A 3S88L 4R2GC 2I26N 5C0NC 5C6PB 1I9RL 4U1MA 5I71B 2A6KA 5FK9B 1NGWB 1MIEH 1KOAA 4JY4A 4YGVB 4JY6B 1C12B 1T04B 2A6DB 1LP9F 1ZGLP 4K3DH 4KUCF 1ACYH 5JW5B 2KDGA 3MCLL 1XCTB 4OF8A 2C5DC 2XKSA 2AEPL 2Z35B 3BPNB 1GSMA 4XC3H 1VGKA 4HWZA 4OZHE 3TIDA 2FEDD 1RMFH 1ZV5A 2UVFA 3VFUA 3OB8A 3ULVE 1X4YA 3AY4C 3BZDA 3DROA 4L3CB 2X7LA 2J8UA 3I6KA 3PHQB 1WFOA 3F5WB 4P2RE 4JQIH 1LO4L 4PTTB 5JW4R 2FIKA 2JIXA 5F89A 4RMRA 1H15B 1P69B 5D4QA 3T3PE 1HSBB 3SDXE 2OZ4H 4NKOB 3ECBB 4PRHB 5JW4M 2XA8H 1DZBA 1MFDL 3NFNB 3PGDA 1N64H 4LVEA 4PLJD 3SKNA 3MCKB 1U8QB 2Z31B 3K4ZA 3BD4A 3HI5L 3DX9A 3CVHH 3EYQC 1K4DA 4G9FA 1K4CB 4JO3L 1P4LA 4KQ4H 4APQD 2DDQL 4IIQA 4M7JH 2P44B 3NCYS 4OLWL 5C6WH 2VDRL 4MJIE 4FFYH 3LS4H 3QB7C 4I2XB 2QSCL 3SE9L 1G7PB 2FYYA 3VFMA 4XNUH 1QFPA 2XN9E 1D6EB 5KS9B 4JGMA 1XGYL 3S96B 4BH7A 3BEWA 2D4DA 3PNWA 3RPIA 4MDIA 3VXQA 3W0WB 5D7LD 4O9HH 5SX4I 3BUYB 4X5LA 2EH7L 1PDKA 3O6LH 2R0ZH 3FFCE 1IC4H 4MNQD 3MRMB 4CN1A 1MI5E 4GAGL 2PCPA 4PGEA 3B9EA 1JN6A 1R3LA 2XXCB 3OKLB 3S8WA 2H9GB 2XFXA 4LHUB 3MLRH 1MCPH 1N4XH 1KB9K 3P9WB 4M6NH 4K94C 1FVEA 1NEZA 5EO9A 5KVDH 1VDGA 3CMOL 4N8CL 4ZNEA 5C92A 5A3IC 5J9PB 5LCVH 3V4PL 1R5IB 1FE8H 1SY6H 2FNBA 2NY1D 3HRZB 3HZYB 3PGFH 3VG0L 4HBQA 2WUCH 2MCPH 2EDNA 2EDHA 5DRXB 2F15A 1KPRB 1UZ8A 1YEJH 2VIRB 4YQXL 3BYYA 1IQDA 3QDMA 3CFBA 4LLQA 4ZOBA 5JUEH 5E2WL 3FB8B 4JR9L 4Y2DA 2RAMA 2GW5A 5EU6B 1AHWC 3VXPA 4Z7VA 4O2FA 2UV3A 1BQHG 5JR1H 2CDEA 4FZEL 4GJTB 4JY6A 4QRRB 3RWHB 3WNOA 1RJZB 3NFPB 1MNUL 3BE1H 1F4WL 3L3OA 5F71A 4FTVA 3AGVA 4XGZA 2E7LC 4HS6B 4YJZL 4PRPA 5C2BL 3NPSC 3DX7B 4PLNC 3TA3D 4V1DE 1MFBL 2OSLB 3U9PH 7FABH 3AMLA 1Z5LB 4HKXA 1NLDH 2HKHL 4J1UA 5I8OL 2OJEB 2HMID 1D5ZB 3B2UC 1RZKL 3DI2B 1GGIH 1EVUA 3C60B 2P24A 3G9AB 4LVHB 5EZOH 4ISVA 2QL1A 4OFPA 4OV5B 5C0AE 4AG4H 4R97B 4JFDA 4L3EE 2CKNA 3VXME 1FZJA 3ARBB 4HV8A 4KAQL 5F44A 1J8HA 1DBAL 3CZFB 3WEXB 3MBEC 2ZCHH 1CTOA 2W0LA 4Y5YC 5F8RC 2VWEE 5ICYB 1YEHL 5LGHH 3O3DB 2DQEL 3QQ9D 3H3BC 1MRCH 3RWFA 5DC4B 2QADC 3MRCA 1MAJA 3R0NA 1W8OA 2FZ3A 2IFFH 4CU7A 3EYOB 3F8UB 3E6FB 1CLOL 3WXWL 1MCSA 3MSPA 3ULUE 1FFNA 3BD5A 4P23B 5JOFA 3VG9C 1QFWL 1RUML 3GNML 1HI6A 3P4MA 1S7QA 3U0TB 3IDJA 3KLAA 2BOBA 4FFZH 4PJDE 4LPXA 2FH8A 1FYTE 3BKML 4NGHH 3W9EA 2DL9A 2VZ1A 1ND0A 4NRZA 2R1XB 1EAJA 4G9DB 4LCIH 2AJXH 4KRPC 4HK0B 4FZ8L 4Y19A 4ZUVB 5F1NA 2VZOA 4HS8H 4F15B 1ROWA 3AS2A 5D2NB 2NXYD 1U3HC 2NW2B 3V6ZB 5T5FL 1KACB 5BO1L 4JJ5A 2F53B 2IMMA 2YSSB 4MA1B 3KPRB 4YHLH 1DBJH 1YYLL 2QLVB 2Z31C 4MXWL 1QFOA 5CLTA 3L7EA 2DQIH 4PTTA 4X7SL 4Z18A 1OF2B 4DVBB 3LIZH 2YUWA 4OFYD 5DQDH 4HT1H 3MV9A 1T0PB 5BVJB 3RDTB 3MNVB 2AJUL 1CDGA 1AKJB 2WWMD 4MLIA 4X6DF 3WFCH 3GMLB 3O4LA 3NTCH 3VFTA 3MODL 4KROB 3CUPA 5F8QC 1C5DB 4PB0L 1NFDA 4FQQA 1OLLA 3BO8B 5LWYH 4IEFB 3QFDB 4X7TA 2A6DA 2D0FA 4R4ND 3DMMB 4HMEA 1NGQL 3ZE2E 2BDNH 5IEHB 5CWSA 4JZOB 4LEOA 3MV7E 2C7UB 4A6YL 4P4KB 3DUUB 4LSTH 5HYJD 3C9NB 2OK0H 1DEEB 4PG2A 3T2OA 2R2HA 1N7ML 2Q1EA 4GUPB 4P5KA 5I18L 1OQXA 4GW5B 3L5XL 3P2TA 3RQ3A 2IF7A 4OCRL 1QR4A 4MA8L 2YPVL 5ICZB 1KCRH 2L7UA 3RDTD 2VKXA 4LBEB 1JP5A 3LKRB 1EZVY 4U6XB 5GJSL 3CLEH 1BM3L 5D96C 5GS0H 4NQSB 3VXTA 3HS0B 1LO0H 5CEZE 3BJ91 1NDGA 1T2XA 2EKSA 1IEAA 3LQZB 2LTQC 1M6OB 1ZHBB 2X89A 4WY7L 4YR6A 5KS9E 1F11B 1J1XH 2BNUA 1A8JH 1NCCH 2DAVA 3GJFB 2ZUSA 2HJKA 3KPQA 3OKNB 3STZB 1W72A 1NSNL 1V5JA 3RTQD 1QBLL 2ZJSH 5K9OB 1UYWL 4ZSOB 3DXAB 3TA3A 2W65B 2DOCA 2JE8A 2NXZC 3SCMA 1H3WM 1FNSH 3EW3B 3HE6D 1CXEA 1SEBA 1EDQA 3BQUA 4ZPVA 4OZHF 4N5EC 4KTYA 3UBXI 2GUOB 1UWXH 4JB9H 1M1SA 5D7IE 2QSTA 3V5DB 1F02I 2YUXA 1Q1JH 4PJEB 1F42A 4OF0A 1YNTA 3OKOB 4Z7OE 2WUCL 4P46B 1NGWA 1HCFX 4K3JL 1NCAH 2BVTA 5IG7A 1RZGB 1N8ZB 2P5ED 2R1WA 5BVPH 2VLRB 2VXTL 5DQ9A 4ALAH 1DUYA 1EGJH 1QLEH 1Y18A 5KVDL 3C8KB 4NZDA 4X7DC 1OGAE 5GQBA 4KMTH 3O3AB 2VDKL 2EH8H 3VJ6A 1IGCL 3BVNA 1DBMH 2X70A 2VN4A 4OZFB 4WI7A 3BEVB 4M6OL 2EO1A 1YDPB 1PVHA 5F1IA 3O3DA 5E8EA 5JOEA 1LWRA 3WJLC 4MMXC 3LMJH 3QIUD 2V2WA 1QR1B 4KROC 3QRGL 3LSOB 5KS9F 1N0XL 3ULUH 1WBYA 1SQ2N 2BFVL 2R0ZL 1YECH 1FFRA 2AQ1A 5DUPH 2Q7YB 1IL1B 3P4NB 3G5VA 1P7KB 4U31A 5DR5H 4OCYH 4GT7A 5DT1L 3U6RA 4I8DA 3ZT7A 2EYSA 2AGJL 3T1WA 1FVCA 3PG2A 3RIAK 3O4LE 1CE6B 3O3EB 4XPGH 1W72H 4Z0BL 5F7WC 4DZBA 2FL5B 3TZVD 1SY6L 1P84J 2PTTA 4S2SA 4M7JL 4CVZA 3P73A 4F8TA 4OLVH 5KVFH 2EIZA 2MHAB 2PETA 4ZOEA 3MV9D 3QUXA 4JDTH 3PQYE 1BBDL 4ODHL 1VFOA 5DLML 1VGEH 2JJTC 2OZ4A 1NKRA 4NO0B 1KB5B 3QFJD 3QZWB 3PWUB 4CMHC 3HMXL 3JWDC 3BEWB 4KK8C 2BVPB 1UKTA 2VZVA 1YECL 1DBAH 2J6EH 3AREA 3OXSA 3SKJL 15C8L 4C56D 2E6JA 3H9SB 1PGRB 1JNLL 2B8OT 3Q5TA 3OXRB 3WDJA 5GGRY 2OR7A 1BIHA 5B4MC 4PGCB 5EA0H 3WFZA 1IGIL 3K2MC 2GKIA 1IGFH 4PJHF 4XNUL 2HTKC 1W2KT 2VLKA 3LEXA 1X5AA 4ZAKC 3IKCB 2H9GA 3VGBA 3B4NA 2XZCL 3KNBA 3CDYA 1QSEB 5GGTH 1ACZA 2R56L 4TNWF 3HC3H 5BMFL 3QH3B 4QT5A 5DUML 1KIRA 3S4SB 1A1OB 4WV1A 1JGVL 5AAMA 4UB0H 3DUUA 3R06B 3NMEA 5EBLA 3V5KB 4ZFFB 1CFTA 1CVSC 2BVEA 2VE6B 2Z0BA 3VXRA 5ADPH 5IWLC 4JO4L 3BRGC 4NDMB 5EZJB 5GS0D 4YQXH 3HZVA 1HOCA 3MOBH 5EPMA 2H1PL 2AQ3A 4BH8B 2HG5B 8FABB 4P2RA 3JBG7 1A7BA 4IDLA 3OKOA 3TT3H 3NCMA 2A9NL 3JWDL 2IQAA 1Q94A 4NQXB 4QHUB 5IM7B 5BXFB 5IB3A 5ISZB 3I75B 1ADQL 1VENA 3QWQB 1PKQB 2VMFA 4Y4HC 3WN5C 2VXSL 1D5XB 3MRBB 2HTLC 2DI8A 4EVNA 2D3VA 3FO0L 1TXKA 1PLGL 3KPLB 9CGTA 3ARGA 2XTJC 5CKGA 2DQHH 5I8EB 4OLVL 5CGYD 5EOCJ 1EBAA 3KPQB 1J5OL 1DANT 3QUZA 3T09A 3WIIH 3U7AA 4G6AC 4G5ZH 1JGDB 4HWBH 5C8JB 2ADGB 5T1KA 5KSAA 3QXDB 1LE5A 3RGVD 1CDIA 4JKWA 5JPMA 5F1NB 4M93B 1KJVB 4X9FA 4PJ5A 4D8PB 3NAAL 3VRJB 4S1RH 1PFCA 3L5XH 2VQTA 3U0PA 5FO9B 2ZCLH 4NRZB 2X4PB 5HHOE 1MCWM 3BWAA 4U1GC 2J6EL 3SGJC 1FFOA 5BS0D 4PJ7B 4FQXA 5D5MA 3VW3L 2EDJA 1F6LL 3IDJB 4ODBD 5GISL 1CFBA 3QWRA 2C4XA 4NUJB 5D93C 5HGBA 2G60H 3IDIA 5DJAB 5DRNA 3B3IA 3HI5H 1IGCH 1H3UA 3B9DA 4PJAE 2I60H 4PJFE 1N7MH 1T0NB 1MRFH 1A3LL 1CGSL 3HE7D 1A4JB 4KI5E 4YWGL 5DD5H 4Y4HA 3DWTA 5GHWL 4DW2H 1UM5H 1KUMA 1M7DA 4Y8DC 4QXTA 1KENH 1WEJL 3L3DB 1OGTB 4YE4H 4GH7B 1RIHL 2YXFA 4BSVB 1CI5A 1PYWB 4CJ0A 1PY4A 1KPVA 5T5NF 1FYTD 2Z93B 2VLKD 3S34L 5I1AA 4R7NA 1NGZA 3V95A 5I30H 4JY4B 4E42A 3S36H 2ZKHL 5DUBA 4RA0C 2NY2C 4HW6A 4J6RH 1K9TA 3WHE0 3VMNA 4UV7H 5CJ5A 3LV3A 4LL9A 2F54A 5C2UB 1PKQE 3P4LA 2WQRA 1F90L 4R7DA 5D7SH 2RCSL 3WLWC 1K85A 3LIZL 2GK0A 4RMSA 2H26B 2J8HA 1EFXD 1TNNA 3AREB 1QLEL 1MRDL 5LGJB 3IDMB 1G6RH 3MJ9A 3GUTB 3TF7C 5DK2B 5A43C 5I1HL 2EDFA 4OLEA 5T3ZD 4NO0A 4AQOA 4I9WE 1J8HE 3GNMH 3VXNA 3HE6C 2R4RH 4YNYA 3MUGB 3MA7A 2KBGA 4ESKA 2OTWB 3UJTL 2AJSL 4HGMA 2H45A 3SDDA 3RZCA 2YPVH 1T6VN 3H9SA 4OGZA 2PXYA 1NH6A 1U3HA 2E9WA 3EFFA 3O2DH 3BSZL 4ZXBA 3VGFA 3TPUB 3O81A 2FX8L 4G3YH 1IC7H 4JFXB 1IL1A 1YEEH 2FGWL 2Z8WC 1GOGA 2B5IB 2NY5C 1WUNT 5AUMB 4NJAL 5H35B 4YXHL 4LF3B 4N90D 5DSCA 3BT2L 4LSTL 4YBLC 3DO7B 1C16A 2FO4A 1S7VB 3S3PA 3KLSA 4S1DC 1S8DA 1GJIA 4RFOH 4RISH 5K9JL 3KLHD 1YEKH 1A64A 3HHRB 3SDYH 5IIEB 3P77B 3UTSD 4IBLT 1WAAA 5HDOA 1P2CB 4Q9QL 2YEZA 1EBPA 5D1ZB 3D87B 1NANH 3LQAC 2UYLB 5T3XH 1WBZA 1UG9A 1FQ9C 3UAJD 1LO0L 3KLHC 1XCQA 4M43L 4UQ3B 3OB0H 3BIKA 2AEQH 5F9JB 4DN3H 1FSKB 4ELMA 3EO1B 5EORH 3MXVH 5GGUA 5H37G 4ZFGL 2FLRT 4HUNB 2VZUA 3SBWC 4GKSA 2DBLL 5E6ID 5IK3A 3HNTH 4FQIH 5IW3A 1WEJH 3E6HA 3DVGA 1IC5L 3NCJL 1NPUA 3ULVL 3MBEA 2GSGB 5KSUA 4R4NC 4XB8A 3ARDA 3QDJE 4LVHC 3RVUC 1R5VA 3N0PB 1A0QL 1I9JH 3CMOH 3Q6GH 4LAQL 4EN3D 3C8KA 5MP6H 5EZIH 4WTXA 2FJGB 4YDKH 3TVMB 3WDHA 2MCPL 1T03H 3WLBB 4RZCB 3HPJA 3PP3H 4AZ8A 1WCBB 4Z7VF 3SCMC 3SQOH 5JXED 5GGTA 2Q3ZA 1MCOH 3O6FB 3MO1A 3IFLH 3K1KC 4ZS7H 3GSVA 2OR8A 4F80A 3DSFH 5FCUH 3BPNC 4NNPL 2XFXB 3FFCD 5DDHA 1SJEA 1YMMA 4ZOCA 3TH4T 1HKFA 1MHEA 3LV3B 1I7ZA 1I9IH 4NN5C 2VLMD 4L3AA 3AY4A 3QBTB 3QIWC 4HUXB 3OQ3B 3IDXH 4ETQB 1N5AB 4F58H 3WIIL 3T3ME 3KXFE 3ZDZF 5F6HI 5I15L 4JN1H 1RVFL 3L3IA 2NY0C 4GG8B 3BN9D 2C3WA 4EUPB 1AH1A 4U05A 3T4YA 2PO6C 4NJAH 3DGGA 1AD9B 1KYOK 1TJHL 3BW9A 3T0EB 3V4UH 1YEKL 3SE8L 1T7ZA 2QHRL 4Z8FH 1E4WL 1ZGLM 4G6ML 2NYYC 4JM2B 2B5IC 1YEDB 1P4IL 2L7JA 3EYFB 4P5TD 4YEFA 3C6SA 4YGAB 1D5XA 2I07B 5IHZB 3ARBC 1X5KA 1KB5L 4XXCA 5GS3A 5IQ7H 1D5IL 4J3TA 2OXHA 2BVOB 2DTMH 3EOAB 5H94A 2CJUL 4L9LB 4R7NB 4HK3J 4U1GB 2EDRA 3D9AH 3BZ4B 1N64L 3MACH 5HI5D 2AERT 4PRNA 1F4XL 5I8KH 2HN7B 4MJIB 1WBXB 3MLWL 1JK8A 5CZKA 4NYLB 2EXWC 4PRDA 4OCLC 3ZKSD 5IB5B 4C4KO 1E0OB 5I1HH 3OV6A 3HN3A 4UQ2A 2IWGA 3O6KH 2DIAA 3TCXA 5AWNL 1IAIM 4LAJH 2PW2A 1Q8MA 3RX7A 4JFDB 1LDSA 2DQTL 4YX2L 1CD9B 4QHKJ 1VADB 4M8VA 1TZGH 2UWEF 4XMPL 5HGBB 5I8EA 4FMKA 2Q20A 4PV8A 4APQA 4MNHA 5FGRA 4YIQB 4MX7B 3FMGL 3JVGC 4MQXC 3FN9A 1N2RB 3LKPA 5DA0B 5INDB 3MRBA 4XBGA 5B8CA 1JFQL 4RMUA 2ED7A 2E9IA 1XGPB 3FB6B 5HHXH 5I73B 3GFUA 3D18B 3OGCA 5IGXL 1WT5A 4Q9BA 1HIML 3QAZB 4MQ7A 3OJMB 3DX6B 3P11H 5DLMH 1Z9SA 4V2BA 2GTZB 3VG0H 4P46D 4F37F 3MRFA 3GIVB 3LKNA 4IDJL 4MQSB 1YJDC 5FM5O 2W0FB 3G5XB 2HRPH 1MQKL 4ZUVA 5ETUB 1NBYB 1MREL 5D2NA 5C3TA 3ILQD 5LG1A 5GGVH 2EDQA 5B3JE 2B2XH 2YUVA 1NJ9A 4ZUUA 4BK5A 1NMBL 4F9PC 5IMOA 5T1MB 5IBLD 3CC5A 3UJTH 2HJLB 5HGHB 3NABL 4JG0H 1FDLL 1AXTL 4NZRL 4QF1A 5CEXB 1CICB 1IVLA 2PXYB 1XAUA 5CHNA 1RJYA 1MUJB 4XHQA 4U3CA 5IFJB 1EO8L 4XNMA 4RGMC 5IVXE 1TLKA 4O02L 3T8XA 4BELD 2LU4A 1RHHA 5GPRA 3GSQB 1JGLH 3VA2C 3WEXA 3LN5B 3HI6L 4PUBL 4RFNB 5K9KA 5C0JA 1CT8B 3LS4L 1AGDB 5IEKA 1G7LB 2RJMA 3MR9A 2BSSA 5FKPB 4J4PD 1VEMA 1BJ8A 4XCYB 1SJXA 5BVPL 4WVRA 1HDMA 4JO2L 4ZUTA 3ZKMD 2DLEA 1CLOH 3WXWH 2H1PH 2P5WE 1IC7L 1OP3K 2VLRD 3QNXB 4MVBC 4KK8D 4PGDB 4KHXL 5IFHH 5D1QA 1ADQH 5C0IB 5I75B 1EVTC 3ZMRA 4DEPB 4YPGA 2K9UA 1NCUA 4OF6A 1T22B 4FQJL 4HS6A 1U91B 4QYOA 1BJ1H 5CBEA 3O9WD 1DEDA 3EOYG 1FG2B 1TTUA 3VFOB 2FDBP 1J8HD 5C0AD 5GHWH 3JV4B 4NCC1 1NBZA 2Q76B 6FABL 2OXGA 1ZLSH 5FF6A 2P45B 2X4TA 2AXFA 4PJHB 3HI6H 4PUBH 4Y4KA 4AEEA 2PW2B 5J0BA 2PUQT 3RVXC 3NPZB 2LFGA 1KC5L 4YNYB 2YD6A 4GLRH 3BP4A 4ODSL 4S1QH 1AGBB 1G9NH 4PRHD 3OJ2C 1SMAA 4P2OB 5IW1A 1DN0A 3GUTA 4UT7L 2AK4D 2FJGA 2CDGA 5DFTA 4MD5A 3OAUH 4MAYC 3SKMA 4P5TC 1KCVL 1LK2B 4Z77A 5EA0L 3FB6A 1TVHB 3SEPA 4NKOA 2WUBL 1KEGH 4GBXA 4L9LA 4R8WL 2ZUWA 4POZD 3HPLA 1MCHA 5DD1L 3NACH 3CU1A 3SE9H 1YY8A 4CVXA 1T3FB 1IGJB 5I75C 3WIHH 4X4YB 3IFPB 3M8OH 2QR0B 5EU3A 2W0FA 4Z95L 3G6JF 5C0CA 5HI4D 1A3LH 1CGSH 4N8VB 5ICXA 2BXZA 4MB4A 3IVKB 4HH8A 1OT1A 4GSDH 3EDJA 5DVNA 4FQ1L 1I3RA 3EDDA 4X4ME 5LAXA 2FATL 3H9HA 4EUPA 2WK2A 3OR7A 4IMLA 3I2CL 5IHBA 1MH5A 3FT2A 4RAVB 2C1PB 3C6LA 5FUCC 1GZQA 4PJBA 5C07D 2A9MH 2ED8A 3C5SA 3JWDH 2DN7A 2AEWA 4LSPH 2DQDH 3OKMB 1G7JA 4TTGA 2YUZA 4GXUM 4MB5A 3PWJA 1NDMA 2BY2A 4XCNA 5ESAB 3OXRA 5ADPL 2X89D 5I9QC 4GRLA 3WN5B 1X6LA 3B9KD 5HYQB 4FFYL 1KELL 1NL0H 1G6VK 1A1MB 5TE6H 5BS0B 4K23L 2AJYH 5E00A 5FDWB 5EC1A 2DLIA 4OT1L 2VERN 4WU7B 4M4RA 4XWOD 5IB4B 3ARQA 3VMOA 5DJXA 1ACYL 2XG5A 1C7SA 1IAII 4YHIB 1CD8A 4P3DA 3OZ9H 1I8LC 4DCQA 1G9EA 1HHJA 2OTUA 1Z2KA 2IEPA 1HHGA 2N1KA 1N3NB 3RBGA 1KJ2A 3LEYH 3GGWB 2VC2H 4OLYH 2FJHB 4LSUL 1HYRC 3S6CA 2I24N 3VWJD 2P7TA 5HDBE 3MRRB 5IB2B 4JFED 4JPVL 5EOTB 5FHBL 4OAWB 4K7FB 4QNPF 1I4FA 4X6DB 4KK6D 5FYJD 4Z7WF 4OZHB 3VH8B 4X80H 2HFGH 3ULUF 1KG0B 4Y16A 3D39B 4HIHB 1J1OL 5D1XA 4MD0B 5TPWL 2XKNB 1BEYH 2DQGH 43CAA 2A83B 4Z78A 4OLUL 4B41A 1FO0A 1QLRA 1X5ZA 3MR9B 4JKLA 1GC1H 3LKSB 3REWB 3DTXB 3N50A 4G43A 2VLJB 5E8PA 3MZTA 5DEZA 5HVHB 4BFEA 5D2LB 5CEZL 4LKXA 3GMPA 4WNQA 3BPLB 5D1QD 3V6BR 5IFAL 3ARFC 1VHPA 3KPTA 3TNNA 2EEAA 8CGTA 1E6JH 3MLUL 5B22A 4OZIA 1Q9KB 1UWEL 3RI5F 3D25A 1VADA 1S7SB 5IROC 3RU8L 3IAGC 4RAHA 1A21A 4G6FD 3GRWL 5KVGH 2OL3L 4CVWA 1CLYL 1F6FB 3CFDA 2FJFB 3EOBA 4H8WC 3KXFB 3QIBC 3TC9A 2V2TA 1MJ8H 1WBYB 5IR1A 1RULL 1QA9B 4LGPB 4NM4H 5KVFL 4ALAL 4WENB 4YK4B 2JLLA 5DMIL 4GG6F 4ZUSA 1IEBA 5ITFB 1JNHA 3BH9A 5D6CB 3HRZA 1JHLL 1R24A 4M7LH 2C3HA 4GQ9L 5INCB 3GSOB 5J6HB 3EHBC 1U8MB 3GI9H 4NRXB 2B4CH 3X3FH 2JCCE 3R8QA 4U1IA 4PJHE 3VFSA 2P8PA 3B9KA 4GFTB 2VDPH 3IXTA 2VB5A 1B0RA 2AEQL 3SKUD 4J3UA 1NGZB 3C87A 1UWXK 3QUXD 5FO9A 4KKCC 2ZCLL 5TGBB 1LEGB 1O7SA 1HCVA 3AXLB 4WEBL 1EX0A 2AJVH 1T0MA 4PP2A 2VOTA 1DBML 5KSBB 1EHAA 1AP2B 1FAIH 4LLVA 4OM0L 2QSCH 1KBGL 1YYLH 4HWBL 3KR3L 1INQA 1MJUL 3FO1A 4BFIB 1QD0A 1ZHLA 5T5FH 3PIQB 1F3RB 1QRNB 4XP6L 2Q8BL 3IDMA 4BK4A 4HLJA 1SHMA 1OP5K 3RX8A 1T0NA 2DQGL 3RJQB 1X6NA 2IAMB 1T5XB 4S11A 4RIRB 3HZYA 3U7YH 3UCRA 3SDAA 3I75A 2VAAB 3QPQD 4AH2B 3D0VB 1RQ5A 1HEZB 2C26A 2Z31A 3QDGB 2A9NH 4XPTH 1OTTC 4H26B 3WMSA 2HTLD 4GKZA 4ZYKB 5EUOB 2CDEB 1HHHA 4OB5H 3TO4C 4NQVB 1BD2A 5DZLA 1NBVH 1G7MB 4RRPA 1KT2B 1Q9LA 4LSQH 4L8CB 4HC1A 5F7KC 2J4WH 3A67L 3P9MA 1YJDL 2VXQL 5DGRA 1HSBA 2VO5A 1T66D 3WHXA 2UY6A 3RWDA 3KPMB 1OARL 4LLDB 2H8PA 4R7DB 3OJVC 1A9EB 3BH8B 4I18C 4MCZA 4U7SA 1V3KA 1OTSC 1A14H 1ZLVH 3S36L 2X7LB 1U91A 4HCRA 2IAMD 5HD8D 2B1HL 1KCRL 4JGJA 4HLZH 4X7CC 4C83B 3H3KA 4P4KD 4D9QD 2CRZA 1UA6H 4D2NA 3QULA 2Y7QB 4UI2A 3KPOA 4G7YH 5FGSA 3DVGB 1EPFA 1FZOB 5BO1H 4KJQD 1IBGH 3E3QE 4MJ2A 1G9ML 1Z3GH 3ARGD 3RP1A 3RFZC 1AGBA 4X6BA 3HC0B 2DKUA 1A6TA 4S0SD 3ARFB 4Q7DA 5GRXG 3P30L 2VQ1A 3PP3K 1KNOA 4TSBH 4Y4KB 4R90L 1XGTB 1T6WA 5DVLA 3D0LB 5ID0A 1HXYA 1PG7X 2K7PA 1AR1C 4FG6D 1LEIA 1YDPA 2GY5A 1I8IA 5I1EH 4TUOB 4J8RB 4E5XA 2BSTA 1FZKA 4NQUA 1BHGA