1OPIA

Solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1opiA00
2DH7A 5LJ3Y 2KXFA 2M88A 3MDFA 1P27B 2E44A 5LXYA 3FEXB 1Q81T 3L3CA 1WF0A 1VQ7S 4C4WA 3K0JA 4TU9A 2DNQA 2EK6A 2MB0B 2YH1A 4UQTA 3G8SA 2DNOA 4OZ1A 2ZJRQ 2V94A 3UCUP 2FC8A 2XSFA 5DDQC 4TLQA 2ZJPQ 2DISA 4M5DB 3U1LA 1X4AA 1ZZNA 2XS5A 2MY7A 5IM0B 3CMES 2G4BA 2BZ2A 2DO4A 4V19X 3IWNC 3BO4A 1WF2A 3CCJS 1R8PA 1NJIT 2AYMA 3HHNB 3NNCA 3US5A 5DDPC 1SJFA 3CCQS 4LIRA 4C0OC 2MKSA 2CJKA 4QPTA 2DIUA 2MKHA 1F9FA 4QU7A 1U1OA 1OPIA 1YIJS 4QU6A 2M4MA 2YWKA 2MQMA 2YH0A 2F9JA 4FXVA 3VF0B 1QM9A 2G1DA 2K8GA 2KM8C 2RVJA 2JWNA 2RQ4A 2MMYA 1U1NA 2KN4A 2RUGA 2MZQA 1HD1A 1X4HA 5ITHA 2LXUA 2MKJA 2HGMA 3RW6A 2FHOB 1WF1A 2XS2A 1KD1T 3VAMA 2CQPA 3S8SA 2MQNA 1JJ2R 1K9MT 3TO8A 2AD9A 4P6QA 2UP1A 5HO4A 3NMRA 2DITA 2X1AA 1H2UX 2YTCA 1N8RT 2CQ0A 1VC6A 2E5IA 2MZSA 1X5SA 4IO9Q 1YWXA 1SJ4P 1FNXH 3CCLS 1X4GA 2DNYA 1SJ3P 3B4MA 1UP1A 1YHQS 1WEZA 1URNA 2J8AA 5JVHQ 1YI2S 2DNNA 2MY8A 4WFAQ 1VQOS 1AUDA 1H6KX 1KC8T 1FJ7A 2CPEA 2G0CA 1U2FA 2FC9A 4BS2A 3MI7X 3LQVA 2DH9A 4YOEA 3EGZA 1XN9A 3UWTA 2AYGA 3SDEB 4CH1A 1D8ZA 2SXLA 3THPA 5BJRA 1VBZA 3CUNA 1VQNS 5LJ5Y 4Y0FA 2NZ4A 3G6ES 3MD3A 4UY8T 2ADCA 2YKAA 2CPJA 2CPZA 4IOAQ 3UD3P 2QEXS 1U1MA 2M2BA 1U1KA 5IFMA 3BEGB 1M90T 2CQ4A 1FHTA 2AYEA 2DO0A 2M9KA 2CQIA 2LA6A 3BO3A 2I2YA 2F9DA 2LQ5A 4ED5A 1IQTA 2DNHA 2MJNA 4WFBQ 2PEHA 2CQBA 3CPWR 2N3LA 2DGQA 2XNQA 2MZRA 2OSRA 1VQ4S 2DHGA 2RRAA 1D9AA 1R8HA 1VQ8S 1N52B 3CD6S 2RS8A 2XB2D 2OTJS 5H1SV 2MKCA 1M5VC 3VAIA 1WG5A 2HVZA 2MZJA 4F02A 2CPFA 1U1LA 5DETA 2E5HA 1B7FA 5GVQA 2MSSA 1M5OC 1VBXA 3VAKA 2N3OA 2DNMA 3MXHP 2K3KA 1X4DA 2Q79A 2DK2A 2CQCA 5LXRA 1UW4A 1DRZA 4ERDA 3SDEA 3CC4S 1X5OA 1WI8A 2ERRA 2X1GA 2MKKA 1WHWA 3P3DA 2U1AA 3CF5Q 2OSQA 4LMZA 1HD0A 1VQMS 2KH9A 1ZZFA 1U6FA 2E5GA 2KRBA 1DZ5A 3I55S 1VQ5S 4PR6A 3UCGA 3H2VE 2DNGA 1OO0B 1YJNS 2O3DA 2QFJA 3G4SS 3LPYA 3D2WA 2KG0A 2DGSA 5CXTA 1U6BA 3FEYB 4ZKAA 2OTLS 1VQLS 2WBRA 1K73T 3DXBA 1YITS 2VONA 4C7QA 1RKJA 1H2TZ 2ADBA 2XS7A 1SJQA 3S6EA 2MKIA 1HA1A 2QA4S 3P5TL 1FJCA 3EGNA 1VQPS 1S79A 2KRRA 3S7RA 1X4FA 2PE8A 2A3JA 3PIOQ 1U1RA 1FJEB 2N7CA 3P49B 3UD4P 3I56S 3NS6A 1VC0A 2D9PA 2DGXA 1UFWA 2CPYA 2GO9A 4CIOA 2DHSA 2KXHA 3VAJA 1Q86T 1O0PA 1M5KC 1K8AT 3BS9A 3R1LA 4Z2XA 1X0FA 2DGOA 3UCZP 3VAFA 1ZH5A 2HYIB 1FO1A 3VALA 2M7SA 3N9UC 1BY9A 1HL6A 1N88A 3CC7S 3R1HA 5LSLA 2F3JA 2MYFA 1YJ9S 2L9WA 1FT8A 3RW7A 4WIIA 1VBYA 1M5PC 2EVZA 1WTBA 5IM0A 2RT3A 2CPHA 5LSOA 3G71S 1WELA 5MLCV 1KOHA 3MUVP 5JVGQ 2MXYA 2CQGA 5DM7Q 5DDOC 2LYVA 4EGLA 2DNKA 2MPUA 2HZCA 1JJHA 2KXNB 3R27A 2RS2A 5D77A 5DDRC 2DHAA 1X4EA 2KT5A 1PO6A 3CCES 3NNHA 1OIAA 1X4CA 3JB9k 2HGNA 1L3KA 3IRWP 1P1TA 2DGWA 3CC2S 2CPDA 1WEYA 2J0SD 2LECA 5GAGU 3P6YC 1FXLA 1SJRA 1S72S 4A8XA 2MZ1A 2LKZA 2X1BA 2GHPA 2LEBA 2DNPA 5GADU 2VOOA 1X5PA 1SXLA 2CPXA 2KI2A 5DM6Q 1VC5A 3TP2A 2MQPA 2N82B 2OIHA 3CCUS 1A7GE 3BO2A 1RK8A 1WHXA 1A9NB 4TU7A 1W2BR 2VODA 2DGUA 2DNZA 2L41A 1WI6A 5HL7Q 1OWXA 3MD1A 2KU7A 1X4BA 2KVIA 2FY1A 4WKRA 2D9OA 4CQ1A 1NO8A 4OZ0A 5IQQA 3PIPQ 4RU2A 3SXLA 3NNAA 5GMKa 4U67Q 4QQBA 2MGZA 3VAHA 3V4MA 2FPHX 2KFYA 2CQ2A 2I38A 1U1PA 4IOCQ 3VAGA 1WHYA 2M0GB 4F26A 4YB1P 1CVJA 5FJ4A 3SMZA 3CMAS 3Q2TC 2MHNA 3G9CA 1JMTA 3G8TA 2BOPA 3B4DA 1VQ6S 4W92B 1DHMA 2CQ3A 2M70A 1DBDA 2B0GA 1QVGR 2CPIA 4PRFA 5CYJA 4YUDA 2DNLA 2L08A 2LCWA 5GAEU 3OW2R 3ZZYA 1M1KT 1WWHA 4J5OA 1X5TA 3DLLQ 4W90B 3CCVS 3G96A 2J76E 2OJ3A 2CQHA 3MOJB 1VQKS 2RQCA 2CQ1A 3Q2SC 4PKDB 4Y00A 1N54B 2KYXA 3CCSS 3S01A 3J7YU 2JRSA 2LEAA 2KG1A 1QVFR 2RRBA 4TU8A 1WHVA 2NLWA 2MSTA 2JVRA 4WCEQ 3CCMS 2XNRA 1H2VZ 2RU3A 3CCRS 3U1MA 1UAWA 3HI9A 2ZJQQ 3CXCR 3CULA 2KM8B 2U2FA 1JJ4A 3THTA 2RNEA 4LJMA 2LXIA 2HGLA 2JX2A 5GAHU 1U1QA 4CH0S 1YJWS 2KHCA 3ZZZA 4WF9Q 2M52A 2DNRA 1YTYA 1Q7YT 2D3OR 2M8DB 2DHXA 4IUFA 2DGTA 2E5JA 1VQ9S 2X1FA 2MZTA 1G2EA 1WG1A 2MQOA 2MGZB 1WEXA 5D78A 2AYBA 1NU4A 5CA5A 3MUTP 3CTRA 4WFNQ 3J7ZT 4F25A 2MQQA 2MQLA 2CQDA 5EN1A 2DIVA 3MURP 2J0QD 2LMIA 3MUMP 2DB1A 3NS5A 2DGVA 3UE2A 1WG4A 2MJUA 4FXWA 3TYTA 1KQSR 2JVOA 3EX7B 3ULHA 2LA4A 1PGZA 1KOOA 2DH8A 2VOPA 2EK1A 3H2UB 1Q82T 2M8HA
chains in the Genus database with same CATH superfamily
4DUZJ 1R0AB 2HHSA 3SIPB 3TZXA 5B0EA 2PIIA 1OYEA 3HVTB 3RRKA 3KLEA 3TOQA 4UZBA 3HHLD 2HNZB 2WVEA 2LU2A 4KFBA 4U7UD 1TL7B 1NK6A 1WKLA 3GB0A 4WPAA 1CPZA 2N4CA 1S97A 2NXJA 2HS4A 3DCAA 4KC5A 1V6HA 4I0WA 1V9OA 3VQTA 2EC0A 3DRPA 4ZPAA 3FJ2A 3ILIA 2HK3A 4C4WA 2EK6A 1NHUA 3K17A 2MB0B 3M4XA 1WC4A 2YH1A 2DNOA 3D6FB 3K8WA 5LOQA 2DT9A 2ZJRQ 4OHVA 1J5OA 2VC1A 1FJGJ 3W65A 4LSNB 2ZJPQ 3EICA 4NRUA 4Q44A 4U8VA 3MAHA 1MROA 4ZPBA 4LF9F 2KJWA 2ALZA 1X4AA 1S10A 2A6OA 1WSVA 3NGSA 2MY7A 4DR7J 2P9EA 3MEDB 3CMES 1FFSB 2I5JB 2G4BA 1TR0A 1WUUA 1RWOB 2DO4A 3L95X 4N8OA 1QUPA 1UW9A 2F1FA 3B8HA 4C97A 5GAGI 4EBEA 1SV5B 2ZHOA 4B3MF 2JEGA 2UUCJ 3MMCB 4NLPA 1RT1A 5E3QA 1SC1B 3PEHA 3W1YC 1WC6A 2IYGA 3UDLA 3D1QA 5DLGA 1VJWA 2J7WA 2VG7A 5JJBA 2W2MP 4EBCA 1QY7A 3K5NA 3ILLA 3CJKB 3DRRA 1KQFB 4X64J 2DIUA 3QGGA 1NBEB 3WZ0A 3FMBA 3PW0A 2R8GA 2MKHA 3BR8A 1U6ZA 2HFNA 2VBYA 1VBKA 2F4FA 3NGDA 4DS4A 4QU7A 2HHQA 4R5PB 1JLEB 1OPIA 2EBGA 1N5YA 3MM5B 2CUYA 4JI6F 1U02A 2OELA 2MQMA 4CNYA 4R8UB 4WXWA 2F9JA 4RW6B 4JI8J 1IBMF 2RDDA 3Q89A 4NLYA 4ED8A 2QFIA 2FJDB 4YY3F 2UXCJ 4DPUA 3MR2A 4IRDA 1M5SA 4OZ5A 1R6YA 3T1YF 5I3UB 2OKQA 1X4HA 4DR4F 4ZCLA 3I0RA 1QLNA 3MM9A 3RW6A 3OTDA 1WF1A 3Q8PB 3DYAA 1V3ZA 2FIUA 3L7UA 1RUSA 3BV8A 4JUZA 4DPOA 3VAMA 4B3RF 1JJ2R 2WVFA 2KJVA 2GHWA 2OD6A 1K9MT 4Q0BB 4HI1A 4WFZA 2XMKA 4F0HA 2HHWA 1KP6A 2XMJA 2GGPA 3DRSA 2D41A 3M6VA 3MPUB 4LT6A 1RU1A 2YVSA 4MIWA 3W8PA 5D4LA 5KT6A 2W9AA 4U8YA 3DOKB 4NMXA 3GV8B 4K4VA 4O4GA 4U7CA 3NMRA 1WSRA 3A8JA 3IBWA 3CJQA 4NEYA 1KQKA 4WTOB 1DTTB 2HFVA 4Y2CA 4HYKA 4ECQA 2E1CA 3PYDA 2YTCA 2WW4A 4ILRA 4UZCA 1YSJA 4Y6IA 4TQRA 4J9MA 3GCXP 4NXMJ 3CO0P 3MAQA 5ETKA 1LWFA 2E5IA 2MZSA 1X5SA 2J9CA 3QATA 2VBWA 1CJTB 3HSGA 3M30B 2VQFF 4JI1F 3OTEA 4TN2A 1EB0A 2I6WA 4OZ3A 3Q8UA 4M63A 8AT1B 1OQ6A 4P2FA 2FQQB 1TL5A 1HHTP 2P6SA 2IMWP 3H40A 5JXSA 2YQ3A 3UR0A 4RW9B 3R9LA 1RWNB 3J81j 1URNA 1UL3A 4WJBA 5G0RB 3TUZC 2VBZA 3UPFA 3KFWX 2A18A 1OY8A 1SKUB 4DL7A 1Q0NA 4X65J 1VQOS 4DBQA 2DXEA 2NUHA 2W24A 1FJ7A 3AOCA 1UEKA 5HMWA 4DV2F 2BW2A 4ED3A 1PAEX 4L6V3 5ETRA 4ZLLA 2FJXA 2HVIA 3L7OA 2HMIA 2Z2ZA 3LQVA 3MEEA 2LDIA 1R7IA 2FDNA 2W9BB 2VJVA 1EP4A 4YP3A 1XNQF 3E01B 3UWTA 3K5MA 5HBMA 2R2TA 4ED6A 3JSMA 1KQGB 2CIMA 3AY0A 1S12A 5H9FJ 2JEFA 3CGIA 1D8ZA 1WORA 2DKOB 3GIMA 1NK7A 2UVWA 1ZS6A 2BANA 3C16B 4JI0F 3SZ2A 3RAXA 1S49A 3GIJA 3GZ7A 3G6ES 2ZHAA 4NXMF 5K14A 4UY8T 1RHJB 4M5NA 2R2RA 4DLEA 1Y3KA 2DR6A 4ECZA 5K8OA 4TQSA 4IH6A 3MGJA 4L76A 4DFMA 4FF4A 1IBCB 2OFHX 2ZBPA 3I96A 1IKYB 3TW0A 2V9WA 1SL0A 5ETLA 2M2BA 5IFMA 5KFJA 1S0NA 3N6NA 4DV0F 4KHPJ 3ENQA 4ED7A 1Y3JA 1XC9A 1H74A 3IRXA 4MT1A 2MDAA 3NRBA 3T5KA 4WE1B 3DU6A 4O0NA 4BLGA 2LQ5A 3OFEA 4GC7A 3UW1A 1BQMA 2PMWA 3A13A 2BA9A 4EFAC 2HRYA 3KDNA 4RWWA 1NKBA 1N33J 3CPWR 5F8MA 2DGQA 4ED0A 2HHHF 3QQCD 3MMAB 1F9HA 3UNYA 4X66J 1VQ4S 4NLGA 2DR7A 1PKUA 4DR4J 2WVDA 4RW7B 3CD6S 4IR9A 1K47A 3A3OB 4X4RA 2A1BA 1HNVB 1HQUB 3JS9A 4A8QA 2E7WA 3EVWA 3M2RB 1TVRB 1FE0A 2I8EA 4Y2AA 4WU2A 3GV5B 3G6YA 2F40A 4TU7A 1YK9A 3LUYA 3MM9B 1HQ2A 5D0HA 5C25B 1M5VC 1IBMJ 4O3SA 4JI2J 1IKYA 3QJPA 2MZJA 4AQYJ 1RKIA 1EJ7L 3EGWB 3GU0A 1OQ3A 2ZOFA 4F02A 4X4OA 2E5HA 3D68A 1D8YA 2MSSA 4LSLB 1M5OC 4OHZA 4ZPWR 3ZTRA 4X64F 4NWBA 4FF3A 1FFWB 2H48B 1LNQA 4RL1A 5AE3A 4Y28C 4AYBD 5KOXA 4JYAJ 4YR2A 3OHBA 3MM7A 5F41A 2DK2A 2CQCA 5LXRA 2HAIA 1VS3A 4NLDA 2EI5A 5C2GA 2PN6A 2GC8A 3E01A 2XY6A 1MSWD 1HWIA 1WI8A 4QIVA 1IWGA 1EP4B 4WP9A 3MEEB 5KFUA 2AWZA 2VDHA 4LBIA 2MKKA 3V6DB 4PUOA 2C1EB 3BKFA 3P3DA 4RUBA 7AT1B 1NSAA 4LF2A 4OZLA 3C19A 2VKRA 4DL3A 1QTMA 1LQ9A 1GT8A 5DO2A 4FS1A 2UVUA 2PC6A 2HQDA 4ZCKA 2W8LA 3DI6B 1DAXA 2LQ9A 3MECA 1CJVB 3FFIB 4DX6A 2VB6A 5KFAA 1ZZFA 1LWXA 2F8MA 2QLXA 1TL1B 1U6FA 4DR1F 2HBQB 3JQJA 1RWMB 2ACMA 1LW2A 2RHQB 3OL9A 3DRXA 4DL4A 1G7CB 2EXUA 3AJ1A 1BXNA 4M5GA 3UCGA 3HO1A 2K7KA 4FNIA 1Q16B 2QT7A 1CJTA 2IIHA 5GMEA 4C0HA 2DNGA 2XSJA 1LWFB 2YX7A 4CWBA 1T3NA 3HMJG 3FFIA 3AXMA 1K1SA 3MECB 1R3NA 1DLOB 2RD5C 3HHEA 3ZTOA 3LOUA 4DR5J 1CLFA 2J7UA 1YBAA 2CJBA 5KTQA 1X0PA 1PYTA 5KFDA 3M8QB 2C3MA 5KG7A 4J9PA 3D2WA 4X4VA 2P5VA 3TVZA 5T7LA 1TUGB 2GCFA 2GGPB 3MAAA 4ANEA 1U8SA 1TKXA 1RJJA 2GIQA 2XMMA 4DV4J 4JI3J 2VONA 4OHWA 4EEYA 5K5MA 4K4UA 1H2TZ 1P9QC 2HK2A 2F8EX 3HSDA 3MM7B 5ETOA 3BBBA 4PQUB 3P5TL 4P52A 4CO2A 3EGNA 1E6YB 3C15B 2BJ3A 3LA0A 3TJAA 4PG8A 2ZD1A 2HHHJ 2OMOA 2EFQA 2KRRA 5KFVA 2XZWA 2AJ4A 5D15A 2PE8A 2BDPA 3WIVA 4A8MP 3MF5A 2LLZA 4ALZA 3R5GA 4NRTA 1VRTB 5K8MA 2R7WA 2B5JB 3PIOQ 1J5EF 3C16A 3BGLA 3O44A 1WKKA 4ILLA 4B9NA 2FB0A 4F0MA 3G86A 1N32J 1B64A 3EDQB 3UN2A 2DGXA 1ROFA 1EQMA 1UFWA 2CJQA 2GO9A 3BF4A 2VIHA 2L3MA 2IM0A 3AD9C 1K8AT 5ETNA 4PEOA 4RW7A 2HWIA 3DRRB 1UFLA 4Z2XA 2C2DA 4USTA 1JK9B 2DEIA 2GX8A 3OR1B 3VAFA 3MMAA 4B08A 2QO3A 3W9IA 4DSKA 2EFNA 1FO1A 1F5CA 1GTEA 1LXJA 2EW9A 3LP2A 3BH7B 1BY9A 3CJ0A 3GFHA 3N9UC 2E29A 4FYYB 3KK3A 1N88A 4LRCA 4O23A 5C5JA 3R1HA 3LWLA 4CLFA 5LSLA 5KT2A 1ELOA 1UVLA 2Y1LB 1CC7A 4WE1A 3HKWA 1FT8A 2FD2A 5KG4A 3KHHA 3IRXB 4F4YA 1VBYA 4ZP7A 5KT3A 2EVZA 4CYUB 4F3QA 1FA0A 2RT3A 1GX5A 4PXCA 2KDOA 1C0UA 5MLCV 1KOHA 3PW2A 2VC0A 2NR0A 3T9ZA 5HP1A 4LF8J 2CQGA 3ZZPA 3ZNJ1 1Q5YA 1HWKA 3M30A 4YDXA 2LYVA 1VRUB 2YY3A 3CSKA 3RB0A 1J5OB 1U8WA 4BDPA 3BPSP 4GO7X 1S1XA 4UY85 2GJ2A 5HATA 5EWFA 1FD2A 1H73A 2BUNA 4DLGA 3FQKA 1VHIA 2I0XA 4O4GB 2HEKA 1NSPA 1VR6A 3M2VA 1UZDA 4LF1A 4QR2A 1X4CA 3IC1A 2FHKA 3LTOA 2G2OA 3CJ5A 3N5BA 2HGNA 3CD7A 3O6QA 2ZH5A 3IRWP 2YWHA 5DS7A 3I82A 4DI6A 3TUIC 4FYWB 2YX4A 4ZK7M 4LREA 2LECA 2QLWA 2R7XA 4H4MB 3P6YC 1SJRA 1BE4A 2B4PA 4ZOSA 4A8XA 3EXCX 4WYWA 1TKTB 1H7XA 4PCQA 1X5PA 4DR3F 2LVWA 1RT2B 3SV4A 2E1MC 1RT5B 2FJAB 2V50A 3WQPA 5JMNA 5I3UA 3TP2A 2MQPA 2JNJA 4O3NA 3MM6A 4ZIWA 3CCUS 1A7GE 2BKPA 3R3TA 2JEIA 3K5OA 1SH3A 2MQ8A 4F4KA 1S4FA 3SCLE 3FSXA 3GFZA 2HIQA 2Q43A 3KK1A 2IA6A 2VODA 3IG1A 4M1KA 1NUEA 3VVTA 3FQLA 5L9NA 2L41A 1GX6A 1VQYA 1WI6A 4R8UA 2XQCA 1WOSA 4PG5A 4WKRA 4N76A 2ZC3A 2D9OA 1NO8A 2YNHA 2ZZMA 1FDBA 2ZKUA 5ETQA 3PIPQ 2K1RB 1FCAA 1EARA 1W26A 5GMKa 4B9LA 3FKBA 3J80Y 4MKBA 3VAHA 5AXNA 3RB4A 2V63A 4GKKJ 3IWLA 3H2LA 4MKVA 2FPHX 4ZVSB 5IV4A 2CQ2A 3ELHA 1WKJA 4TVAB 3DOMA 3AODA 1PILA 4IOCQ 4DR2F 1FKAF 1VLOA 2HNDB 2RDJA 1CVJA 2C3PA 1Y11A 1PIEA 2CA9A 2OHDA 3CMAS 5FJ4A 1JMTA 2DY9A 1FEEA 4OJ3A 2UUWA 1FDAA 3ISZA 4CLZA 4B3OA 2XI2A 3VGSA 5HLFB 4I7FB 2HHUA 1LXNA 2M70A 3BSAA 4DMZA 5U47A 1QVGR 3GR0A 4IQXA 1KWMA 1UPPA 1TFWA 3DXSX 5CYJA 4YUDA 2XMVA 4X4QA 3NGUA 5HVHA 2XGQA 4AL6A 1EX8A 1QAIA 2C2EA 1M1KT 2VA2A 1WWHA 4OI2A 1NDCA 5I42A 2AX1A 3R2DJ 1CSJA 4X4UA 3FZ2A 4BC9A 4K4SA 4HH1A 3ENAA 4JB8B 3CCVS 4OZJA 2DR5A 1RISA 1Y10A 1NPRA 2AX0A 4J37A 3H5YA 2D74B 4I7FA 2W2QP 2RQCA 2HNZA 4ED2A 1JNZB 1QAXA 3Q2SC 3HHLA 1AA1B 1RE1B 3OTBA 1GQEA 4IG0A 2IBOA 5KFPA 1EAYC 3TZWA 1N54B 4M94A 4DPYA 2Y3YA 2KYXA 2XTJP 4PABA 4TYBA 2PO4A 3S01A 5M2PA 4ZPTR 3WX4A 3AHPA 1UVMA 4K50A 5HMZA 3HVAA 5CYMA 2JRSA 4UW2A 4KRWA 2X7IA 2LEAA 4M5LA 5CYMB 3OV7A 1FK9B 1TUWA 2AHOB 2FGCA 4DOZA 4DL2A 3V81A 4URSA 2OEMA 1XWLA 4MJKA 1KVKA 3PJ9A 4TU8A 2NLWA 3OPKA 3OXLA 5GAHI 4OX9J 3RZAA 3HHLB 1SIZA 2IJRA 2PSZA 1UMJA 2RU3A 4RZRA 5LL6d 3LAKA 3D67A 3BYPA 4OFZA 3U1MA 3M9MB 3NWGA 4KV8B 1RAEB 3HD1A 5KFNA 4PG4A 4PWWA 4NI2B 5ETSA 3CXCR 3GJRB 5EGYA 1TP7A 1S48A 3OXFA 4LJMA 4ETZA 1JJ4A 4B3TJ 3R7BB 4R25A 3GYGA 4F36A 1FJCA 3O1LA 1TL3B 1FVQA 3C14A 3I32A 3K5PA 4B3MJ 2RDIA 4HHUA 4P71A 1XMBA 4WF9Q 3HF5A 2FZGB 2MKYA 4OZNA 2HIYA 4TLRA 1YKWA 3MEGA 2QGFB 1KSPA 4A46A 4NEZA 4QR0A 4B3SJ 4DHVA 4LFBF 1NMEB 3QNWB 1YTYA 1IBKJ 3VZHA 3R5BA 2PGCA 3R5AA 3BB5A 4IUFA 1HWLA 3JSYA 4OYMA 2IJNA 5B0BA 1U7LA 4OI3A 5IWAJ 1R8BA 3FBCA 4B9MA 2X1FA 2Q6BA 3BPDA 1JLCA 1G2EA 1F2HA 4XDDA 5KFIA 3UQSA 4Q8FA 4LUBA 4JI7F 2BXJA 2MQOA 1WEXA 1DLOA 2JC1A 1CQNA 2AYBA 3F44A 1RHMB 1NU4A 4P7VA 1AFIA 2D7SA 3LGNA 2W4DA 4YR3A 5J2MB 4KO0A 3GQCA 2VQEJ 4F50A 3PJWA 4F25A 3N79A 5DLFA 1J27A 2BE7D 4LR9A 4MTPA 3W66A 5EN1A 4KKOB 2G0JA 1Y5NB 2HZAA 2QE5A 3LAMA 2LMIA 1FEHA 4OYXA 2DB1A 1HNXF 4DV6F 1SCJB 4K4TA 2Q6CA 3UE2A 2R4FA 4P2SA 2MJUA 1KQSR 3PW4A 3EX7B 2V69A 4NLSA 1FK9A 2DH8A 3R5DA 5CABA 1JX4A 1MG7A 1Q82T 2BE2B 2ZOGA 5LT5A 3SQGB 1I3OB 3DU5A 4H4MA 2DH7A 1R89A 5J2NB 3W61A 1F1BB 5LJ3Y 3J7YI 1S77D 4IG0B 2M88A 1NXIA 3CCZA 1OS5A 2DHHA 4EYIB 3RBEA 1DY3A 2HHXA 1N5VA 1WOPA 1FKPB 1EQ0A 1HW9A 1AXQA 3FEZA 1JLAB 3M2VB 4YQWA 5LXYA 3ISNC 5J1EA 2N7YA 4TNOA 4ZS6A 3BBCA 5M2UA 4Q5VA 2O01C 4C11A 1AW0A 2HMIB 3AFGA 3HFVA 1HI0P 3K0JA 1V3SA 2BEFA 4UQTA 2ZM6J 1HR0F 1GEHA 2WHOA 1RWWB 3CWJA 3MTKA 2V94A 3ZC4A 3IN5A 2XLKA 2FC8A 5KFTA 4RUAA 4USWA 2XO7A 2AZ1A 2AJ0A 2DISA 3TVYA 2AU0A 4IFVB 4DQIA 2BMBA 3DM2B 1TUVA 3GONA 4CYUA 1ZTWA 1JLFB 2HHTA 5AE2A 4DR6F 1RU2A 4PPZA 5L9XA 1DJ0A 2BZ2A 3UI3A 4A47A 1SC3B 2F7VA 4UQGA 2UUAF 4V19X 3BO4A 2QA2A 1PBAA 4H54A 1EKRA 4PZVA 4DF4A 3CCJS 3MTJA 1NJIT 1V3RA 4WZQA 1N6QB 1U09A 2DXDA 4JV2A 2ZUAA 3FRZA 4FYVB 4NLOA 3WDOA 4XIUA 3GV7B 3GIRA 3US5A 3R7SB 4JV1A 3SSSA 3CCQS 5KFZA 2MKSA 2LU1A 5E2QA 1TZ0A 1M5HA 2B43A 4NASA 3U27A 1KEKA 4X4TA 4DR1J 3PKMA 5DRKA 4F2RA 4KB7A 4NA2A 2QIFA 4QU6A 1U2CA 4K0KF 1Q8KA 3HT0A 3PRVA 3NS7B 5KG6A 3H4DA 4FXVA 1JLBA 1Q53A 3BKTA 2W2NP 3M32A 3SCKE 2K8GA 1NK5A 2QZ8A 1HW8A 1RA6A 2KM8C 2FLNA 1TU0B 3I0SA 4F8RA 2JOQA 2O5DA 2CNLB 4K4XA 4EYHB 1U1NA 4NXNJ 5RUBA 1Z2ZA 5DQHA 5DG9A 3MMBA 2GW8A 1ZM3A 1RT2A 1NPKA 3BGFA 2LXUA 2MKJA 3LP0A 4D3GA 2E1AA 2WOMA 5IT9U 3ET6B 2DR9A 4PUOB 1KD1T 1TV6A 3NXZA 3S8SA 5HROB 1XR5A 4U9RA 4H4OB 5M2RA 1Z2LA 2EFGA 2CXEA 1RWKB 2CJXB 1FTCA 2VBXA 1RT3B 4NE9C 5HO4A 2HHVA 2AP6A 5AXLA 1GFWB 2XYPB 2ZUGA 3IM9A 3KLIA 3W5XA 4LF6F 4OYPA 1XR6A 2ASJA 4N56A 1H2UX 3H5UA 3TZZA 1S7IA 4NA1A 1EKSA 1OMSA 2GVZA 3UVJB 1VC6A 2QG9B 3BN4A 2RSQA 5HVFA 4IO9Q 1YWXA 3BSCA 3LF0A 2BQRA 5KFCA 4MFBB 4QW9A 4A8YA 2VKZG 3CCLS 1RB0A 4EI2A 5HJYA 4DV4F 1HNZJ 2JSXA 3PHEA 2G2ZA 3B4MA 3FNNA 3MZIA 3DLGB 1ZETA 1SJ3P 4B3TF 4EO6A 1U45A 1UP1A 1YJNS 2RF2A 1TL1A 3MPWA 9RUBA 3I5CA 3ITHB 2ASLA 4CRJA 2VHGA 1U0SA 4DCPB 2IMOA 3I9V9 5L1KA 2UUAJ 2H51B 3GJTB 5KG0A 1RTDA 1UETA 3M2UB 3R97A 1KC8T 2YNGA 1XQIA 1NJXA 2G0CA 2WVBA 4DSLA 1VHFA 3TR5A 1QSLA 3BM7A 3V6DA 4BS2A 3MI7X 1RADB 2NXCA 3DRSB 1GXUA 1LFWA 2B8PA 4C8MA 3BSOA 2OLWA 4YOEA 2H1YA 1WDDA 1N32F 4ZIVA 5D4OA 2V2ZA 4PAAA 4KHRA 2OPQB 4X62J 3NY0A 2BR0A 4GMKA 3EGZA 3QT7A 4QWCA 4CH1A 3OSNA 3PYEA 4ZCIA 3THPA 2YWWA 2AMCB 1BWVA 3CUNA 2QMUB 1VBZA 3OFGA 5LJ5Y 2B5JA 4WU3A 2IVFB 4Y0FA 2R7RA 3MMJA 3PKYA 2HAFA 3IGNA 3QIDA 2BJDA 2CPJA 4L75A 4P9SA 5B0AA 1EZZB 3U1NA 4XDCA 4J9UE 5L1LA 4IOAQ 1SH2A 3JYTB 1G3OA 3D28A 4OYWA 1U49A 1N34J 2QEXS 2ZVSA 4DX7A 1HBOB 3PY8A 1U1KA 1MMLA 4I2QB 5D0GA 5KT7A 4U7UK 1C1CA 1KRPA 2HWHA 2AYEA 4PYAA 4ZPDA 4ZVOB 2M9KA 1S57A 1VLYA 1XEZA 2HG4A 2LA6A 4X4SA 2I2YA 4KBIA 4Y3CA 1C1BA 2VU5A 4I68A 4KH1B 3DMJA 4NLVA 1IQTA 1XR7A 2Y9HA 2B9YA 4WFBQ 2PEHA 2CQBA 5KFRA 2A0FB 2EFPA 3SSQA 2W1BA 2E7VA 2XNQA 2MZRA 2OSRA 2R7QA 3QAEA 2DHGA 3H42A 3NEKA 2RRAA 3ISND 3FSIA 1VQ8S 1IVZA 5DGBA 5SZTA 4OX8A 1T0TV 1MLAA 4TXSA 4ZP6A 1PJ6A 1LFPA 1BHNA 2V68A 2FYXA 2RS8A 4F04B 2XB2D 1FXDA 4BC7A 1NB7A 1FDDA 5H1SV 2Z58B 4HT5A 3NGTA 3MWBA 2MKCA 3IFEA 1T8EA 1TK8A 4DL5A 3MOZA 3DGPB 1LW2B 2DJWA 5DG7A 5DETA 1Q1KA 2A10A 3M8ZA 3FBEA 3OLAA 2B9EA 3OR2B 1R31A 3DC2A 2UV8G 3OR2A 2QC3A 4K7QA 2YKMB 4USHA 5BYRA 2VPWB 3HX9A 3Q8QB 5I4MA 2DNMA 1ZYQA 4TY8A 3QWPA 4K59A 3TAMB 5BR8F 3DGPA 1X4DA 3OFHA 3UFCX 4PYDA 3V4IA 3A4TA 5K20B 3BH6B 2DXFA 4K4ZA 3HKZD 2Q3PA 3RB6A 2Y0SD 4PG6A 1D9DA 3E51A 1RSCA 1EHWA 4QWEA 1DRZA 3OTCA 3SDEA 3CC4S 4G3IA 1X5OA 1ICEB 4HVZA 4R0JA 3W3SA 4ERDA 2QRRA 2JJ4D 2X1GA 2B7BB 3DNCA 4FXDA 4IFYB 3R6LB 3ET6A 5DJBA 1C2PA 2U1AA 2DVIA 4J90A 4P2MA 4B9SA 4V1Ak 3ETMA 3T19A 3ZZTA 3B6BA 4CTAB 1HD0A 4KTQA 2L9NA 4M95A 1VQMS 2RQMA 1JB0C 4JI0J 3TUJC 4LF4J 1C1BB 3DLKA 3I0SB 5SUHA 5IS2A 1HQEB 3NCPA 4ECVA 1O5JA 2MLXA 2VV5A 1TKZA 2D3UA 2B7CB 4RW9A 5L1IA 2ZH6A 2XWYA 2KRBA 5E41A 1IXKA 1VJQA 3I55S 1DZ5A 1VQ5S 1D3WA 2YKNA 4ZHRB 4PR6A 2KZZA 4Q2LA 2ZH7A 5J2MA 1N5YB 2GJFA 4KPCA 4X4NA 1NEEA 1OPZA 1KNZA 2IDLA 4KHPF 1UJ4A 3RBZA 2BW7A 4DUYF 4I1TA 2HLUA 2O3DA 2WSCC 2ZNYA 2VG7B 3U02A 1DTTA 3M6WA 4X65F 4AL7A 1T9TA 1EETB 4ZMMA 4TKTA 1D9FA 3BQ0A 2W01A 2DYAA 3G4SS 1PJ5A 3LPYA 4HR2A 1S6QA 5HJXA 4A8KA 1N5QA 3RUBL 1WNEA 5HQMA 1CULA 2DGSA 2IM2A 3FCHA 4B9TA 3FEYB 4ZKAA 3DDKA 1PYSB 1SVDA 2EC2A 2Z2LA 3AH6A 2XHWA 2J9EA 3H7HB 4I69A 4Q0BA 2WBRA 1CJUA 1LK7A 1I5OB 1Q5VA 2IAJB 2Z56B 3DXBA 2RUSA 3HJVA 3DYAB 3N4WA 2ZBQA 4DPTA 5LMNJ 4UOCA 1GMUA 4CLSA 3CD5A 2XS7A 3S6EA 2MKIA 5KAKA 3H90A 3AJ2A 2Y1JA 2YNGB 1DQ9A 4JBCA 5HMXA 3W5YA 2W9CA 3S7RA 1Q7LB 3SCIE 1X4FA 3O3LA 4PPDA 4JI4F 4XO0A 2A3JA 4IQMA 3DOLB 2HPUA 3DRPB 4OJHA 5D3GB 2Z0GA 1U1RA 2N7CA 3UD5A 4DSIA 4RLEA 2GMHA 3I56S 3P49B 3NS6A 5F3ZA 4NLRA 2D9PA 3PACA 4ICLB 4CIOA 2K7JA 1FKPA 5KFEA 4JI2F 3VAJA 2KXHA 4KFBB 1Q86T 4GKJJ 1O0PA 2PMZD 1UZHA 1M5KC 3GSIA 2WBMA 4U95A 1UJ6A 2FVQA 4F4XA 6FDRA 1BQNB 2KYZA 2NS1B 3BS9A 3R1LA 1HNZF 3UVJA 5KFXA 1R0AA 2DGOA 2GAHC 3KLHB 1PAUB 3SBMA 1K44A 1T11A 2BE2A 4C3LA 4DSEA 4K2JA 2N4DA 1WC0A 5A6WA 4I2PA 4GO5X 2XEXA 2BYCA 1RT1B 1RQ0A 4NZ6A 5A6PA 3EVOA 3PO4A 4C6AA 2MYFA 3GILA 2L9WA 4ECSA 3MEDA 2ZZNA 2I9SA 5E3CA 3EVMA 2IY5B 3T6BA 5IM0A 2K06A 5LSOA 1L3TA 3PDNA 3M8SA 1WELA 3G71S 3QWUA 1F9EB 2WOMB 3NAHA 2BJ9A 5DM7Q 3JQMA 5DDOC 3H20A 2AIRB 5EX0A 4CLKA 5C7PA 4YHHJ 4EGLA 2DNKA 2H5EA 3QT5A 3K58A 5LMUF 1AROP 3KNAA 3G8QA 2ZM6F 2CJAA 1NDLA 4OYBA 2JFDA 5DDRC 3QIPB 5J2PB 1LW0B 5B0FA 1GXLA 5IT0A 1PO6A 1HBMA 4EK2A 1VDHA 3NOGA 3E2EA 4K5SA 1RLCL 2OEKA 4LFBJ 1ZBTA 2PT0A 2H4YB 2CPDA 4EWTA 3AQPA 5CZXA 3CC2S 1BQXA 3C6TB 3HVTA 1PSDA 3KLEB 4WK3A 2LQBA 4P73A 3OFFA 2V4JB 3ZO7A 2AGOA 3NG8A 4QIGA 1S72S 4PWDA 2KB2A 4W4MA 2LEBA 2ILYA 2DNPA 3S1TA 2VOOA 3GG1A 1KHWA 1OY6A 2KI2A 1C4AA 2LQ8A 5KFMA 1QSYA 1KFSA 2R7TA 2HQGA 2NSBA 1KDNA 2N82B 2OIHA 1KONA 1XTZA 2ILZA 4F4WA 1CC8A 5IQ6A 4QIWD 3CJ4A 5A2QU 1VISA 3PNIA 1RI7A 1S6OA 3KUEA 2XYHB 1KFDA 3GG0A 4KHMA 5CZVA 1W2BR 2DGUA 1HBUA 3DM2A 2OPRA 4DS5A 1F60B 3G2XA 1ZA1B 2KU7A 4KSEB 4KYZA 3ZTSA 2QLJB 4RUCA 4OZ0A 2XULA 5E7OB 3DLHA 4OHYA 2ZHBA 4ECRA 2HQCA 4WWSA 3HVWA 2GMJA 3W8GA 4L3KA 2AKWB 1PYOB 2MEWA 5GAEI 3BN7A 2FZCB 3TWZA 4U67Q 1UWBB 1ULRA 1N36F 3GFXA 1H38A 5IWAF 4PXDA 1T7PA 3WBZA 1XMOF 3CVKA 3MMCA 2KFYA 2IM1A 2O1PA 3CDBA 3TX8A 4I6WA 1MWQA 3DFEA 4MIAA 4X66F 1S6UA 2IVMA 5E3AA 3QRQA 2QL5B 3K8VA 4LF9J 3SMZA 3BQ1A 3G9CA 4K2XA 4HLBA 2V8DA 3I31A 3KHGA 2DR8A 4W92B 1DHMA 1LWCB 3CJTA 3EM1A 2QLBB 2B0GA 5IC6B 3TZYA 2XO6A 2CPIA 2XC9A 4A8SA 1IBKF 1URRA 2GVDB 2DNLA 4LRBA 1RTIB 2LCWA 2ACYA 5A0YB 5GAEU 3ZZYA 2ZE2B 2XHCA 3K2YA 4PXEA 4J5OA 4YFUA 4DQSA 1FKOA 1NAQA 3DLLQ 1FRLA 4WIQA 4W90B 4ZLNA 3Q8VA 1T9WA 3PX6A 3G96A 2WZ1A 3NAIA 1Q8BA 2KZMA 1UEUA 2CQHA 2B3TB 3QSYB 1SQFA 2WW8A 2ABYA 2DCLA 1HNIA 2IC3B 3AD7C 3QFHA 4RW8B 1TQLA 3LP1B 4N47A 4ES3A 2BJ1A 2CQ1A 1SQEA 4PKDB 4Y00A 3UR3C 3MR5A 2R8HA 2F4VF 1KN6A 4J91A 3P45B 4NCBA 1H0HB 3TNVA 2HHPA 2YNIA 4URQU 4HHJA 3MPDA 3H98A 3H4BA 2HRTA 1BC6A 3M8PA 3SEOA 2G1HA 2LEPA 5A2QY 2QN6B 4BWMA 1QVFR 2V8HA 1Q8LA 3V6JA 1J2VA 2V0NA 3FDSA 3IWXA 2FVSA 3AB2B 1RHKB 2FJWA 1SUQB 5C24B 3HVRA 1MWZA 2XY7A 3KTQA 2BABA 4WCEQ 4MYUA 4O3OA 4ZVGA 2PI4A 1WACA 2DTJA 4OX6A 1OSCA 3IS9A 3OUYA 3HSJA 3IM8A 1CQMA 4DWIA 4Q2MA 2KFZA 4LBHA 2YQ0A 3QIPA 5J2PA 4AXIA 3J7A1 3THTA 2P6TA 3EWGA 4OMFG 4G1QA 3L4BC 4YEAA 1RABB 1R8CA 2CDQA 3GTYX 2JX2A 4KGXB 4KR0B 1XERA 5GAHU 1YJWS 2VQFJ 5H9FK 1WJ9A 2HFZA 2YWEA 4I6AA 5CYQB 3ZZZA 2M52A 5C42B 2M5YA 2GFFA 4QWDA 2E9ZA 3PR5B 4KV8A 3D6MB 1FF2A 2UVVA 4C9DA 2DNRA 2GQ2A 2WONB 3H0PA 4G65A 4NX9A 4OI4A 1WD6A 5B0GA 3TA2A 4DFPA 3NP5A 4CLPA 3RRHA 3M05A 2M8DB 2VFUA 4P7TA 2HS0A 5L38A 3CE8A 3VGUA 4Q8EA 3V2UC 3ZNUA 2PEBA 3KLGA 1MMNA 1T9XA 5L1JA 2AT1B 3OD2A 3V81B 2MZTA 2Y1IA 2K2PA 1LV5A 2BJEA 3O2IA 2H4WB 1CS4B 4RBTA 1U1QA 4H4KC 3R7NB 2MGZB 2C2RA 5KOWA 2YNIB 2J6SA 5D78A 2E5LF 1RAIB 1JWWA 1S1XB 7FD1A 2HLTA 2DY1A 2YKPA 1H72C 4NZ7A 4WP3A 2AGPA 2Y8WA 4ZPCA 1TFYA 1NCLA 2LP4A 4X84A 2GJIA 1O6XA 4IKAA 2NQPA 1YBTA 5T14A 4FVMA 2Y0BB 4F0KA 5B0DA 4IRKA 1N5SA 4DR6J 4L73A 1HBNA 2P2CB 3CCTA 3LW5C 2DGVA 1I1GA 3QSIA 4ZVFA 4NL5A 3HP6A 3WC2A 1RWPB 1SI9A 1VI7A 3TYTA 3V5RA 2LA4A 3JQKA 4NCGB 1HI8A 1KOOA 1ZAXA 1HNWF 3OVAA 1HYSB 3FBFA 2EK1A 3H2UB 3CDEA 1FFGB 4JI5F 5A8KA 3O8WA 3D1HA 3M9OB 2HWTA 4Q7AA 1BD6A 2KXFA 3N6MA 4FYXB 1S1WA 2NXEA 3GSDA 4NOHA 4ED4A 2E44A 4QW8A 1RTHB 5ETMA 2HFSA 3PZPA 4ECXA 2QV6A 5E3RA 1Y4ZB 2DBBA 3VCDA 4F4AA 3B78A 3X3UA 4FKXA 4OYOA 3VTIA 4B9VA 5D8HB 2QL9B 1YG0A 1Q81T 3L3CA 3QYYA 1B0VA 2KKHA 2HS3A 2DNQA 3D6TB 4HI2A 1YJUA 5E33A 4G1QB 1APSA 3G8SA 1HMVB 1RWXB 2GIFA 4OZ1A 1DQAA 4TLQA 2CADA 1LOUA 4M5DB 2LDYA 3EDRB 2FJVA 1ZZNA 3DN9A 2XS5A 1MN7A 5IM0B 3R8YA 2C22A 4E8UA 4JI6J 3IWNC 4UOHA 2IPOB 4ZP8A 4A8FA 4FF2A 1B0PA 1SBRA 1UKUA 3KJNB 2ERRA 4OLPA 2AYMA 4F3MA 5A8WB 1L3UA 2CKWA 1UWAA 2G13A 4WP8A 4CLYA 3TRGA 4URGA 3SYZA 2BJ8A 4K5RA 4C8OA 3P4UB 4G1IA 4DF8A 3NNCA 5DDPC 1IKXA 1U47A 2V4JA 4I56A 5CD4H 4C0OC 3DLBA 1HPZB 5F8GA 4IDKB 1NZ8A 5FLXU 3D1OA 1F9FA 3GPAA 4IG3B 4DQPA 1U1OA 1N4LA 1YIJS 1JLGA 1N34F 1FTRA 1GAOA 1YQHA 2M4MA 1IR0A 2YWKA 4CO0A 4RBVA 1HBMB 1AZSB 1UVKA 1DURA 3VF0B 1U2RA 2XMUA 3TAMA 3V4IB 4OHXA 1SL2A 1HNWJ 2RVJA 5IV3A 3KLFB 5CCLA 2RQ4A 2QX0A 2MMYA 1IR2A 5HN0A 2RUGA 3OTOJ 3H5SA 2YWGA 4NZ0A 5KFSA 1HD1A 2D1CA 3POTA 5ITHA 3ZFVA 3K59A 2ZDPA 2HGMA 1FXRA 2CAJA 2H65B 3DRYA 4B9UA 3ONQA 4JI3F 2XS2A 2XG8A 3FSYA 2CWKA 1SKSA 4OYZA 4PWUA 1P6TA 2MQNA 1GMWD 2IAJA 2B6AA 3HZGA 1FVSA 2CNKB 1RAGB 2IHR1 3CD0A 3GYNA 2HURA 4LRAA 5F3TA 2AD9A 2OPSB 4QIEA 3J81U 2XCAA 4PXBA 3W2WB 4JI5J 3LP2B 1DQ8A 4MIBA 1VIOA 1F3FA 3C3LA 3KLHA 2P9CA 3FC9A 2CQ0A 4DJBA 3KK2B 1VFJA 1E6VB 2Z4PA 3LGMA 1SJ4P 4WTYA 2IRYA 2C2ZB 1C1CB 1FNXH 1KVJA 3H59A 1NJWA 1X4GA 4QR1A 1HI1A 2DNYA 1TVRA 1ZPWX 1PG5B 2ZWOA 4RW4B 5KFWA 2IA0A 3JYTA 3EZ5A 1RAOA 1YHQS 2UVRA 1E6VA 3DOLA 3GCWP 3OJUA 1YI2S 6FD1A 1MW7A 4NLUA 3WHIA 2IJFA 3D0IE 4YB7A 2XLJA 3WX8A 2W9CB 1R43A 2CG4A 3TAQA 1AUDA 4LFCF 2CPEA 5B7WA 5D0EA 4QBUA 2XWXA 4U96A 1U2FA 2FC9A 4IFYA 1XK8A 3M6XA 2DH9A 2AJ1A 4YS2A 2BRLA 4Q45A 2K3IA 1BGXT 2OI2A 4ZJOA 2KO1A 2MLYA 2BACA 3ZZUA 2AYGA 3MAAB 3FBBA 3PR4A 5KG2A 3PX0A 5LMUJ 2PD1A 2SXLA 5F8HA 3M2UA 3QO9B 5BJRA 5K9FA 4OYAA 5EDWA 3GIIA 1S99A 4DV1F 3RR7A 1VQNS 4QYZK 2NZ4A 1S9GB 2VH7A 3M8YA 3MD3A 1S1VB 1KVIA 1FI4A 2HFUA 3N0VA 2YKAA 1RHUB 3BZQA 4FN5A 4XTTA 2JC0A 2RMLA 5F8LA 2Y8YA 4ECTA 2EG2A 1P1LA 4DSFA 1U1MA 2G9OA 5D0RA 4DUZF 1XNQJ 3VZIA 4HT7A 4X4PA 4ZHRA 1UCNA 3PEJA 4LQ3A 4MFBA 2B4UA 3VGTA 1SKRA 1PBUA 1RT4A 1JXEA 2CQIA 4FP9A 3KK2A 2Q66A 4X2BA 4BCAA 4ZVEA 2F9DA 1BUXA 1S1UB 2V4QA 3GYXB 2ZBCA 3DGVA 1IKWB 4ED5A 2WVCA 2JDJA 1UPMB 3CT9A 2GV1A 2I1RA 3AOBA 3BGOP 2DNHA 3W2WA 3OL8A 1QDUB 2B4VA 3OTOF 2M3DA 5G4DA 4L74A 4JP8A 1MU2A 1UVIA 3MPYA 1F5AA 1R8HA 1DTQB 4LF4F 5BR8J 2H9ZA 5G0RA 4J9NA 1N52B 2DRDA 1FRIA 4UUWA 2B6AB 1RT4B 2ATLA 4OIXA 5HROA 2CNNB 3EE3A 3RGIA 5BXIA 3TARA 2OTJS 2RKIB 4KGMA 1BWEA 2W7PA 1S0MA 1N5TA 3Q8YA 3RG6A 2FY8A 2HVZA 3HK2A 1RLDA 2CPFA 3A3PB 2DD8S 1YJRA 4P2XA 3AA8A 3D0GE 3HXMA 5E0OA 3ADAC 4FZVA 1BLUA 2F65A 3VAKA 4EMDA 3FK4A 2N3OA 1WDTA 3MXHP 2YBVA 2K3KA 3QO9A 3RYLA 2HQFA 5EUHA 1AZSA 2YQ1A 4OX9F 1RT6A 1VMBA 5C25A 4ETXA 3OHAA 3F56A 5HVGA 1NB2A 1OSDA 1AUSL 1RCXB 1UW4A 5EWGA 4K4YA 3TQ1A 2C28A 3EPIA 2PFFB 1RTHA 2P8IA 4C8ZA 2OMLA 2V2QA 1ZM2A 3CJ8A 2IM3A 4USIA 2VPXB 4J9VA 2R8KA 1WHWA 3W2VB 1CULB 1KS2A 3HFKA 5F9LA 3RJMB 1YZ6A 1NRKA 2OSQA 1W7WA 1RT6B 4ANDA 2POKA 3I0RB 1G4CA 4QOTA 4LMZA 2JHEA 5HQLA 1T03A 2V67A 1WOOA 3A8EA 4M5IA 2KH9A 1AT1B 3DMJB 5CD4A 4ATNA 4CO5A 3T3FA 2NREA 5KG1A 3I5AA 2Z2YB 1REVA 1X9WA 4C98A 1RYRA 2E5GA 1W25A 4DR7F 4RW4A 2RJZA 5L46A 2UXDJ 2C2KB 1IKVB 5J2QB 5FD1A 1TAUA 2UZAA 4C8NA 1IKVA 4J9SA 4ZJQA 5J2QA 2BQ3A 3KOAA 4I4BA 2GMLA 2NXUA 1IWAA 3RAMA 3I87A 2J6UA 3UDCA 4DV0J 1Q8IA 1REVB 1HMVA 1HARA 2F8HA 3H2VE 4MKAA 4AT1B 3K57A 2V4RA 1JXVA 3CJKA 3DLKB 2NXNA 1OO0B 3QMQA 2XCPA 1HWJA 1U25A 5DQIA 1HIYA 2QFJA 4CI0B 1FWKA 3PXGa 3CMQA 3MM8B 4YHHF 3IA0A 4RJVA 1Q4RA 1U0HB 5E5NA 3BDEA 1SV5A 4RNOA 1NJYA 5CXTA 2OTLS 1TELA 3ZTQA 1NK0A 1YGYA 5HK4A 4JV5F 3BGRB 3IGVA 1VQLS 1RHQB 4DN0A 2IFXA 4M5HA 1NPPA 1D09B 2A2DA 4I64A 1TV6B 2BJ7A 2CJYB 3B54A 3A8KA 3RU0A 4XPEA 3OLBA 3P96A 4C3KA 4NLTA 2IVYA 3KNGA 3MR6A 2D3ZA 2FVCA 1CJKB 1HA1A 2ZH8A 1IR1A 3POTB 2QA4S 5L8RC 2JL9A 5AXMA 1VQPS 1S79A 1VK8A 4OV1A 1YBUA 1RACB 2VICA 2R7OA 4CT9A 4DV2J 1KLNA 3TJ9A 2VFRA 3N6LA 3IR6B 2CJ9A 3D6HB 2W4CA 5F9NA 5B0CA 3UD4P 1MWYA 4V19J 2IRUA 1VC0A 2E9RX 3FUYA 2EFOA 2NYHA 5HAOA 4QPXA 2VD3A 1AB8A 1TL7A 2GZOA 4IOBA 3IS9B 4IG3A 4WKYA 1S9EB 4DN9A 3OUYB 4DSJA 3A8IA 1P8GA 2APOA 3AOAA 3IR5B 2BBEA 3PFOA 3QLHB 5IC4B 1LKZA 1S6PB 1IM4A 2VG6B 3LH2S 4RNNA 3TANA 5C24A 3OT9A 3QJJA 1MU2B 2BKOA 1XMQJ 2MLZA 2HYIB 4MK8A 3TJ8A 2HNYA 2M7SA 2FHMA 1JLCB 3DHXA 3KUGA 2YNFB 2D69A 1YVFA 4JI7J 4M5KA 2XMWA 3CJSA 3RB3A 1M5PC 2Q1LA 1N56A 2J9DE 1WTBA 1JLFA 2PDAA 3MR7A 1JQGA 1BMQB 2CPHA 2XMTA 2QSWA 1T05B 2VF3A 3UDVA 3PRBA 3MUVP 2UUBJ 3RTVA 3D3CJ 3AB4B 2OO4A 3QGIA 4J9LA 1QTNB 5CYQA 5AXKA 3KLVA 1U26A 3ZZRA 2ZBRA 2MPUA 4ECYA 3RRGA 4AE5A 2XZTB 3AA9A 1S1VA 3R27A 2RS2A 1X7VA 1F6TA 3NCRA 4NYZA 5D77A 2QLFB 4DUYJ 4W98A 3T5LA 2NSCA 1V5IB 2KT5A 4FDFA 4RW6A 1JKHB 3BR9A 4C0BA 3THVA 4O3PA 3WIUA 3NNHA 1OIAA 2EFVA 4B17A 3MM5A 2WCXA 4O44B 1N48A 1JLEA 2C2NA 4ZLJA 1L3KA 1FX2A 5HSPA 1QUVA 2ZDOA 2OEJA 5GAGU 4I67A 3H25A 1QJHA 5J2NA 2L9DA 1QAJA 5CH7B 3M8RA 3CJ3A 1JJCB 2LKZA 2GHPA 2X1BA 1HKAA 1R0BG 3M1VA 2FGOA 4LRFA 5GADU 4Y34A 2NUUG 1RT7B 4QWBA 1SXLA 2CPXA 1FE4A 4OJGA 1C4CA 5DM6Q 5EWEA 1VC5A 2PI5A 1JNRB 2UXDF 3CDAA 2Z2MA 5A76A 5KFHA 5LSRA 3BO2A 4WZMA 3D0HE 3KJVB 2D3O1 1ZAWA 3CNQP 1FRXA 1LWEA 1WHXA 1A9NB 2OAUA 2UU9J 3LP1A 1T9UA 3JTNA 4KGVB 4EU0A 1HNIB 4RW8A 2DNZA 1XNRJ 4IFVA 5HL7Q 1OWXA 4DDFA 3G6VA 2BM0A 1X4BA 2KVIA 4DCJB 2BQUA 4LF5F 1UEVA 4CQ1A 3TEHB 3QPIA 4HEA9 4YN3B 4MKYA 3MEKA 3R2CJ 1LWEB 3G82B 3EXYA 2CYYA 4KAIA 4RU2A 3GE9A 4C11B 3NNAA 4QQBA 2MGZA 1CS4A 1RTIA 3MCSA 3V4MA 4D3HA 4ID5B 2IBKA 5ETTA 1JLAA 2I38A 3HULA 3F73A 4DV7F 4DV5J 3VAGA 1WHYA 1U1PA 4XAKA 4Q43A 2NZCA 4CNZA 4YB1P 4C2MA 3SFUA 1IBLJ 4B02A 2CDRB 1W2IA 4E98A 3G8TA 3B4DA 2RE1A 4EO8A 1X31C 3QT8A 3NCQA 3ILOA 2BOPA 2DEJA 4A8OA 1XMQF 3VR1A 1VQ6S 3R5JB 2CQ3A 3C6UA 3EZOA 4N8NA 2MTLA 1S5ZA 3D9BA 2PA3A 3LP0B 4MMOA 2RB7A 4NLWA 4DV6J 4PRFA 1IJFB 1B99A 2L08A 8RUCA 1GNKA 3GJQB 3OW2R 5FDLA 4IH5A 5KFBA 4NCAA 2AEMA 2OUGA 3PRDA 2W7AA 3FCVA 3CDUA 1X5TA 2V8GA 3CJ2A 4LR8A 4U6PA 4DFJA 2B9WA 2ZVIA 1FD8A 4ELUA 3G6XA 2KVQE 2E66A 1IBLF 5KFQA 2OJ3A 1OYDA 2XI3A 1I6JA 3CIZA 4ES2A 4QYRA 4F67A 5GMDA 1VQKS 3C46A 4GKJF 2ROPA 3KK1B 1FRHA 1FNMA 3K7RA 3Q86A 2AW0A 3EJMA 4MYTA 3J7YU 3A1YG 1UTAA 1GXTA 1RBLA 3A3NB 4AD6A 5KFKA 2V8PA 3BQ2A 4YB5A 3D54A 2IDEA 2RRBA 4MK7A 1TKTA 4GVBA 3VHQA 1SKWA 2R7VA 3N5FA 3QBCA 1WHVA 2DPJA 1NH7A 3GP9A 2HBRB 1S6PA 2JVRA 2MSTA 2VG6A 2YX1A 1FRMA 3IBFB 3SFGA 3CCMS 2XNRA 2F63A 3GIKA 5DZ7A 5FLXY 2B56A 2ZEJA 1UAWA 5KFGA 1LW0A 2C3YA 2WAQD 1NH8A 3NGKA 4WBFA 2HW3A 5DZ6A 4QIFA 4CLTA 4C48A 4FPIA 2YWFA 4CDIA 4YDDB 4O4RA 3KJVA 3HM9A 2X3DA 3RBXA 2HZVA 4F2SA 4LVNP 2RHSB 1A0OB 4LFAJ 3J80U 4ZITA 2XLIA 1RT7A 3HZEA 4QYZJ 1AYEA 1CJKA 1PC5A 5CHCB 1L3VA 1K0VA 2FJBB 2CRLA 1YJVA 1DARA 2PFDA 5E3PA 2D3OR 4WXOA 3O5TB 2EKYA 2ATCB 1IUJA 2DGTA 2Z57B 5A8KB 2YPYA 2E5JA 3D5MA 3LO3A 4BBYA 1VQ9S 4GVLA 1NKEA 1Y9OA 4KGKA 5JUMA 3TEGA 4ID5A 3KK3B 5C42A 1WG1A 3SCJE 4I2PB 4LF6J 4ZVHA 5F0UA 3MCMA 2FVRA 4JI4J 1GK8A 1FX4A 1HNXJ 3DLEB 2R42A 4HTIA 5CAAA 1CBKA 2ZKTA 3MUTP 1M1GA 2CNOB 3JTPA 2B4OA 2NPIA 4LIWA 4M5JA 5F8JA 4R0EA 4CT8A 4CP5A 4NLQA 4BHQA 2MQQA 2MQLA 4FF1A 1IN0A 1KLMA 3BDPA 4KQZA 4WFXA 1T05A 5LMNF 4FBUA 3MURP 3IAS9 1GMWA 2J0QD 3NLCA 3MUMP 4HKQA 1YJ7A 1VRTA 3NS5A 2WB4A 4O3QA 4K4WA 4KJIA 1VIXA 1RBOB 1RTJA 5A8RB 3JAMY 2HVHA 5J1NA 3ULHA 3QGPA 2BE9B 4DX8H 2EPIA 2R8IA 4LFCJ 3AXKA 1E6YA 3C15A 4ELVA 3VV2B 5AJ3F 1P9YA 4PQUA 3FVYA 4CLWA 5ETVA 4YMEA 3GWCA 4B3SF 3JXOA 5HLFA 4LF7F 1RDRA 1T9VA 4XPCA 3ZZ0A 3SI8A 4LF5J 1KTQA 3KMQA 3MDFA 1P27B 2ZITA 3C6TA 2V8VA 1RXOB 2BOAA 3DOMB 3MEGB 4N41A 2C3OA 1QD1A 2RRNA 3P8BB 2XZDB 4GC6A 1D0EA 2CVIA 1JKHA 2KT3A 2RIJA 2O66A 1FRKA 2AF6A 1EETA 1NHVA 1Y5IB 3AQOA 3FEXB 4O3RA 1ZA2B 4KIAA 4ZJLA 4JV0A 1WF0A 2YKMA 1VQ7S 4TU9A 4WYLA 1U24A 2GIRA 3IAM9 3JAMU 5A0YA 2VQEF 4Z7CA 3I9ZA 4CH7A 1UFKA 2YNHB 3UCUP 2XSFA 3IR7B 5DDQC 4EZ9A 4DL0C 4KPYA 3U1LA 3OQ2A 1HHSA 3I5BA 2UXBJ 1O8BA 3T6JA 3HJFA 5IT9Y 3FRYA 4OV6A 5K8NA 1H7WA 3KWMA 2GA7A 4NYOA 4OYIA 1TKDA 2OP5A 3JTOA 1EIYB 1WC1A 5J1PA 1DTQA 1WF2A 2COLA 2VFVA 3RBDA 1R8PA 3DI6A 4OLOA 4USVA 3VGVA 1U0HA 1N33F 5ETPA 3W9HA 4CTAA 1KBRA 2VPYB 4OJ1A 4RWXA 1UWBA 4RX6A 4ZVRB 4L3NA 5K8PA 1JXLA 4LF7J 3HHNB 2IRXA 2ZBIA 2W2PP 1SJFA 2KHDA 1S1UA 4LIRA 3Q24A 2CJKA 2Z8QA 3G87A 3G82A 4QPTA 3NMAA 1KKHA 1JIHA 1S9EA 3OL7A 2IC3A 4KGZB 5HI7A 2J9DA 2UU9F 1YX2A 2QJ3A 4L72B 4Y2KA 1MNEA 1RBAA 1X60A 2FTRA 4I2QA 4NA3A 4DX5A 3SV3A 1UVJA 1RWVB 2YH0A 2G0IA 4FNHA 3FGVA 3W7BA 1QM9A 2G1DA 5EHHA 1TK5A 4F3OA 5KT4A 2ZC4A 1S0OA 2JWNA 1FKOB 5I42B 4RO0A 4USUA 2BX6A 2KN4A 1ZPVA 4BWJA 3OVBA 3T5JA 2MZQA 1WTFA 1Y7PA 2CZ4A 4K8RA 2W8KA 3Q0AA 1TMJA 4DG1A 3CB4A 3ZTPA 1F3VA 4DEZA 1ZM9A 2V2KA 1RAFB 3QAUA 1LWCA 2BM1A 2FHOB 5T41A 2EKNA 3A12A 1NSQA 2R8JA 3W2VA 4AL5A 1YDLA 2X3GA 3M2RA 4ZVPB 5KFLA 2CQPA 3VVUA 5AE1A 4DR2J 4ER8A 1NJZA 4B3OB 1VRQC 2ZH2A 3BGRA 1CJUB 4UOFA 2HKEA 1N0VC 3TO8A 2IYIA 2F5GA 4P6QA 5HMYA 3MCOA 2UP1A 1SB6A 3LANA 4ITSA 1OJ4A 2UV8A 4TYAA 1SC4B 4FYDA 2GO8A 3M8QA 3TA0A 3V6HA 4H4KA 4ZVUB 4J9QA 2DITA 4DQQA 1L5UA 2JEJA 2E9TA 2BVZA 1PJ7A 2C2OB 1ZAVA 2OGUA 4USMA 2EWHA 2X1AA 5DGAA 2H5JB 1N8RT 2K1RA 2HBYB 3P5BP 5AJ3J 1YRUA 1S9FA 3ITHA 1PCAA 4IRCA 1RA7A 1UA1A 3JSRA 4LFAF 4Y65A 3PHTA 1X9MA 4CCHA 1FJGF 1VYAA 4RBUA 1HBUB 1C0TB 1K1QA 4CM0A 5BYQA 2J8SA 3GFYA 3FZBA 1WEZA 2J8AA 1B3TA 4DR3J 3T9NA 5JVHQ 2FLOA 1A6LA 1SC6A 2VFSA 4TY9A 4ZP9A 1Z4UA 2DNNA 3SQOP 4DZDA 1NDKA 4E0DA 3OVSA 2B8QA 4DFKA 2BANB 2MY8A 4WFAQ 1T03B 1ITPA 1H6KX 1HHQA 2NPFA 3NL0A 5I3QA 2JLFA 3EPGA 1J5EJ 3PO5A 3I6PA 2UXBF 4UUXA 4ECWA 3RR8A 1IKWA 2AEJA 3U7JA 1Y5LB 4HACB 2OPSA 3M9NB 3E8OA 1NK4A 3QLHA 4H4OA 2HBZB 4C3MA 1VCTA 1XN9A 4LRDA 3SDEB 2RU9A 2OH2A 1KHVA 1QE1B 4EZ6A 2R7SA 4ICLA 1RTZA 4RR5A 1B7YB 4TY8B 5KFFA 1IQZA 5IOLA 5F8IA 1ZTTA 1RTDB 1NK8A 1NLKL 5B08A 3V6KA 4CO3A 2E5LJ 4WFYA 2ADCA 1RWUA 3B82A 2CPZA 2RF2B 4ELTA 4LR7A 3UD3P 1TL4A 1M0SA 3BKUA 5HP1B 1RYSA 2ZH4A 4N5SA 3W63A 1YRTA 3T1HJ 4JV5J 1CEZA 1YZ7A 2JFKA 2YKOA 1JLGB 2AJ2A 1VOMA 3BEGB 4RNHA 2CQ4A 1T02A 1M90T 2DO0A 1FHTA 1YRXA 1HNVA 1HQUA 1I51B 2QA1A 3BO3A 1RCOB 3IP0A 4HACA 4Z7YA 3J81Y 1IKXB 4DV3F 1CJVA 2HQIA 3NWRA 2DPIA 3KLIB 3KDOA 1S6QB 1K0TA 2MJNA 1NSKL 2V2VA 3CDWA 3KYLA 2N3LA 3MM8A 4USJC 1RT3A 3AD8C 1K73T 4DV5F 1D9AA 2AZ3A 3TAPA 3T1AA 4A4JA 4ES1A 1S4EA 1BQNA 4UF4A 2QTWA 5IXUA 1F5BA 3KUHA 4ZDNA 2FZKB 1Q95G 2BV3A 1S1TA 1NM2A 1HFEL 2OPPA 7FDRA 2ASDA 1WC5A 2B51A 5H9EK 4MK9A 3VAIA 4FS2A 1WG5A 1Y0HA 4HL9A 4AFFA 3MMBB 3OSPA 4E2FB 1U1LA 3PX4A 2OD4A 1YJTA 3QRPA 4GKKF 4HH0A 1B7FA 5GVQA 4DU8A 3TX0A 1B70B 1S9GA 2AEFA 1R8AA 3KJFB 5H9EJ 1VBXA 5F8NA 1T3OA 3C8YA 2Q79A 1KTVA 1ZM4A 2OPPB 3FCWA 4DXLA 6AT1B 1S1TB 5D4NA 5KG3A 2OPQA 1NKCA 2VZ9A 1U4BA 2CVEA 4IH7A 3QZ7A 5T7LB 2LFVA 2WK4A 2HVDA 3MPVA 4Y2IA 2QSFA 3CF5Q 2G2YA 3DHWC 4DG1B 4CO4A 4A48A 3BREA 4DV7J 1BQMB 3PJXA 4RUHA 4DV1J 1L3SA 3PTWA 2J5AA 3CEDA 5D6GA 1HR0J 4KY3A 4FPRA 2HVEA 1Z1ZA 3DLGA 3NKYA 5MAOA 2KTQA 3D4JA 3EGVA 2A2CA 2AJFE 3PW5A 2XY5A 3BGUA 2YKNB 3QJLA 3CJRA 2RKIA 2XYGB 4LSNA 1X9SA 2XGPA 1B4SA 3MFIA 5IZHA 4OX7A 3AAWB 1RP5A 3W5ZA 1HQEA 2GVZB 1FWPA 2UUBF 1R0CB 3M7VA 5K14B 3T1YJ 1LEOA 2GQCA 3GJSB 2CZVC 2YXLA 3C2PA 3N01A 4XK8C 3DKDA 1S0VA 2DRAA 1RAJA 5DG8A 1N36J 1FNOA 2H54B 3DOKA 2W2OP 2KG0A 3CIMA 1QE1A 3F41A 1U6BA 2RQKA 3EZUA 2J0WA 4P10A 2FHJA 4LF8F 1MMDA 1IM6A 3UN5A 1YITS 1IJEB 4C7QA 1RGVA 3D3BJ 3EYZA 3R6GB 5KT5A 1RKJA 2XM3A 3MHYA 4OI0A 3PCOB 1SJQA 3VWSA 1S76D 3MR3A 5KFYA 1HBOA 1AFJA 4ANCA 2FJEB 2R7UA 2W7OA 2F4VJ 2W4PA 4J9RA 5KFOA 3KG0A 4HTJA 4RNFA 2YPZA 3C14B 4AQYF 3Q22A 2HSEB 4LSLA 1HWUA 1O51A 1YLXA 3IMQJ 4ZVTB 3MFHA 3ENWA 3KLFA 2AJQA 3DDIA 3TI0A 2MHEA 5CCMA 1F0XA 4LBPA 4S0MA 3TVKA 3VQSA 1FJEB 1R27B 2H5IB 1S59A 3M32B 1C0TA 4KKOA 4LQ9A 4ZCMA 3H5XA 2CPYA 1KR4A 2DHSA 5I3PA 3NOCA 2JLGA 3HCXA 4AUKA 3T41A 3QZ8A 1QSSA 4IDKA 2VL1A 1GH8A 1X0FA 2QYCA 3IBCB 3UCZP 2W9BA 3H8YA 4IR1A 2AGQA 1ZH5A 2DRBA 3VALA 4ED1A 2JZ5A 4ECUA 1HL6A 5FIIA 3KMSA 2J6TA 4JOUA 3CC7S 3HSZA 2FVPA 2AQ4A 4ID8A 1RTJB 4AXJA 2F3JA 5C2CA 3OL6A 3RW7A 1X8DA 3Q83A 1YJ9S 3CW2C 1SL1A 4WIIA 1XMOJ 2VA3A 2VASA 3KG1A 4JYAF 2I5JA 2VDIA 4M5MA 2KT2A 4MH8A 4UOGA 1HLWA 3WC0A 1TAQA 4FVCA 3BSNA 2L48A 3OBIA 1XJWB 2C42A 5THWA 3Q8SB 1NHKL 5JVGQ 2MXYA 1SJ1A 5B09A 3QGHA 3LPEA 2XMAA 4C8YA 4PQAA 2FUG9 4HDGA 4QWAA 4F4ZA 3DDNA 2GHVC 2NCKL 3DLEA 3IXQA 5AT1B 5BYSA 4CLUA 2HZCA 1JJHA 2KXNB 1NZAA 3UDEA 2ZE2A 1XIQA 1LK5A 2CWXA 2AV5A 2DHAA 3D66A 3PYGA 1PC4A 1X4EA 2OFGX 1CG2A 3ILJA 3PG9A 3QFWA 1Y00A 2E7XA 5J1EB 2ROGA 2ZNZA 3PYFA 3CCES 3JB9k 3CCWA 3JSMB 3UO0A 2CZ9A 1VGYA 5HBMB 2HQ3A 2JLEA 1P1TA 2DGWA 2WSFC 1WC3A 2W25A 1S1WB 2YKQA 1WEYA 4WK1A 5CQGA 2Y1RI 2J0SD 4KE5A 4NI2A 4PG7A 3ENVA 1SIWB 3FMWA 4MAKA 1FXLA 2WONA 2VFTA 2MZ1A 4CLLA 1NK9A 4P74A 2WB1D 3KKFA 4ENOA 1N0UA 1OY9A 1HYSA 3NBPB 4M8LA 4G1PA 2JH3A 4OI6A 5KG5A 4ILMA 4Z37A 1RK8A 4GRSA 1JLQA 1HBNB 4DU7A 1VK3A 2QL7B 4NPOA 2GAGC 1VQSA 4DPWA 3OXGA 4LVOP 3HDSA 4IYQA 4RPFA 4ZVQB 5ADZA 1JLBB 1NDPA 3EUNA 1XBWA 2LQJA 2E1PA 1T95A 4KT0C 1V5VA 1UVNA 3MD1A 2ZZTA 3HHDA 5LM7E 1H3DA 3BJYA 2FY1A 2J7KA 4O0IA 2ROEA 5IQQA 3DLJA 4EUVA 1GTHA 1Q78A 2VG5A 4KO0B 4OQJA 1HPZA 5DQGA 3J7Z5 4C8LA 2LXFA 2R3VA 1SUQA 3HPOA 4NXNF 1ZOTA 3SXLA 3AT1B 3BBFA 2V5HG 1TTHB 3NGRA 4GVBB 1FERA 1G6BA 4CZCA 1NNDA 3KXDA 5F0WA 5A8WA 5GADI 1N6QA 4KH0B 1T94A 5HQ8A 4G6VB 2KFNA 4HDHA 4B3RJ 4NYPA 2M0GB 3LGHA 3ZZOA 3RAQA 4F26A 1QAYA 2O67A 3HLUA 3PM9A 2ZOMA 2MHNA 4LSZB 4P75A 3Q2TC 4DL6A 2ZFHA 2R2UA 2HNDA 3CO9A 2ZH3A 2A6MA 1RHRB 2C2MB 3L7PA 1DBDA 4N77A 4OZ2A 4EBDA 1GMVA 3GR1A 4M5DA 2GNKA 2J0XA 3TA1A 3C66A 1SQGA 3W62A 4DUTA 2EBEA 2RH3A 2P9GA 1TL3A 4ZA1A 2WSEC 3LALA 4Y2MA 5A8RA 8ATCB 4NLXA 2QMXA 4DCOB 1I94F 9ATCB 3JSBA 3TQEA 2VG5B 4JI1J 5HANA 1M1HA 4QCLA 2GVDA 2V34A 3Q23A 2J76E 2ALYB 3W9JA 1KLMB 4I6YA 4F7VA 2RILA 2R9LA 4R5PA 3MOJB 1F2GA 1C0UB 1RAHB 2HFOA 1T9YA 2BKNA 2PA8D 1FWLA 3MCNA 2VJUA 1TK0A 1H98A 3BYRA 4YB6A 3R5CA 4OL8A 3M6UA 1RZMA 3CCSS 3PV8A 2EG1A 2UUCF 3KG4A 3PFEA 1RT5A 2QMWA 2ZWPA 1TMMA 3I4HX 3F0NA 3K89A 2V9KA 4J7CA 4NCGA 2KG1A 4A8WA 3OJSA 1MN9A 2DCUB 2UUTA 3OR1A 3UNGC 3T1HF 2WRMA 4QJVA 2B9XA 1H2VZ 3EMTA 4UT4A 2BRKA 4FKYA 3CCRS 1FRJA 3J7AN 1DFDA 1REGX 3HHLC 1MROB 1ACMB 2XBPA 3HI9A 2EEYA 3K5LA 4J9OA 3T5HA 2OPRB 2ZJQQ 2CFXA 4CO1A 2CG8A 2KM8B 3CULA 2U2FA 1D1UA 4JI8F 4FBTA 2GQQA 2RNEA 2R2SA 5D3GA 4ZN1A 1UA0A 2LXIA 3GLJA 3QT6A 4RKUC 2C3UA 1FESA 4NMLA 5IT4A 2HGLA 3LWMA 4J9KA 2FLLA 4C8KA 4USKA 4CH0S 3Q8RB 2KHCA 1VRUA 2Z30B 2GS8A 1Q79A 3AJDA 3HD2A 3IO1A 4UTGA 4OI1A 3KHRA 1R6VA 3M1VB 3KLGB 2VUGA 3PW7A 3KJQB 3GMGA 3X1LB 4PWDB 4ZLPA 2ADBA 3UN3A 1Q7YT 3E3XA 3W60A 3L9ZA 2HRUA 3HT3A 2DHXA 3SQGA 4ZN3A 5EX3A 1TKXB 2ASYA 3D7SB 4DV3J 1B0TA 4O44A 3HFZB 1S7HA 3TUPA 4QZVB 3QRRA 2NYIA 3M8WA 2ZH1A 1RAAB 3W64A 4DZ6A 2ZH9A 3SSRA 2E1RA 3ETOA 2QYGA 4ZPVR 5CA5A 3CTRA 4RNMA 2XSJB 2QA4G 4WFNQ 4HHHA 3J7ZT 2KL8A 1SPBP 4CM2A 2PMHA 2VPZB 5L39A 1XNRF 2CQDA 1SH0A 3ZXWA 2DIVA 4X62F 3IG1B 3I4PA 4IO1A 4K0KJ 2FLPA 2H3EB 1TKZB 1G1XA 4N7TA 3N28A 1WG4A 1JLQB 2X51A 2V6AA 4YR0A 4FXWA 1UJ5A 2JVOA 2YNFA 4DPXA 3HHKA 1FDNA 2RAQA 3L09A 3MM6B 5FDLB 2ZD1B 1PGZA 4YY3J 3KHLA 2UXCF 4P72A 1U48A 3NBPA 4RU9A 2VOPA 5D4PA 2HNYB 3ICLA 3M8PB 4DQRA 2WTFA 3PVXA 1I94J 3C6UB 4DR5F 2FHJD 2M8HA
chains in the Genus database with same CATH topology
1R0AB 2HHSA 5B0EA 2PIIA 3HVTB 3RRKA 3KLEA 3TOQA 3HHLD 2HNZB 2LU2A 4KFBA 1NK6A 3GB0A 1CPZA 2N4CA 1S97A 2HS4A 3DCAA 4KC5A 1V6HA 4I0WA 1V9OA 3VQTA 2EC0A 3DRPA 4ZPAA 3FJ2A 4C4WA 2EK6A 1NHUA 2MB0B 3M4XA 2YH1A 2DNOA 3K8WA 1J5OA 2ZJRQ 2DT9A 4OHVA 2VC1A 4LSNB 2ZJPQ 4NRUA 4Q44A 3MAHA 1MROA 4ZPBA 4LF9F 2KJWA 2ALZA 1X4AA 1S10A 2MY7A 2P9EA 3MEDB 3CMES 2G4BA 2I5JB 1TR0A 2DO4A 3L95X 4N8OA 4EBEA 1QUPA 4C97A 2F1FA 3B8HA 5GAGI 1SV5B 2ZHOA 4B3MF 2JEGA 3MMCB 4NLPA 1RT1A 5E3QA 3PEHA 2IYGA 3UDLA 3D1QA 5DLGA 1VJWA 2J7WA 2VG7A 5JJBA 4EBCA 1QY7A 3K5NA 3CJKB 3DRRA 1KQFB 2DIUA 3QGGA 3WZ0A 2R8GA 3FMBA 3PW0A 2MKHA 3BR8A 1U6ZA 2HFNA 2VBYA 3NGDA 4DS4A 4QU7A 4R5PB 1JLEB 1OPIA 2EBGA 1N5YA 3MM5B 4JI6F 2MQMA 4CNYA 4R8UB 4WXWA 2F9JA 4RW6B 1IBMF 4NLYA 4ED8A 2FJDB 4YY3F 3MR2A 4IRDA 1M5SA 4OZ5A 1R6YA 3T1YF 5I3UB 2OKQA 1X4HA 4DR4F 4ZCLA 3I0RA 1QLNA 3MM9A 3RW6A 3OTDA 1WF1A 3Q8PB 3DYAA 1V3ZA 2FIUA 3VAMA 4DPOA 4B3RF 4JUZA 1JJ2R 2KJVA 2GHWA 2OD6A 1K9MT 4Q0BB 4HI1A 4WFZA 2XMKA 2HHWA 2XMJA 2GGPA 3DRSA 2D41A 3M6VA 4LT6A 5KT6A 2YVSA 4MIWA 2W9AA 5D4LA 3DOKB 3GV8B 4K4VA 4O4GA 4U7CA 3NMRA 1KQKA 3IBWA 4HYKA 4ECQA 2E1CA 1DTTB 4Y2CA 2YTCA 4ILRA 1YSJA 4Y6IA 4TQRA 4J9MA 3MAQA 1LWFA 2E5IA 2MZSA 1X5SA 2J9CA 2VBWA 3M30B 4JI1F 2VQFF 3OTEA 4TN2A 4M63A 1OQ6A 1TL5A 1HHTP 2P6SA 2IMWP 3H40A 5JXSA 2YQ3A 3UR0A 4RW9B 1URNA 1UL3A 4WJBA 5G0RB 3TUZC 2VBZA 3UPFA 3KFWX 2A18A 4DL7A 1VQOS 4DBQA 2NUHA 2W24A 1FJ7A 5HMWA 4DV2F 2BW2A 4ED3A 2HVIA 4L6V3 2FJXA 3L7OA 2HMIA 3LQVA 3MEEA 2LDIA 1R7IA 2FDNA 2W9BB 1XNQF 1EP4A 4YP3A 3E01B 3UWTA 3K5MA 5HBMA 2R2TA 4ED6A 3JSMA 1KQGB 2CIMA 3AY0A 5H9FJ 3CGIA 1D8ZA 3GIMA 1NK7A 2UVWA 3SZ2A 2BANA 4JI0F 1S49A 3GIJA 3GZ7A 3G6ES 2ZHAA 4NXMF 5K14A 4UY8T 2R2RA 4DLEA 1Y3KA 4ECZA 5K8OA 4TQSA 4IH6A 3MGJA 4DFMA 4FF4A 2OFHX 3TW0A 3I96A 1IKYB 2V9WA 1SL0A 2M2BA 5IFMA 5KFJA 1S0NA 3N6NA 4DV0F 3ENQA 1XC9A 1Y3JA 3IRXA 2MDAA 3NRBA 3T5KA 4WE1B 3DU6A 2LQ5A 3OFEA 4GC7A 3UW1A 1BQMA 2BA9A 4EFAC 2HRYA 4RWWA 1NKBA 3CPWR 5F8MA 2DGQA 4ED0A 2HHHF 3MMAB 1VQ4S 4NLGA 2DR7A 4RW7B 3CD6S 4IR9A 4X4RA 2A1BA 1HNVB 1HQUB 4A8QA 2E7WA 3M2RB 1TVRB 1FE0A 2I8EA 4Y2AA 4WU2A 3GV5B 3G6YA 2F40A 3MM9B 3LUYA 5C25B 1M5VC 4O3SA 3QJPA 1IKYA 2MZJA 1RKIA 4F02A 3EGWB 1OQ3A 2ZOFA 4X4OA 2E5HA 1D8YA 2MSSA 4LSLB 1M5OC 4OHZA 4ZPWR 4X64F 4NWBA 4FF3A 5AE3A 4Y28C 4AYBD 5KOXA 4YR2A 3OHBA 3MM7A 5F41A 2DK2A 2CQCA 5LXRA 2HAIA 1VS3A 4NLDA 2EI5A 2PN6A 2GC8A 3E01A 2XY6A 1MSWD 1HWIA 1WI8A 4QIVA 1EP4B 2W9BA 2ERRA 3MEEB 5KFUA 2AWZA 2MKKA 3V6DB 4PUOA 3P3DA 4OZLA 4DL3A 1QTMA 2VKRA 1LQ9A 1GT8A 5DO2A 4FS1A 2UVUA 2PC6A 4ZCKA 2W8LA 3DI6B 1DAXA 2LQ9A 3MECA 3FFIB 2VB6A 5KFAA 1ZZFA 2F8MA 2QLXA 1TL1B 1U6FA 4DR1F 1LW2A 3OL9A 3DRXA 4DL4A 1G7CB 3AJ1A 3UCGA 3HO1A 2K7KA 4FNIA 1Q16B 2QT7A 4C0HA 1T3NA 2DNGA 2XSJA 1LWFB 2YX7A 3HMJG 3FFIA 1K1SA 3MECB 1R3NA 1DLOB 2RD5C 3HHEA 1CLFA 3LOUA 2J7UA 1YBAA 2CJBA 5KTQA 1X0PA 5KFDA 3M8QB 2C3MA 5KG7A 4J9PA 3D2WA 4X4VA 2P5VA 3TVZA 5T7LA 2GCFA 2GGPB 1U8SA 1TKXA 1RJJA 2GIQA 2XMMA 2VONA 4OHWA 4EEYA 5K5MA 4K4UA 1H2TZ 1P9QC 2F8EX 3MM7B 4PQUB 3P5TL 4CO2A 1FJCA 3EGNA 1E6YB 4PG8A 2ZD1A 2OMOA 2EFQA 2KRRA 5KFVA 2XZWA 2AJ4A 2PE8A 2BDPA 4A8MP 3MF5A 2LLZA 4ALZA 2R7WA 4NRTA 1VRTB 5K8MA 1J5EF 2B5JB 3PIOQ 3BGLA 3O44A 4ILLA 4B9NA 2FB0A 3G86A 1B64A 2DGXA 1ROFA 1UFWA 2CJQA 2GO9A 3BF4A 2L3MA 2IM0A 1K8AT 4RW7A 2HWIA 3DRRB 1UFLA 4Z2XA 2C2DA 1JK9B 2GX8A 3OR1B 3VAFA 3MMAA 4B08A 2QO3A 4DSKA 2EFNA 1FO1A 1F5CA 1GTEA 1LXJA 2EW9A 3LP2A 3N9UC 3CJ0A 1BY9A 3GFHA 3KK3A 2E29A 1N88A 4O23A 5C5JA 3R1HA 3LWLA 5LSLA 5KT2A 1ELOA 1CC7A 4WE1A 3HKWA 1FT8A 2FD2A 5KG4A 3KHHA 3IRXB 4F4YA 1VBYA 4ZP7A 5KT3A 2EVZA 4F3QA 1FA0A 2RT3A 1GX5A 4PXCA 2KDOA 1C0UA 5MLCV 1KOHA 3PW2A 2VC0A 2NR0A 3T9ZA 5HP1A 2CQGA 3ZZPA 1HWKA 3M30A 4YDXA 2LYVA 1VRUB 2YY3A 3CSKA 3RB0A 1J5OB 4BDPA 4GO7X 1S1XA 4UY85 2GJ2A 5EWFA 1FD2A 2BUNA 4DLGA 3FQKA 2I0XA 4O4GB 3M2VA 4QR2A 1X4CA 3IC1A 2FHKA 3N5BA 3CJ5A 2HGNA 3CD7A 3O6QA 2ZH5A 3IRWP 2YWHA 5DS7A 3I82A 3TUIC 4ZK7M 2YX4A 2LECA 2QLWA 2R7XA 4H4MB 3P6YC 1SJRA 2B4PA 4ZOSA 4A8XA 3EXCX 4WYWA 1TKTB 1H7XA 4PCQA 1X5PA 4DR3F 2LVWA 1RT2B 3SV4A 2E1MC 1RT5B 2FJAB 5I3UA 3TP2A 2MQPA 4O3NA 3MM6A 2JEIA 3CCUS 1A7GE 3R3TA 3K5OA 1SH3A 4F4KA 1S4FA 3SCLE 3FSXA 3GFZA 2HIQA 2Q43A 3KK1A 2IA6A 2VODA 3IG1A 4M1KA 3FQLA 5L9NA 2L41A 1GX6A 1VQYA 1WI6A 4R8UA 4PG5A 4WKRA 4N76A 2ZC3A 2D9OA 1NO8A 2YNHA 2ZZMA 1FDBA 2ZKUA 3PIPQ 2K1RB 1FCAA 5GMKa 4B9LA 3RB4A 3J80Y 4MKBA 3VAHA 5AXNA 3IWLA 3H2LA 2FPHX 2CQ2A 3DOMA 1PILA 4IOCQ 4DR2F 1FKAF 2HNDB 2RDJA 1CVJA 2C3PA 3CMAS 5FJ4A 1JMTA 4OJ3A 1FEEA 2UUWA 1FDAA 3ISZA 4B3OA 2HHUA 2XI2A 5HLFB 4I7FB 1LXNA 2M70A 3BSAA 4DMZA 5U47A 1QVGR 3GR0A 4IQXA 1TFWA 3DXSX 5CYJA 4YUDA 2XMVA 4X4QA 2XGQA 4AL6A 1QAIA 2C2EA 1M1KT 2VA2A 1WWHA 4OI2A 5I42A 2AX1A 1CSJA 4X4UA 3FZ2A 4BC9A 4K4SA 4HH1A 3CCV