1OPYA

Ksi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords DELTA5-3-KETOSTEROID IOSMERASE
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1opyA00
5BXQA 2BNGA 4HVNA 4L8OA 1ZO2A 4N3VA 2HMOB 4R9KA 3NV0A 5IEOA 1OHOA 3JUMA 3LZAA 5IG4A 2GBXB 4XBXA 4HM2B 1DMMA 1O7WB 2GEXA 4HZBB 2PZVA 2F98A 4IIAA 3CNMA 4R1KA 4OUQA 3OX9A 4XBTA 1BUQA 2Z7AA 3HX8A 4L7KA 3K0ZA 5D83A 3SEDA 3GWRA 3FKAA 1ISKA 2RFRA 4XM4A 2JQ5A 1OF5A 1VZZA 3WMDA 3MG1A 5JPPA 1NWWA 3HK4A 3M8CA 2HMLB 3UJMA 3FZWA 4PEJA 4XDVA 3B7CA 5IG0A 1ULJB 1OF5B 3T8NA 5STDA 4GB5A 3F7SA 1W01A 3T8UA 1E3VA 3FF2A 2A15A 1GY6A 2CKFB 3EC9A 1O7GB 3DMCA 8CHOA 1JB4A 4X2HA 3OV4A 1GY5A 1JB5A 1EA2A 1DMNA 5D82A 1K41A 5DREA 2QIYA 3B8LA 5KP1A 4R9LA 3MG3A 1JKGB 5FW5A 4J8TA 3D9RA 5TGNA 5KP4A 1JB2A 4HM1B 3CU3A 4HM4B 4HJLB 3OWUA 2Z76A 4WYKA 4XDWA 2RCDA 3OWSA 1QMAA 1E97A 2I9WA 1Q40A 3LYGA 3H51A 1OGXA 4LMIA 3DM8A 3K7CA 2YFIB 1O7PB 3KE7A 4WYKB 3H3HA 3MSOA 1OPYA 1Q40B 1W00A 3OWYA 3CPOA 4FCMA 1GYBA 4LGQA 3VGNA 5CF1A 1UUVB 1Z1SA 3FF0A 3DXOA 4HKVB 4OVMA 3FGYA 3G16A 1TUHA 3MG2A 2B24B 5AIGA 3F8XA 3RGAA 1AR0A 1DMQA 1WQLB 3A76A 3EBYA 3F8HA 5IENA 4I4KA 3FH1A 3EF8A 3GZRA 2YFLB 3Q90A 1OCVA 1CQSA 1STDA 3CNXA 1JKGA 3VSYA 2GXFA 2OWPA 4U13A 4L8PA 4K1UA 3MYTA 3NUVA 5IEPA 3F7XA 3GRDA 3SOAA 5HGRA 2XRXB 5IF6A 3F40A 2RGQA 4XBYA 1GS3A 1QJGA 1IDPA 2HMKB 2R4IA 2HMNB 3EJVA 3EQQB 3F9SA 4HM3B 4Q53A 5BVBA 1W6YA 3BLZA 5JPUA 3ECFA 3JUOA 4FCJA 5CXOA 3S5CA 4X2OA 2Z77A 1O7HB 2BMOB 3GZBA 3ER7A 4MJDA 4XB5A 5CF2A 1S5AA 3KZTA 2XR8B 3B4OA 3OXAA 4HM6B 1A2KA 2HMMB 3DUKA 3EHCA 2F86B 3GZYB 4HM8B 5KP3A 3UNLA 5DRVA 5CLKA 2B1XB 2F99A 1SJWA 2XSOB 3SOYA 4WP5A 2K54A 4HZ9B 1JN5A 1ULIB 4HM7B 3JUPA 2HMJB 5AEUB 2W2CA 4STDA 3DZLA 5G2GA 1EG9B 3NV0B 3EN1B 3HZPA 4HM0B 5EVHA 3IPTA 3NXJA 5AI1A 2UX0A 1OH0A 1C7HA 2GEYA 1ZX2A 3JUNA 3BB9A 4ORLA 1NU3A 7STDA 1O7NB 5IERA 3B4PA 3E99A 3G8ZA 3MKIA 1O7MB 3I0YA 2BMQB 1GY7A 1OGZA 2GBWB 3F14A 3FSDA 2CHCA 1W02A 2IMJA 1HKXA 4RZMA 5AIFA 5AEWB 3NBRA 3MHEA 1OUNA 4KVHA 4H3UA 3KKGA 1UUWB 5IG5A 3GZXB 3JUQA 6STDA 3RGRA 1NDOB 2XSHB 1OHSA 1TP6A 3KSPA 4CDLA 4HM5B 1Q42A 2QGUA 3EBTA 5D81A 1ASKA 2INXA 3EX9A 4K1VA 4WWUC 3NHXA 2BMRB 4J9AA 4LEHA 5CK6A 5AIHA 3FLJA 3ROBA 1U5OA 3G0KA 3STDA 1JN5B 3NM2A 5AIIA 2STDA 3EN8A 1E3RA 2YFJB 1OHPA 5IG3A
chains in the Genus database with same CATH superfamily
5G1LA 1BSCA 1D6YA 5IG4A 1DMMA 2GEXA 4R1KA 1NO3A 1RCKA 2F98A 3AGNA 3HIIA 4XBTA 1DYUA 1KQS2 1ZGXA 2V1LA 1ISKA 5RNTA 1WTHA 1VZZA 4BU4A 1Q864 3WMDA 1BNJA 2ZA4A 4N6UA 3HK4A 4K90B 4TX4A 2CG1A 2XFSA 3B7CA 4MMZB 2ML6A 3G6E3 4BL2A 4FCZA 3T8UA 1FUSA 1MGRA 1BIRA 1M904 2CKFB 3LTAA 1BUJA 2KF6A 1K28A 4HYZA 3ZFZA 4AKYA 1DMNA 1GD3A 3FCSB 5DREA 2CH9A 2GU1A 1A67A 4HOHA 1JV2B 1FGRA 1JB2A 4WYKA 3DGLA 4XDWA 1DVCA 1FYSA 3CC43 1YGEA 1UCIA 1Q40A 3LYGA 1DVDA 1B21A 1OACA 1BSAA 2D42A 3NQYA 4EBGA 2UGIA 4WYKB 3WHOA 3MSOA 1OPYA 1GD4A 1Q40B 1RHLA 3CPOA 2CX0A 1TIJA 1T3BA 1BSBA 5CF1A 1UUVB 1VQQA 1Z1SA 2LQVA 2C4BA 1J2BA 1GOVA 1YNVX 3F8XA 1DMQA 1EKMA 3A76A 2WGQA 1RGLA 3EBYA 1W2ZA 1CYVA 1RGFA 2BIRA 3K63A 4I4KA 4JF8A 3IJEB 1RJOA 2KRTA 1UUGB 3EF8A 3FH1A 2YFLB 4KFDA 1QAKA 2L4VA 1JKGA 3VSYA 2OWPA 1BNFA 1UDII 1I2EA 3DGNA 5IEPA 2M7OA 3GRDA 4BTWA 5IF6A 1QALA 2HMKB 2R4IA 1IDPA 1I3FA 3EQQB 4HM3B 1BRHA 5BU4A 2RNTA 2P05A 1BNSA 2XH9A 3BLZA 3RDEA 4FCJA 3SX1A 1FGQA 2Z77A 4KFFA 4XB5A 3GZBA 1TTOA 2ZHXB 1QVF2 7GSPA 3KZTA 5AEUB 3DUKA 3EHCA 5DRVA 1LNHA 3EE1A 2B1XB 3O8YA 3UL5A 4IPBA 3FG1A 4MMXB 3SOYA 4WP5A 1VQ73 4DKIA 4HZ9B 2KF3A 2F5MA 1JN5A 2XGLA 2W56B 3JUPA 1TRQA 5AYSC 2W04A 1IQYA 1GOYA 1EG9B 1I70A 3DY5A 3NV0B 1YJN3 1YHQ3 2P09A 1WMPA 3IPTA 2FNQA 1B2ZA 2UX0A 3MWZA 3NXJA 4JRFA 1OH0A 1B27A 2GEYA 3JUNA 2CWTA 1NU3A 1YVSA 2Y74A 3E99A 3G8ZA 4LYLB 1B2UA 1MWRA 1IVWA 3FSDA 1OGZA 3F14A 3L0RA 3LTCA 3CCL3 1W02A 3QK9A 1EQKA 1DETA 1YGWA 5AEWB 5HOHA 1Q814 4ZM8A 1RGHA 1BRKA 3WA2X 2WGOA 3JUQA 6STDA 2W9QA 3JVCA 4I5QA 3X42A 1I0XA 1WMNA 4N6LA 2XSHB 2QEX3 1B3SA 3X3YA 1MWUA 1Q42A 1QVG2 4O02B 3WOFB 4K1VA 1IVVA 3CCS3 1YJW3 3NHXA 2BMRB 4J9AA 1IQXA 1LOVA 2K0MA 2STDA 1G96A 1MNLA 2BU4A 1G02A 5BXQA 2BNGA 4N3VA 6RNTA 1GMQA 2XEPA 3HOHA 4GSPA 4IIAA 1IYYA 4BL3A 1Q824 1D6ZA 1JZDA 1EEJA 4RNYA 1NNVA 3Q1CA 1BRSA 1OF5A 1FUWA 1IT8A 1K734 1BRIA 3KN4A 1NWWA 1IVXA 1RN7A 2BHMA 1X1YA 3UJMA 3FZWA 3A5EA 1ULJB 1OF5B 1SQWA 3AMOB 3GAXA 4GB5A 1TJDA 3X3XA 1IK3A 1F8NA 1E3VA 1VQ53 1GY6A 3KCHA 1IT7A 1V74A 2F4YA 3NM7A 1LVNA 2K3DA 3CC23 1D6UA 1AQZA 1RGGA 1V57A 3B8LA 5KP1A 5FW5A 1U8CB 1W6CA 4HM1B 1YJ93 4HJLB 3OWUA 1BSEA 2RCDA 3EB8A 3OWSA 1E97A 1N9EA 4MMYB 2F5WA 3DM8A 1IU7A 3D5GA 3T0UA 1RMSA 4FCMA 4LGQA 1YIJ3 4HBRA 1BANA 1VQ43 1I0VA 3DXOA 4HKVB 2P0MA 1PY3A 1PFPA 3MG2A 3RGAA 1JBRA 1BU4A 1LOWA 2RBIA 1WQLB 3GSPA 3SYUA 1KC84 5IENA 3CME3 3CCV3 2CW9A 3LTBA 1Y4KA 3QRDA 1IV9A 2XGNA 5LC6A 1STDA 4N6TA 1RNBA 3KFQC 3PZWA 4U13A 1UW1A 3MYTA 2KF4A 3SOAA 4EYCA 3F40A 2RGQA 5G1KA 1I2GA 6GSPA 4Q53A 1BAOA 2W56A 5CXOA 3WR2A 1Q7HA 2BMOB 5CF2A 3X3ZA 3Q2PA 2XR8B 3B4OA 4HM6B 4HM8B 4MJDA 3I563 1YIT3 2XF3A 3GZYB 9RNTA 3UNLA 1A90A 2CFKA 3NQZA 3SLUA 1FA3A 2KF5A 1RNTA 1SJWA 2E2TA 2BT3A 1STFI 3S28A 1FZUA 3AHSA 1I2FA 2CC3A 5I97A 1VQN3 2W03A 1ULIB 2UUGC 2W2CA 2KXGA 1UCKA 2LYXA 1QAFA 3ALAA 2CX1A 1UI8A 1TRPA 5LC7A 3EN1B 3LTDA 2QA43 1VQL3 4KFEA 1BNRA 1C7HA 1VQ83 2CWUA 7STDA 3HI7A 1HU9A 1VQ93 2C11A 1VQO3 3MKIA 2BMQB 3OX9A 5AIFA 1N8QA 2AAEA 3DGMA 1I3IA 1MOLA 4OK0A 4RZMA 2W6JH 4KVHA 1LXEA 4NREA 1UUWB 1JBTA 1IVUA 3CCR3 1US1A 1DE3A 3CCE3 1FW7A 2FXTA 2WOHA 3N9HA 2YX9A 1LOYA 2WO0A 4MEIA 1W4NA 5D81A 2INXA 5AYRB 2KAAA 3FLJA 4ILFA 2MC8A 3ROBA 1AVLA 2H0IA 3NM2A 3CCJ3 1K9M4 2P0XA 3AMOA 4HVNA 7RNTA 1ZO2A 2HMOB 1ZS7A 1OHOA 3JUMA 3LZAA 4WFOA 3BNCA 4XBXA 1MGWA 2CWVA 1O7WB 1B2SA 4HM2B 2PZVA 3DGOA 1EUIC 3I553 1FUTA 3OW22 1BRGA 1SIIA 1T5YA 1BUQA 5D83A 3CMA3 2RFRA 4XM4A 1TU5A 2Q07A 2ZL8A 3MG1A 5JPPA 3WODG 1RGEA 2Z6BA 4XDVA 1JNQA 1MWSA 5IG0A 2FGTA 3Q3FA 8RNTA 1R4YA 1UGIA 1AV4A 3FF2A 1RLSA 2A15A 1NJI4 1BSDA 8CHOA 3KSED 1O7GB 3DMCA 1LQMB 1JB4A 1KSIA 3S67A 2O9UX 2E2VA 3LOYA 1GY5A 1JB5A 3AHWA 1EA2A 1TFOA 3NBBA 1K41A 3K5TA 1VQK3 1M1K4 4R9LA 1RRHA 3MG3A 2P38A 5TGNA 3D9RA 2E2UA 3WOEB 3PYJA 1LNIA 3CU3A 2CFLA 2Z76A 1X1WA 2CK3H 3BNDA 4EW5A 1QMAA 1VQM3 1S723 3H51A 1OGXA 4LMIA 4AKZA 3K7CA 1CEWI 1O7PB 3H3HA 4CJNA 2MF7A 1RGAA 3FF0A 2R41A 4OVMA 3FGYA 3G16A 1TUHA 5AIGA 1FGOA 1AR0A 3LH4A 2OCTA 3F8HA 5ELUA 1CH0A 1BVIA 3GZRA 1OCVA 4H61A 3ZG5A 3CCM3 2GXFA 1BGSA 4L8PA 3NUVA 1HZ1A 4O2HA 1GMPA 1SPUA 1VQ63 1GS3A 1QJGA 4R9KA 2CFWA 3EJVA 3F9SA 4HAAA 4QWTA 4BIRA 1W6YA 5JPUA 1GSPA 3ECFA 3JUOA 4FMDA 2SARA 1B2MA 1O7HB 2GU3A 1I8VA 1S5AA 1W6GA 5IW9A 1YI23 3OXAA 1A2VA 1A2KA 1A2PA 1SIHA 3AGOA 2F86B 5KP3A 1AVKA 5CLKA 3HIGA 2F56A 2H0GA 4O3VA 3K9MC 2BO9B 1BNGA 3X41A 4N6MA 4BTXA 1RCLA 4HM7B 2HMJB 2C10A 1NB5I 1FGMA 2IA7A 4STDA 3DZLA 1RN4A 2OOVA 4LSOA 3URPA 3HZPA 5FGOA 4R4KA 4N6NB 1RTUA 4FR9A 1JZOA 2RSXA 4ORLA 2L1SA 3BB9A 2OTJ3 2IUKA 1O7NB 3ZG0A 5IERA 3B4PA 1AY7A 1O7MB 3D5IA 3I0YA 1GY7A 5D82A 2IMJA 1KWIA 4CPKA 1JJ22 3MPHA 3MHEA 1M1XB 1OUNA 4H3UA 1K8A4 3FG4A 3NX0A 1BNEA 1N5HA 3GZXB 1X1XA 3RGRA 3WA3A 3BNEA 1OHSA 2XFTA 4HM5B 2QGUA 3EX9A 3FG3A 4K61A 1NB3I 1RSNA 4WWUC 4LEHA 5CK6A 3PCRA 1V58A 5AIHA 1U5OA 3G0KA 2WOFA 4J5GA 1VQP3 5JBSA 3UB1A 3D79A 3PS8A 2YFJB 4KT3B 1N8R4 1BRNL 1OHPA 1HYFA 4GHOA 5IG3A 3G713 5IEOA 1RRLA 4L8OA 3CCQ3 1IQ8A 3TDGA 3CCU3 3NV0A 3CD63 2PNCA 1M9GA 1UCLA 2GBXB 4HZBB 1UI7A 1W5ZA 1FGTA 3CNMA 4OUQA 2Z7AA 3HX8A 2HOHA 3K0ZA 4L7KA 5EEOA 3GWRA 1B2XA 3FKAA 3SEDA 4GL6A 4G1MB 4FMCA 2JQ5A 4EV5A 3V99A 3CC73 3M8CA 2HMLB 1LRAA 4FMAA 4PEJA 3PGBA 3T8NA 5STDA 1MWTA 3F7SA 1W01A 5A0OB 1WMOA 3VF1A 2W9PA 3EC9A 1W2B2 1N5PA 4X2HA 3OV4A 4EXRA 1B20A 5EQLA 1RN1A 2QIYA 3V98A 1JKGB 3DH2A 4J8TA 5KP4A 1TFKA 2ML5A 2OQEC 2ZDJA 4HM4B 2GSPA 1C54A 1GMRA 1JRQA 1T2IA 2CFDA 1GOUA 4NHFA 2I9WA 3U1WA 1G0TA 2OTL3 3N8BA 3LXUX 3U97A 2YFIB 4EV2A 3KE7A 1KD14 1IV7A 2O3OA 1W00A 3OWYA 3VGNA 1GYBA 2D1WA 1BOXA 1RDSA 4LZIA 2B24B 1PYLA 2KCDA 4CCVA 1PU4A 2JDIH 3PXMA 3Q90A 3SVAA 4N6OB 1CQSA 4KZ1A 2H0HA 1X1UA 3CNXA 3G4S3 4K1UA 5GSPA 3F7XA 3DGYA 4J5KA 2XRXB 5HGRA 1BNIA 1L5GB 1JBSA 4XBYA 3RNTA 1SARA 2HMNB 1W7CA 2CG0A 5BVBA 1Q9EA 1WNHA 1N9JA 3S5CA 3V92A 3CPW2 4IT7A 4X2OA 3ER7A 3BIRA 2IUJA 3D3LA 2CIUA 4CDLA 1T2HA 1LQGC 2HMMB 1ROVA 4O8SA 1RGCA 2AADA 2J8XB 2F99A 2XSOB 2K54A 5BIRA 2SBLA 4FMBA 1UCJA 3X40A 5G2GA 2OOVC 3BU4A 4HM0B 5EVHA 3LT9A 5ELJA 5AI1A 5M1AA 3IMAB 1ZX2A 3S29A 2Y73A 2GBWB 1UGHI 4R80A 4RBNA 2CHCA 3PCSA 3N54B 1HKXA 4RNTA 3NBRA 3SXXA 3UL6A 2IY2A 4EC6A 3WDGB 3S27A 1RKYA 3KKGA 3NBJA 5IG5A 4RNZA 2CFGA 3D4AA 1ROAA 1R4CA 3BNBA 1NDOB 4WHAA 1TP6A 3KSPA 1CYUA 1LOXA 3EBTA 1ASKA 2W0QA 5M19A 4BTYA 3LT8A 1YVBI 5M18A 3STDA 1JN5B 1RGKA 1BRJA 4NPBA 5AIIA 2IYJA 3EN8A 3CXC2 1E3RA 3LMLA 2OQEA 1Q7Y4 3KIIA 4AEQA 3J7Yd 4N6V0
chains in the Genus database with same CATH topology
1D6YA 5IG4A 1DMMA 2GEXA 4R1KA 1NO3A 2F98A 3HIIA 4XBTA 1KQS2 1DYUA 2V1LA 1ISKA 1WTHA 1VZZA 1Q864 3WMDA 4N6UA 3HK4A 4K90B 4TX4A 2CG1A 2XFSA 3B7CA 4MMZB 2ML6A 3G6E3 4FCZA 3T8UA 1M904 2CKFB 3LTAA 1K28A 4HYZA 1DMNA 1GD3A 3FCSB 5DREA 2CH9A 2GU1A 1A67A 1JV2B 1FGRA 1JB2A 4WYKA 3DGLA 4XDWA 1DVCA 3CC43 1YGEA 1Q40A 3LYGA 1DVDA 1OACA 2D42A 3NQYA 4EBGA 4WYKB 3MSOA 1OPYA 1GD4A 1Q40B 3CPOA 1TIJA 5CF1A 1UUVB 1Z1SA 2LQVA 1J2BA 3F8XA 1DMQA 1EKMA 3A76A 2WGQA 3EBYA 1W2ZA 1CYVA 3K63A 4I4KA 4JF8A 3UB1A 4AKYA 3IJEB 1RJOA 2KRTA 3FH1A 3EF8A 2YFLB 4KFDA 1QAKA 2L4VA 1JKGA 3VSYA 2OWPA 3DGNA 5IEPA 2M7OA 3GRDA 4BTWA 5IF6A 1QALA 2HMKB 2R4IA 1IDPA 4HM3B 3EQQB 2P05A 2XH9A 3BLZA 3SX1A 3RDEA 4FCJA 1FGQA 2Z77A 4KFFA 4XB5A 3GZBA 1QVF2 3KZTA 5AEUB 3DUKA 3EHCA 5DRVA 1LNHA 3EE1A 2B1XB 3O8YA 3UL5A 4IPBA 3FG1A 4MMXB 3SOYA 4WP5A 1VQ73 4HZ9B 1JN5A 2XGLA 2W56B 3JUPA 5AYSC 2W04A 1IQYA 1EG9B 3DY5A 3NV0B 1YHQ3 1YJN3 2P09A 1WMPA 3IPTA 2FNQA 3NXJA 2UX0A 3MWZA 4JRFA 1OH0A 2GEYA 3JUNA 2CWTA 1NU3A 2Y74A 3E99A 3G8ZA 1IVWA 3FSDA 1OGZA 3F14A 3L0RA 3LTCA 3CCL3 1W02A 3QK9A 1EQKA 5AEWB 1Q814 4ZM8A 3WA2X 2WGOA 3JUQA 6STDA 2W9QA 3JVCA 3X42A 1WMNA 4N6LA 2XSHB 2QEX3 3X3YA 1Q42A 1QVG2 4O02B 3WOFB 4K1VA 1IVVA 3CCS3 1YJW3 3NHXA 2BMRB 4J9AA 1IQXA 2K0MA 2STDA 1G96A 1MNLA 5BXQA 2BNGA 4N3VA 2XEPA 4IIAA 1Q824 1D6ZA 4RNYA 3Q1CA 1FUWA 1OF5A 1IT8A 1K734 3KN4A 1NWWA 1IVXA 1RN7A 2BHMA 3UJMA 3FZWA 1ULJB 1OF5B 1SQWA 3AMOB 3GAXA 4GB5A 1IK3A 3X3XA 1F8NA 1E3VA 1VQ53 1GY6A 1IT7A 1V74A 3NM7A 1LVNA 3CC23 1D6UA 5KP1A 3B8LA 5FW5A 1U8CB 1W6CA 4HM1B 1YJ93 4HJLB 3OWUA 2RCDA 3EB8A 3OWSA 1E97A 1N9EA 4MMYB 3DM8A 1IU7A 3T0UA 4FCMA 4LGQA 1YIJ3 4HBRA 1VQ43 3DXOA 4HKVB 2P0MA 1PFPA 3MG2A 3RGAA 1KC84 1WQLB 5IENA 3CME3 3CCV3 2CW9A 3LTBA 1Y4KA 3QRDA 1IV9A 2XGNA 5LC6A 1STDA 4N6TA 3KFQC 3PZWA 4U13A 1UW1A 3MYTA 3SOAA 4EYCA 3F40A 2RGQA 4Q53A 2W56A 5CXOA 2BMOB 5CF2A 3X3ZA 3Q2PA 2XR8B 3B4OA 4HM6B 4HM8B 4MJDA 3I563 1YIT3 2XF3A 3GZYB 1A90A 3UNLA 2CFKA 3NQZA 3SLUA 1FA3A 1SJWA 2E2TA 2BT3A 1STFI 3S28A 2CC3A 5I97A 1VQN3 2W03A 1ULIB 2W2CA 2KXGA 3ALAA 2LYXA 1QAFA 1UI8A 5LC7A 3EN1B 3LTDA 2QA43 1VQL3 4KFEA 1C7HA 1VQ83 2CWUA 7STDA 3HI7A 1HU9A 1VQ93 2C11A 1VQO3 3MKIA 2BMQB 3OX9A 5AIFA 1N8QA 4RZMA 3DGMA 4OK0A 1MOLA 2W6JH 4KVHA 1LXEA 4NREA 1UUWB 1IVUA 3CCR3 1US1A 3CCE3 2FXTA 2WOHA 3N9HA 2YX9A 2WO0A 4MEIA 1W4NA 5D81A 2INXA 5AYRB 3FLJA 3ROBA 2MC8A 1AVLA 3NM2A 3CCJ3 1K9M4 2P0XA 3AMOA 4HVNA 1ZO2A 2HMOB 1OHOA 3JUMA 3LZAA 4WFOA 3BNCA 4XBXA 2CWVA 4HM2B 1O7WB 3I553 2PZVA 3DGOA 3OW22 1SIIA 1BUQA 1T5YA 5D83A 3CMA3 2RFRA 4XM4A 1TU5A 2Q07A 2ZL8A 3MG1A 5JPPA 3WODG 2Z6BA 4XDVA 1JNQA 5IG0A 2FGTA 1AV4A 3FF2A 2A15A 1NJI4 8CHOA 3KSED 1O7GB 3DMCA 1JB4A 1KSIA 3S67A 2O9UX 2E2VA 3LOYA 1GY5A 1JB5A 1EA2A 1TFOA 3NBBA 1K41A 3K5TA 1VQK3 1M1K4 4R9LA 1RRHA 3MG3A 2P38A 5TGNA 3D9RA 2E2UA 3WOEB 3PYJA 3CU3A 2CFLA 2Z76A 3BNDA 2CK3H 1QMAA 1VQM3 1S723 3H51A 1OGXA 4LMIA 4AKZA 3K7CA 1CEWI 1O7PB 3H3HA 2MF7A 3FF0A 4OVMA 3FGYA 3G16A 1TUHA 5AIGA 1FGOA 1AR0A 3LH4A 2OCTA 3F8HA 5ELUA 3GZRA 1OCVA 4H61A 3CCM3 2GXFA 4L8PA 3NUVA 4O2HA 1SPUA 1VQ63 1GS3A 1QJGA 4R9KA 2CFWA 3EJVA 3F9SA 4QWTA 5JPUA 1W6YA 3ECFA 3JUOA 4FMDA 1O7HB 2GU3A 1S5AA 1W6GA 5IW9A 1YI23 3OXAA 1A2VA 1A2KA 1SIHA 2F86B 5KP3A 1AVKA 5CLKA 3HIGA 4O3VA 3K9MC 2BO9B 3X41A 4N6MA 4BTXA 4HM7B 2HMJB 2C10A 1NB5I 1FGMA 2IA7A 4STDA 3DZLA 2OOVA 4LSOA 3HZPA 5FGOA 4R4KA 4N6NB 4FR9A 2RSXA 4ORLA 2OTJ3 3BB9A 2IUKA 1O7NB 5IERA 3B4PA 1O7MB 3I0YA 1GY7A 5D82A 2IMJA 1KWIA 1JJ22 3MPHA 3MHEA 1M1XB 1OUNA 4H3UA 1K8A4 3FG4A 3NX0A 1N5HA 3GZXB 3RGRA 3WA3A 3BNEA 1OHSA 2XFTA 4HM5B 2QGUA 3EX9A 3FG3A 4K61A 1NB3I 4WWUC 5CK6A 4LEHA 5AIHA 3PCRA 1U5OA 3G0KA 2WOFA 1VQP3 5JBSA 3PS8A 2YFJB 1N8R4 1OHPA 5IG3A 3G713 5IEOA 1RRLA 4L8OA 3CCQ3 1IQ8A 3TDGA 3CCU3 3NV0A 3CD63 2PNCA 1M9GA 2GBXB 4HZBB 1UI7A 1W5ZA 1FGTA 3CNMA 4OUQA 2Z7AA 3HX8A 4L7KA 3K0ZA 5EEOA 3SEDA 3GWRA 3FKAA 4GL6A 4G1MB 4FMCA 2JQ5A 4EV5A 3V99A 3CC73 3M8CA 2HMLB 4FMAA 4PEJA 3PGBA 3T8NA 5STDA 5A0OB 3F7SA 1W01A 1WMOA 3VF1A 2W9PA 3EC9A 1W2B2 1N5PA 4X2HA 3OV4A 4EXRA 5EQLA 2QIYA 3V98A 1JKGB 4J8TA 5KP4A 1TFKA 2ML5A 2OQEC 2ZDJA 4HM4B 1JRQA 2CFDA 4NHFA 3U1WA 2I9WA 2OTL3 3N8BA 3LXUX 3U97A 2YFIB 4EV2A 3KE7A 1KD14 1IV7A 2O3OA 1W00A 3OWYA 3VGNA 1GYBA 2D1WA 4LZIA 2B24B 2KCDA 4CCVA 1PU4A 2JDIH 3PXMA 3Q90A 3SVAA 4N6OB 1CQSA 4KZ1A 3CNXA 3G4S3 4K1UA 3F7XA 5HGRA 2XRXB 1L5GB 4XBYA 2HMNB 1W7CA 2CG0A 5BVBA 1WNHA 1N9JA 3S5CA 3V92A 3CPW2 4IT7A 4X2OA 3ER7A 2IUJA 3D3LA 2CIUA 4CDLA 2HMMB 1ROVA 4O8SA 2F99A 2XSOB 2K54A 2SBLA 4FMBA 3X40A 5G2GA 2OOVC 4HM0B 5EVHA 3LT9A 5ELJA 5AI1A 3IMAB 1ZX2A 3S29A 2Y73A 2GBWB 4R80A 4RBNA 2CHCA 3PCSA 3N54B 1HKXA 3NBRA 3SXXA 3UL6A 4EC6A 3WDGB 3S27A 1RKYA 3KKGA 3NBJA 5IG5A 4RNZA 2CFGA 1ROAA 1R4CA 3BNBA 1NDOB 4WHAA 1TP6A 3KSPA 1CYUA 1LOXA 3EBTA 1ASKA 2W0QA 4BTYA 3LT8A 1YVBI 3STDA 1JN5B 5AIIA 3CXC2 3EN8A 1E3RA 3LMLA 2OQEA 1Q7Y4 3KIIA 4AEQA 3J7Yd 4N6V0
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXQ A;  2BNG A;  4HVN A;  4L8O A;  1ZO2 A;  4N3V A;  2HMO B;  4R9K A;  3NV0 A;  5IEO A;  1OHO A;  3JUM A;  3LZA A;  5IG4 A;  2GBX B;  4XBX A;  4HM2 B;  1DMM A;  1O7W B;  2GEX A;  4HZB B;  2PZV A;  2F98 A;  4IIA A;  3CNM A;  4R1K A;  4OUQ A;  3OX9 A;  4XBT A;  1BUQ A;  2Z7A A;  3HX8 A;  4L7K A;  3K0Z A;  5D83 A;  3SED A;  3GWR A;  3FKA A;  1ISK A;  2RFR A;  4XM4 A;  2JQ5 A;  1OF5 A;  1VZZ A;  3WMD A;  3MG1 A;  5JPP A;  1NWW A;  3HK4 A;  3M8C A;  2HML B;  3UJM A;  3FZW A;  4PEJ A;  4XDV A;  3B7C A;  5IG0 A;  1ULJ B;  1OF5 B;  3T8N A;  5STD A;  4GB5 A;  3F7S A;  1W01 A;  3T8U A;  1E3V A;  3FF2 A;  2A15 A;  1GY6 A;  2CKF B;  3EC9 A;  1O7G B;  3DMC A;  8CHO A;  1JB4 A;  4X2H A;  3OV4 A;  1GY5 A;  1JB5 A;  1EA2 A;  1DMN A;  5D82 A;  1K41 A;  5DRE A;  2QIY A;  3B8L A;  5KP1 A;  4R9L A;  3MG3 A;  1JKG B;  5FW5 A;  4J8T A;  3D9R A;  5TGN A;  5KP4 A;  1JB2 A;  4HM1 B;  3CU3 A;  4HM4 B;  4HJL B;  3OWU A;  2Z76 A;  4WYK A;  4XDW A;  2RCD A;  3OWS A;  1QMA A;  1E97 A;  2I9W A;  1Q40 A;  3LYG A;  3H51 A;  1OGX A;  4LMI A;  3DM8 A;  3K7C A;  2YFI B;  1O7P B;  3KE7 A;  4WYK B;  3H3H A;  3MSO A;  1OPY A;  1Q40 B;  1W00 A;  3OWY A;  3CPO A;  4FCM A;  1GYB A;  4LGQ A;  3VGN A;  5CF1 A;  1UUV B;  1Z1S A;  3FF0 A;  3DXO A;  4HKV B;  4OVM A;  3FGY A;  3G16 A;  1TUH A;  3MG2 A;  2B24 B;  5AIG A;  3F8X A;  3RGA A;  1AR0 A;  1DMQ A;  1WQL B;  3A76 A;  3EBY A;  3F8H A;  5IEN A;  4I4K A;  3FH1 A;  3EF8 A;  3GZR A;  2YFL B;  3Q90 A;  1OCV A;  1CQS A;  1STD A;  3CNX A;  1JKG A;  3VSY A;  2GXF A;  2OWP A;  4U13 A;  4L8P A;  4K1U A;  3MYT A;  3NUV A;  5IEP A;  3F7X A;  3GRD A;  3SOA A;  5HGR A;  2XRX B;  5IF6 A;  3F40 A;  2RGQ A;  4XBY A;  1GS3 A;  1QJG A;  1IDP A;  2HMK B;  2R4I A;  2HMN B;  3EJV A;  3EQQ B;  3F9S A;  4HM3 B;  4Q53 A;  5BVB A;  1W6Y A;  3BLZ A;  5JPU A;  3ECF A;  3JUO A;  4FCJ A;  5CXO A;  3S5C A;  4X2O A;  2Z77 A;  1O7H B;  2BMO B;  3GZB A;  3ER7 A;  4MJD A;  4XB5 A;  5CF2 A;  1S5A A;  3KZT A;  2XR8 B;  3B4O A;  3OXA A;  4HM6 B;  1A2K A;  2HMM B;  3DUK A;  3EHC A;  2F86 B;  3GZY B;  4HM8 B;  5KP3 A;  3UNL A;  5DRV A;  5CLK A;  2B1X B;  2F99 A;  1SJW A;  2XSO B;  3SOY A;  4WP5 A;  2K54 A;  4HZ9 B;  1JN5 A;  1ULI B;  4HM7 B;  3JUP A;  2HMJ B;  5AEU B;  2W2C A;  4STD A;  3DZL A;  5G2G A;  1EG9 B;  3NV0 B;  3EN1 B;  3HZP A;  4HM0 B;  5EVH A;  3IPT A;  3NXJ A;  5AI1 A;  2UX0 A;  1OH0 A;  1C7H A;  2GEY A;  1ZX2 A;  3JUN A;  3BB9 A;  4ORL A;  1NU3 A;  7STD A;  1O7N B;  5IER A;  3B4P A;  3E99 A;  3G8Z A;  3MKI A;  1O7M B;  3I0Y A;  2BMQ B;  1GY7 A;  1OGZ A;  2GBW B;  3F14 A;  3FSD A;  2CHC A;  1W02 A;  2IMJ A;  1HKX A;  4RZM A;  5AIF A;  5AEW B;  3NBR A;  3MHE A;  1OUN A;  4KVH A;  4H3U A;  3KKG A;  1UUW B;  5IG5 A;  3GZX B;  3JUQ A;  6STD A;  3RGR A;  1NDO B;  2XSH B;  1OHS A;  1TP6 A;  3KSP A;  4CDL A;  4HM5 B;  1Q42 A;  2QGU A;  3EBT A;  5D81 A;  1ASK A;  2INX A;  3EX9 A;  4K1V A;  4WWU C;  3NHX A;  2BMR B;  4J9A A;  4LEH A;  5CK6 A;  5AIH A;  3FLJ A;  3ROB A;  1U5O A;  3G0K A;  3STD A;  1JN5 B;  3NM2 A;  5AII A;  2STD A;  3EN8 A;  1E3R A;  2YFJ B;  1OHP A;  5IG3 A; 
#chains in the Genus database with same CATH topology
 5G1L A;  1BSC A;  1D6Y A;  5IG4 A;  1DMM A;  2GEX A;  4R1K A;  1NO3 A;  1RCK A;  2F98 A;  3AGN A;  3HII A;  4XBT A;  1DYU A;  1KQS 2;  1ZGX A;  2V1L A;  1ISK A;  5RNT A;  1WTH A;  1VZZ A;  4BU4 A;  1Q86 4;  3WMD A;  1BNJ A;  2ZA4 A;  4N6U A;  3HK4 A;  4K90 B;  4TX4 A;  2CG1 A;  2XFS A;  3B7C A;  4MMZ B;  2ML6 A;  3G6E 3;  4BL2 A;  4FCZ A;  3T8U A;  1FUS A;  1MGR A;  1BIR A;  1M90 4;  2CKF B;  3LTA A;  1BUJ A;  2KF6 A;  1K28 A;  4HYZ A;  3ZFZ A;  4AKY A;  1DMN A;  1GD3 A;  3FCS B;  5DRE A;  2CH9 A;  2GU1 A;  1A67 A;  4HOH A;  1JV2 B;  1FGR A;  1JB2 A;  4WYK A;  3DGL A;  4XDW A;  1DVC A;  1FYS A;  3CC4 3;  1YGE A;  1UCI A;  1Q40 A;  3LYG A;  1DVD A;  1B21 A;  1OAC A;  1BSA A;  2D42 A;  3NQY A;  4EBG A;  2UGI A;  4WYK B;  3WHO A;  3MSO A;  1OPY A;  1GD4 A;  1Q40 B;  1RHL A;  3CPO A;  2CX0 A;  1TIJ A;  1T3B A;  1BSB A;  5CF1 A;  1UUV B;  1VQQ A;  1Z1S A;  2LQV A;  2C4B A;  1J2B A;  1GOV A;  1YNV X;  3F8X A;  1DMQ A;  1EKM A;  3A76 A;  2WGQ A;  1RGL A;  3EBY A;  1W2Z A;  1CYV A;  1RGF A;  2BIR A;  3K63 A;  4I4K A;  4JF8 A;  3IJE B;  1RJO A;  2KRT A;  1UUG B;  3EF8 A;  3FH1 A;  2YFL B;  4KFD A;  1QAK A;  2L4V A;  1JKG A;  3VSY A;  2OWP A;  1BNF A;  1UDI I;  1I2E A;  3DGN A;  5IEP A;  2M7O A;  3GRD A;  4BTW A;  5IF6 A;  1QAL A;  2HMK B;  2R4I A;  1IDP A;  1I3F A;  3EQQ B;  4HM3 B;  1BRH A;  5BU4 A;  2RNT A;  2P05 A;  1BNS A;  2XH9 A;  3BLZ A;  3RDE A;  4FCJ A;  3SX1 A;  1FGQ A;  2Z77 A;  4KFF A;  4XB5 A;  3GZB A;  1TTO A;  2ZHX B;  1QVF 2;  7GSP A;  3KZT A;  5AEU B;  3DUK A;  3EHC A;  5DRV A;  1LNH A;  3EE1 A;  2B1X B;  3O8Y A;  3UL5 A;  4IPB A;  3FG1 A;  4MMX B;  3SOY A;  4WP5 A;  1VQ7 3;  4DKI A;  4HZ9 B;  2KF3 A;  2F5M A;  1JN5 A;  2XGL A;  2W56 B;  3JUP A;  1TRQ A;  5AYS C;  2W04 A;  1IQY A;  1GOY A;  1EG9 B;  1I70 A;  3DY5 A;  3NV0 B;  1YJN 3;  1YHQ 3;  2P09 A;  1WMP A;  3IPT A;  2FNQ A;  1B2Z A;  2UX0 A;  3MWZ A;  3NXJ A;  4JRF A;  1OH0 A;  1B27 A;  2GEY A;  3JUN A;  2CWT A;  1NU3 A;  1YVS A;  2Y74 A;  3E99 A;  3G8Z A;  4LYL B;  1B2U A;  1MWR A;  1IVW A;  3FSD A;  1OGZ A;  3F14 A;  3L0R A;  3LTC A;  3CCL 3;  1W02 A;  3QK9 A;  1EQK A;  1DET A;  1YGW A;  5AEW B;  5HOH A;  1Q81 4;  4ZM8 A;  1RGH A;  1BRK A;  3WA2 X;  2WGO A;  3JUQ A;  6STD A;  2W9Q A;  3JVC A;  4I5Q A;  3X42 A;  1I0X A;  1WMN A;  4N6L A;  2XSH B;  2QEX 3;  1B3S A;  3X3Y A;  1MWU A;  1Q42 A;  1QVG 2;  4O02 B;  3WOF B;  4K1V A;  1IVV A;  3CCS 3;  1YJW 3;  3NHX A;  2BMR B;  4J9A A;  1IQX A;  1LOV A;  2K0M A;  2STD A;  1G96 A;  1MNL A;  2BU4 A;  1G02 A;  5BXQ A;  2BNG A;  4N3V A;  6RNT A;  1GMQ A;  2XEP A;  3HOH A;  4GSP A;  4IIA A;  1IYY A;  4BL3 A;  1Q82 4;  1D6Z A;  1JZD A;  1EEJ A;  4RNY A;  1NNV A;  3Q1C A;  1BRS A;  1OF5 A;  1FUW A;  1IT8 A;  1K73 4;  1BRI A;  3KN4 A;  1NWW A;  1IVX A;  1RN7 A;  2BHM A;  1X1Y A;  3UJM A;  3FZW A;  3A5E A;  1ULJ B;  1OF5 B;  1SQW A;  3AMO B;  3GAX A;  4GB5 A;  1TJD A;  3X3X A;  1IK3 A;  1F8N A;  1E3V A;  1VQ5 3;  1GY6 A;  3KCH A;  1IT7 A;  1V74 A;  2F4Y A;  3NM7 A;  1LVN A;  2K3D A;  3CC2 3;  1D6U A;  1AQZ A;  1RGG A;  1V57 A;  3B8L A;  5KP1 A;  5FW5 A;  1U8C B;  1W6C A;  4HM1 B;  1YJ9 3;  4HJL B;  3OWU A;  1BSE A;  2RCD A;  3EB8 A;  3OWS A;  1E97 A;  1N9E A;  4MMY B;  2F5W A;  3DM8 A;  1IU7 A;  3D5G A;  3T0U A;  1RMS A;  4FCM A;  4LGQ A;  1YIJ 3;  4HBR A;  1BAN A;  1VQ4 3;  1I0V A;  3DXO A;  4HKV B;  2P0M A;  1PY3 A;  1PFP A;  3MG2 A;  3RGA A;  1JBR A;  1BU4 A;  1LOW A;  2RBI A;  1WQL B;  3GSP A;  3SYU A;  1KC8 4;  5IEN A;  3CME 3;  3CCV 3;  2CW9 A;  3LTB A;  1Y4K A;  3QRD A;  1IV9 A;  2XGN A;  5LC6 A;  1STD A;  4N6T A;  1RNB A;  3KFQ C;  3PZW A;  4U13 A;  1UW1 A;  3MYT A;  2KF4 A;  3SOA A;  4EYC A;  3F40 A;  2RGQ A;  5G1K A;  1I2G A;  6GSP A;  4Q53 A;  1BAO A;  2W56 A;  5CXO A;  3WR2 A;  1Q7H A;  2BMO B;  5CF2 A;  3X3Z A;  3Q2P A;  2XR8 B;  3B4O A;  4HM6 B;  4HM8 B;  4MJD A;  3I56 3;  1YIT 3;  2XF3 A;  3GZY B;  9RNT A;  3UNL A;  1A90 A;  2CFK A;  3NQZ A;  3SLU A;  1FA3 A;  2KF5 A;  1RNT A;  1SJW A;  2E2T A;  2BT3 A;  1STF I;  3S28 A;  1FZU A;  3AHS A;  1I2F A;  2CC3 A;  5I97 A;  1VQN 3;  2W03 A;  1ULI B;  2UUG C;  2W2C A;  2KXG A;  1UCK A;  2LYX A;  1QAF A;  3ALA A;  2CX1 A;  1UI8 A;  1TRP A;  5LC7 A;  3EN1 B;  3LTD A;  2QA4 3;  1VQL 3;  4KFE A;  1BNR A;  1C7H A;  1VQ8 3;  2CWU A;  7STD A;  3HI7 A;  1HU9 A;  1VQ9 3;  2C11 A;  1VQO 3;  3MKI A;  2BMQ B;  3OX9 A;  5AIF A;  1N8Q A;  2AAE A;  3DGM A;  1I3I A;  1MOL A;  4OK0 A;  4RZM A;  2W6J H;  4KVH A;  1LXE A;  4NRE A;  1UUW B;  1JBT A;  1IVU A;  3CCR 3;  1US1 A;  1DE3 A;  3CCE 3;  1FW7 A;  2FXT A;  2WOH A;  3N9H A;  2YX9 A;  1LOY A;  2WO0 A;  4MEI A;  1W4N A;  5D81 A;  2INX A;  5AYR B;  2KAA A;  3FLJ A;  4ILF A;  2MC8 A;  3ROB A;  1AVL A;  2H0I A;  3NM2 A;  3CCJ 3;  1K9M 4;  2P0X A;  3AMO A;  4HVN A;  7RNT A;  1ZO2 A;  2HMO B;  1ZS7 A;  1OHO A;  3JUM A;  3LZA A;  4WFO A;  3BNC A;  4XBX A;  1MGW A;  2CWV A;  1O7W B;  1B2S A;  4HM2 B;  2PZV A;  3DGO A;  1EUI C;  3I55 3;  1FUT A;  3OW2 2;  1BRG A;  1SII A;  1T5Y A;  1BUQ A;  5D83 A;  3CMA 3;  2RFR A;  4XM4 A;  1TU5 A;  2Q07 A;  2ZL8 A;  3MG1 A;  5JPP A;  3WOD G;  1RGE A;  2Z6B A;  4XDV A;  1JNQ A;  1MWS A;  5IG0 A;  2FGT A;  3Q3F A;  8RNT A;  1R4Y A;  1UGI A;  1AV4 A;  3FF2 A;  1RLS A;  2A15 A;  1NJI 4;  1BSD A;  8CHO A;  3KSE D;  1O7G B;  3DMC A;  1LQM B;  1JB4 A;  1KSI A;  3S67 A;  2O9U X;  2E2V A;  3LOY A;  1GY5 A;  1JB5 A;  3AHW A;  1EA2 A;  1TFO A;  3NBB A;  1K41 A;  3K5T A;  1VQK 3;  1M1K 4;  4R9L A;  1RRH A;  3MG3 A;  2P38 A;  5TGN A;  3D9R A;  2E2U A;  3WOE B;  3PYJ A;  1LNI A;  3CU3 A;  2CFL A;  2Z76 A;  1X1W A;  2CK3 H;  3BND A;  4EW5 A;  1QMA A;  1VQM 3;  1S72 3;  3H51 A;  1OGX A;  4LMI A;  4AKZ A;  3K7C A;  1CEW I;  1O7P B;  3H3H A;  4CJN A;  2MF7 A;  1RGA A;  3FF0 A;  2R41 A;  4OVM A;  3FGY A;  3G16 A;  1TUH A;  5AIG A;  1FGO A;  1AR0 A;  3LH4 A;  2OCT A;  3F8H A;  5ELU A;  1CH0 A;  1BVI A;  3GZR A;  1OCV A;  4H61 A;  3ZG5 A;  3CCM 3;  2GXF A;  1BGS A;  4L8P A;  3NUV A;  1HZ1 A;  4O2H A;  1GMP A;  1SPU A;  1VQ6 3;  1GS3 A;  1QJG A;  4R9K A;  2CFW A;  3EJV A;  3F9S A;  4HAA A;  4QWT A;  4BIR A;  1W6Y A;  5JPU A;  1GSP A;  3ECF A;  3JUO A;  4FMD A;  2SAR A;  1B2M A;  1O7H B;  2GU3 A;  1I8V A;  1S5A A;  1W6G A;  5IW9 A;  1YI2 3;  3OXA A;  1A2V A;  1A2K A;  1A2P A;  1SIH A;  3AGO A;  2F86 B;  5KP3 A;  1AVK A;  5CLK A;  3HIG A;  2F56 A;  2H0G A;  4O3V A;  3K9M C;  2BO9 B;  1BNG A;  3X41 A;  4N6M A;  4BTX A;  1RCL A;  4HM7 B;  2HMJ B;  2C10 A;  1NB5 I;  1FGM A;  2IA7 A;  4STD A;  3DZL A;  1RN4 A;  2OOV A;  4LSO A;  3URP A;  3HZP A;  5FGO A;  4R4K A;  4N6N B;  1RTU A;  4FR9 A;  1JZO A;  2RSX A;  4ORL A;  2L1S A;  3BB9 A;  2OTJ 3;  2IUK A;  1O7N B;  3ZG0 A;  5IER A;  3B4P A;  1AY7 A;  1O7M B;  3D5I A;  3I0Y A;  1GY7 A;  5D82 A;  2IMJ A;  1KWI A;  4CPK A;  1JJ2 2;  3MPH A;  3MHE A;  1M1X B;  1OUN A;  4H3U A;  1K8A 4;  3FG4 A;  3NX0 A;  1BNE A;  1N5H A;  3GZX B;  1X1X A;  3RGR A;  3WA3 A;  3BNE A;  1OHS A;  2XFT A;  4HM5 B;  2QGU A;  3EX9 A;  3FG3 A;  4K61 A;  1NB3 I;  1RSN A;  4WWU C;  4LEH A;  5CK6 A;  3PCR A;  1V58 A;  5AIH A;  1U5O A;  3G0K A;  2WOF A;  4J5G A;  1VQP 3;  5JBS A;  3UB1 A;  3D79 A;  3PS8 A;  2YFJ B;  4KT3 B;  1N8R 4;  1BRN L;  1OHP A;  1HYF A;  4GHO A;  5IG3 A;  3G71 3;  5IEO A;  1RRL A;  4L8O A;  3CCQ 3;  1IQ8 A;  3TDG A;  3CCU 3;  3NV0 A;  3CD6 3;  2PNC A;  1M9G A;  1UCL A;  2GBX B;  4HZB B;  1UI7 A;  1W5Z A;  1FGT A;  3CNM A;  4OUQ A;  2Z7A A;  3HX8 A;  2HOH A;  3K0Z A;  4L7K A;  5EEO A;  3GWR A;  1B2X A;  3FKA A;  3SED A;  4GL6 A;  4G1M B;  4FMC A;  2JQ5 A;  4EV5 A;  3V99 A;  3CC7 3;  3M8C A;  2HML B;  1LRA A;  4FMA A;  4PEJ A;  3PGB A;  3T8N A;  5STD A;  1MWT A;  3F7S A;  1W01 A;  5A0O B;  1WMO A;  3VF1 A;  2W9P A;  3EC9 A;  1W2B 2;  1N5P A;  4X2H A;  3OV4 A;  4EXR A;  1B20 A;  5EQL A;  1RN1 A;  2QIY A;  3V98 A;  1JKG B;  3DH2 A;  4J8T A;  5KP4 A;  1TFK A;  2ML5 A;  2OQE C;  2ZDJ A;  4HM4 B;  2GSP A;  1C54 A;  1GMR A;  1JRQ A;  1T2I A;  2CFD A;  1GOU A;  4NHF A;  2I9W A;  3U1W A;  1G0T A;  2OTL 3;  3N8B A;  3LXU X;  3U97 A;  2YFI B;  4EV2 A;  3KE7 A;  1KD1 4;  1IV7 A;  2O3O A;  1W00 A;  3OWY A;  3VGN A;  1GYB A;  2D1W A;  1BOX A;  1RDS A;  4LZI A;  2B24 B;  1PYL A;  2KCD A;  4CCV A;  1PU4 A;  2JDI H;  3PXM A;  3Q90 A;  3SVA A;  4N6O B;  1CQS A;  4KZ1 A;  2H0H A;  1X1U A;  3CNX A;  3G4S 3;  4K1U A;  5GSP A;  3F7X A;  3DGY A;  4J5K A;  2XRX B;  5HGR A;  1BNI A;  1L5G B;  1JBS A;  4XBY A;  3RNT A;  1SAR A;  2HMN B;  1W7C A;  2CG0 A;  5BVB A;  1Q9E A;  1WNH A;  1N9J A;  3S5C A;  3V92 A;  3CPW 2;  4IT7 A;  4X2O A;  3ER7 A;  3BIR A;  2IUJ A;  3D3L A;  2CIU A;  4CDL A;  1T2H A;  1LQG C;  2HMM B;  1ROV A;  4O8S A;  1RGC A;  2AAD A;  2J8X B;  2F99 A;  2XSO B;  2K54 A;  5BIR A;  2SBL A;  4FMB A;  1UCJ A;  3X40 A;  5G2G A;  2OOV C;  3BU4 A;  4HM0 B;  5EVH A;  3LT9 A;  5ELJ A;  5AI1 A;  5M1A A;  3IMA B;  1ZX2 A;  3S29 A;  2Y73 A;  2GBW B;  1UGH I;  4R80 A;  4RBN A;  2CHC A;  3PCS A;  3N54 B;  1HKX A;  4RNT A;  3NBR A;  3SXX A;  3UL6 A;  2IY2 A;  4EC6 A;  3WDG B;  3S27 A;  1RKY A;  3KKG A;  3NBJ A;  5IG5 A;  4RNZ A;  2CFG A;  3D4A A;  1ROA A;  1R4C A;  3BNB A;  1NDO B;  4WHA A;  1TP6 A;  3KSP A;  1CYU A;  1LOX A;  3EBT A;  1ASK A;  2W0Q A;  5M19 A;  4BTY A;  3LT8 A;  1YVB I;  5M18 A;  3STD A;  1JN5 B;  1RGK A;  1BRJ A;  4NPB A;  5AII A;  2IYJ A;  3EN8 A;  3CXC 2;  1E3R A;  3LML A;  2OQE A;  1Q7Y 4;  3KII A;  4AEQ A;  3J7Y d;  4N6V 0; 
#chains in the Genus database with same CATH homology
 1D6Y A;  5IG4 A;  1DMM A;  2GEX A;  4R1K A;  1NO3 A;  2F98 A;  3HII A;  4XBT A;  1KQS 2;  1DYU A;  2V1L A;  1ISK A;  1WTH A;  1VZZ A;  1Q86 4;  3WMD A;  4N6U A;  3HK4 A;  4K90 B;  4TX4 A;  2CG1 A;  2XFS A;  3B7C A;  4MMZ B;  2ML6 A;  3G6E 3;  4FCZ A;  3T8U A;  1M90 4;  2CKF B;  3LTA A;  1K28 A;  4HYZ A;  1DMN A;  1GD3 A;  3FCS B;  5DRE A;  2CH9 A;  2GU1 A;  1A67 A;  1JV2 B;  1FGR A;  1JB2 A;  4WYK A;  3DGL A;  4XDW A;  1DVC A;  3CC4 3;  1YGE A;  1Q40 A;  3LYG A;  1DVD A;  1OAC A;  2D42 A;  3NQY A;  4EBG A;  4WYK B;  3MSO A;  1OPY A;  1GD4 A;  1Q40 B;  3CPO A;  1TIJ A;  5CF1 A;  1UUV B;  1Z1S A;  2LQV A;  1J2B A;  3F8X A;  1DMQ A;  1EKM A;  3A76 A;  2WGQ A;  3EBY A;  1W2Z A;  1CYV A;  3K63 A;  4I4K A;  4JF8 A;  3UB1 A;  4AKY A;  3IJE B;  1RJO A;  2KRT A;  3FH1 A;  3EF8 A;  2YFL B;  4KFD A;  1QAK A;  2L4V A;  1JKG A;  3VSY A;  2OWP A;  3DGN A;  5IEP A;  2M7O A;  3GRD A;  4BTW A;  5IF6 A;  1QAL A;  2HMK B;  2R4I A;  1IDP A;  4HM3 B;  3EQQ B;  2P05 A;  2XH9 A;  3BLZ A;  3SX1 A;  3RDE A;  4FCJ A;  1FGQ A;  2Z77 A;  4KFF A;  4XB5 A;  3GZB A;  1QVF 2;  3KZT A;  5AEU B;  3DUK A;  3EHC A;  5DRV A;  1LNH A;  3EE1 A;  2B1X B;  3O8Y A;  3UL5 A;  4IPB A;  3FG1 A;  4MMX B;  3SOY A;  4WP5 A;  1VQ7 3;  4HZ9 B;  1JN5 A;  2XGL A;  2W56 B;  3JUP A;  5AYS C;  2W04 A;  1IQY A;  1EG9 B;  3DY5 A;  3NV0 B;  1YHQ 3;  1YJN 3;  2P09 A;  1WMP A;  3IPT A;  2FNQ A;  3NXJ A;  2UX0 A;  3MWZ A;  4JRF A;  1OH0 A;  2GEY A;  3JUN A;  2CWT A;  1NU3 A;  2Y74 A;  3E99 A;  3G8Z A;  1IVW A;  3FSD A;  1OGZ A;  3F14 A;  3L0R A;  3LTC A;  3CCL 3;  1W02 A;  3QK9 A;  1EQK A;  5AEW B;  1Q81 4;  4ZM8 A;  3WA2 X;  2WGO A;  3JUQ A;  6STD A;  2W9Q A;  3JVC A;  3X42 A;  1WMN A;  4N6L A;  2XSH B;  2QEX 3;  3X3Y A;  1Q42 A;  1QVG 2;  4O02 B;  3WOF B;  4K1V A;  1IVV A;  3CCS 3;  1YJW 3;  3NHX A;  2BMR B;  4J9A A;  1IQX A;  2K0M A;  2STD A;  1G96 A;  1MNL A;  5BXQ A;  2BNG A;  4N3V A;  2XEP A;  4IIA A;  1Q82 4;  1D6Z A;  4RNY A;  3Q1C A;  1FUW A;  1OF5 A;  1IT8 A;  1K73 4;  3KN4 A;  1NWW A;  1IVX A;  1RN7 A;  2BHM A;  3UJM A;  3FZW A;  1ULJ B;  1OF5 B;  1SQW A;  3AMO B;  3GAX A;  4GB5 A;  1IK3 A;  3X3X A;  1F8N A;  1E3V A;  1VQ5 3;  1GY6 A;  1IT7 A;  1V74 A;  3NM7 A;  1LVN A;  3CC2 3;  1D6U A;  5KP1 A;  3B8L A;  5FW5 A;  1U8C B;  1W6C A;  4HM1 B;  1YJ9 3;  4HJL B;  3OWU A;  2RCD A;  3EB8 A;  3OWS A;  1E97 A;  1N9E A;  4MMY B;  3DM8 A;  1IU7 A;  3T0U A;  4FCM A;  4LGQ A;  1YIJ 3;  4HBR A;  1VQ4 3;  3DXO A;  4HKV B;  2P0M A;  1PFP A;  3MG2 A;  3RGA A;  1KC8 4;  1WQL B;  5IEN A;  3CME 3;  3CCV 3;  2CW9 A;  3LTB A;  1Y4K A;  3QRD A;  1IV9 A;  2XGN A;  5LC6 A;  1STD A;  4N6T A;  3KFQ C;  3PZW A;  4U13 A;  1UW1 A;  3MYT A;  3SOA A;  4EYC A;  3F40 A;  2RGQ A;  4Q53 A;  2W56 A;  5CXO A;  2BMO B;  5CF2 A;  3X3Z A;  3Q2P A;  2XR8 B;  3B4O A;  4HM6 B;  4HM8 B;  4MJD A;  3I56 3;  1YIT 3;  2XF3 A;  3GZY B;  1A90 A;  3UNL A;  2CFK A;  3NQZ A;  3SLU A;  1FA3 A;  1SJW A;  2E2T A;  2BT3 A;  1STF I;  3S28 A;  2CC3 A;  5I97 A;  1VQN 3;  2W03 A;  1ULI B;  2W2C A;  2KXG A;  3ALA A;  2LYX A;  1QAF A;  1UI8 A;  5LC7 A;  3EN1 B;  3LTD A;  2QA4 3;  1VQL 3;  4KFE A;  1C7H A;  1VQ8 3;  2CWU A;  7STD A;  3HI7 A;  1HU9 A;  1VQ9 3;  2C11 A;  1VQO 3;  3MKI A;  2BMQ B;  3OX9 A;  5AIF A;  1N8Q A;  4RZM A;  3DGM A;  4OK0 A;  1MOL A;  2W6J H;  4KVH A;  1LXE A;  4NRE A;  1UUW B;  1IVU A;  3CCR 3;  1US1 A;  3CCE 3;  2FXT A;  2WOH A;  3N9H A;  2YX9 A;  2WO0 A;  4MEI A;  1W4N A;  5D81 A;  2INX A;  5AYR B;  3FLJ A;  3ROB A;  2MC8 A;  1AVL A;  3NM2 A;  3CCJ 3;  1K9M 4;  2P0X A;  3AMO A;  4HVN A;  1ZO2 A;  2HMO B;  1OHO A;  3JUM A;  3LZA A;  4WFO A;  3BNC A;  4XBX A;  2CWV A;  4HM2 B;  1O7W B;  3I55 3;  2PZV A;  3DGO A;  3OW2 2;  1SII A;  1BUQ A;  1T5Y A;  5D83 A;  3CMA 3;  2RFR A;  4XM4 A;  1TU5 A;  2Q07 A;  2ZL8 A;  3MG1 A;  5JPP A;  3WOD G;  2Z6B A;  4XDV A;  1JNQ A;  5IG0 A;  2FGT A;  1AV4 A;  3FF2 A;  2A15 A;  1NJI 4;  8CHO A;  3KSE D;  1O7G B;  3DMC A;  1JB4 A;  1KSI A;  3S67 A;  2O9U X;  2E2V A;  3LOY A;  1GY5 A;  1JB5 A;  1EA2 A;  1TFO A;  3NBB A;  1K41 A;  3K5T A;  1VQK 3;  1M1K 4;  4R9L A;  1RRH A;  3MG3 A;  2P38 A;  5TGN A;  3D9R A;  2E2U A;  3WOE B;  3PYJ A;  3CU3 A;  2CFL A;  2Z76 A;  3BND A;  2CK3 H;  1QMA A;  1VQM 3;  1S72 3;  3H51 A;  1OGX A;  4LMI A;  4AKZ A;  3K7C A;  1CEW I;  1O7P B;  3H3H A;  2MF7 A;  3FF0 A;  4OVM A;  3FGY A;  3G16 A;  1TUH A;  5AIG A;  1FGO A;  1AR0 A;  3LH4 A;  2OCT A;  3F8H A;  5ELU A;  3GZR A;  1OCV A;  4H61 A;  3CCM 3;  2GXF A;  4L8P A;  3NUV A;  4O2H A;  1SPU A;  1VQ6 3;  1GS3 A;  1QJG A;  4R9K A;  2CFW A;  3EJV A;  3F9S A;  4QWT A;  5JPU A;  1W6Y A;  3ECF A;  3JUO A;  4FMD A;  1O7H B;  2GU3 A;  1S5A A;  1W6G A;  5IW9 A;  1YI2 3;  3OXA A;  1A2V A;  1A2K A;  1SIH A;  2F86 B;  5KP3 A;  1AVK A;  5CLK A;  3HIG A;  4O3V A;  3K9M C;  2BO9 B;  3X41 A;  4N6M A;  4BTX A;  4HM7 B;  2HMJ B;  2C10 A;  1NB5 I;  1FGM A;  2IA7 A;  4STD A;  3DZL A;  2OOV A;  4LSO A;  3HZP A;  5FGO A;  4R4K A;  4N6N B;  4FR9 A;  2RSX A;  4ORL A;  2OTJ 3;  3BB9 A;  2IUK A;  1O7N B;  5IER A;  3B4P A;  1O7M B;  3I0Y A;  1GY7 A;  5D82 A;  2IMJ A;  1KWI A;  1JJ2 2;  3MPH A;  3MHE A;  1M1X B;  1OUN A;  4H3U A;  1K8A 4;  3FG4 A;  3NX0 A;  1N5H A;  3GZX B;  3RGR A;  3WA3 A;  3BNE A;  1OHS A;  2XFT A;  4HM5 B;  2QGU A;  3EX9 A;  3FG3 A;  4K61 A;  1NB3 I;  4WWU C;  5CK6 A;  4LEH A;  5AIH A;  3PCR A;  1U5O A;  3G0K A;  2WOF A;  1VQP 3;  5JBS A;  3PS8 A;  2YFJ B;  1N8R 4;  1OHP A;  5IG3 A;  3G71 3;  5IEO A;  1RRL A;  4L8O A;  3CCQ 3;  1IQ8 A;  3TDG A;  3CCU 3;  3NV0 A;  3CD6 3;  2PNC A;  1M9G A;  2GBX B;  4HZB B;  1UI7 A;  1W5Z A;  1FGT A;  3CNM A;  4OUQ A;  2Z7A A;  3HX8 A;  4L7K A;  3K0Z A;  5EEO A;  3SED A;  3GWR A;  3FKA A;  4GL6 A;  4G1M B;  4FMC A;  2JQ5 A;  4EV5 A;  3V99 A;  3CC7 3;  3M8C A;  2HML B;  4FMA A;  4PEJ A;  3PGB A;  3T8N A;  5STD A;  5A0O B;  3F7S A;  1W01 A;  1WMO A;  3VF1 A;  2W9P A;  3EC9 A;  1W2B 2;  1N5P A;  4X2H A;  3OV4 A;  4EXR A;  5EQL A;  2QIY A;  3V98 A;  1JKG B;  4J8T A;  5KP4 A;  1TFK A;  2ML5 A;  2OQE C;  2ZDJ A;  4HM4 B;  1JRQ A;  2CFD A;  4NHF A;  3U1W A;  2I9W A;  2OTL 3;  3N8B A;  3LXU X;  3U97 A;  2YFI B;  4EV2 A;  3KE7 A;  1KD1 4;  1IV7 A;  2O3O A;  1W00 A;  3OWY A;  3VGN A;  1GYB A;  2D1W A;  4LZI A;  2B24 B;  2KCD A;  4CCV A;  1PU4 A;  2JDI H;  3PXM A;  3Q90 A;  3SVA A;  4N6O B;  1CQS A;  4KZ1 A;  3CNX A;  3G4S 3;  4K1U A;  3F7X A;  5HGR A;  2XRX B;  1L5G B;  4XBY A;  2HMN B;  1W7C A;  2CG0 A;  5BVB A;  1WNH A;  1N9J A;  3S5C A;  3V92 A;  3CPW 2;  4IT7 A;  4X2O A;  3ER7 A;  2IUJ A;  3D3L A;  2CIU A;  4CDL A;  2HMM B;  1ROV A;  4O8S A;  2F99 A;  2XSO B;  2K54 A;  2SBL A;  4FMB A;  3X40 A;  5G2G A;  2OOV C;  4HM0 B;  5EVH A;  3LT9 A;  5ELJ A;  5AI1 A;  3IMA B;  1ZX2 A;  3S29 A;  2Y73 A;  2GBW B;  4R80 A;  4RBN A;  2CHC A;  3PCS A;  3N54 B;  1HKX A;  3NBR A;  3SXX A;  3UL6 A;  4EC6 A;  3WDG B;  3S27 A;  1RKY A;  3KKG A;  3NBJ A;  5IG5 A;  4RNZ A;  2CFG A;  1ROA A;  1R4C A;  3BNB A;  1NDO B;  4WHA A;  1TP6 A;  3KSP A;  1CYU A;  1LOX A;  3EBT A;  1ASK A;  2W0Q A;  4BTY A;  3LT8 A;  1YVB I;  3STD A;  1JN5 B;  5AII A;  3CXC 2;  3EN8 A;  1E3R A;  3LML A;  2OQE A;  1Q7Y 4;  3KII A;  4AEQ A;  3J7Y d;  4N6V 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...