1OPYA

Ksi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords DELTA5-3-KETOSTEROID IOSMERASE
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1opyA00
3DMCA 5KP1A 2GEYA 2F98A 3T8NA 1OHOA 1GS3A 2GXFA 3S5CA 2BMQB 3ER7A 3GZYB 3IPTA 3KKGA 1QJGA 3FF0A 4L7KA 2XR8B 2QIYA 5IEPA 3VSYA 1JB2A 2HMJB 5AIHA 3B7CA 3H3HA 3HK4A 3VGNA 2GBWB 4XB5A 5AI1A 3GWRA 3FLJA 1K41A 2K54A 3EC9A 1OH0A 3B4OA 4LMIA 1W00A 1UUVB 3NV0A 3F8XA 3CNMA 1OHSA 3UNLA 3OV4A 3D9RA 4GB5A 5DREA 4IIAA 1C7HA 5EVHA 3HX8A 3EN1B 3UJMA 3MG2A 1GY7A 4HM6B 1DMMA 2BMOB 2HMLB 3F7SA 3FH1A 2A15A 2F99A 3MG3A 4HM2B 1OGZA 1OF5B 3CNXA 3F8HA 4XDVA 5STDA 2BNGA 3H51A 4WWUC 4R1KA 2PZVA 1JB5A 2B1XB 1GY5A 4HVNA 5KP4A 5D83A 3EJVA 3E99A 2JQ5A 2YFJB 2XSOB 2Z77A 1OF5A 3F14A 3GRDA 4J8TA 4OVMA 1E3RA 1OHPA 4STDA 5IG5A 1IDPA 3MKIA 5KP3A 2R4IA 1QMAA 3DXOA 3NXJA 3SOYA 1JN5A 2XSHB 3GZRA 5CK6A 2HMMB 1Q42A 3EN8A 1TP6A 1ULJB 3G0KA 3I0YA 3G16A 3GZBA 4HKVB 4I4KA 3LZAA 4J9AA 4KVHA 4XBXA 1OUNA 3Q90A 5G2GA 1OPYA 2I9WA 4WYKB 2CHCA 3JUMA 1O7WB 3CPOA 1BUQA 3BLZA 5CXOA 5AEWB 3MHEA 4HZ9B 2IMJA 1ISKA 2HMOB 4FCMA 1S5AA 3M8CA 4HZBB 4XBTA 1JKGA 3FKAA 1WQLB 1VZZA 2Z76A 3KSPA 3JUQA 3NV0B 5JPUA 4ORLA 4WP5A 1ZO2A 1O7HB 2XRXB 3NHXA 2CKFB 1CQSA 2RCDA 3KZTA 1OGXA 5CF2A 4X2OA 1AR0A 3OX9A 1A2KA 2BMRB 3F9SA 2QGUA 3JUOA 3FSDA 5HGRA 3DM8A 3MG1A 5JPPA 1EG9B 4X2HA 1W01A 2OWPA 3EF8A 3EQQB 2RGQA 3NM2A 2Z7AA 4HM5B 4U13A 4XBYA 5TGNA 3WMDA 1HKXA 1O7NB 3T8UA 5CF1A 1JB4A 1DMQA 4OUQA 4MJDA 2B24B 3STDA 5BXQA 2HMNB 3ECFA 1O7GB 1W02A 3EBYA 3EHCA 5FW5A 4HM0B 5IG0A 1STDA 3LYGA 3JUPA 3FZWA 4Q53A 3B8LA 8CHOA 5IERA 5AIGA 1GYBA 3GZXB 3SEDA 4HM4B 1O7MB 4PEJA 4XDWA 1UUWB 4WYKA 1Z1SA 1E97A 1ASKA 4HM8B 4XM4A 1GY6A 1W6YA 4L8PA 2RFRA 3K0ZA 4L8OA 4N3VA 3RGRA 4HM3B 1TUHA 3G8ZA 5D81A 2W2CA 3JUNA 1OCVA 3EX9A 3FGYA 3K7CA 3OXAA 4H3UA 5IENA 1EA2A 1ULIB 4HJLB 4K1VA 4R9KA 3SOAA 3BB9A 5BVBA 3RGAA 5IG4A 1DMNA 5AIIA 4CDLA 4HM7B 7STDA 1NU3A 2INXA 4LGQA 3A76A 1NDOB 3MYTA 3EBTA 5IEOA 1JKGB 3NBRA 3DUKA 3OWUA 1SJWA 3NUVA 3OWYA 4R9LA 3F40A 5AIFA 5DRVA 3OWSA 3ROBA 2YFIB 1U5OA 5IF6A 5CLKA 1O7PB 1Q40A 3CU3A 5AEUB 4FCJA 1Q40B 6STDA 2GBXB 1NWWA 3DZLA 2UX0A 4RZMA 2HMKB 2F86B 3HZPA 1E3VA 3FF2A 2STDA 3B4PA 3KE7A 3F7XA 3MSOA 1JN5B 1ZX2A 2YFLB 4HM1B 4K1UA 5IG3A 4LEHA 2GEXA 5D82A
chains in the Genus database with same CATH superfamily
1MNLA 1D6YA 5EEOA 2ZHXB 1GS3A 1RGEA 2Q07A 1MGRA 3CCE3 2V1LA 1DVDA 3IPTA 1AQZA 4GSPA 3DH2A 3X3ZA 2QIYA 3FCSB 3SXXA 1TFKA 2CIUA 3EE1A 2KAAA 1LQMB 1BANA 2FNQA 3H3HA 1T3BA 2GBWB 3FLJA 1EEJA 2K54A 4HBRA 1OH0A 1BSDA 1X1WA 1SPUA 3B4OA 4MMXB 4LMIA 1W00A 3F8XA 1BOXA 1EUIC 3QK9A 2CK3H 1IYYA 5EVHA 3EN1B 3N54B 1IQ8A 3UJMA 1CYVA 1GY7A 1IQYA 3BNDA 3F7SA 4HM6B 1MWUA 1OGZA 1W5ZA 5STDA 5AYRB 1IT8A 1TJDA 1V57A 2RNTA 2W04A 1I2FA 1RTUA 2Y74A 2B1XB 3CCV3 5D83A 2Z77A 2XSOB 3AMOB 3KSED 4CPKA 4EBGA 3UL6A 1UGIA 5LC7A 1WMPA 2XFSA 1N9JA 3SLUA 2WGOA 1BRGA 1SIHA 3G713 3EN8A 3G0KA 3LZAA 3S29A 2F56A 3Q90A 2I9WA 5G2GA 2CHCA 3QRDA 4RNZA 1RRHA 2M7OA 2O9UX 1RJOA 3IMAB 4WHAA 1JKGA 1WQLB 1VZZA 1MWRA 2UUGC 4KFFA 1PY3A 1CEWI 2XRXB 2CKFB 3AGOA 3KZTA 3DGMA 4LSOA 1AR0A 3OX9A 3SX1A 3URPA 1S723 2LQVA 1TRQA 1Y4KA 3JUOA 3MG1A 5JPPA 1TTOA 1TU5A 4U13A 3EQQB 2Z7AA 2CWTA 3N8BA 4XBYA 5G1KA 3V92A 1N8QA 3T8UA 2ML6A 1BSCA 1JZDA 1YIT3 4KFEA 1KQS2 1KWIA 3STDA 2MC8A 3ECFA 1W6GA 5IG0A 3EBYA 1VQO3 1MOLA 1BSAA 1STDA 1RKYA 3SEDA 2PNCA 1HYFA 3DY5A 4XDWA 1Z1SA 4XM4A 1BNIA 1G96A 3WHOA 1IVVA 2P0MA 2RFRA 4L8OA 4HM3B 5M19A 2W9PA 1TUHA 5AYSC 4H3UA 1YI23 5HOHA 1U8CB 2QEX3 2D42A 1G02A 4BU4A 4RNYA 4MEIA 3ZG5A 1VQK3 1AY7A 1Q864 2P38A 5CF1A 3EBTA 3DUKA 2CFDA 3KN4A 3L0RA 1JJ22 5DRVA 1CYUA 1VQN3 1BRJA 1QALA 1HU9A 1ZGXA 5CLKA 5M1AA 1O7PB 1YGWA 1FUWA 3NBJA 3WA2X 4AEQA 2CFKA 2OOVC 1YVSA 1Q40B 3PS8A 1NWWA 4CJNA 2W56B 1IV9A 1RRLA 3LXUX 2F86B 1AVKA 3HZPA 1E3VA 2ZA4A 3B4PA 4FCMA 5ELJA 2BIRA 2KF5A 1BVIA 5EQLA 2GEXA 1I2GA 3WR2A 2GEYA 2F98A 1RGHA 4RNTA 3FF0A 1FUTA 3CCM3 3K9MC 3VGNA 3CCU3 1K41A 5I97A 3EC9A 2KF6A 1LXEA 1RN4A 3NV0A 1OHSA 3OV4A 3D9RA 4GB5A 4TX4A 4IIAA 5DREA 4BTYA 1VQL3 2F4YA 3CC43 2OOVA 5IERA 3D5GA 2HMLB 3FH1A 4HM2B 3ZFZA 2W0QA 1OF5B 1RGFA 3CNXA 4HYZA 3CCJ3 3TDGA 3JVCA 2BNGA 4GL6A 1ROVA 1W6CA 3HIIA 3LTDA 3V98A 1VQ43 5KP4A 3UB1A 3E99A 2BO9B 2YFJB 3J7Yd 2JDIH 2FXTA 1E3RA 1OHPA 5IG5A 1IDPA 1JBRA 3X3YA 1GOYA 2SARA 2R4IA 1QMAA 3NXJA 3G4S3 2O3OA 3SOYA 1US1A 1LVNA 2XFTA 5CK6A 1EQKA 1ROAA 1Q42A 4FMAA 4EW5A 1ULJB 4KVHA 1T5YA 2E2TA 3G16A 3GZBA 3LOYA 4ILFA 4J9AA 4NREA 4QWTA 4BTXA 1NJI4 1I8VA 1OPYA 1LQGC 3JUMA 3CPOA 4N6OB 1J2BA 1R4CA 1BRIA 1UW1A 3BLZA 4EV5A 5IW9A 2IMJA 2ZL8A 1BSBA 4NPBA 1ISKA 1C54A 1B2UA 3AHSA 4AKYA 1CH0A 1F8NA 4BL3A 3A5EA 4N6V0 2CW9A 5JPUA 1M1K4 1O7HB 3NHXA 1K28A 1D6UA 3D4AA 3AMOA 4X2OA 1YJ93 2KF4A 2BMRB 1BAOA 3F9SA 3GSPA 1BSEA 2CH9A 2H0HA 2UGIA 3AHWA 1BUJA 1W01A 1RCKA 3EF8A 2RGQA 3WODG 1RSNA 4EC6A 1YVBI 3FG3A 2KCDA 1HKXA 1O7NB 2F5MA 3BU4A 3S67A 3KIIA 4OUQA 1I70A 2B24B 2HMNB 2GU1A 4O3VA 3BIRA 3LYGA 4Q53A 2OQEA 2GU3A 1M9GA 1V58A 2SBLA 2CG1A 2IA7A 4WYKA 2FGTA 2WOHA 1ASKA 1PYLA 2AADA 2LYXA 1W6YA 3HI7A 1FYSA 2KXGA 4N3VA 3X42A 3JUNA 1WMNA 6RNTA 5IENA 1EA2A 2C10A 4R9KA 1RDSA 1V74A 1TRPA 5BVBA 3RGAA 5IG4A 1DMNA 1M904 3D79A 4CDLA 1I0XA 1NU3A 2INXA 2ZDJA 4LGQA 3V99A 1PU4A 1NDOB 1JKGB 3NBRA 3OWYA 5BU4A 1RNTA 1SJWA 3RDEA 1B2ZA 3U1WA 5LC6A 4G1MB 4N6UA 3LT9A 3ROBA 4K90B 4R80A 5AEUB 1W2ZA 3T0UA 1UUGB 3PXMA 2HMKB 1B27A 1LOWA 3FF2A 2E2UA 4K1UA 1VQ93 2YFLB 3BNBA 4HM1B 5IG3A 1D6ZA 1B2SA 1SARA 3CXC2 1B2XA 3NBBA 4DKIA 3DMCA 1FGOA 3MPHA 3OW22 1K9M4 3CC73 1BGSA 1Q7HA 4KZ1A 1FGMA 3LTBA 7RNTA 4ZM8A 2BMQB 1QVG2 1W7CA 2BT3A 3KKGA 4H61A 3G6E3 1IVUA 1KSIA 5G1LA 4L7KA 2XR8B 1Q814 5IEPA 3VSYA 3NQZA 1JB2A 1FGQA 1QAKA 1IQXA 1RGAA 2XF3A 3HK4A 3KFQC 4KFDA 5AIHA 1BIRA 3GWRA 1ZS7A 1GMRA 1RMSA 3Q1CA 1A90A 5FGOA 3CCL3 3LTAA 1MGWA 1GSPA 1QAFA 2Y73A 4JRFA 2P09A 1I2EA 1C7HA 3HX8A 1DMMA 2YX9A 2A15A 2F99A 3MG3A 1Q9EA 1A2VA 3FG4A 2KRTA 3F8HA 3LMLA 2CWUA 1JRQA 1BRHA 4WWUC 4FMDA 4R1KA 3CCR3 2K0MA 4IT7A 3EJVA 2JQ5A 1OF5A 2CFWA 3NM7A 1B3SA 3CC23 1N9EA 4OVMA 3BNEA 4STDA 3MKIA 1VQ63 5M18A 3DXOA 3CME3 2W6JH 3GZRA 1JNQA 3I0YA 1TP6A 4HKVB 4I4KA 1OUNA 1KC84 1PFPA 3HIGA 4K61A 4WYKB 1K734 3GAXA 5CXOA 3ZG0A 3MHEA 4HZ9B 1BNFA 4HZBB 3HOHA 3PCRA 3NV0B 3JUQA 4WP5A 1ZO2A 3CMA3 1UCKA 1CQSA 1B20A 4KT3B 4EYCA 1HZ1A 2D1WA 1LOVA 1OGXA 1W2B2 1UDII 1FA3A 3WDGB 5GSPA 3I553 2QGUA 1N5HA 3FSDA 1WNHA 5HGRA 3DM8A 2AAEA 1JZOA 3U97A 5TGNA 3NM2A 3WMDA 3CD63 1IV7A 3SVAA 1DYUA 1DMQA 1DVCA 1JB4A 1X1YA 4MMZB 2XEPA 4MJDA 7GSPA 5FW5A 1W02A 2BHMA 5JBSA 1RNBA 1WMOA 1LOXA 1R4YA 3B8LA 3MWZA 1FGRA 1N5PA 2HOHA 3NX0A 1OACA 3AGNA 2W56A 1O7MB 4MMYB 3DGYA 1GOUA 4PEJA 1VQ53 2IY2A 3IJEB 4HM8B 1YGEA 2RBIA 1I3FA 2CC3A 3DGOA 3K0ZA 3RGRA 2OTJ3 2OQEC 2E2VA 3G8ZA 2H0GA 1OCVA 3K7CA 3OXAA 1VQM3 1NNVA 2Z6BA 4NHFA 4K1VA 1BNEA 1MWSA 4EXRA 1AV4A 3BB9A 2C11A 4R4KA 1B21A 4HOHA 4N6MA 1IVXA 5AIIA 1SIIA 4HM7B 2XGLA 7STDA 1IVWA 3S28A 5IEOA 3MYTA 3I563 1JBSA 3KCHA 1MWTA 3F40A 5AIFA 3OWSA 1WTHA 1GMPA 2YFIB 1YJN3 1VQ73 3EB8A 1Q40A 3PCSA 1L5GB 3BNCA 9RNTA 3CCS3 1YHQ3 2OTL3 1X1XA 5RNTA 2UX0A 1K8A4 2RSXA 1FW7A 2W03A 2STDA 3S5CA 4JF8A 3MSOA 1JN5B 1ZX2A 2CG0A 5KP1A 4LEHA 2WO0A 4FMCA 5D82A 2MF7A 3T8NA 4CCVA 1NB3I 1OHOA 4IPBA 2GXFA 1Q824 1YIJ3 3ER7A 3GZYB 5A0OB 5BIRA 1QJGA 2CWVA 1I0VA 1YNVX 4GHOA 2W9QA 2HMJB 3B7CA 3VF1A 4XB5A 5AI1A 2QA43 2K3DA 3N9HA 3NQYA 2CFLA 2WGQA 1BRNL 1RN7A 1RGKA 1EKMA 1UUVB 1X1UA 2CX1A 3Q2PA 3CNMA 4J5KA 3UNLA 1QVF2 1BUQA 4BIRA 2H0IA 4LZIA 1UGHI 4FMBA 3MG2A 1BNRA 2BMOB 1LOYA 1A67A 3RNTA 3CCQ3 4XDVA 3PGBA 3K5TA 3H51A 1UCJA 4BL2A 3DGLA 2PZVA 1JB5A 1LNIA 1GY5A 4HVNA 3D5IA 4N6LA 3F14A 3LT8A 1GOVA 4HAAA 1YJW3 1UI8A 6GSPA 3GRDA 4J8TA 1B2MA 5KP3A 3K63A 3FG1A 4EV2A 1JN5A 2ML5A 2XSHB 2HMMB 4FCZA 3O8YA 1DETA 3PZWA 4WFOA 1FGTA 1A2PA 4XBXA 1RN1A 1JV2B 1O7WB 5AEWB 1BNGA 2IUKA 4O02B 2HMOB 1IU7A 1S5AA 3M8CA 4XBTA 2J8XB 3FKAA 3KSPA 2Z76A 1N8R4 2OCTA 1STFI 1GD4A 4ORLA 4FR9A 1RGCA 2L4VA 4N6NB 1BU4A 2RCDA 1T2IA 5CF2A 1I3IA 1T2HA 1VQQA 1A2KA 1TFOA 1JBTA 2IYJA 1GD3A 1M1XB 1VQP3 1EG9B 4X2HA 2IUJA 3S27A 4AKZA 2OWPA 1RGLA 2WOFA 4HM5B 2F5WA 4O8SA 4RBNA 1UCLA 5BXQA 1O7GB 1UI7A 1RGGA 3DGNA 3EHCA 4HM0B 4LYLB 2L1SA 1Q7Y4 3JUPA 2R41A 3FZWA 1W4NA 8CHOA 5AIGA 1GYBA 2GSPA 3GZXB 3UL5A 5ELUA 1BRSA 4HM4B 1UUWB 4BTWA 1E97A 2P0XA 1GY6A 4I5QA 1LRAA 1RCLA 4L8PA 1VQ83 4J5GA 5D81A 2W2CA 3EX9A 3FGYA 1NO3A 1G0TA 1IK3A 1AVLA 1ULIB 4HJLB 1RLSA 3WA3A 3LTCA 1GMQA 2XH9A 3WOFB 1BNJA 4O2HA 1FZUA 3SYUA 2XGNA 2C4BA 2P05A 3WOEB 3A76A 3D3LA 3LH4A 3CPW2 1DE3A 4N6TA 1LNHA 3OWUA 3X41A 3NUVA 2KF3A 4R9LA 3X3XA 5IF6A 1U5OA 3X40A 1RHLA 1NB5I 3PYJA 3CU3A 1TIJA 3Q3FA 1IT7A 4FCJA 2GBXB 6STDA 3DZLA 8RNTA 2BU4A 1SQWA 4RZMA 1BNSA 1KD14 2CFGA 1BRKA 3SOAA 2CX0A 3KE7A 3F7XA 4OK0A 1UCIA 3ALAA 1FUSA
chains in the Genus database with same CATH topology
1MNLA 1D6YA 5EEOA 1GS3A 2Q07A 3CCE3 1DVDA 2V1LA 3IPTA 3X3ZA 2QIYA 3FCSB 3SXXA 1TFKA 2CIUA 3EE1A 2FNQA 3H3HA 2GBWB 3FLJA 2K54A 4HBRA 1OH0A 1SPUA 3B4OA 4MMXB 4LMIA 1W00A 3F8XA 3QK9A 2CK3H 5EVHA 3EN1B 3N54B 1IQ8A 3UJMA 1CYVA 1GY7A 1IQYA 3BNDA 3F7SA 4HM6B 1OGZA 1W5ZA 5STDA 1IT8A 2W04A 2Y74A 2B1XB 3CCV3 5D83A 2Z77A 2XSOB 3AMOB 3KSED 4EBGA 3UL6A 5LC7A 1WMPA 2XFSA 1N9JA 3SLUA 2WGOA 1SIHA 3G713 3EN8A 3G0KA 3LZAA 3S29A 3Q90A 5G2GA 2I9WA 2CHCA 3QRDA 4RNZA 1RRHA 2M7OA 2O9UX 1RJOA 3IMAB 4WHAA 1JKGA 1WQLB 1VZZA 4KFFA 1CEWI 2XRXB 2CKFB 3KZTA 3DGMA 4LSOA 1AR0A 3OX9A 3SX1A 1S723 2LQVA 1Y4KA 3JUOA 3MG1A 5JPPA 1TU5A 4U13A 3EQQB 2Z7AA 2CWTA 3N8BA 4XBYA 3V92A 1N8QA 3T8UA 2ML6A 1YIT3 4KFEA 1KQS2 1KWIA 3STDA 2MC8A 3ECFA 1W6GA 5IG0A 3EBYA 1VQO3 1MOLA 1STDA 1RKYA 3SEDA 2PNCA 3DY5A 4XDWA 1Z1SA 4XM4A 1G96A 1IVVA 2P0MA 2RFRA 4L8OA 4HM3B 2W9PA 1TUHA 5AYSC 4H3UA 1YI23 1U8CB 2QEX3 2D42A 4RNYA 4MEIA 1VQK3 1Q864 2P38A 5CF1A 3EBTA 3DUKA 2CFDA 3KN4A 3L0RA 1JJ22 5DRVA 1CYUA 1VQN3 1QALA 1HU9A 1FUWA 5CLKA 1O7PB 3NBJA 3WA2X 4AEQA 2CFKA 2OOVC 3PS8A 1Q40B 1NWWA 2W56B 1IV9A 1RRLA 3LXUX 2F86B 1AVKA 3HZPA 1E3VA 4FCMA 3B4PA 5ELJA 5EQLA 2GEXA 2GEYA 2F98A 3FF0A 3CCM3 3K9MC 3VGNA 3CCU3 1K41A 5I97A 3EC9A 1LXEA 3NV0A 1OHSA 3OV4A 3D9RA 4GB5A 4TX4A 4IIAA 5DREA 4BTYA 1VQL3 3CC43 5IERA 3FH1A 2HMLB 4HM2B 2W0QA 1OF5B 3CNXA 4HYZA 3CCJ3 3TDGA 3JVCA 2BNGA 4GL6A 1ROVA 1W6CA 3HIIA 3LTDA 3V98A 1VQ43 5KP4A 3UB1A 3E99A 2BO9B 2YFJB 3J7Yd 2JDIH 2FXTA 1E3RA 1OHPA 5IG5A 1IDPA 3X3YA 2R4IA 1QMAA 3NXJA 3G4S3 2O3OA 3SOYA 1US1A 1LVNA 2XFTA 5CK6A 1EQKA 1ROAA 1Q42A 4FMAA 1ULJB 4KVHA 1T5YA 2E2TA 3G16A 3GZBA 3LOYA 4J9AA 4NREA 4QWTA 1NJI4 4BTXA 1OPYA 3JUMA 3CPOA 4N6OB 1J2BA 1R4CA 1UW1A 3BLZA 4EV5A 1BUQA 5IW9A 2IMJA 2ZL8A 1ISKA 4AKYA 1F8NA 4N6V0 2CW9A 5JPUA 1M1K4 1O7HB 3NHXA 1K28A 1D6UA 3AMOA 4X2OA 1YJ93 2BMRB 3F9SA 2CH9A 1W01A 3EF8A 2RGQA 3WODG 4EC6A 1YVBI 3FG3A 2KCDA 1HKXA 1O7NB 3S67A 3KIIA 4OUQA 2B24B 2HMNB 2GU1A 4O3VA 3LYGA 4Q53A 2OQEA 2GU3A 1M9GA 2SBLA 2CG1A 2IA7A 4WYKA 2FGTA 2WOHA 1ASKA 2LYXA 1W6YA 3HI7A 2KXGA 4N3VA 3X42A 3JUNA 1WMNA 5IENA 1EA2A 2C10A 4R9KA 1V74A 5BVBA 3RGAA 5IG4A 1DMNA 1M904 4CDLA 2ZDJA 1NU3A 2INXA 4LGQA 1PU4A 3V99A 1NDOB 1JKGB 3NBRA 3OWYA 1SJWA 3RDEA 3U1WA 5LC6A 4G1MB 4N6UA 3LT9A 3ROBA 4K90B 4R80A 5AEUB 1W2ZA 3T0UA 3PXMA 2HMKB 3FF2A 2E2UA 4K1UA 1VQ93 2YFLB 3BNBA 4HM1B 5IG3A 1D6ZA 3CXC2 3NBBA 3OW22 3DMCA 1FGOA 3MPHA 1K9M4 3CC73 4KZ1A 1FGMA 3LTBA 4ZM8A 2BMQB 1QVG2 1W7CA 2BT3A 3KKGA 4H61A 3G6E3 1IVUA 1KSIA 4L7KA 2XR8B 1Q814 5IEPA 3VSYA 3NQZA 1JB2A 1FGQA 1QAKA 1IQXA 2XF3A 3HK4A 4KFDA 3KFQC 5AIHA 5AYRB 3GWRA 3Q1CA 1A90A 5FGOA 3CCL3 3LTAA 1QAFA 2Y73A 4JRFA 2P09A 1C7HA 3HX8A 1DMMA 2YX9A 2A15A 2F99A 3MG3A 1A2VA 3FG4A 2KRTA 3F8HA 3LMLA 2CWUA 1JRQA 4WWUC 3CCR3 4FMDA 4R1KA 2K0MA 4IT7A 3EJVA 2JQ5A 1OF5A 2CFWA 3NM7A 3CC23 1N9EA 4OVMA 3BNEA 4STDA 3MKIA 1VQ63 3DXOA 3CME3 2W6JH 3GZRA 1JNQA 3I0YA 1TP6A 4HKVB 4I4KA 1OUNA 1KC84 1PFPA 3HIGA 4K61A 4WYKB 1K734 3GAXA 5CXOA 3MHEA 4HZ9B 4HZBB 3PCRA 3NV0B 3JUQA 4WP5A 1ZO2A 3CMA3 1CQSA 4EYCA 1OGXA 2D1WA 1W2B2 1FA3A 3WDGB 3I553 2QGUA 1N5HA 3FSDA 1WNHA 5HGRA 3DM8A 3U97A 5TGNA 3NM2A 3WMDA 3CD63 1IV7A 3SVAA 1DYUA 1DMQA 1DVCA 1JB4A 4MMZB 2XEPA 4MJDA 5FW5A 1W02A 2BHMA 5JBSA 1WMOA 1LOXA 3B8LA 3MWZA 3NX0A 1N5PA 1FGRA 1OACA 4MMYB 2W56A 1O7MB 4PEJA 1VQ53 3IJEB 4HM8B 1YGEA 2CC3A 3DGOA 3K0ZA 3RGRA 2OTJ3 2OQEC 2E2VA 3G8ZA 1OCVA 3K7CA 3OXAA 1VQM3 2Z6BA 4NHFA 4K1VA 4EXRA 1AV4A 3BB9A 2C11A 4R4KA 4N6MA 1IVXA 5AIIA 1SIIA 4HM7B 2XGLA 7STDA 1IVWA 3S28A 5IEOA 3MYTA 3I563 5AIFA 3F40A 3OWSA 1WTHA 2YFIB 1YJN3 1VQ73 3EB8A 1Q40A 3PCSA 1L5GB 3BNCA 1YHQ3 3CCS3 2OTL3 2UX0A 1K8A4 2RSXA 2W03A 2STDA 3S5CA 4JF8A 3MSOA 1JN5B 1ZX2A 2CG0A 5KP1A 4LEHA 2WO0A 4FMCA 5D82A 2MF7A 3T8NA 4CCVA 1NB3I 1OHOA 4IPBA 2GXFA 1Q824 1YIJ3 3ER7A 3GZYB 5A0OB 1QJGA 2CWVA 2W9QA 2HMJB 3B7CA 3VF1A 4XB5A 5AI1A 2QA43 3N9HA 3NQYA 2CFLA 2WGQA 1RN7A 1EKMA 1UUVB 3Q2PA 3CNMA 3UNLA 1QVF2 4LZIA 4FMBA 3MG2A 2BMOB 1A67A 3CCQ3 4XDVA 3PGBA 3K5TA 3H51A 3DGLA 2PZVA 1JB5A 4HVNA 1GY5A 4N6LA 3F14A 3LT8A 1YJW3 1UI8A 3GRDA 4J8TA 5KP3A 3K63A 3FG1A 4EV2A 1JN5A 2ML5A 2XSHB 2HMMB 4FCZA 3O8YA 3PZWA 4WFOA 1FGTA 4XBXA 1JV2B 1O7WB 5AEWB 2IUKA 4O02B 2HMOB 1IU7A 1S5AA 3M8CA 4XBTA 3FKAA 3KSPA 2Z76A 1N8R4 2OCTA 1STFI 1GD4A 4ORLA 4FR9A 2L4VA 4N6NB 2RCDA 5CF2A 1A2KA 1TFOA 1GD3A 1M1XB 1VQP3 1EG9B 4X2HA 2IUJA 3S27A 4AKZA 2OWPA 2WOFA 4HM5B 4O8SA 4RBNA 5BXQA 1O7GB 1UI7A 3DGNA 3EHCA 1Q7Y4 4HM0B 3JUPA 3FZWA 8CHOA 1W4NA 5AIGA 1GYBA 3GZXB 3UL5A 5ELUA 4HM4B 1UUWB 4BTWA 1E97A 2P0XA 1GY6A 4L8PA 1VQ83 5D81A 2W2CA 3EX9A 3FGYA 1NO3A 1IK3A 1AVLA 1ULIB 4HJLB 3WA3A 3LTCA 2XH9A 3WOFB 4O2HA 2XGNA 2P05A 3WOEB 3A76A 3D3LA 3LH4A 3CPW2 4N6TA 1LNHA 3OWUA 3X41A 3NUVA 4R9LA 3X3XA 5IF6A 1U5OA 3X40A 1NB5I 3PYJA 3CU3A 1TIJA 4FCJA 1IT7A 6STDA 2GBXB 3DZLA 1SQWA 4RZMA 1KD14 2CFGA 3SOAA 3KE7A 3F7XA 4OK0A 3ALAA 2OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMC A;  5KP1 A;  2GEY A;  2F98 A;  3T8N A;  1OHO A;  1GS3 A;  2GXF A;  3S5C A;  2BMQ B;  3ER7 A;  3GZY B;  3IPT A;  3KKG A;  1QJG A;  3FF0 A;  4L7K A;  2XR8 B;  2QIY A;  5IEP A;  3VSY A;  1JB2 A;  2HMJ B;  5AIH A;  3B7C A;  3H3H A;  3HK4 A;  3VGN A;  2GBW B;  4XB5 A;  5AI1 A;  3GWR A;  3FLJ A;  1K41 A;  2K54 A;  3EC9 A;  1OH0 A;  3B4O A;  4LMI A;  1W00 A;  1UUV B;  3NV0 A;  3F8X A;  3CNM A;  1OHS A;  3UNL A;  3OV4 A;  3D9R A;  4GB5 A;  5DRE A;  4IIA A;  1C7H A;  5EVH A;  3HX8 A;  3EN1 B;  3UJM A;  3MG2 A;  1GY7 A;  4HM6 B;  1DMM A;  2BMO B;  2HML B;  3F7S A;  3FH1 A;  2A15 A;  2F99 A;  3MG3 A;  4HM2 B;  1OGZ A;  1OF5 B;  3CNX A;  3F8H A;  4XDV A;  5STD A;  2BNG A;  3H51 A;  4WWU C;  4R1K A;  2PZV A;  1JB5 A;  2B1X B;  1GY5 A;  4HVN A;  5KP4 A;  5D83 A;  3EJV A;  3E99 A;  2JQ5 A;  2YFJ B;  2XSO B;  2Z77 A;  1OF5 A;  3F14 A;  3GRD A;  4J8T A;  4OVM A;  1E3R A;  1OHP A;  4STD A;  5IG5 A;  1IDP A;  3MKI A;  5KP3 A;  2R4I A;  1QMA A;  3DXO A;  3NXJ A;  3SOY A;  1JN5 A;  2XSH B;  3GZR A;  5CK6 A;  2HMM B;  1Q42 A;  3EN8 A;  1TP6 A;  1ULJ B;  3G0K A;  3I0Y A;  3G16 A;  3GZB A;  4HKV B;  4I4K A;  3LZA A;  4J9A A;  4KVH A;  4XBX A;  1OUN A;  3Q90 A;  5G2G A;  1OPY A;  2I9W A;  4WYK B;  2CHC A;  3JUM A;  1O7W B;  3CPO A;  1BUQ A;  3BLZ A;  5CXO A;  5AEW B;  3MHE A;  4HZ9 B;  2IMJ A;  1ISK A;  2HMO B;  4FCM A;  1S5A A;  3M8C A;  4HZB B;  4XBT A;  1JKG A;  3FKA A;  1WQL B;  1VZZ A;  2Z76 A;  3KSP A;  3JUQ A;  3NV0 B;  5JPU A;  4ORL A;  4WP5 A;  1ZO2 A;  1O7H B;  2XRX B;  3NHX A;  2CKF B;  1CQS A;  2RCD A;  3KZT A;  1OGX A;  5CF2 A;  4X2O A;  1AR0 A;  3OX9 A;  1A2K A;  2BMR B;  3F9S A;  2QGU A;  3JUO A;  3FSD A;  5HGR A;  3DM8 A;  3MG1 A;  5JPP A;  1EG9 B;  4X2H A;  1W01 A;  2OWP A;  3EF8 A;  3EQQ B;  2RGQ A;  3NM2 A;  2Z7A A;  4HM5 B;  4U13 A;  4XBY A;  5TGN A;  3WMD A;  1HKX A;  1O7N B;  3T8U A;  5CF1 A;  1JB4 A;  1DMQ A;  4OUQ A;  4MJD A;  2B24 B;  3STD A;  5BXQ A;  2HMN B;  3ECF A;  1O7G B;  1W02 A;  3EBY A;  3EHC A;  5FW5 A;  4HM0 B;  5IG0 A;  1STD A;  3LYG A;  3JUP A;  3FZW A;  4Q53 A;  3B8L A;  8CHO A;  5IER A;  5AIG A;  1GYB A;  3GZX B;  3SED A;  4HM4 B;  1O7M B;  4PEJ A;  4XDW A;  1UUW B;  4WYK A;  1Z1S A;  1E97 A;  1ASK A;  4HM8 B;  4XM4 A;  1GY6 A;  1W6Y A;  4L8P A;  2RFR A;  3K0Z A;  4L8O A;  4N3V A;  3RGR A;  4HM3 B;  1TUH A;  3G8Z A;  5D81 A;  2W2C A;  3JUN A;  1OCV A;  3EX9 A;  3FGY A;  3K7C A;  3OXA A;  4H3U A;  5IEN A;  1EA2 A;  1ULI B;  4HJL B;  4K1V A;  4R9K A;  3SOA A;  3BB9 A;  5BVB A;  3RGA A;  5IG4 A;  1DMN A;  5AII A;  4CDL A;  4HM7 B;  7STD A;  1NU3 A;  2INX A;  4LGQ A;  3A76 A;  1NDO B;  3MYT A;  3EBT A;  5IEO A;  1JKG B;  3NBR A;  3DUK A;  3OWU A;  1SJW A;  3NUV A;  3OWY A;  4R9L A;  3F40 A;  5AIF A;  5DRV A;  3OWS A;  3ROB A;  2YFI B;  1U5O A;  5IF6 A;  5CLK A;  1O7P B;  1Q40 A;  3CU3 A;  5AEU B;  4FCJ A;  1Q40 B;  6STD A;  2GBX B;  1NWW A;  3DZL A;  2UX0 A;  4RZM A;  2HMK B;  2F86 B;  3HZP A;  1E3V A;  3FF2 A;  2STD A;  3B4P A;  3KE7 A;  3F7X A;  3MSO A;  1JN5 B;  1ZX2 A;  2YFL B;  4HM1 B;  4K1U A;  5IG3 A;  4LEH A;  2GEX A;  5D82 A; 
#chains in the Genus database with same CATH topology
 1MNL A;  1D6Y A;  5EEO A;  2ZHX B;  1GS3 A;  1RGE A;  2Q07 A;  1MGR A;  3CCE 3;  2V1L A;  1DVD A;  3IPT A;  1AQZ A;  4GSP A;  3DH2 A;  3X3Z A;  2QIY A;  3FCS B;  3SXX A;  1TFK A;  2CIU A;  3EE1 A;  2KAA A;  1LQM B;  1BAN A;  2FNQ A;  3H3H A;  1T3B A;  2GBW B;  3FLJ A;  1EEJ A;  2K54 A;  4HBR A;  1OH0 A;  1BSD A;  1X1W A;  1SPU A;  3B4O A;  4MMX B;  4LMI A;  1W00 A;  3F8X A;  1BOX A;  1EUI C;  3QK9 A;  2CK3 H;  1IYY A;  5EVH A;  3EN1 B;  3N54 B;  1IQ8 A;  3UJM A;  1CYV A;  1GY7 A;  1IQY A;  3BND A;  3F7S A;  4HM6 B;  1MWU A;  1OGZ A;  1W5Z A;  5STD A;  5AYR B;  1IT8 A;  1TJD A;  1V57 A;  2RNT A;  2W04 A;  1I2F A;  1RTU A;  2Y74 A;  2B1X B;  3CCV 3;  5D83 A;  2Z77 A;  2XSO B;  3AMO B;  3KSE D;  4CPK A;  4EBG A;  3UL6 A;  1UGI A;  5LC7 A;  1WMP A;  2XFS A;  1N9J A;  3SLU A;  2WGO A;  1BRG A;  1SIH A;  3G71 3;  3EN8 A;  3G0K A;  3LZA A;  3S29 A;  2F56 A;  3Q90 A;  2I9W A;  5G2G A;  2CHC A;  3QRD A;  4RNZ A;  1RRH A;  2M7O A;  2O9U X;  1RJO A;  3IMA B;  4WHA A;  1JKG A;  1WQL B;  1VZZ A;  1MWR A;  2UUG C;  4KFF A;  1PY3 A;  1CEW I;  2XRX B;  2CKF B;  3AGO A;  3KZT A;  3DGM A;  4LSO A;  1AR0 A;  3OX9 A;  3SX1 A;  3URP A;  1S72 3;  2LQV A;  1TRQ A;  1Y4K A;  3JUO A;  3MG1 A;  5JPP A;  1TTO A;  1TU5 A;  4U13 A;  3EQQ B;  2Z7A A;  2CWT A;  3N8B A;  4XBY A;  5G1K A;  3V92 A;  1N8Q A;  3T8U A;  2ML6 A;  1BSC A;  1JZD A;  1YIT 3;  4KFE A;  1KQS 2;  1KWI A;  3STD A;  2MC8 A;  3ECF A;  1W6G A;  5IG0 A;  3EBY A;  1VQO 3;  1MOL A;  1BSA A;  1STD A;  1RKY A;  3SED A;  2PNC A;  1HYF A;  3DY5 A;  4XDW A;  1Z1S A;  4XM4 A;  1BNI A;  1G96 A;  3WHO A;  1IVV A;  2P0M A;  2RFR A;  4L8O A;  4HM3 B;  5M19 A;  2W9P A;  1TUH A;  5AYS C;  4H3U A;  1YI2 3;  5HOH A;  1U8C B;  2QEX 3;  2D42 A;  1G02 A;  4BU4 A;  4RNY A;  4MEI A;  3ZG5 A;  1VQK 3;  1AY7 A;  1Q86 4;  2P38 A;  5CF1 A;  3EBT A;  3DUK A;  2CFD A;  3KN4 A;  3L0R A;  1JJ2 2;  5DRV A;  1CYU A;  1VQN 3;  1BRJ A;  1QAL A;  1HU9 A;  1ZGX A;  5CLK A;  5M1A A;  1O7P B;  1YGW A;  1FUW A;  3NBJ A;  3WA2 X;  4AEQ A;  2CFK A;  2OOV C;  1YVS A;  1Q40 B;  3PS8 A;  1NWW A;  4CJN A;  2W56 B;  1IV9 A;  1RRL A;  3LXU X;  2F86 B;  1AVK A;  3HZP A;  1E3V A;  2ZA4 A;  3B4P A;  4FCM A;  5ELJ A;  2BIR A;  2KF5 A;  1BVI A;  5EQL A;  2GEX A;  1I2G A;  3WR2 A;  2GEY A;  2F98 A;  1RGH A;  4RNT A;  3FF0 A;  1FUT A;  3CCM 3;  3K9M C;  3VGN A;  3CCU 3;  1K41 A;  5I97 A;  3EC9 A;  2KF6 A;  1LXE A;  1RN4 A;  3NV0 A;  1OHS A;  3OV4 A;  3D9R A;  4GB5 A;  4TX4 A;  4IIA A;  5DRE A;  4BTY A;  1VQL 3;  2F4Y A;  3CC4 3;  2OOV A;  5IER A;  3D5G A;  2HML B;  3FH1 A;  4HM2 B;  3ZFZ A;  2W0Q A;  1OF5 B;  1RGF A;  3CNX A;  4HYZ A;  3CCJ 3;  3TDG A;  3JVC A;  2BNG A;  4GL6 A;  1ROV A;  1W6C A;  3HII A;  3LTD A;  3V98 A;  1VQ4 3;  5KP4 A;  3UB1 A;  3E99 A;  2BO9 B;  2YFJ B;  3J7Y d;  2JDI H;  2FXT A;  1E3R A;  1OHP A;  5IG5 A;  1IDP A;  1JBR A;  3X3Y A;  1GOY A;  2SAR A;  2R4I A;  1QMA A;  3NXJ A;  3G4S 3;  2O3O A;  3SOY A;  1US1 A;  1LVN A;  2XFT A;  5CK6 A;  1EQK A;  1ROA A;  1Q42 A;  4FMA A;  4EW5 A;  1ULJ B;  4KVH A;  1T5Y A;  2E2T A;  3G16 A;  3GZB A;  3LOY A;  4ILF A;  4J9A A;  4NRE A;  4QWT A;  4BTX A;  1NJI 4;  1I8V A;  1OPY A;  1LQG C;  3JUM A;  3CPO A;  4N6O B;  1J2B A;  1R4C A;  1BRI A;  1UW1 A;  3BLZ A;  4EV5 A;  5IW9 A;  2IMJ A;  2ZL8 A;  1BSB A;  4NPB A;  1ISK A;  1C54 A;  1B2U A;  3AHS A;  4AKY A;  1CH0 A;  1F8N A;  4BL3 A;  3A5E A;  4N6V 0;  2CW9 A;  5JPU A;  1M1K 4;  1O7H B;  3NHX A;  1K28 A;  1D6U A;  3D4A A;  3AMO A;  4X2O A;  1YJ9 3;  2KF4 A;  2BMR B;  1BAO A;  3F9S A;  3GSP A;  1BSE A;  2CH9 A;  2H0H A;  2UGI A;  3AHW A;  1BUJ A;  1W01 A;  1RCK A;  3EF8 A;  2RGQ A;  3WOD G;  1RSN A;  4EC6 A;  1YVB I;  3FG3 A;  2KCD A;  1HKX A;  1O7N B;  2F5M A;  3BU4 A;  3S67 A;  3KII A;  4OUQ A;  1I70 A;  2B24 B;  2HMN B;  2GU1 A;  4O3V A;  3BIR A;  3LYG A;  4Q53 A;  2OQE A;  2GU3 A;  1M9G A;  1V58 A;  2SBL A;  2CG1 A;  2IA7 A;  4WYK A;  2FGT A;  2WOH A;  1ASK A;  1PYL A;  2AAD A;  2LYX A;  1W6Y A;  3HI7 A;  1FYS A;  2KXG A;  4N3V A;  3X42 A;  3JUN A;  1WMN A;  6RNT A;  5IEN A;  1EA2 A;  2C10 A;  4R9K A;  1RDS A;  1V74 A;  1TRP A;  5BVB A;  3RGA A;  5IG4 A;  1DMN A;  1M90 4;  3D79 A;  4CDL A;  1I0X A;  1NU3 A;  2INX A;  2ZDJ A;  4LGQ A;  3V99 A;  1PU4 A;  1NDO B;  1JKG B;  3NBR A;  3OWY A;  5BU4 A;  1RNT A;  1SJW A;  3RDE A;  1B2Z A;  3U1W A;  5LC6 A;  4G1M B;  4N6U A;  3LT9 A;  3ROB A;  4K90 B;  4R80 A;  5AEU B;  1W2Z A;  3T0U A;  1UUG B;  3PXM A;  2HMK B;  1B27 A;  1LOW A;  3FF2 A;  2E2U A;  4K1U A;  1VQ9 3;  2YFL B;  3BNB A;  4HM1 B;  5IG3 A;  1D6Z A;  1B2S A;  1SAR A;  3CXC 2;  1B2X A;  3NBB A;  4DKI A;  3DMC A;  1FGO A;  3MPH A;  3OW2 2;  1K9M 4;  3CC7 3;  1BGS A;  1Q7H A;  4KZ1 A;  1FGM A;  3LTB A;  7RNT A;  4ZM8 A;  2BMQ B;  1QVG 2;  1W7C A;  2BT3 A;  3KKG A;  4H61 A;  3G6E 3;  1IVU A;  1KSI A;  5G1L A;  4L7K A;  2XR8 B;  1Q81 4;  5IEP A;  3VSY A;  3NQZ A;  1JB2 A;  1FGQ A;  1QAK A;  1IQX A;  1RGA A;  2XF3 A;  3HK4 A;  3KFQ C;  4KFD A;  5AIH A;  1BIR A;  3GWR A;  1ZS7 A;  1GMR A;  1RMS A;  3Q1C A;  1A90 A;  5FGO A;  3CCL 3;  3LTA A;  1MGW A;  1GSP A;  1QAF A;  2Y73 A;  4JRF A;  2P09 A;  1I2E A;  1C7H A;  3HX8 A;  1DMM A;  2YX9 A;  2A15 A;  2F99 A;  3MG3 A;  1Q9E A;  1A2V A;  3FG4 A;  2KRT A;  3F8H A;  3LML A;  2CWU A;  1JRQ A;  1BRH A;  4WWU C;  4FMD A;  4R1K A;  3CCR 3;  2K0M A;  4IT7 A;  3EJV A;  2JQ5 A;  1OF5 A;  2CFW A;  3NM7 A;  1B3S A;  3CC2 3;  1N9E A;  4OVM A;  3BNE A;  4STD A;  3MKI A;  1VQ6 3;  5M18 A;  3DXO A;  3CME 3;  2W6J H;  3GZR A;  1JNQ A;  3I0Y A;  1TP6 A;  4HKV B;  4I4K A;  1OUN A;  1KC8 4;  1PFP A;  3HIG A;  4K61 A;  4WYK B;  1K73 4;  3GAX A;  5CXO A;  3ZG0 A;  3MHE A;  4HZ9 B;  1BNF A;  4HZB B;  3HOH A;  3PCR A;  3NV0 B;  3JUQ A;  4WP5 A;  1ZO2 A;  3CMA 3;  1UCK A;  1CQS A;  1B20 A;  4KT3 B;  4EYC A;  1HZ1 A;  2D1W A;  1LOV A;  1OGX A;  1W2B 2;  1UDI I;  1FA3 A;  3WDG B;  5GSP A;  3I55 3;  2QGU A;  1N5H A;  3FSD A;  1WNH A;  5HGR A;  3DM8 A;  2AAE A;  1JZO A;  3U97 A;  5TGN A;  3NM2 A;  3WMD A;  3CD6 3;  1IV7 A;  3SVA A;  1DYU A;  1DMQ A;  1DVC A;  1JB4 A;  1X1Y A;  4MMZ B;  2XEP A;  4MJD A;  7GSP A;  5FW5 A;  1W02 A;  2BHM A;  5JBS A;  1RNB A;  1WMO A;  1LOX A;  1R4Y A;  3B8L A;  3MWZ A;  1FGR A;  1N5P A;  2HOH A;  3NX0 A;  1OAC A;  3AGN A;  2W56 A;  1O7M B;  4MMY B;  3DGY A;  1GOU A;  4PEJ A;  1VQ5 3;  2IY2 A;  3IJE B;  4HM8 B;  1YGE A;  2RBI A;  1I3F A;  2CC3 A;  3DGO A;  3K0Z A;  3RGR A;  2OTJ 3;  2OQE C;  2E2V A;  3G8Z A;  2H0G A;  1OCV A;  3K7C A;  3OXA A;  1VQM 3;  1NNV A;  2Z6B A;  4NHF A;  4K1V A;  1BNE A;  1MWS A;  4EXR A;  1AV4 A;  3BB9 A;  2C11 A;  4R4K A;  1B21 A;  4HOH A;  4N6M A;  1IVX A;  5AII A;  1SII A;  4HM7 B;  2XGL A;  7STD A;  1IVW A;  3S28 A;  5IEO A;  3MYT A;  3I56 3;  1JBS A;  3KCH A;  1MWT A;  3F40 A;  5AIF A;  3OWS A;  1WTH A;  1GMP A;  2YFI B;  1YJN 3;  1VQ7 3;  3EB8 A;  1Q40 A;  3PCS A;  1L5G B;  3BNC A;  9RNT A;  3CCS 3;  1YHQ 3;  2OTL 3;  1X1X A;  5RNT A;  2UX0 A;  1K8A 4;  2RSX A;  1FW7 A;  2W03 A;  2STD A;  3S5C A;  4JF8 A;  3MSO A;  1JN5 B;  1ZX2 A;  2CG0 A;  5KP1 A;  4LEH A;  2WO0 A;  4FMC A;  5D82 A;  2MF7 A;  3T8N A;  4CCV A;  1NB3 I;  1OHO A;  4IPB A;  2GXF A;  1Q82 4;  1YIJ 3;  3ER7 A;  3GZY B;  5A0O B;  5BIR A;  1QJG A;  2CWV A;  1I0V A;  1YNV X;  4GHO A;  2W9Q A;  2HMJ B;  3B7C A;  3VF1 A;  4XB5 A;  5AI1 A;  2QA4 3;  2K3D A;  3N9H A;  3NQY A;  2CFL A;  2WGQ A;  1BRN L;  1RN7 A;  1RGK A;  1EKM A;  1UUV B;  1X1U A;  2CX1 A;  3Q2P A;  3CNM A;  4J5K A;  3UNL A;  1QVF 2;  1BUQ A;  4BIR A;  2H0I A;  4LZI A;  1UGH I;  4FMB A;  3MG2 A;  1BNR A;  2BMO B;  1LOY A;  1A67 A;  3RNT A;  3CCQ 3;  4XDV A;  3PGB A;  3K5T A;  3H51 A;  1UCJ A;  4BL2 A;  3DGL A;  2PZV A;  1JB5 A;  1LNI A;  1GY5 A;  4HVN A;  3D5I A;  4N6L A;  3F14 A;  3LT8 A;  1GOV A;  4HAA A;  1YJW 3;  1UI8 A;  6GSP A;  3GRD A;  4J8T A;  1B2M A;  5KP3 A;  3K63 A;  3FG1 A;  4EV2 A;  1JN5 A;  2ML5 A;  2XSH B;  2HMM B;  4FCZ A;  3O8Y A;  1DET A;  3PZW A;  4WFO A;  1FGT A;  1A2P A;  4XBX A;  1RN1 A;  1JV2 B;  1O7W B;  5AEW B;  1BNG A;  2IUK A;  4O02 B;  2HMO B;  1IU7 A;  1S5A A;  3M8C A;  4XBT A;  2J8X B;  3FKA A;  3KSP A;  2Z76 A;  1N8R 4;  2OCT A;  1STF I;  1GD4 A;  4ORL A;  4FR9 A;  1RGC A;  2L4V A;  4N6N B;  1BU4 A;  2RCD A;  1T2I A;  5CF2 A;  1I3I A;  1T2H A;  1VQQ A;  1A2K A;  1TFO A;  1JBT A;  2IYJ A;  1GD3 A;  1M1X B;  1VQP 3;  1EG9 B;  4X2H A;  2IUJ A;  3S27 A;  4AKZ A;  2OWP A;  1RGL A;  2WOF A;  4HM5 B;  2F5W A;  4O8S A;  4RBN A;  1UCL A;  5BXQ A;  1O7G B;  1UI7 A;  1RGG A;  3DGN A;  3EHC A;  4HM0 B;  4LYL B;  2L1S A;  1Q7Y 4;  3JUP A;  2R41 A;  3FZW A;  1W4N A;  8CHO A;  5AIG A;  1GYB A;  2GSP A;  3GZX B;  3UL5 A;  5ELU A;  1BRS A;  4HM4 B;  1UUW B;  4BTW A;  1E97 A;  2P0X A;  1GY6 A;  4I5Q A;  1LRA A;  1RCL A;  4L8P A;  1VQ8 3;  4J5G A;  5D81 A;  2W2C A;  3EX9 A;  3FGY A;  1NO3 A;  1G0T A;  1IK3 A;  1AVL A;  1ULI B;  4HJL B;  1RLS A;  3WA3 A;  3LTC A;  1GMQ A;  2XH9 A;  3WOF B;  1BNJ A;  4O2H A;  1FZU A;  3SYU A;  2XGN A;  2C4B A;  2P05 A;  3WOE B;  3A76 A;  3D3L A;  3LH4 A;  3CPW 2;  1DE3 A;  4N6T A;  1LNH A;  3OWU A;  3X41 A;  3NUV A;  2KF3 A;  4R9L A;  3X3X A;  5IF6 A;  1U5O A;  3X40 A;  1RHL A;  1NB5 I;  3PYJ A;  3CU3 A;  1TIJ A;  3Q3F A;  1IT7 A;  4FCJ A;  2GBX B;  6STD A;  3DZL A;  8RNT A;  2BU4 A;  1SQW A;  4RZM A;  1BNS A;  1KD1 4;  2CFG A;  1BRK A;  3SOA A;  2CX0 A;  3KE7 A;  3F7X A;  4OK0 A;  1UCI A;  3ALA A;  1FUS A; 
#chains in the Genus database with same CATH homology
 1MNL A;  1D6Y A;  5EEO A;  1GS3 A;  2Q07 A;  3CCE 3;  1DVD A;  2V1L A;  3IPT A;  3X3Z A;  2QIY A;  3FCS B;  3SXX A;  1TFK A;  2CIU A;  3EE1 A;  2FNQ A;  3H3H A;  2GBW B;  3FLJ A;  2K54 A;  4HBR A;  1OH0 A;  1SPU A;  3B4O A;  4MMX B;  4LMI A;  1W00 A;  3F8X A;  3QK9 A;  2CK3 H;  5EVH A;  3EN1 B;  3N54 B;  1IQ8 A;  3UJM A;  1CYV A;  1GY7 A;  1IQY A;  3BND A;  3F7S A;  4HM6 B;  1OGZ A;  1W5Z A;  5STD A;  1IT8 A;  2W04 A;  2Y74 A;  2B1X B;  3CCV 3;  5D83 A;  2Z77 A;  2XSO B;  3AMO B;  3KSE D;  4EBG A;  3UL6 A;  5LC7 A;  1WMP A;  2XFS A;  1N9J A;  3SLU A;  2WGO A;  1SIH A;  3G71 3;  3EN8 A;  3G0K A;  3LZA A;  3S29 A;  3Q90 A;  5G2G A;  2I9W A;  2CHC A;  3QRD A;  4RNZ A;  1RRH A;  2M7O A;  2O9U X;  1RJO A;  3IMA B;  4WHA A;  1JKG A;  1WQL B;  1VZZ A;  4KFF A;  1CEW I;  2XRX B;  2CKF B;  3KZT A;  3DGM A;  4LSO A;  1AR0 A;  3OX9 A;  3SX1 A;  1S72 3;  2LQV A;  1Y4K A;  3JUO A;  3MG1 A;  5JPP A;  1TU5 A;  4U13 A;  3EQQ B;  2Z7A A;  2CWT A;  3N8B A;  4XBY A;  3V92 A;  1N8Q A;  3T8U A;  2ML6 A;  1YIT 3;  4KFE A;  1KQS 2;  1KWI A;  3STD A;  2MC8 A;  3ECF A;  1W6G A;  5IG0 A;  3EBY A;  1VQO 3;  1MOL A;  1STD A;  1RKY A;  3SED A;  2PNC A;  3DY5 A;  4XDW A;  1Z1S A;  4XM4 A;  1G96 A;  1IVV A;  2P0M A;  2RFR A;  4L8O A;  4HM3 B;  2W9P A;  1TUH A;  5AYS C;  4H3U A;  1YI2 3;  1U8C B;  2QEX 3;  2D42 A;  4RNY A;  4MEI A;  1VQK 3;  1Q86 4;  2P38 A;  5CF1 A;  3EBT A;  3DUK A;  2CFD A;  3KN4 A;  3L0R A;  1JJ2 2;  5DRV A;  1CYU A;  1VQN 3;  1QAL A;  1HU9 A;  1FUW A;  5CLK A;  1O7P B;  3NBJ A;  3WA2 X;  4AEQ A;  2CFK A;  2OOV C;  3PS8 A;  1Q40 B;  1NWW A;  2W56 B;  1IV9 A;  1RRL A;  3LXU X;  2F86 B;  1AVK A;  3HZP A;  1E3V A;  4FCM A;  3B4P A;  5ELJ A;  5EQL A;  2GEX A;  2GEY A;  2F98 A;  3FF0 A;  3CCM 3;  3K9M C;  3VGN A;  3CCU 3;  1K41 A;  5I97 A;  3EC9 A;  1LXE A;  3NV0 A;  1OHS A;  3OV4 A;  3D9R A;  4GB5 A;  4TX4 A;  4IIA A;  5DRE A;  4BTY A;  1VQL 3;  3CC4 3;  5IER A;  3FH1 A;  2HML B;  4HM2 B;  2W0Q A;  1OF5 B;  3CNX A;  4HYZ A;  3CCJ 3;  3TDG A;  3JVC A;  2BNG A;  4GL6 A;  1ROV A;  1W6C A;  3HII A;  3LTD A;  3V98 A;  1VQ4 3;  5KP4 A;  3UB1 A;  3E99 A;  2BO9 B;  2YFJ B;  3J7Y d;  2JDI H;  2FXT A;  1E3R A;  1OHP A;  5IG5 A;  1IDP A;  3X3Y A;  2R4I A;  1QMA A;  3NXJ A;  3G4S 3;  2O3O A;  3SOY A;  1US1 A;  1LVN A;  2XFT A;  5CK6 A;  1EQK A;  1ROA A;  1Q42 A;  4FMA A;  1ULJ B;  4KVH A;  1T5Y A;  2E2T A;  3G16 A;  3GZB A;  3LOY A;  4J9A A;  4NRE A;  4QWT A;  1NJI 4;  4BTX A;  1OPY A;  3JUM A;  3CPO A;  4N6O B;  1J2B A;  1R4C A;  1UW1 A;  3BLZ A;  4EV5 A;  1BUQ A;  5IW9 A;  2IMJ A;  2ZL8 A;  1ISK A;  4AKY A;  1F8N A;  4N6V 0;  2CW9 A;  5JPU A;  1M1K 4;  1O7H B;  3NHX A;  1K28 A;  1D6U A;  3AMO A;  4X2O A;  1YJ9 3;  2BMR B;  3F9S A;  2CH9 A;  1W01 A;  3EF8 A;  2RGQ A;  3WOD G;  4EC6 A;  1YVB I;  3FG3 A;  2KCD A;  1HKX A;  1O7N B;  3S67 A;  3KII A;  4OUQ A;  2B24 B;  2HMN B;  2GU1 A;  4O3V A;  3LYG A;  4Q53 A;  2OQE A;  2GU3 A;  1M9G A;  2SBL A;  2CG1 A;  2IA7 A;  4WYK A;  2FGT A;  2WOH A;  1ASK A;  2LYX A;  1W6Y A;  3HI7 A;  2KXG A;  4N3V A;  3X42 A;  3JUN A;  1WMN A;  5IEN A;  1EA2 A;  2C10 A;  4R9K A;  1V74 A;  5BVB A;  3RGA A;  5IG4 A;  1DMN A;  1M90 4;  4CDL A;  2ZDJ A;  1NU3 A;  2INX A;  4LGQ A;  1PU4 A;  3V99 A;  1NDO B;  1JKG B;  3NBR A;  3OWY A;  1SJW A;  3RDE A;  3U1W A;  5LC6 A;  4G1M B;  4N6U A;  3LT9 A;  3ROB A;  4K90 B;  4R80 A;  5AEU B;  1W2Z A;  3T0U A;  3PXM A;  2HMK B;  3FF2 A;  2E2U A;  4K1U A;  1VQ9 3;  2YFL B;  3BNB A;  4HM1 B;  5IG3 A;  1D6Z A;  3CXC 2;  3NBB A;  3OW2 2;  3DMC A;  1FGO A;  3MPH A;  1K9M 4;  3CC7 3;  4KZ1 A;  1FGM A;  3LTB A;  4ZM8 A;  2BMQ B;  1QVG 2;  1W7C A;  2BT3 A;  3KKG A;  4H61 A;  3G6E 3;  1IVU A;  1KSI A;  4L7K A;  2XR8 B;  1Q81 4;  5IEP A;  3VSY A;  3NQZ A;  1JB2 A;  1FGQ A;  1QAK A;  1IQX A;  2XF3 A;  3HK4 A;  4KFD A;  3KFQ C;  5AIH A;  5AYR B;  3GWR A;  3Q1C A;  1A90 A;  5FGO A;  3CCL 3;  3LTA A;  1QAF A;  2Y73 A;  4JRF A;  2P09 A;  1C7H A;  3HX8 A;  1DMM A;  2YX9 A;  2A15 A;  2F99 A;  3MG3 A;  1A2V A;  3FG4 A;  2KRT A;  3F8H A;  3LML A;  2CWU A;  1JRQ A;  4WWU C;  3CCR 3;  4FMD A;  4R1K A;  2K0M A;  4IT7 A;  3EJV A;  2JQ5 A;  1OF5 A;  2CFW A;  3NM7 A;  3CC2 3;  1N9E A;  4OVM A;  3BNE A;  4STD A;  3MKI A;  1VQ6 3;  3DXO A;  3CME 3;  2W6J H;  3GZR A;  1JNQ A;  3I0Y A;  1TP6 A;  4HKV B;  4I4K A;  1OUN A;  1KC8 4;  1PFP A;  3HIG A;  4K61 A;  4WYK B;  1K73 4;  3GAX A;  5CXO A;  3MHE A;  4HZ9 B;  4HZB B;  3PCR A;  3NV0 B;  3JUQ A;  4WP5 A;  1ZO2 A;  3CMA 3;  1CQS A;  4EYC A;  1OGX A;  2D1W A;  1W2B 2;  1FA3 A;  3WDG B;  3I55 3;  2QGU A;  1N5H A;  3FSD A;  1WNH A;  5HGR A;  3DM8 A;  3U97 A;  5TGN A;  3NM2 A;  3WMD A;  3CD6 3;  1IV7 A;  3SVA A;  1DYU A;  1DMQ A;  1DVC A;  1JB4 A;  4MMZ B;  2XEP A;  4MJD A;  5FW5 A;  1W02 A;  2BHM A;  5JBS A;  1WMO A;  1LOX A;  3B8L A;  3MWZ A;  3NX0 A;  1N5P A;  1FGR A;  1OAC A;  4MMY B;  2W56 A;  1O7M B;  4PEJ A;  1VQ5 3;  3IJE B;  4HM8 B;  1YGE A;  2CC3 A;  3DGO A;  3K0Z A;  3RGR A;  2OTJ 3;  2OQE C;  2E2V A;  3G8Z A;  1OCV A;  3K7C A;  3OXA A;  1VQM 3;  2Z6B A;  4NHF A;  4K1V A;  4EXR A;  1AV4 A;  3BB9 A;  2C11 A;  4R4K A;  4N6M A;  1IVX A;  5AII A;  1SII A;  4HM7 B;  2XGL A;  7STD A;  1IVW A;  3S28 A;  5IEO A;  3MYT A;  3I56 3;  5AIF A;  3F40 A;  3OWS A;  1WTH A;  2YFI B;  1YJN 3;  1VQ7 3;  3EB8 A;  1Q40 A;  3PCS A;  1L5G B;  3BNC A;  1YHQ 3;  3CCS 3;  2OTL 3;  2UX0 A;  1K8A 4;  2RSX A;  2W03 A;  2STD A;  3S5C A;  4JF8 A;  3MSO A;  1JN5 B;  1ZX2 A;  2CG0 A;  5KP1 A;  4LEH A;  2WO0 A;  4FMC A;  5D82 A;  2MF7 A;  3T8N A;  4CCV A;  1NB3 I;  1OHO A;  4IPB A;  2GXF A;  1Q82 4;  1YIJ 3;  3ER7 A;  3GZY B;  5A0O B;  1QJG A;  2CWV A;  2W9Q A;  2HMJ B;  3B7C A;  3VF1 A;  4XB5 A;  5AI1 A;  2QA4 3;  3N9H A;  3NQY A;  2CFL A;  2WGQ A;  1RN7 A;  1EKM A;  1UUV B;  3Q2P A;  3CNM A;  3UNL A;  1QVF 2;  4LZI A;  4FMB A;  3MG2 A;  2BMO B;  1A67 A;  3CCQ 3;  4XDV A;  3PGB A;  3K5T A;  3H51 A;  3DGL A;  2PZV A;  1JB5 A;  4HVN A;  1GY5 A;  4N6L A;  3F14 A;  3LT8 A;  1YJW 3;  1UI8 A;  3GRD A;  4J8T A;  5KP3 A;  3K63 A;  3FG1 A;  4EV2 A;  1JN5 A;  2ML5 A;  2XSH B;  2HMM B;  4FCZ A;  3O8Y A;  3PZW A;  4WFO A;  1FGT A;  4XBX A;  1JV2 B;  1O7W B;  5AEW B;  2IUK A;  4O02 B;  2HMO B;  1IU7 A;  1S5A A;  3M8C A;  4XBT A;  3FKA A;  3KSP A;  2Z76 A;  1N8R 4;  2OCT A;  1STF I;  1GD4 A;  4ORL A;  4FR9 A;  2L4V A;  4N6N B;  2RCD A;  5CF2 A;  1A2K A;  1TFO A;  1GD3 A;  1M1X B;  1VQP 3;  1EG9 B;  4X2H A;  2IUJ A;  3S27 A;  4AKZ A;  2OWP A;  2WOF A;  4HM5 B;  4O8S A;  4RBN A;  5BXQ A;  1O7G B;  1UI7 A;  3DGN A;  3EHC A;  1Q7Y 4;  4HM0 B;  3JUP A;  3FZW A;  8CHO A;  1W4N A;  5AIG A;  1GYB A;  3GZX B;  3UL5 A;  5ELU A;  4HM4 B;  1UUW B;  4BTW A;  1E97 A;  2P0X A;  1GY6 A;  4L8P A;  1VQ8 3;  5D81 A;  2W2C A;  3EX9 A;  3FGY A;  1NO3 A;  1IK3 A;  1AVL A;  1ULI B;  4HJL B;  3WA3 A;  3LTC A;  2XH9 A;  3WOF B;  4O2H A;  2XGN A;  2P05 A;  3WOE B;  3A76 A;  3D3L A;  3LH4 A;  3CPW 2;  4N6T A;  1LNH A;  3OWU A;  3X41 A;  3NUV A;  4R9L A;  3X3X A;  5IF6 A;  1U5O A;  3X40 A;  1NB5 I;  3PYJ A;  3CU3 A;  1TIJ A;  4FCJ A;  1IT7 A;  6STD A;  2GBX B;  3DZL A;  1SQW A;  4RZM A;  1KD1 4;  2CFG A;  3SOA A;  3KE7 A;  3F7X A;  4OK0 A;  3ALA A;  2OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...