1OPYA

Ksi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA5-3-KETOSTEROID IOSMERASE
molecule tags Isomerase
source organism Pseudomonas putida
publication title High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue.
pubmed doi rcsb
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1opyA00
3MYTA 1ISKA 1E3RA 4LMIA 4XBTA 5CLKA 2CKFB 3ER7A 1ZO2A 5AIHA 3CNMA 3LYGA 5IG0A 1Z1SA 2GEYA 3EF8A 3HX8A 4HM2B 4LGQA 3JUQA 5IG3A 5BVBA 3K7CA 1O7NB 1JB2A 3B4OA 3D9RA 5CK6A 4CDLA 3HK4A 4J9AA 3NHXA 3DUKA 1W02A 3OXAA 4X2HA 3UJMA 2F98A 3ROBA 8CHOA 1OF5B 2GEXA 2RFRA 3FF2A 3F40A 3Q90A 1OHPA 3EN8A 3IPTA 3OWUA 4OVMA 4ORLA 2B1XB 4STDA 4WWUC 5AEUB 5IG4A 4HM4B 3JUNA 2GBWB 2BMOB 1UUWB 2Z76A 4MJDA 3MG2A 2HMJB 3EN1B 4PEJA 1NU3A 5IG5A 4XBYA 4XM4A 3KZTA 5D82A 5EVHA 3S5CA 1W01A 4L8OA 3NV0A 3BLZA 2RGQA 4HM1B 3DM8A 5IF6A 3MG3A 3JUPA 3K0ZA 1NWWA 2CHCA 3BB9A 3G16A 3SOAA 1JN5B 3EBYA 4RZMA 3SOYA 1S5AA 3CU3A 4HJLB 4R9LA 3EQQB 1ULIB 4I4KA 4KVHA 3ECFA 3FZWA 1QJGA 3UNLA 2JQ5A 1DMMA 3FF0A 1Q40B 5AIIA 5IEPA 1AR0A 5JPUA 1WQLB 5KP4A 3G8ZA 1TUHA 1IDPA 3MG1A 4XBXA 3NXJA 2F86B 3GRDA 4HM6B 5IERA 3F8HA 1A2KA 2IMJA 5D81A 3FLJA 4WYKA 5AI1A 1W6YA 1SJWA 1JN5A 1O7HB 3M8CA 3F9SA 4R1KA 4XB5A 4FCMA 2RCDA 5HGRA 1OGZA 1STDA 3I0YA 3MHEA 1K41A 1TP6A 2XR8B 2YFJB 2GXFA 3EJVA 4X2OA 5DRVA 5DREA 5TGNA 5BXQA 2XSOB 5KP1A 3MSOA 5STDA 4XDWA 1EG9B 1Q42A 1C7HA 4XDVA 3WMDA 5AEWB 3FSDA 4HM3B 4K1UA 2XRXB 1JKGB 2INXA 4HKVB 4HZ9B 4IIAA 1OPYA 2QGUA 3EX9A 3OWSA 3DXOA 4R9KA 1JKGA 2F99A 4FCJA 4HVNA 3STDA 1VZZA 3H3HA 3G0KA 4H3UA 6STDA 1QMAA 5AIGA 2HMLB 1OH0A 2HMKB 2YFLB 4HM5B 3JUMA 5JPPA 2XSHB 5FW5A 5CF2A 1BUQA 3GZXB 2HMNB 7STDA 1ASKA 3CPOA 2BMQB 1O7WB 1OF5A 3CNXA 4L8PA 5CF1A 3B7CA 3EBTA 3HZPA 3GZRA 3H51A 4OUQA 3VSYA 2HMOB 3B8LA 4HM8B 3DMCA 3OV4A 3MKIA 1HKXA 3KE7A 3NUVA 5G2GA 1OGXA 2I9WA 2B24B 5IENA 3KSPA 5D83A 4Q53A 2UX0A 4LEHA 3T8NA 3EC9A 4U13A 3OWYA 2BNGA 3A76A 3NM2A 3NV0B 5AIFA 3JUOA 3RGAA 1GY6A 1JB4A 3GZYB 1GS3A 1GYBA 4HZBB 5CXOA 3EHCA 3NBRA 1E3VA 3GZBA 4HM0B 1NDOB 1OCVA 3T8UA 3F7SA 4WYKB 1W00A 3OX9A 4K1VA 1GY5A 1DMNA 3KKGA 2W2CA 4L7KA 1EA2A 2PZVA 3GWRA 1DMQA 5KP3A 1Q40A 1ZX2A 4N3VA 2K54A 1GY7A 3F8XA 3FH1A 3VGNA 4WP5A 2BMRB 1U5OA 3LZAA 1JB5A 2Z77A 2STDA 2Z7AA 2QIYA 1O7PB 2YFIB 3F14A 2OWPA 1O7MB 1O7GB 1OHOA 1CQSA 1UUVB 2GBXB 3FKAA 3RGRA 1OHSA 2A15A 1ULJB 2HMMB 3B4PA 3E99A 3DZLA 3SEDA 4HM7B 1OUNA 1E97A 3F7XA 2R4IA 3FGYA 5IEOA 4J8TA 4GB5A
chains in the Genus database with same CATH superfamily
2IA7A 1ISKA 1MGWA 1YJN3 1RHLA 2D42A 5AIHA 3CNMA 3LYGA 1TU5A 4CJNA 3SLUA 3CCU3 3GAXA 1B27A 2IYJA 1O7NB 1I8VA 3PGBA 1FA3A 3OXAA 3DGNA 2CX0A 2QEX3 4ILFA 1K28A 1OHPA 3IPTA 3OWUA 1KSIA 4STDA 4WWUC 5IG4A 2KF4A 1EKMA 4HM4B 3D5IA 1KQS2 3X3YA 2D1WA 4FCZA 1STFI 3DGLA 4MJDA 3LMLA 1JBRA 1IQYA 2OOVC 1VQL3 4XM4A 5M1AA 3SYUA 5AYRB 2K0MA 4NREA 3SXXA 2BHMA 4L8OA 3NV0A 3BLZA 4HM1B 3DM8A 3LTDA 1L5GB 2M7OA 3MG3A 3JUPA 3G16A 1GMQA 3BNEA 3O8YA 3CU3A 4EYCA 1AQZA 1DETA 1T3BA 4KVHA 3CC23 1RSNA 1YGEA 1A90A 3ZG5A 1RN4A 1N8R4 3X3XA 5IEPA 2JDIH 1AR0A 1WQLB 1QAFA 1DE3A 1I2EA 4XBXA 3U1WA 3BNDA 1B20A 4EV5A 1D6UA 3F8HA 5D81A 2ZHXB 4WYKA 9RNTA 3VF1A 2O3OA 3J7Yd 1WMNA 2CFWA 3CPW2 1B2SA 4QWTA 3WA3A 5DRVA 5HOHA 4X2OA 5BXQA 1AVKA 1CYUA 1MWSA 1W4NA 3FG4A 5STDA 4WFOA 1IT8A 2J8XB 3WMDA 5AEWB 2XRXB 1JKGB 1GMPA 4HKVB 1BUJA 2WGOA 1VQP3 1GD3A 2QGUA 2CH9A 1LQMB 3EX9A 3CXC2 4HYZA 2F99A 1YNVX 4MMXB 3FCSB 3H3HA 4H3UA 1RGLA 2C4BA 1MWUA 5AIGA 5BU4A 1N8QA 6STDA 2KF3A 1YIJ3 3K63A 2YFLB 3JUMA 2KXGA 3G4S3 1TFOA 5CF2A 3GZXB 1B2MA 2HMNB 4CCVA 4KFFA 1QVG2 1O7WB 3L0RA 2KAAA 2ML5A 4BTXA 3EBTA 4LYLB 1LNIA 4OUQA 2W0QA 3WOEB 2CWTA 2HMOB 1W5ZA 3DMCA 3KE7A 2F5MA 1UCLA 2ML6A 1OGXA 2Q07A 1YJW3 1JJ22 1N5HA 3KSPA 4J5KA 4U13A 1RN1A 4KT3B 3Q2PA 3NX0A 5JBSA 1JBSA 2H0GA 1BNJA 4HM0B 5EEOA 3T8UA 2OQEC 3F7SA 3RNTA 1GY5A 1EA2A 2BT3A 3CCM3 1DMQA 1I70A 1Q40A 1ZX2A 4ZM8A 1LQGC 3F8XA 3FH1A 1PYLA 1TFKA 1IVUA 4I5QA 4WHAA 2YFIB 4AKYA 1O7MB 3RGRA 1ROAA 1X1WA 1OHSA 3FG3A 4J5GA 1ULJB 1RJOA 1BNEA 1PFPA 2HMMB 2KF6A 1YVBI 2RBIA 3B4PA 3DY5A 3KIIA 3SEDA 2XH9A 1OUNA 1TIJA 1E97A 3F7XA 2R4IA 3G0KA 1UW1A 1IK3A 1U8CB 4IT7A 1G0TA 1YIT3 1UCJA 5A0OB 2ZL8A 4LSOA 1GMRA 4LMIA 3I553 3LTCA 2CKFB 1BNFA 3RDEA 1Z1SA 1M1K4 1I2GA 4HM2B 3EB8A 1GOVA 3CMA3 1JB2A 1LOVA 2L1SA 1B2ZA 1N5PA 8RNTA 3HK4A 5RNTA 1FUWA 3NHXA 8CHOA 3UJMA 1GOUA 1YHQ3 1OF5B 2AADA 2GEXA 2F56A 4KFEA 3CC73 1W6CA 4ORLA 5FGOA 2B1XB 2V1LA 5EQLA 2GBWB 3IJEB 3MG2A 3KSED 2OCTA 2HMJB 1IQ8A 1FGRA 1IT7A 3TDGA 1RCKA 1TRPA 1MOLA 1UI7A 1JZOA 3NBBA 5IEOA 1TRQA 1N9EA 1BRIA 3KZTA 5D82A 5EVHA 5GSPA 1W01A 3S5CA 1I3FA 1AVLA 2RGQA 5IF6A 2CWUA 2UGIA 1VQN3 3CCE3 2WOHA 1NWWA 3BB9A 3QRDA 3EBYA 4RZMA 3PXMA 5BIRA 4I4KA 1ULIB 4KFDA 3ZFZA 2W03A 1DMMA 2C10A 3FF0A 1MGRA 1Q40B 4GL6A 5AIIA 1BNSA 3V99A 3G8ZA 1RGCA 1TUHA 1IDPA 4HM6B 3GRDA 3CCR3 1VQM3 1A2KA 5LC7A 1UGIA 3FLJA 1IVVA 2CG0A 4NPBA 1JN5A 1O7HB 4XB5A 5ELUA 3S67A 3WDGB 5HGRA 1STDA 3I0YA 1K41A 1TP6A 2YFJB 4EBGA 2GXFA 1EQKA 5KP1A 1LOYA 1M9GA 5TGNA 3MSOA 1Q42A 3BNBA 1BGSA 3FSDA 4HM3B 4K1UA 1T5YA 3ZG0A 1Q7Y4 4IIAA 1BU4A 3LXUX 1FGQA 1NB5I 4BIRA 1KD14 3OWSA 1RNTA 1IU7A 1JKGA 3V92A 1PY3A 1VZZA 1R4CA 2CW9A 2W9PA 2HMKB 3UL5A 1GD4A 1BRKA 2XSHB 7RNTA 3UL6A 1ASKA 1RGGA 3D5GA 1VQ43 1OF5A 3NM7A 3CCJ3 1JZDA 3GZRA 2XFSA 1BNIA 1NB3I 1OACA 1BANA 2OQEA 4RBNA 4TX4A 1HU9A 4RNZA 1V58A 3CD63 1RGAA 3BU4A 2H0HA 3HIGA 2B24B 5IENA 1FW7A 5D83A 2UX0A 2CK3H 3NQZA 4LEHA 3EC9A 3CCV3 2P0XA 1JBTA 1D6ZA 3NM2A 1GY6A 2CFKA 2KF5A 3GZYB 1Q864 3GZBA 1NDOB 3X42A 1BRGA 2Y74A 1BSDA 1CH0A 1W00A 1QAKA 4AEQA 4GHOA 1Q7HA 4MMYB 4N3VA 3VGNA 1AY7A 1CEWI 2XF3A 4WP5A 1WTHA 1QVF2 3CCQ3 2E2VA 3U97A 2STDA 3SOYA 2OWPA 1UUVB 1BSCA 1CQSA 2WOFA 1IYYA 2MC8A 3QK9A 2A15A 3URPA 1R4YA 3E99A 3GSPA 3LH4A 4LZIA 3WOFB 2GU3A 1YI23 4HM7B 3FGYA 3D4AA 3JVCA 1G96A 4FMCA 1QALA 1I3IA 4FMAA 4J8TA 2F4YA 4GB5A 1N9JA 4XBTA 2RSXA 1BNGA 2O9UX 5CLKA 4N6TA 5IG0A 3EF8A 2GEYA 3HX8A 1UCIA 3HOHA 4LGQA 3JUQA 1US1A 5IG3A 5BVBA 2CFLA 3D9RA 3B4OA 5CK6A 1RKYA 1YVSA 1ZGXA 4EV2A 4J9AA 3WODG 4X2HA 2F98A 3ROBA 1JNQA 3Q90A 3K5TA 5AI1A 3EN8A 4FR9A 1VQ83 1M1XB 1LNHA 4O2HA 2IUJA 5I97A 4HAAA 1LOXA 1IVWA 4OK0A 1NJI4 1NU3A 3KFQC 5IG5A 3Q3FA 4XBYA 2ZA4A 1LXEA 3I563 4K61A 1VQ53 5M19A 1RGHA 1X1UA 1MWRA 2XGNA 2CHCA 2CWVA 1BRNL 3SOAA 2XGLA 1JN5B 2CFGA 4R9LA 3EQQB 1K734 1QJGA 2JQ5A 4IPBA 1V57A 3D3LA 5JPUA 4HBRA 3PCRA 1PU4A 2GSPA 1FGOA 2RNTA 3HI7A 2F86B 5IERA 1HYFA 3LTAA 2IMJA 4MMZB 5IW9A 1W6YA 3LT9A 1DVDA 1SJWA 1LRAA 3M8CA 3WHOA 1OGZA 1Q814 3SX1A 3MHEA 5G1LA 3EJVA 3AHWA 2R41A 1UDII 3PZWA 1VQ73 4XDWA 2P05A 4XDVA 1UI8A 3KN4A 1RTUA 2PNCA 4GSPA 5ELJA 1BRSA 3BIRA 3OW22 2INXA 3N54B 1OPYA 3BNCA 3DXOA 1BAOA 4R9KA 3CME3 4FCJA 4HVNA 3STDA 3S29A 1YGWA 2C11A 2HMLB 4HM5B 2CC3A 4BU4A 1B2XA 3EE1A 3DGOA 3AMOA 4BL3A 2BIRA 1I0XA 2BO9B 2CFDA 1DVCA 3CNXA 5LC6A 1VQQA 3IMAB 3HZPA 3CC43 2W04A 3B8LA 4HM8B 2H0IA 3OV4A 3V98A 1HKXA 3D79A 1X1YA 2MF7A 2W9QA 1YJ93 1CYVA 2FNQA 4R4KA 4Q53A 2OTL3 4FMBA 5AIFA 3RGAA 3JUOA 3DGMA 4JRFA 1JB4A 4HZBB 1GYBA 1BIRA 1Q9EA 4EW5A 1RNBA 1RDSA 2IUKA 1E3VA 1ZS7A 3NQYA 1RGFA 3S27A 3G6E3 1T2IA 1G02A 2UUGC 3K9MC 1DMNA 3KKGA 2W2CA 3MPHA 4O3VA 4K90B 2PZVA 3UB1A 1B21A 1GY7A 1K9M4 1M904 1W2B2 2BMRB 1U5OA 3X3ZA 1JB5A 3WA2X 2Z77A 1ROVA 1B2UA 2Z7AA 1O7PB 1BSEA 1FYSA 3PYJA 4HJLB 1O7GB 2GBXB 1X1XA 2YX9A 1MWTA 1EUIC 2WGQA 3DZLA 2CIUA 1FGMA 1GSPA 2CG1A 1FUSA 1D6YA 3MYTA 3DGYA 4BTWA 1IQXA 1E3RA 4BL2A 1A67A 6GSPA 1V74A 1RGEA 3ER7A 1ZO2A 2W56A 2P0MA 1Y4KA 3N8BA 2XEPA 3FG1A 3A5EA 2BU4A 2HOHA 5G1KA 2W56B 5M18A 3K7CA 4CDLA 4KZ1A 4N6NB 2ZDJA 2LYXA 3DUKA 1W02A 3Q1CA 3N9HA 1IV7A 2KCDA 2E2TA 2RFRA 3FF2A 3F40A 4OVMA 3CCS3 7GSPA 1TTOA 1UGHI 5AEUB 1WNHA 1FZUA 3JUNA 2BMOB 1UUWB 2Z76A 3LOYA 1JV2B 3AMOB 3EN1B 3AHSA 3PS8A 4PEJA 2OOVA 1J2BA 3T0UA 1I2FA 1S723 4EC6A 1RRHA 3SVAA 1RGKA 1F8NA 2IY2A 5AYSC 1SQWA 4N6UA 1DYUA 4H61A 3K0ZA 2P38A 4DKIA 1NNVA 2OTJ3 1S5AA 4O8SA 2CX1A 3NBJA 3ECFA 3FZWA 3UNLA 2Z6BA 4R80A 1VQ93 1UCKA 5KP4A 3X40A 1BRHA 1VQ63 3MG1A 4NHFA 3NXJA 3KCHA 1SARA 2SARA 1BRJA 4JF8A 1TJDA 1UUGB 4N6OB 3F9SA 4R1KA 1RN7A 4FCMA 3G713 2RCDA 1HZ1A 1LVNA 1LOWA 3CCL3 1A2PA 2XR8B 1RLSA 5DREA 1C54A 1IVXA 2XSOB 1BVIA 1EG9B 1C7HA 1BSBA 4RNTA 1W2ZA 2FXTA 4HZ9B 4EXRA 2KRTA 3AGNA 1RMSA 3HIIA 3LTBA 1VQK3 1BSAA 1K8A4 1QMAA 2QA43 2WO0A 1OH0A 1KC84 2P09A 2E2UA 1W7CA 4N6MA 4MEIA 5FW5A 5JPPA 1BUQA 1MNLA 1SIHA 7STDA 3CPOA 1BNRA 2BMQB 5CF1A 2L4VA 4L8PA 1Q824 3B7CA 3H51A 2F5WA 3S28A 1IV9A 3VSYA 3MKIA 3ALAA 3NUVA 5G2GA 4N6LA 1VQO3 2I9WA 3MWZA 1RCLA 1SPUA 1WMOA 2Y73A 3T8NA 4N6V0 4RNYA 3OWYA 2FGTA 1AV4A 2BNGA 3A76A 1SIIA 3NV0B 4BTYA 5CXOA 1GS3A 3LT8A 1T2HA 1NO3A 3EHCA 3NBRA 1I0VA 2XFTA 1A2VA 1OCVA 4WYKB 3X41A 3OX9A 4K1VA 1FGTA 3DH2A 2K3DA 3PCSA 4L7KA 3GWRA 5KP3A 4FMDA 3WR2A 1B3SA 2K54A 3AGOA 1WMPA 1BOXA 1JRQA 3LZAA 1GOYA 4O02B 2QIYA 2LQVA 1RRLA 3F14A 6RNTA 1OHOA 1FUTA 4HOHA 3FKAA 4CPKA 2AAEA 2SBLA 1KWIA 4AKZA 1EEJA 1W6GA 2GU1A 2W6JH 4G1MB
chains in the Genus database with same CATH topology
2IA7A 1ISKA 1YJN3 2D42A 5AIHA 3CNMA 3LYGA 1TU5A 3SLUA 3CCU3 3GAXA 1O7NB 1FA3A 3PGBA 3OXAA 3DGNA 2QEX3 1K28A 1OHPA 3IPTA 3OWUA 1KSIA 4STDA 4WWUC 5IG4A 1EKMA 4HM4B 1KQS2 3X3YA 2D1WA 4FCZA 1STFI 3DGLA 4MJDA 3LMLA 1IQYA 2OOVC 1VQL3 4XM4A 5AYRB 2K0MA 4NREA 3SXXA 2BHMA 4L8OA 3NV0A 3BLZA 4HM1B 3DM8A 3LTDA 1L5GB 2M7OA 3MG3A 3JUPA 3G16A 3BNEA 3O8YA 3CU3A 4EYCA 4KVHA 3CC23 1YGEA 1A90A 1N8R4 3X3XA 5IEPA 2JDIH 1AR0A 1WQLB 1QAFA 4XBXA 3U1WA 3BNDA 4EV5A 1D6UA 3F8HA 5D81A 4WYKA 3VF1A 2O3OA 3J7Yd 1WMNA 2CFWA 3CPW2 4QWTA 3WA3A 5DRVA 4X2OA 5BXQA 1AVKA 1CYUA 1W4NA 3FG4A 5STDA 4WFOA 1IT8A 3WMDA 5AEWB 2XRXB 1JKGB 4HKVB 2WGOA 1VQP3 1GD3A 2QGUA 2CH9A 3EX9A 3CXC2 4HYZA 2F99A 4MMXB 3FCSB 3H3HA 4H3UA 6STDA 5AIGA 1YIJ3 1N8QA 3K63A 2YFLB 3JUMA 2KXGA 3G4S3 1TFOA 5CF2A 3GZXB 2HMNB 4CCVA 4KFFA 1QVG2 1O7WB 3L0RA 2ML5A 4BTXA 3EBTA 3WOEB 4OUQA 2W0QA 2CWTA 2HMOB 1W5ZA 3DMCA 3KE7A 2ML6A 1OGXA 2Q07A 1YJW3 1JJ22 1N5HA 3KSPA 4U13A 3Q2PA 3NX0A 5JBSA 5EEOA 4HM0B 3T8UA 2OQEC 3F7SA 1GY5A 1EA2A 2BT3A 3CCM3 1DMQA 1Q40A 1ZX2A 4ZM8A 3F8XA 3FH1A 1TFKA 1IVUA 4WHAA 2YFIB 4AKYA 1O7MB 3RGRA 1ROAA 1OHSA 3FG3A 1ULJB 1RJOA 1PFPA 2HMMB 3B4PA 3DY5A 1YVBI 3KIIA 3SEDA 2XH9A 1OUNA 1TIJA 1E97A 3F7XA 2R4IA 3G0KA 1UW1A 1IK3A 1U8CB 4IT7A 1YIT3 5A0OB 2ZL8A 4LSOA 4LMIA 3I553 3LTCA 2CKFB 1M1K4 3RDEA 1Z1SA 4HM2B 3EB8A 3CMA3 1JB2A 1N5PA 3HK4A 1FUWA 3NHXA 8CHOA 3UJMA 1YHQ3 1OF5B 2GEXA 4KFEA 3CC73 1W6CA 4ORLA 5FGOA 2B1XB 2V1LA 5EQLA 2GBWB 3IJEB 3MG2A 3KSED 2OCTA 2HMJB 1IQ8A 1FGRA 1IT7A 3TDGA 1YJ93 1MOLA 1UI7A 3NBBA 1N9EA 3KZTA 5D82A 5EVHA 3S5CA 1W01A 1AVLA 2RGQA 5IF6A 2CWUA 1VQN3 3CCE3 2WOHA 1NWWA 3BB9A 3QRDA 3EBYA 4RZMA 3PXMA 4I4KA 1ULIB 4KFDA 2W03A 1DMMA 2C10A 3FF0A 1Q40B 4GL6A 5AIIA 3V99A 3G8ZA 1TUHA 1IDPA 4HM6B 3GRDA 3CCR3 1VQM3 1A2KA 5LC7A 3FLJA 1IVVA 2CG0A 1JN5A 1O7HB 4XB5A 5ELUA 3S67A 3WDGB 5HGRA 1STDA 3I0YA 1K41A 1TP6A 2YFJB 4EBGA 2GXFA 1EQKA 5KP1A 1M9GA 5TGNA 3MSOA 1Q42A 3BNBA 1Q7Y4 3FSDA 4HM3B 4K1UA 1T5YA 4IIAA 3LXUX 1NB5I 1FGQA 1KD14 3OWSA 1IU7A 1JKGA 3V92A 1VZZA 1R4CA 2CW9A 2W9PA 2HMKB 3UL5A 1GD4A 2XSHB 3UL6A 1ASKA 1VQ43 1OF5A 3NM7A 3CCJ3 3GZRA 2XFSA 1NB3I 1OACA 2OQEA 4RBNA 4TX4A 1HU9A 4RNZA 3CD63 3HIGA 2B24B 5IENA 5D83A 2UX0A 2CK3H 3NQZA 4LEHA 3EC9A 3CCV3 2P0XA 1D6ZA 3NM2A 1GY6A 2CFKA 3GZYB 1Q864 3GZBA 1NDOB 3X42A 2Y74A 1W00A 1QAKA 4AEQA 4MMYB 4N3VA 3VGNA 1CEWI 2XF3A 4WP5A 1WTHA 1QVF2 3CCQ3 2E2VA 3U97A 2STDA 3SOYA 2OWPA 1UUVB 1CQSA 2WOFA 2MC8A 3QK9A 2A15A 3E99A 3LH4A 4LZIA 3WOFB 2GU3A 1YI23 4HM7B 3FGYA 3JVCA 5IEOA 1G96A 4FMCA 1QALA 1PU4A 4FMAA 4J8TA 4GB5A 1N9JA 4XBTA 2RSXA 2O9UX 5CLKA 4N6TA 5IG0A 3EF8A 2GEYA 3HX8A 4LGQA 3JUQA 1US1A 5IG3A 5BVBA 2CFLA 3D9RA 3B4OA 5CK6A 1RKYA 4EV2A 4J9AA 3WODG 4X2HA 2F98A 3ROBA 1JNQA 3Q90A 3K5TA 5AI1A 3EN8A 4FR9A 1VQ83 1M1XB 1LNHA 4O2HA 2IUJA 5I97A 1LOXA 1IVWA 4OK0A 1NJI4 1NU3A 3KFQC 5IG5A 4XBYA 1LXEA 3I563 4K61A 1VQ53 2XGNA 2CHCA 2CWVA 3SOAA 2XGLA 1JN5B 2CFGA 4R9LA 3EQQB 1K734 1QJGA 2JQ5A 4IPBA 3D3LA 5JPUA 4HBRA 3PCRA 1FGOA 3HI7A 2F86B 5IERA 3LTAA 4MMZB 2IMJA 5IW9A 1W6YA 3LT9A 1DVDA 1SJWA 3M8CA 1OGZA 1Q814 3SX1A 3MHEA 3EJVA 3PZWA 1VQ73 4XDWA 2P05A 4XDVA 1UI8A 3KN4A 2PNCA 5ELJA 3OW22 2INXA 3N54B 1OPYA 3BNCA 3DXOA 4R9KA 3CME3 4FCJA 4HVNA 3STDA 3S29A 2C11A 2HMLB 4HM5B 2CC3A 3EE1A 3DGOA 3AMOA 2BO9B 2CFDA 3CNXA 1DVCA 5LC6A 3IMAB 3HZPA 3CC43 2W04A 3B8LA 4HM8B 3OV4A 3V98A 1HKXA 2MF7A 2W9QA 1CYVA 2FNQA 4R4KA 4Q53A 2OTL3 4FMBA 5AIFA 3RGAA 3JUOA 3DGMA 4JRFA 1JB4A 4HZBB 1GYBA 2IUKA 1E3VA 3NQYA 3S27A 3G6E3 3K9MC 3MPHA 1DMNA 3KKGA 2W2CA 4O3VA 4K90B 2PZVA 3UB1A 1GY7A 1K9M4 1M904 1W2B2 2BMRB 1U5OA 3X3ZA 1JB5A 3WA2X 2Z77A 1ROVA 2Z7AA 3PYJA 1O7PB 4HJLB 4O02B 1O7GB 2GBXB 2YX9A 2WGQA 3DZLA 2CIUA 1FGMA 2CG1A 1D6YA 3MYTA 4BTWA 1IQXA 1E3RA 1A67A 1V74A 3ER7A 1ZO2A 2W56A 2P0MA 1Y4KA 3N8BA 2XEPA 3FG1A 2W56B 3K7CA 4CDLA 4KZ1A 4N6NB 2ZDJA 2LYXA 3DUKA 1W02A 3Q1CA 3N9HA 1IV7A 2KCDA 2E2TA 2RFRA 3FF2A 3F40A 4OVMA 3CCS3 5AEUB 1WNHA 3JUNA 2BMOB 1UUWB 2Z76A 3LOYA 1JV2B 3AMOB 3EN1B 4PEJA 3PS8A 2OOVA 1J2BA 3T0UA 1S723 4EC6A 1RRHA 3SVAA 1F8NA 5AYSC 1SQWA 4N6UA 1DYUA 4H61A 3K0ZA 2P38A 2OTJ3 1S5AA 4O8SA 3NBJA 3ECFA 3FZWA 3UNLA 2Z6BA 4R80A 1VQ93 5KP4A 3X40A 1VQ63 3MG1A 4NHFA 3NXJA 4JF8A 4N6OB 3F9SA 4R1KA 1RN7A 4FCMA 3G713 2RCDA 1LVNA 3CCL3 2XR8B 5DREA 1IVXA 2XSOB 1EG9B 1C7HA 1W2ZA 2FXTA 4HZ9B 4EXRA 2KRTA 3HIIA 3LTBA 1VQK3 1K8A4 1QMAA 2QA43 2WO0A 1OH0A 1KC84 2P09A 2E2UA 1W7CA 4N6MA 4MEIA 5FW5A 5JPPA 1BUQA 1MNLA 1SIHA 7STDA 3CPOA 2BMQB 5CF1A 2L4VA 4L8PA 1Q824 3B7CA 3H51A 3S28A 1IV9A 3VSYA 3MKIA 3ALAA 3NUVA 5G2GA 4N6LA 1VQO3 2I9WA 3MWZA 1SPUA 1WMOA 2Y73A 3T8NA 4N6V0 4RNYA 3OWYA 2FGTA 1AV4A 2BNGA 3A76A 1SIIA 3NV0B 4BTYA 5CXOA 1GS3A 3LT8A 1NO3A 3EHCA 3NBRA 2XFTA 1A2VA 1OCVA 4WYKB 3X41A 3OX9A 4K1VA 1FGTA 3PCSA 4L7KA 3GWRA 5KP3A 4FMDA 2K54A 1WMPA 1JRQA 3LZAA 2QIYA 2LQVA 1RRLA 3F14A 1OHOA 3FKAA 2SBLA 1KWIA 4AKZA 2GU1A 1W6GA 2W6JH 4G1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYT A;  1ISK A;  1E3R A;  4LMI A;  4XBT A;  5CLK A;  2CKF B;  3ER7 A;  1ZO2 A;  5AIH A;  3CNM A;  3LYG A;  5IG0 A;  1Z1S A;  2GEY A;  3EF8 A;  3HX8 A;  4HM2 B;  4LGQ A;  3JUQ A;  5IG3 A;  5BVB A;  3K7C A;  1O7N B;  1JB2 A;  3B4O A;  3D9R A;  5CK6 A;  4CDL A;  3HK4 A;  4J9A A;  3NHX A;  3DUK A;  1W02 A;  3OXA A;  4X2H A;  3UJM A;  2F98 A;  3ROB A;  8CHO A;  1OF5 B;  2GEX A;  2RFR A;  3FF2 A;  3F40 A;  3Q90 A;  1OHP A;  3EN8 A;  3IPT A;  3OWU A;  4OVM A;  4ORL A;  2B1X B;  4STD A;  4WWU C;  5AEU B;  5IG4 A;  4HM4 B;  3JUN A;  2GBW B;  2BMO B;  1UUW B;  2Z76 A;  4MJD A;  3MG2 A;  2HMJ B;  3EN1 B;  4PEJ A;  1NU3 A;  5IG5 A;  4XBY A;  4XM4 A;  3KZT A;  5D82 A;  5EVH A;  3S5C A;  1W01 A;  4L8O A;  3NV0 A;  3BLZ A;  2RGQ A;  4HM1 B;  3DM8 A;  5IF6 A;  3MG3 A;  3JUP A;  3K0Z A;  1NWW A;  2CHC A;  3BB9 A;  3G16 A;  3SOA A;  1JN5 B;  3EBY A;  4RZM A;  3SOY A;  1S5A A;  3CU3 A;  4HJL B;  4R9L A;  3EQQ B;  1ULI B;  4I4K A;  4KVH A;  3ECF A;  3FZW A;  1QJG A;  3UNL A;  2JQ5 A;  1DMM A;  3FF0 A;  1Q40 B;  5AII A;  5IEP A;  1AR0 A;  5JPU A;  1WQL B;  5KP4 A;  3G8Z A;  1TUH A;  1IDP A;  3MG1 A;  4XBX A;  3NXJ A;  2F86 B;  3GRD A;  4HM6 B;  5IER A;  3F8H A;  1A2K A;  2IMJ A;  5D81 A;  3FLJ A;  4WYK A;  5AI1 A;  1W6Y A;  1SJW A;  1JN5 A;  1O7H B;  3M8C A;  3F9S A;  4R1K A;  4XB5 A;  4FCM A;  2RCD A;  5HGR A;  1OGZ A;  1STD A;  3I0Y A;  3MHE A;  1K41 A;  1TP6 A;  2XR8 B;  2YFJ B;  2GXF A;  3EJV A;  4X2O A;  5DRV A;  5DRE A;  5TGN A;  5BXQ A;  2XSO B;  5KP1 A;  3MSO A;  5STD A;  4XDW A;  1EG9 B;  1Q42 A;  1C7H A;  4XDV A;  3WMD A;  5AEW B;  3FSD A;  4HM3 B;  4K1U A;  2XRX B;  1JKG B;  2INX A;  4HKV B;  4HZ9 B;  4IIA A;  1OPY A;  2QGU A;  3EX9 A;  3OWS A;  3DXO A;  4R9K A;  1JKG A;  2F99 A;  4FCJ A;  4HVN A;  3STD A;  1VZZ A;  3H3H A;  3G0K A;  4H3U A;  6STD A;  1QMA A;  5AIG A;  2HML B;  1OH0 A;  2HMK B;  2YFL B;  4HM5 B;  3JUM A;  5JPP A;  2XSH B;  5FW5 A;  5CF2 A;  1BUQ A;  3GZX B;  2HMN B;  7STD A;  1ASK A;  3CPO A;  2BMQ B;  1O7W B;  1OF5 A;  3CNX A;  4L8P A;  5CF1 A;  3B7C A;  3EBT A;  3HZP A;  3GZR A;  3H51 A;  4OUQ A;  3VSY A;  2HMO B;  3B8L A;  4HM8 B;  3DMC A;  3OV4 A;  3MKI A;  1HKX A;  3KE7 A;  3NUV A;  5G2G A;  1OGX A;  2I9W A;  2B24 B;  5IEN A;  3KSP A;  5D83 A;  4Q53 A;  2UX0 A;  4LEH A;  3T8N A;  3EC9 A;  4U13 A;  3OWY A;  2BNG A;  3A76 A;  3NM2 A;  3NV0 B;  5AIF A;  3JUO A;  3RGA A;  1GY6 A;  1JB4 A;  3GZY B;  1GS3 A;  1GYB A;  4HZB B;  5CXO A;  3EHC A;  3NBR A;  1E3V A;  3GZB A;  4HM0 B;  1NDO B;  1OCV A;  3T8U A;  3F7S A;  4WYK B;  1W00 A;  3OX9 A;  4K1V A;  1GY5 A;  1DMN A;  3KKG A;  2W2C A;  4L7K A;  1EA2 A;  2PZV A;  3GWR A;  1DMQ A;  5KP3 A;  1Q40 A;  1ZX2 A;  4N3V A;  2K54 A;  1GY7 A;  3F8X A;  3FH1 A;  3VGN A;  4WP5 A;  2BMR B;  1U5O A;  3LZA A;  1JB5 A;  2Z77 A;  2STD A;  2Z7A A;  2QIY A;  1O7P B;  2YFI B;  3F14 A;  2OWP A;  1O7M B;  1O7G B;  1OHO A;  1CQS A;  1UUV B;  2GBX B;  3FKA A;  3RGR A;  1OHS A;  2A15 A;  1ULJ B;  2HMM B;  3B4P A;  3E99 A;  3DZL A;  3SED A;  4HM7 B;  1OUN A;  1E97 A;  3F7X A;  2R4I A;  3FGY A;  5IEO A;  4J8T A;  4GB5 A; 
#chains in the Genus database with same CATH topology
 2IA7 A;  1ISK A;  1MGW A;  1YJN 3;  1RHL A;  2D42 A;  5AIH A;  3CNM A;  3LYG A;  1TU5 A;  4CJN A;  3SLU A;  3CCU 3;  3GAX A;  1B27 A;  2IYJ A;  1O7N B;  1I8V A;  3PGB A;  1FA3 A;  3OXA A;  3DGN A;  2CX0 A;  2QEX 3;  4ILF A;  1K28 A;  1OHP A;  3IPT A;  3OWU A;  1KSI A;  4STD A;  4WWU C;  5IG4 A;  2KF4 A;  1EKM A;  4HM4 B;  3D5I A;  1KQS 2;  3X3Y A;  2D1W A;  4FCZ A;  1STF I;  3DGL A;  4MJD A;  3LML A;  1JBR A;  1IQY A;  2OOV C;  1VQL 3;  4XM4 A;  5M1A A;  3SYU A;  5AYR B;  2K0M A;  4NRE A;  3SXX A;  2BHM A;  4L8O A;  3NV0 A;  3BLZ A;  4HM1 B;  3DM8 A;  3LTD A;  1L5G B;  2M7O A;  3MG3 A;  3JUP A;  3G16 A;  1GMQ A;  3BNE A;  3O8Y A;  3CU3 A;  4EYC A;  1AQZ A;  1DET A;  1T3B A;  4KVH A;  3CC2 3;  1RSN A;  1YGE A;  1A90 A;  3ZG5 A;  1RN4 A;  1N8R 4;  3X3X A;  5IEP A;  2JDI H;  1AR0 A;  1WQL B;  1QAF A;  1DE3 A;  1I2E A;  4XBX A;  3U1W A;  3BND A;  1B20 A;  4EV5 A;  1D6U A;  3F8H A;  5D81 A;  2ZHX B;  4WYK A;  9RNT A;  3VF1 A;  2O3O A;  3J7Y d;  1WMN A;  2CFW A;  3CPW 2;  1B2S A;  4QWT A;  3WA3 A;  5DRV A;  5HOH A;  4X2O A;  5BXQ A;  1AVK A;  1CYU A;  1MWS A;  1W4N A;  3FG4 A;  5STD A;  4WFO A;  1IT8 A;  2J8X B;  3WMD A;  5AEW B;  2XRX B;  1JKG B;  1GMP A;  4HKV B;  1BUJ A;  2WGO A;  1VQP 3;  1GD3 A;  2QGU A;  2CH9 A;  1LQM B;  3EX9 A;  3CXC 2;  4HYZ A;  2F99 A;  1YNV X;  4MMX B;  3FCS B;  3H3H A;  4H3U A;  1RGL A;  2C4B A;  1MWU A;  5AIG A;  5BU4 A;  1N8Q A;  6STD A;  2KF3 A;  1YIJ 3;  3K63 A;  2YFL B;  3JUM A;  2KXG A;  3G4S 3;  1TFO A;  5CF2 A;  3GZX B;  1B2M A;  2HMN B;  4CCV A;  4KFF A;  1QVG 2;  1O7W B;  3L0R A;  2KAA A;  2ML5 A;  4BTX A;  3EBT A;  4LYL B;  1LNI A;  4OUQ A;  2W0Q A;  3WOE B;  2CWT A;  2HMO B;  1W5Z A;  3DMC A;  3KE7 A;  2F5M A;  1UCL A;  2ML6 A;  1OGX A;  2Q07 A;  1YJW 3;  1JJ2 2;  1N5H A;  3KSP A;  4J5K A;  4U13 A;  1RN1 A;  4KT3 B;  3Q2P A;  3NX0 A;  5JBS A;  1JBS A;  2H0G A;  1BNJ A;  4HM0 B;  5EEO A;  3T8U A;  2OQE C;  3F7S A;  3RNT A;  1GY5 A;  1EA2 A;  2BT3 A;  3CCM 3;  1DMQ A;  1I70 A;  1Q40 A;  1ZX2 A;  4ZM8 A;  1LQG C;  3F8X A;  3FH1 A;  1PYL A;  1TFK A;  1IVU A;  4I5Q A;  4WHA A;  2YFI B;  4AKY A;  1O7M B;  3RGR A;  1ROA A;  1X1W A;  1OHS A;  3FG3 A;  4J5G A;  1ULJ B;  1RJO A;  1BNE A;  1PFP A;  2HMM B;  2KF6 A;  1YVB I;  2RBI A;  3B4P A;  3DY5 A;  3KII A;  3SED A;  2XH9 A;  1OUN A;  1TIJ A;  1E97 A;  3F7X A;  2R4I A;  3G0K A;  1UW1 A;  1IK3 A;  1U8C B;  4IT7 A;  1G0T A;  1YIT 3;  1UCJ A;  5A0O B;  2ZL8 A;  4LSO A;  1GMR A;  4LMI A;  3I55 3;  3LTC A;  2CKF B;  1BNF A;  3RDE A;  1Z1S A;  1M1K 4;  1I2G A;  4HM2 B;  3EB8 A;  1GOV A;  3CMA 3;  1JB2 A;  1LOV A;  2L1S A;  1B2Z A;  1N5P A;  8RNT A;  3HK4 A;  5RNT A;  1FUW A;  3NHX A;  8CHO A;  3UJM A;  1GOU A;  1YHQ 3;  1OF5 B;  2AAD A;  2GEX A;  2F56 A;  4KFE A;  3CC7 3;  1W6C A;  4ORL A;  5FGO A;  2B1X B;  2V1L A;  5EQL A;  2GBW B;  3IJE B;  3MG2 A;  3KSE D;  2OCT A;  2HMJ B;  1IQ8 A;  1FGR A;  1IT7 A;  3TDG A;  1RCK A;  1TRP A;  1MOL A;  1UI7 A;  1JZO A;  3NBB A;  5IEO A;  1TRQ A;  1N9E A;  1BRI A;  3KZT A;  5D82 A;  5EVH A;  5GSP A;  1W01 A;  3S5C A;  1I3F A;  1AVL A;  2RGQ A;  5IF6 A;  2CWU A;  2UGI A;  1VQN 3;  3CCE 3;  2WOH A;  1NWW A;  3BB9 A;  3QRD A;  3EBY A;  4RZM A;  3PXM A;  5BIR A;  4I4K A;  1ULI B;  4KFD A;  3ZFZ A;  2W03 A;  1DMM A;  2C10 A;  3FF0 A;  1MGR A;  1Q40 B;  4GL6 A;  5AII A;  1BNS A;  3V99 A;  3G8Z A;  1RGC A;  1TUH A;  1IDP A;  4HM6 B;  3GRD A;  3CCR 3;  1VQM 3;  1A2K A;  5LC7 A;  1UGI A;  3FLJ A;  1IVV A;  2CG0 A;  4NPB A;  1JN5 A;  1O7H B;  4XB5 A;  5ELU A;  3S67 A;  3WDG B;  5HGR A;  1STD A;  3I0Y A;  1K41 A;  1TP6 A;  2YFJ B;  4EBG A;  2GXF A;  1EQK A;  5KP1 A;  1LOY A;  1M9G A;  5TGN A;  3MSO A;  1Q42 A;  3BNB A;  1BGS A;  3FSD A;  4HM3 B;  4K1U A;  1T5Y A;  3ZG0 A;  1Q7Y 4;  4IIA A;  1BU4 A;  3LXU X;  1FGQ A;  1NB5 I;  4BIR A;  1KD1 4;  3OWS A;  1RNT A;  1IU7 A;  1JKG A;  3V92 A;  1PY3 A;  1VZZ A;  1R4C A;  2CW9 A;  2W9P A;  2HMK B;  3UL5 A;  1GD4 A;  1BRK A;  2XSH B;  7RNT A;  3UL6 A;  1ASK A;  1RGG A;  3D5G A;  1VQ4 3;  1OF5 A;  3NM7 A;  3CCJ 3;  1JZD A;  3GZR A;  2XFS A;  1BNI A;  1NB3 I;  1OAC A;  1BAN A;  2OQE A;  4RBN A;  4TX4 A;  1HU9 A;  4RNZ A;  1V58 A;  3CD6 3;  1RGA A;  3BU4 A;  2H0H A;  3HIG A;  2B24 B;  5IEN A;  1FW7 A;  5D83 A;  2UX0 A;  2CK3 H;  3NQZ A;  4LEH A;  3EC9 A;  3CCV 3;  2P0X A;  1JBT A;  1D6Z A;  3NM2 A;  1GY6 A;  2CFK A;  2KF5 A;  3GZY B;  1Q86 4;  3GZB A;  1NDO B;  3X42 A;  1BRG A;  2Y74 A;  1BSD A;  1CH0 A;  1W00 A;  1QAK A;  4AEQ A;  4GHO A;  1Q7H A;  4MMY B;  4N3V A;  3VGN A;  1AY7 A;  1CEW I;  2XF3 A;  4WP5 A;  1WTH A;  1QVF 2;  3CCQ 3;  2E2V A;  3U97 A;  2STD A;  3SOY A;  2OWP A;  1UUV B;  1BSC A;  1CQS A;  2WOF A;  1IYY A;  2MC8 A;  3QK9 A;  2A15 A;  3URP A;  1R4Y A;  3E99 A;  3GSP A;  3LH4 A;  4LZI A;  3WOF B;  2GU3 A;  1YI2 3;  4HM7 B;  3FGY A;  3D4A A;  3JVC A;  1G96 A;  4FMC A;  1QAL A;  1I3I A;  4FMA A;  4J8T A;  2F4Y A;  4GB5 A;  1N9J A;  4XBT A;  2RSX A;  1BNG A;  2O9U X;  5CLK A;  4N6T A;  5IG0 A;  3EF8 A;  2GEY A;  3HX8 A;  1UCI A;  3HOH A;  4LGQ A;  3JUQ A;  1US1 A;  5IG3 A;  5BVB A;  2CFL A;  3D9R A;  3B4O A;  5CK6 A;  1RKY A;  1YVS A;  1ZGX A;  4EV2 A;  4J9A A;  3WOD G;  4X2H A;  2F98 A;  3ROB A;  1JNQ A;  3Q90 A;  3K5T A;  5AI1 A;  3EN8 A;  4FR9 A;  1VQ8 3;  1M1X B;  1LNH A;  4O2H A;  2IUJ A;  5I97 A;  4HAA A;  1LOX A;  1IVW A;  4OK0 A;  1NJI 4;  1NU3 A;  3KFQ C;  5IG5 A;  3Q3F A;  4XBY A;  2ZA4 A;  1LXE A;  3I56 3;  4K61 A;  1VQ5 3;  5M19 A;  1RGH A;  1X1U A;  1MWR A;  2XGN A;  2CHC A;  2CWV A;  1BRN L;  3SOA A;  2XGL A;  1JN5 B;  2CFG A;  4R9L A;  3EQQ B;  1K73 4;  1QJG A;  2JQ5 A;  4IPB A;  1V57 A;  3D3L A;  5JPU A;  4HBR A;  3PCR A;  1PU4 A;  2GSP A;  1FGO A;  2RNT A;  3HI7 A;  2F86 B;  5IER A;  1HYF A;  3LTA A;  2IMJ A;  4MMZ B;  5IW9 A;  1W6Y A;  3LT9 A;  1DVD A;  1SJW A;  1LRA A;  3M8C A;  3WHO A;  1OGZ A;  1Q81 4;  3SX1 A;  3MHE A;  5G1L A;  3EJV A;  3AHW A;  2R41 A;  1UDI I;  3PZW A;  1VQ7 3;  4XDW A;  2P05 A;  4XDV A;  1UI8 A;  3KN4 A;  1RTU A;  2PNC A;  4GSP A;  5ELJ A;  1BRS A;  3BIR A;  3OW2 2;  2INX A;  3N54 B;  1OPY A;  3BNC A;  3DXO A;  1BAO A;  4R9K A;  3CME 3;  4FCJ A;  4HVN A;  3STD A;  3S29 A;  1YGW A;  2C11 A;  2HML B;  4HM5 B;  2CC3 A;  4BU4 A;  1B2X A;  3EE1 A;  3DGO A;  3AMO A;  4BL3 A;  2BIR A;  1I0X A;  2BO9 B;  2CFD A;  1DVC A;  3CNX A;  5LC6 A;  1VQQ A;  3IMA B;  3HZP A;  3CC4 3;  2W04 A;  3B8L A;  4HM8 B;  2H0I A;  3OV4 A;  3V98 A;  1HKX A;  3D79 A;  1X1Y A;  2MF7 A;  2W9Q A;  1YJ9 3;  1CYV A;  2FNQ A;  4R4K A;  4Q53 A;  2OTL 3;  4FMB A;  5AIF A;  3RGA A;  3JUO A;  3DGM A;  4JRF A;  1JB4 A;  4HZB B;  1GYB A;  1BIR A;  1Q9E A;  4EW5 A;  1RNB A;  1RDS A;  2IUK A;  1E3V A;  1ZS7 A;  3NQY A;  1RGF A;  3S27 A;  3G6E 3;  1T2I A;  1G02 A;  2UUG C;  3K9M C;  1DMN A;  3KKG A;  2W2C A;  3MPH A;  4O3V A;  4K90 B;  2PZV A;  3UB1 A;  1B21 A;  1GY7 A;  1K9M 4;  1M90 4;  1W2B 2;  2BMR B;  1U5O A;  3X3Z A;  1JB5 A;  3WA2 X;  2Z77 A;  1ROV A;  1B2U A;  2Z7A A;  1O7P B;  1BSE A;  1FYS A;  3PYJ A;  4HJL B;  1O7G B;  2GBX B;  1X1X A;  2YX9 A;  1MWT A;  1EUI C;  2WGQ A;  3DZL A;  2CIU A;  1FGM A;  1GSP A;  2CG1 A;  1FUS A;  1D6Y A;  3MYT A;  3DGY A;  4BTW A;  1IQX A;  1E3R A;  4BL2 A;  1A67 A;  6GSP A;  1V74 A;  1RGE A;  3ER7 A;  1ZO2 A;  2W56 A;  2P0M A;  1Y4K A;  3N8B A;  2XEP A;  3FG1 A;  3A5E A;  2BU4 A;  2HOH A;  5G1K A;  2W56 B;  5M18 A;  3K7C A;  4CDL A;  4KZ1 A;  4N6N B;  2ZDJ A;  2LYX A;  3DUK A;  1W02 A;  3Q1C A;  3N9H A;  1IV7 A;  2KCD A;  2E2T A;  2RFR A;  3FF2 A;  3F40 A;  4OVM A;  3CCS 3;  7GSP A;  1TTO A;  1UGH I;  5AEU B;  1WNH A;  1FZU A;  3JUN A;  2BMO B;  1UUW B;  2Z76 A;  3LOY A;  1JV2 B;  3AMO B;  3EN1 B;  3AHS A;  3PS8 A;  4PEJ A;  2OOV A;  1J2B A;  3T0U A;  1I2F A;  1S72 3;  4EC6 A;  1RRH A;  3SVA A;  1RGK A;  1F8N A;  2IY2 A;  5AYS C;  1SQW A;  4N6U A;  1DYU A;  4H61 A;  3K0Z A;  2P38 A;  4DKI A;  1NNV A;  2OTJ 3;  1S5A A;  4O8S A;  2CX1 A;  3NBJ A;  3ECF A;  3FZW A;  3UNL A;  2Z6B A;  4R80 A;  1VQ9 3;  1UCK A;  5KP4 A;  3X40 A;  1BRH A;  1VQ6 3;  3MG1 A;  4NHF A;  3NXJ A;  3KCH A;  1SAR A;  2SAR A;  1BRJ A;  4JF8 A;  1TJD A;  1UUG B;  4N6O B;  3F9S A;  4R1K A;  1RN7 A;  4FCM A;  3G71 3;  2RCD A;  1HZ1 A;  1LVN A;  1LOW A;  3CCL 3;  1A2P A;  2XR8 B;  1RLS A;  5DRE A;  1C54 A;  1IVX A;  2XSO B;  1BVI A;  1EG9 B;  1C7H A;  1BSB A;  4RNT A;  1W2Z A;  2FXT A;  4HZ9 B;  4EXR A;  2KRT A;  3AGN A;  1RMS A;  3HII A;  3LTB A;  1VQK 3;  1BSA A;  1K8A 4;  1QMA A;  2QA4 3;  2WO0 A;  1OH0 A;  1KC8 4;  2P09 A;  2E2U A;  1W7C A;  4N6M A;  4MEI A;  5FW5 A;  5JPP A;  1BUQ A;  1MNL A;  1SIH A;  7STD A;  3CPO A;  1BNR A;  2BMQ B;  5CF1 A;  2L4V A;  4L8P A;  1Q82 4;  3B7C A;  3H51 A;  2F5W A;  3S28 A;  1IV9 A;  3VSY A;  3MKI A;  3ALA A;  3NUV A;  5G2G A;  4N6L A;  1VQO 3;  2I9W A;  3MWZ A;  1RCL A;  1SPU A;  1WMO A;  2Y73 A;  3T8N A;  4N6V 0;  4RNY A;  3OWY A;  2FGT A;  1AV4 A;  2BNG A;  3A76 A;  1SII A;  3NV0 B;  4BTY A;  5CXO A;  1GS3 A;  3LT8 A;  1T2H A;  1NO3 A;  3EHC A;  3NBR A;  1I0V A;  2XFT A;  1A2V A;  1OCV A;  4WYK B;  3X41 A;  3OX9 A;  4K1V A;  1FGT A;  3DH2 A;  2K3D A;  3PCS A;  4L7K A;  3GWR A;  5KP3 A;  4FMD A;  3WR2 A;  1B3S A;  2K54 A;  3AGO A;  1WMP A;  1BOX A;  1JRQ A;  3LZA A;  1GOY A;  4O02 B;  2QIY A;  2LQV A;  1RRL A;  3F14 A;  6RNT A;  1OHO A;  1FUT A;  4HOH A;  3FKA A;  4CPK A;  2AAE A;  2SBL A;  1KWI A;  4AKZ A;  1EEJ A;  1W6G A;  2GU1 A;  2W6J H;  4G1M B; 
#chains in the Genus database with same CATH homology
 2IA7 A;  1ISK A;  1YJN 3;  2D42 A;  5AIH A;  3CNM A;  3LYG A;  1TU5 A;  3SLU A;  3CCU 3;  3GAX A;  1O7N B;  1FA3 A;  3PGB A;  3OXA A;  3DGN A;  2QEX 3;  1K28 A;  1OHP A;  3IPT A;  3OWU A;  1KSI A;  4STD A;  4WWU C;  5IG4 A;  1EKM A;  4HM4 B;  1KQS 2;  3X3Y A;  2D1W A;  4FCZ A;  1STF I;  3DGL A;  4MJD A;  3LML A;  1IQY A;  2OOV C;  1VQL 3;  4XM4 A;  5AYR B;  2K0M A;  4NRE A;  3SXX A;  2BHM A;  4L8O A;  3NV0 A;  3BLZ A;  4HM1 B;  3DM8 A;  3LTD A;  1L5G B;  2M7O A;  3MG3 A;  3JUP A;  3G16 A;  3BNE A;  3O8Y A;  3CU3 A;  4EYC A;  4KVH A;  3CC2 3;  1YGE A;  1A90 A;  1N8R 4;  3X3X A;  5IEP A;  2JDI H;  1AR0 A;  1WQL B;  1QAF A;  4XBX A;  3U1W A;  3BND A;  4EV5 A;  1D6U A;  3F8H A;  5D81 A;  4WYK A;  3VF1 A;  2O3O A;  3J7Y d;  1WMN A;  2CFW A;  3CPW 2;  4QWT A;  3WA3 A;  5DRV A;  4X2O A;  5BXQ A;  1AVK A;  1CYU A;  1W4N A;  3FG4 A;  5STD A;  4WFO A;  1IT8 A;  3WMD A;  5AEW B;  2XRX B;  1JKG B;  4HKV B;  2WGO A;  1VQP 3;  1GD3 A;  2QGU A;  2CH9 A;  3EX9 A;  3CXC 2;  4HYZ A;  2F99 A;  4MMX B;  3FCS B;  3H3H A;  4H3U A;  6STD A;  5AIG A;  1YIJ 3;  1N8Q A;  3K63 A;  2YFL B;  3JUM A;  2KXG A;  3G4S 3;  1TFO A;  5CF2 A;  3GZX B;  2HMN B;  4CCV A;  4KFF A;  1QVG 2;  1O7W B;  3L0R A;  2ML5 A;  4BTX A;  3EBT A;  3WOE B;  4OUQ A;  2W0Q A;  2CWT A;  2HMO B;  1W5Z A;  3DMC A;  3KE7 A;  2ML6 A;  1OGX A;  2Q07 A;  1YJW 3;  1JJ2 2;  1N5H A;  3KSP A;  4U13 A;  3Q2P A;  3NX0 A;  5JBS A;  5EEO A;  4HM0 B;  3T8U A;  2OQE C;  3F7S A;  1GY5 A;  1EA2 A;  2BT3 A;  3CCM 3;  1DMQ A;  1Q40 A;  1ZX2 A;  4ZM8 A;  3F8X A;  3FH1 A;  1TFK A;  1IVU A;  4WHA A;  2YFI B;  4AKY A;  1O7M B;  3RGR A;  1ROA A;  1OHS A;  3FG3 A;  1ULJ B;  1RJO A;  1PFP A;  2HMM B;  3B4P A;  3DY5 A;  1YVB I;  3KII A;  3SED A;  2XH9 A;  1OUN A;  1TIJ A;  1E97 A;  3F7X A;  2R4I A;  3G0K A;  1UW1 A;  1IK3 A;  1U8C B;  4IT7 A;  1YIT 3;  5A0O B;  2ZL8 A;  4LSO A;  4LMI A;  3I55 3;  3LTC A;  2CKF B;  1M1K 4;  3RDE A;  1Z1S A;  4HM2 B;  3EB8 A;  3CMA 3;  1JB2 A;  1N5P A;  3HK4 A;  1FUW A;  3NHX A;  8CHO A;  3UJM A;  1YHQ 3;  1OF5 B;  2GEX A;  4KFE A;  3CC7 3;  1W6C A;  4ORL A;  5FGO A;  2B1X B;  2V1L A;  5EQL A;  2GBW B;  3IJE B;  3MG2 A;  3KSE D;  2OCT A;  2HMJ B;  1IQ8 A;  1FGR A;  1IT7 A;  3TDG A;  1YJ9 3;  1MOL A;  1UI7 A;  3NBB A;  1N9E A;  3KZT A;  5D82 A;  5EVH A;  3S5C A;  1W01 A;  1AVL A;  2RGQ A;  5IF6 A;  2CWU A;  1VQN 3;  3CCE 3;  2WOH A;  1NWW A;  3BB9 A;  3QRD A;  3EBY A;  4RZM A;  3PXM A;  4I4K A;  1ULI B;  4KFD A;  2W03 A;  1DMM A;  2C10 A;  3FF0 A;  1Q40 B;  4GL6 A;  5AII A;  3V99 A;  3G8Z A;  1TUH A;  1IDP A;  4HM6 B;  3GRD A;  3CCR 3;  1VQM 3;  1A2K A;  5LC7 A;  3FLJ A;  1IVV A;  2CG0 A;  1JN5 A;  1O7H B;  4XB5 A;  5ELU A;  3S67 A;  3WDG B;  5HGR A;  1STD A;  3I0Y A;  1K41 A;  1TP6 A;  2YFJ B;  4EBG A;  2GXF A;  1EQK A;  5KP1 A;  1M9G A;  5TGN A;  3MSO A;  1Q42 A;  3BNB A;  1Q7Y 4;  3FSD A;  4HM3 B;  4K1U A;  1T5Y A;  4IIA A;  3LXU X;  1NB5 I;  1FGQ A;  1KD1 4;  3OWS A;  1IU7 A;  1JKG A;  3V92 A;  1VZZ A;  1R4C A;  2CW9 A;  2W9P A;  2HMK B;  3UL5 A;  1GD4 A;  2XSH B;  3UL6 A;  1ASK A;  1VQ4 3;  1OF5 A;  3NM7 A;  3CCJ 3;  3GZR A;  2XFS A;  1NB3 I;  1OAC A;  2OQE A;  4RBN A;  4TX4 A;  1HU9 A;  4RNZ A;  3CD6 3;  3HIG A;  2B24 B;  5IEN A;  5D83 A;  2UX0 A;  2CK3 H;  3NQZ A;  4LEH A;  3EC9 A;  3CCV 3;  2P0X A;  1D6Z A;  3NM2 A;  1GY6 A;  2CFK A;  3GZY B;  1Q86 4;  3GZB A;  1NDO B;  3X42 A;  2Y74 A;  1W00 A;  1QAK A;  4AEQ A;  4MMY B;  4N3V A;  3VGN A;  1CEW I;  2XF3 A;  4WP5 A;  1WTH A;  1QVF 2;  3CCQ 3;  2E2V A;  3U97 A;  2STD A;  3SOY A;  2OWP A;  1UUV B;  1CQS A;  2WOF A;  2MC8 A;  3QK9 A;  2A15 A;  3E99 A;  3LH4 A;  4LZI A;  3WOF B;  2GU3 A;  1YI2 3;  4HM7 B;  3FGY A;  3JVC A;  5IEO A;  1G96 A;  4FMC A;  1QAL A;  1PU4 A;  4FMA A;  4J8T A;  4GB5 A;  1N9J A;  4XBT A;  2RSX A;  2O9U X;  5CLK A;  4N6T A;  5IG0 A;  3EF8 A;  2GEY A;  3HX8 A;  4LGQ A;  3JUQ A;  1US1 A;  5IG3 A;  5BVB A;  2CFL A;  3D9R A;  3B4O A;  5CK6 A;  1RKY A;  4EV2 A;  4J9A A;  3WOD G;  4X2H A;  2F98 A;  3ROB A;  1JNQ A;  3Q90 A;  3K5T A;  5AI1 A;  3EN8 A;  4FR9 A;  1VQ8 3;  1M1X B;  1LNH A;  4O2H A;  2IUJ A;  5I97 A;  1LOX A;  1IVW A;  4OK0 A;  1NJI 4;  1NU3 A;  3KFQ C;  5IG5 A;  4XBY A;  1LXE A;  3I56 3;  4K61 A;  1VQ5 3;  2XGN A;  2CHC A;  2CWV A;  3SOA A;  2XGL A;  1JN5 B;  2CFG A;  4R9L A;  3EQQ B;  1K73 4;  1QJG A;  2JQ5 A;  4IPB A;  3D3L A;  5JPU A;  4HBR A;  3PCR A;  1FGO A;  3HI7 A;  2F86 B;  5IER A;  3LTA A;  4MMZ B;  2IMJ A;  5IW9 A;  1W6Y A;  3LT9 A;  1DVD A;  1SJW A;  3M8C A;  1OGZ A;  1Q81 4;  3SX1 A;  3MHE A;  3EJV A;  3PZW A;  1VQ7 3;  4XDW A;  2P05 A;  4XDV A;  1UI8 A;  3KN4 A;  2PNC A;  5ELJ A;  3OW2 2;  2INX A;  3N54 B;  1OPY A;  3BNC A;  3DXO A;  4R9K A;  3CME 3;  4FCJ A;  4HVN A;  3STD A;  3S29 A;  2C11 A;  2HML B;  4HM5 B;  2CC3 A;  3EE1 A;  3DGO A;  3AMO A;  2BO9 B;  2CFD A;  3CNX A;  1DVC A;  5LC6 A;  3IMA B;  3HZP A;  3CC4 3;  2W04 A;  3B8L A;  4HM8 B;  3OV4 A;  3V98 A;  1HKX A;  2MF7 A;  2W9Q A;  1CYV A;  2FNQ A;  4R4K A;  4Q53 A;  2OTL 3;  4FMB A;  5AIF A;  3RGA A;  3JUO A;  3DGM A;  4JRF A;  1JB4 A;  4HZB B;  1GYB A;  2IUK A;  1E3V A;  3NQY A;  3S27 A;  3G6E 3;  3K9M C;  3MPH A;  1DMN A;  3KKG A;  2W2C A;  4O3V A;  4K90 B;  2PZV A;  3UB1 A;  1GY7 A;  1K9M 4;  1M90 4;  1W2B 2;  2BMR B;  1U5O A;  3X3Z A;  1JB5 A;  3WA2 X;  2Z77 A;  1ROV A;  2Z7A A;  3PYJ A;  1O7P B;  4HJL B;  4O02 B;  1O7G B;  2GBX B;  2YX9 A;  2WGQ A;  3DZL A;  2CIU A;  1FGM A;  2CG1 A;  1D6Y A;  3MYT A;  4BTW A;  1IQX A;  1E3R A;  1A67 A;  1V74 A;  3ER7 A;  1ZO2 A;  2W56 A;  2P0M A;  1Y4K A;  3N8B A;  2XEP A;  3FG1 A;  2W56 B;  3K7C A;  4CDL A;  4KZ1 A;  4N6N B;  2ZDJ A;  2LYX A;  3DUK A;  1W02 A;  3Q1C A;  3N9H A;  1IV7 A;  2KCD A;  2E2T A;  2RFR A;  3FF2 A;  3F40 A;  4OVM A;  3CCS 3;  5AEU B;  1WNH A;  3JUN A;  2BMO B;  1UUW B;  2Z76 A;  3LOY A;  1JV2 B;  3AMO B;  3EN1 B;  4PEJ A;  3PS8 A;  2OOV A;  1J2B A;  3T0U A;  1S72 3;  4EC6 A;  1RRH A;  3SVA A;  1F8N A;  5AYS C;  1SQW A;  4N6U A;  1DYU A;  4H61 A;  3K0Z A;  2P38 A;  2OTJ 3;  1S5A A;  4O8S A;  3NBJ A;  3ECF A;  3FZW A;  3UNL A;  2Z6B A;  4R80 A;  1VQ9 3;  5KP4 A;  3X40 A;  1VQ6 3;  3MG1 A;  4NHF A;  3NXJ A;  4JF8 A;  4N6O B;  3F9S A;  4R1K A;  1RN7 A;  4FCM A;  3G71 3;  2RCD A;  1LVN A;  3CCL 3;  2XR8 B;  5DRE A;  1IVX A;  2XSO B;  1EG9 B;  1C7H A;  1W2Z A;  2FXT A;  4HZ9 B;  4EXR A;  2KRT A;  3HII A;  3LTB A;  1VQK 3;  1K8A 4;  1QMA A;  2QA4 3;  2WO0 A;  1OH0 A;  1KC8 4;  2P09 A;  2E2U A;  1W7C A;  4N6M A;  4MEI A;  5FW5 A;  5JPP A;  1BUQ A;  1MNL A;  1SIH A;  7STD A;  3CPO A;  2BMQ B;  5CF1 A;  2L4V A;  4L8P A;  1Q82 4;  3B7C A;  3H51 A;  3S28 A;  1IV9 A;  3VSY A;  3MKI A;  3ALA A;  3NUV A;  5G2G A;  4N6L A;  1VQO 3;  2I9W A;  3MWZ A;  1SPU A;  1WMO A;  2Y73 A;  3T8N A;  4N6V 0;  4RNY A;  3OWY A;  2FGT A;  1AV4 A;  2BNG A;  3A76 A;  1SII A;  3NV0 B;  4BTY A;  5CXO A;  1GS3 A;  3LT8 A;  1NO3 A;  3EHC A;  3NBR A;  2XFT A;  1A2V A;  1OCV A;  4WYK B;  3X41 A;  3OX9 A;  4K1V A;  1FGT A;  3PCS A;  4L7K A;  3GWR A;  5KP3 A;  4FMD A;  2K54 A;  1WMP A;  1JRQ A;  3LZA A;  2QIY A;  2LQV A;  1RRL A;  3F14 A;  1OHO A;  3FKA A;  2SBL A;  1KWI A;  4AKZ A;  2GU1 A;  1W6G A;  2W6J H;  4G1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...