1OPYA

Ksi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA5-3-KETOSTEROID IOSMERASE
publication title High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1opyA00
3F7XA 4K1UA 1OHSA 3BB9A 5IEOA 3FF2A 3GZYB 4PEJA 3NUVA 2GBXB 1BUQA 3F7SA 3KSPA 2B24B 1EA2A 3HZPA 2HMMB 4L8PA 3HK4A 1GYBA 1EG9B 3FKAA 1IDPA 2CKFB 3NBRA 5CXOA 4HM0B 4HM1B 1VZZA 4GB5A 2Z76A 2QGUA 1QMAA 3F40A 1JKGA 3GZRA 2HMJB 5KP3A 2W2CA 5IERA 3B8LA 3DUKA 3DZLA 2CHCA 5IF6A 4WWUC 4CDLA 4FCJA 3JUMA 4L7KA 3GZBA 4HZ9B 4LMIA 4XBYA 1O7NB 5STDA 3EN1B 2HMNB 3B4PA 2Z77A 1Q40B 3B4OA 3NM2A 3EBTA 1ULJB 3NV0B 3CPOA 3HX8A 5IEPA 1OGZA 5IG3A 1DMNA 5AIFA 5DREA 2B1XB 1SJWA 1S5AA 3F8XA 7STDA 2GBWB 3JUNA 2RCDA 2R4IA 3OV4A 5HGRA 4XDWA 3LYGA 3RGRA 3NHXA 5D81A 5CF2A 4STDA 2XRXB 1K41A 1OH0A 3STDA 3IPTA 3WMDA 4XBXA 3BLZA 2XR8B 2A15A 4I4KA 3SOAA 1WQLB 3GRDA 1UUVB 4XBTA 3F9SA 4HM6B 3M8CA 3FGYA 3EN8A 5CK6A 1Q40A 5D82A 1ASKA 5AEWB 3S5CA 3NV0A 4XB5A 3ER7A 5EVHA 4WYKB 4RZMA 2HMKB 3B7CA 4HJLB 4J8TA 2I9WA 3UJMA 1JB5A 2RGQA 3KZTA 4ORLA 4LGQA 2IMJA 3JUQA 5AIGA 4FCMA 4HKVB 3GWRA 1GY5A 3SOYA 1UUWB 5IENA 2JQ5A 3EC9A 3F14A 1ULIB 2INXA 5KP1A 4L8OA 2BMOB 3DM8A 1O7MB 2UX0A 3MHEA 1JB2A 1JN5B 5FW5A 2XSHB 2GEYA 3FF0A 2F98A 1A2KA 1OPYA 3G16A 1OF5B 3MYTA 3EHCA 3ROBA 1ISKA 5BXQA 4X2OA 3FZWA 4WYKA 3OWSA 1QJGA 4R1KA 5KP4A 5IG0A 4HM8B 1DMMA 4XDVA 3DMCA 3GZXB 2HMOB 4U13A 5G2GA 2F99A 5JPUA 1Z1SA 1JB4A 3G0KA 1ZX2A 3ECFA 1GY7A 4R9KA 2HMLB 1STDA 3MSOA 1JN5A 1OUNA 2BNGA 3OWYA 3OWUA 1OF5A 4HVNA 2Z7AA 4HM3B 3EF8A 4XM4A 3RGAA 5AIIA 4R9LA 1C7HA 1OHPA 3DXOA 5TGNA 3EX9A 3MG3A 3LZAA 1TUHA 3G8ZA 3VSYA 4Q53A 4WP5A 1TP6A 1O7WB 1AR0A 2STDA 3FSDA 2K54A 8CHOA 1O7GB 4HM4B 4K1VA 1HKXA 3MG1A 5CF1A 1OCVA 1W01A 2BMRB 2GXFA 3EQQB 5AEUB 1E97A 3MG2A 1NWWA 1W6YA 3JUOA 2XSOB 3H3HA 3T8NA 5AI1A 2YFIB 5CLKA 2QIYA 1OHOA 4MJDA 3D9RA 4N3VA 3KE7A 3FH1A 3Q90A 4HZBB 5IG5A 1O7PB 1U5OA 4OVMA 1GS3A 5AIHA 3OXAA 3H51A 2YFJB 4H3UA 2F86B 4HM5B 1E3VA 1OGXA 4HM2B 1W02A 2BMQB 1GY6A 2RFRA 3CNMA 1NU3A 3UNLA 1W00A 2OWPA 3K0ZA 3A76A 3MKIA 1E3RA 1ZO2A 3T8UA 3EJVA 6STDA 1O7HB 3FLJA 3I0YA 3CU3A 1NDOB 2GEXA 4OUQA 1Q42A 3K7CA 4HM7B 4J9AA 5BVBA 5IG4A 2PZVA 1CQSA 1JKGB 3EBYA 3VGNA 3OX9A 5DRVA 3KKGA 4LEHA 1DMQA 2YFLB 4IIAA 3E99A 3JUPA 3F8HA 5JPPA 4KVHA 3NXJA 3SEDA 4X2HA 5D83A 3CNXA
chains in the Genus database with same CATH superfamily
1AQZA 1RNTA 3F7XA 4EV5A 2XH9A 1LNHA 3LH4A 4HBRA 4K1UA 3Q2PA 4FMBA 1OHSA 3BB9A 3LT8A 3BIRA 4OK0A 5IEOA 3AMOA 1MWUA 3FF2A 3GZYB 1QVG2 3WOEB 1YHQ3 4PEJA 4I5QA 2XF3A 3NUVA 1AV4A 2L4VA 1BNRA 1C54A 2GBXB 3CCL3 1B2SA 1BUQA 3F7SA 3NX0A 3KSPA 1VQ73 1BGSA 3Q3FA 1YVBI 1DVDA 2B24B 1EA2A 3HZPA 2HMMB 4L8PA 1JJ22 1JZOA 4BL3A 2OTJ3 2E2VA 1LQGC 3HK4A 2LQVA 1GYBA 1EG9B 3FKAA 1IDPA 3BNEA 2CKFB 1J2BA 3WODG 1W7CA 3NBRA 5CXOA 4HM0B 4HM1B 2LYXA 1MGRA 1RCLA 1I70A 3AHWA 1YJ93 1VZZA 1KC84 2WGQA 4GB5A 2Z76A 1GD3A 3T0UA 2QGUA 1FGTA 1QMAA 3F40A 1D6ZA 1JKGA 2W9PA 3GZRA 1T2IA 2HMJB 5KP3A 3WA2X 1VQ63 2IUKA 2W2CA 5IERA 4GHOA 4J5GA 3B8LA 1A2VA 3DGYA 7RNTA 4EBGA 2CG1A 4DKIA 2JDIH 5FGOA 1YJW3 2Q07A 2P0XA 2ZDJA 2K3DA 1FUSA 2UUGC 2XEPA 3DUKA 4FMCA 3LT9A 4R4KA 1TFOA 1JRQA 3IMAB 1BNIA 1LVNA 2Z6BA 3DZLA 1TFKA 2CHCA 5IF6A 4WWUC 4CDLA 4EYCA 2H0HA 4FCJA 3JUMA 1IV7A 1OACA 1QVF2 1IVVA 4L7KA 1JBRA 3GZBA 4HZ9B 1UW1A 3HIIA 4LMIA 6RNTA 4KT3B 4XBYA 1O7NB 1YJN3 5STDA 3G6E3 2P09A 5RNTA 2W04A 3EN1B 1LNIA 1EKMA 1LQMB 2HMNB 3RDEA 4O2HA 1QALA 3B4PA 3KIIA 2Z77A 3GAXA 3DGOA 1BRHA 4RBNA 3K5TA 4HAAA 1Q40B 3B4OA 2CWUA 3NM2A 3EBTA 2O9UX 3DGMA 4QWTA 1KD14 1IYYA 1VQQA 3LTCA 1ULJB 3NV0B 3CPOA 3HX8A 2XGLA 3ZG5A 5IEPA 1FA3A 1OGZA 1R4YA 1SARA 3V98A 5IG3A 1BIRA 1DMNA 5LC7A 2K0MA 2XGNA 3TDGA 1YIT3 4HOHA 2D42A 5AIFA 5DREA 1M1XB 2B1XB 1SJWA 2CW9A 9RNTA 3D4AA 1BNFA 1S5AA 1ZGXA 3UL5A 1BNSA 3S28A 1I8VA 1X1YA 1W6GA 3F8XA 7STDA 1DVCA 2GBWB 3MWZA 4NPBA 1RRHA 3X3YA 1I0XA 1BUJA 3JUNA 4K61A 1N8R4 4N6LA 2RCDA 3OW22 2GU3A 1G96A 2R4IA 2XFSA 1MWTA 1B2XA 2MF7A 4N6OB 3CCU3 1SIHA 1QAKA 2ZL8A 3OV4A 2CX0A 4O3VA 5HGRA 1IQ8A 1X1XA 1TU5A 4XDWA 1WMOA 3LYGA 1D6YA 3RGRA 3NHXA 5D81A 5CF2A 1GMRA 3G4S3 1K28A 4FMAA 1YI23 4STDA 3SYUA 2XRXB 1VQ83 1Q7Y4 1NJI4 2OOVC 1K41A 1GMPA 1OH0A 3CPW2 3STDA 3IPTA 1SIIA 4RNZA 3WMDA 1IV9A 3BLZA 1GD4A 2XR8B 4XBXA 2A15A 3SVAA 5LC6A 1T5YA 3KSED 4I4KA 3SOAA 3D5IA 3J7Yd 3X40A 2RSXA 2HOHA 1WQLB 1BRKA 3GRDA 3CCS3 1UUVB 3X3ZA 4BTYA 4KFDA 1W2B2 4XBTA 3F9SA 1NNVA 2OCTA 4HM6B 3M8CA 3FGYA 2OQEA 1B2ZA 3EN8A 5CK6A 1Q40A 5IW9A 3WR2A 5D82A 2H0IA 1ASKA 2W6JH 3V99A 3CC23 1ROAA 5AEWB 3S5CA 1STFI 1GMQA 3LTAA 3LOYA 1BNGA 1BOXA 3GSPA 3NV0A 4XB5A 3N8BA 3PCRA 1A2PA 1BANA 2WOHA 2OTL3 3ER7A 3CC43 5EVHA 4WYKB 4RZMA 2GU1A 2HMKB 3K9MC 3LMLA 4LSOA 1BVIA 3EE1A 2CFLA 3B7CA 4LZIA 2L1SA 4HJLB 1PFPA 6GSPA 4J8TA 2I9WA 2R41A 1IT7A 3UJMA 1KQS2 1BRNL 2KRTA 1JB5A 4WHAA 2AADA 3PGBA 3D3LA 2RGQA 2SARA 1A90A 2RBIA 2WOFA 3KZTA 1N9JA 4LGQA 4ORLA 2IMJA 3VF1A 5M1AA 5AYRB 3JUQA 5AIGA 1T2HA 1IVXA 2IUJA 4FCMA 4HKVB 3GWRA 1RGGA 1FGQA 1GY5A 5EQLA 1UUWB 3SOYA 4AEQA 4EW5A 5IENA 2JQ5A 4KFFA 5A0OB 1W6CA 3EC9A 2WO0A 1RDSA 3L0RA 3S27A 3X42A 7GSPA 3F14A 1V74A 1B27A 1ULIB 1N9EA 3UL6A 1CYUA 2INXA 1Y4KA 1GOVA 5KP1A 3UB1A 4L8OA 2BMOB 2F5MA 3PXMA 2XFTA 4TX4A 3DM8A 3ZFZA 1BSCA 1NB3I 1O7MB 3BNBA 2UX0A 3MHEA 1JB2A 1JN5B 1FYSA 1F8NA 1JNQA 1X1UA 3N54B 5FW5A 1YIJ3 2XSHB 2GEYA 1RGHA 3FF0A 2C10A 1RGCA 2CWTA 2F98A 1A2KA 1OPYA 2SBLA 2Y74A 3G16A 1U8CB 1N8QA 3I563 1OF5B 2F56A 1WMNA 2H0GA 3MYTA 1JV2B 3EHCA 4GL6A 1B20A 1RN7A 1ZS7A 1UI8A 3ROBA 1AVLA 4AKYA 1VQL3 1VQN3 4CPKA 1ISKA 1FUWA 1FUTA 5BXQA 4X2OA 2O3OA 2ML6A 2BU4A 1BNJA 1MWRA 3JVCA 4BU4A 4RNTA 4NREA 3FZWA 1DYUA 1M9GA 3A5EA 3HI7A 4WYKA 3OWSA 1QJGA 4R1KA 5KP4A 5IG0A 1BSBA 2QA43 3NBBA 4HM8B 4H61A 1DMMA 3CCR3 1WTHA 3BNDA 2ZHXB 2W0QA 4XDVA 1PU4A 4BTWA 3DMCA 2CFDA 3GZXB 2HMOB 2ZA4A 4CCVA 4JF8A 4BL2A 3D79A 1EQKA 1B3SA 3IJEB 1RKYA 4U13A 1TJDA 5G2GA 2F99A 2MC8A 1EUIC 1Z1SA 3FCSB 4MEIA 5JPUA 3WA3A 1JB4A 1UCIA 3G0KA 1LOXA 1N5PA 1ZX2A 2CFWA 1RGAA 3ECFA 1VQ53 2M7OA 3WHOA 1GSPA 1UI7A 1K734 1GOUA 1IQYA 3CC73 1GY7A 4R9KA 3FG4A 1I2EA 1RMSA 1US1A 2HMLB 1BRGA 3AGOA 2KF4A 2V1LA 3BNCA 1NB5I 1RLSA 2W9QA 1RJOA 3KN4A 1HU9A 1STDA 5ELJA 3MSOA 1JN5A 3Q1CA 1FGOA 1OUNA 3U1WA 1CH0A 2BNGA 4MMXB 1B2UA 3OWYA 4LYLB 1M1K4 3NQYA 3OWUA 2E2UA 3CCE3 1V57A 1Q814 3U97A 1OF5A 2CX1A 2CC3A 4HVNA 3CD63 2Z7AA 1IQXA 4HM3B 4KFEA 3DH2A 1RGKA 3EF8A 3G713 1RCKA 1JBTA 2AAEA 4XM4A 1IT8A 1UDII 5M18A 1NO3A 2KCDA 3RGAA 5AIIA 1MNLA 3CCQ3 4GSPA 2CWVA 4R9LA 4BTXA 4IT7A 4NHFA 1C7HA 1OHPA 3DXOA 1VQO3 5TGNA 1YGWA 3EX9A 3MG3A 1JBSA 4MMYB 1AVKA 3SX1A 3LZAA 1RGLA 1SQWA 1TUHA 4KZ1A 1I3IA 1MWSA 3EB8A 3G8ZA 4FR9A 3SXXA 1D6UA 3VSYA 1X1WA 4N6UA 4R80A 4Q53A 1Q7HA 4WP5A 1TP6A 1A67A 1O7WB 1AR0A 2STDA 1BU4A 3FSDA 2RNTA 4J5KA 1LOVA 5AYSC 1I2GA 3FG3A 2K54A 8CHOA 2CIUA 1O7GB 3WDGB 1G02A 4HM4B 2CFGA 1HZ1A 3NM7A 1IK3A 1TRQA 1DETA 1YGEA 4K1VA 1HKXA 5G1LA 1IU7A 2BHMA 3MG1A 5CF1A 1VQM3 1W5ZA 2F4YA 3LTDA 1OCVA 5M19A 1W01A 2BMRB 2P0MA 2GXFA 4O8SA 1BSDA 1RN4A 3EQQB 3WOFB 5AEUB 1E97A 1T3BA 3CME3 3MG2A 1Q864 1NWWA 3RNTA 1LXEA 1Q824 3KFQC 1W6YA 1QAFA 2XSOB 2W03A 3JUOA 1MGWA 3H3HA 3T8NA 3V92A 2KAAA 1N5HA 4WFOA 5AI1A 2YFIB 3PCSA 3NBJA 3ZG0A 5JBSA 1UUGB 1Q9EA 4O02B 5ELUA 3O8YA 1BSEA 1YNVX 4N6V0 2CH9A 5CLKA 2QIYA 1UGIA 1OHOA 3AHSA 2IY2A 4MJDA 3D9RA 1I0VA 1KSIA 2FNQA 3CCV3 3DGNA 1EEJA 4N3VA 2W56A 3KE7A 3CXC2 2QEX3 2KF6A 2BT3A 1RHLA 3SLUA 1I3FA 3FH1A 1UCJA 3ALAA 2OQEC 3Q90A 4HZBB 2PNCA 5IG5A 1O7PB 1RSNA 2P05A 1U5OA 4IPBA 3D5GA 4N6TA 1GS3A 3FG1A 4OVMA 5AIHA 1B2MA 3OXAA 3MPHA 1VQK3 1AY7A 2YFJB 3H51A 4H3UA 2F86B 4HM5B 4CJNA 1UCLA 1E3VA 1OGXA 4BIRA 1VQP3 1UCKA 5GSPA 3LXUX 3CCJ3 1LRAA 4FCZA 4HM2B 1PY3A 5EEOA 1G0TA 1W02A 1TIJA 2KF3A 1K8A4 1CEWI 1FZUA 1WNHA 2BMQB 2KXGA 3URPA 4EV2A 1WMPA 2CFKA 3QRDA 1RNBA 2OOVA 3X41A 2D1WA 2FXTA 1HYFA 1GY6A 1GOYA 2WGOA 1LOWA 5HOHA 1CYVA 1RN1A 1R4CA 1IVWA 1JZDA 2RFRA 2FGTA 1NU3A 3CNMA 4MMZB 4N6MA 4AKZA 2C11A 4EC6A 3UNLA 3AMOB 1W00A 2OWPA 4JRFA 3K0ZA 1K9M4 3PYJA 2IYJA 2CK3H 1B21A 2GSPA 4HYZA 1ROVA 5BIRA 3PS8A 3A76A 3MKIA 1FGRA 1E3RA 1TTOA 1ZO2A 3PZWA 3T8UA 1LOYA 1VQ93 1RGFA 1MOLA 1BRJA 3HOHA 1L5GB 1FGMA 1BNEA 4N6NB 1V58A 8RNTA 4RNYA 1PYLA 1BRSA 3EJVA 4EXRA 1M904 3K63A 2BIRA 1KWIA 2CG0A 6STDA 3AGNA 1O7HB 5I97A 1I2FA 2Y73A 2J8XB 3FLJA 3I0YA 1UGHI 3CU3A 3QK9A 1NDOB 2GEXA 4OUQA 2UGIA 1DE3A 1Q42A 2F5WA 3K7CA 3KCHA 3S67A 1S723 2KF5A 3BU4A 4FMDA 2ML5A 4HM7B 1BRIA 1SPUA 2YX9A 4J9AA 1BAOA 2E2TA 4ILFA 1YVSA 5BVBA 3N9HA 2W56B 5IG4A 2PZVA 1VQ43 1CQSA 1W4NA 1JKGB 3EBYA 1BSAA 2IA7A 3LTBA 4G1MB 2P38A 1RTUA 3OX9A 3VGNA 5BU4A 5DRVA 3KKGA 1TRPA 4LEHA 1DMQA 1W2ZA 5G1KA 2YFLB 3DGLA 3I553 4ZM8A 4IIAA 3E99A 3DY5A 1RGEA 3HIGA 3JUPA 1RRLA 3CCM3 3F8HA 4K90B 2C4BA 5JPPA 4KVHA 3NXJA 3S29A 3X3XA 3CMA3 1IVUA 3SEDA 4X2HA 5D83A 3NQZA 2BO9B 1FW7A 3CNXA
chains in the Genus database with same CATH topology
3F7XA 4EV5A 2XH9A 1LNHA 3LH4A 4HBRA 4K1UA 3Q2PA 4FMBA 1OHSA 3BB9A 3LT8A 4OK0A 5IEOA 3AMOA 3FF2A 3GZYB 1QVG2 3WOEB 1YHQ3 4PEJA 2XF3A 3NUVA 1AV4A 2L4VA 2GBXB 3CCL3 1BUQA 3F7SA 3NX0A 3KSPA 1VQ73 1YVBI 1DVDA 2B24B 1EA2A 3HZPA 2HMMB 4L8PA 1JJ22 2OTJ3 2E2VA 3HK4A 2LQVA 1GYBA 1EG9B 3FKAA 1IDPA 3BNEA 2CKFB 1J2BA 3WODG 1W7CA 3NBRA 5CXOA 4HM0B 4HM1B 2LYXA 1YJ93 1VZZA 1KC84 2WGQA 4GB5A 2Z76A 1GD3A 3T0UA 2QGUA 1FGTA 1QMAA 3F40A 1D6ZA 1JKGA 2W9PA 3GZRA 2HMJB 5KP3A 3WA2X 1VQ63 2IUKA 2W2CA 5IERA 3B8LA 1A2VA 4EBGA 2CG1A 2JDIH 5FGOA 1YJW3 2Q07A 2P0XA 2ZDJA 2XEPA 3DUKA 4FMCA 3LT9A 4R4KA 1TFOA 1JRQA 3IMAB 1LVNA 2Z6BA 3DZLA 1TFKA 2CHCA 5IF6A 4WWUC 4CDLA 4EYCA 4FCJA 3JUMA 1IV7A 1OACA 1QVF2 1IVVA 4L7KA 3GZBA 4HZ9B 1UW1A 3HIIA 4LMIA 4XBYA 1O7NB 1YJN3 5STDA 3G6E3 2P09A 2W04A 3EN1B 1EKMA 2HMNB 3RDEA 4O2HA 1QALA 3B4PA 3KIIA 2Z77A 3GAXA 3DGOA 4RBNA 3K5TA 1Q40B 3B4OA 2CWUA 3NM2A 3EBTA 2O9UX 3DGMA 4QWTA 1KD14 3LTCA 1ULJB 3NV0B 3CPOA 3HX8A 2XGLA 1FA3A 5IEPA 1OGZA 3V98A 5IG3A 1DMNA 5LC7A 2K0MA 2XGNA 3TDGA 1YIT3 2D42A 5AIFA 5DREA 1M1XB 2B1XB 1SJWA 2CW9A 1S5AA 3UL5A 3S28A 1W6GA 3F8XA 7STDA 2GBWB 1DVCA 3MWZA 1RRHA 3X3YA 3JUNA 4K61A 1N8R4 4N6LA 2RCDA 3OW22 2GU3A 1G96A 2R4IA 2XFSA 2MF7A 4N6OB 3CCU3 1SIHA 1QAKA 2ZL8A 3OV4A 5HGRA 4O3VA 1IQ8A 1TU5A 4XDWA 1WMOA 3LYGA 1D6YA 3RGRA 3NHXA 5D81A 5CF2A 3G4S3 1K28A 4FMAA 1YI23 4STDA 1VQ83 2XRXB 1Q7Y4 1NJI4 2OOVC 1K41A 1OH0A 3CPW2 3STDA 3IPTA 1SIIA 4RNZA 3WMDA 1IV9A 3BLZA 1GD4A 2XR8B 4XBXA 2A15A 3SVAA 5LC6A 1T5YA 3KSED 4I4KA 3SOAA 3J7Yd 3X40A 2RSXA 3CCS3 1WQLB 3GRDA 1UUVB 3X3ZA 4BTYA 4KFDA 1W2B2 4XBTA 3F9SA 2OCTA 4HM6B 3M8CA 3FGYA 2OQEA 3EN8A 5CK6A 5IW9A 1Q40A 5D82A 1ASKA 2W6JH 3V99A 3CC23 1ROAA 5AEWB 3S5CA 1STFI 3LTAA 3LOYA 3NV0A 4XB5A 3N8BA 3PCRA 2OTL3 3CC43 2WOHA 3ER7A 5EVHA 4WYKB 4RZMA 2GU1A 2HMKB 3K9MC 3LMLA 4LSOA 3EE1A 2CFLA 3B7CA 4LZIA 4HJLB 1PFPA 4J8TA 2I9WA 1KQS2 1IT7A 3UJMA 2KRTA 1JB5A 4WHAA 3PGBA 3D3LA 2RGQA 1A90A 2WOFA 3KZTA 1N9JA 4LGQA 4ORLA 2IMJA 3VF1A 5AYRB 3JUQA 5AIGA 1IVXA 2IUJA 4FCMA 4HKVB 3GWRA 1FGQA 1GY5A 5EQLA 1UUWB 3SOYA 4AEQA 5IENA 2JQ5A 4KFFA 5A0OB 1W6CA 3EC9A 2WO0A 3L0RA 3S27A 3X42A 3F14A 1V74A 1ULIB 1N9EA 3UL6A 1CYUA 2INXA 1Y4KA 5KP1A 3UB1A 4L8OA 2BMOB 3PXMA 2XFTA 4TX4A 3DM8A 1NB3I 1O7MB 3BNBA 2UX0A 3MHEA 1JB2A 1JN5B 1F8NA 3N54B 1JNQA 1YIJ3 5FW5A 2XSHB 2GEYA 3FF0A 2C10A 2CWTA 2F98A 1A2KA 1OPYA 2SBLA 2Y74A 3G16A 1U8CB 1N8QA 3I563 1OF5B 1WMNA 3MYTA 1JV2B 3EHCA 4GL6A 1RN7A 1UI8A 3ROBA 1AVLA 4AKYA 1VQL3 1VQN3 1ISKA 1FUWA 5BXQA 4X2OA 2O3OA 2ML6A 3JVCA 4NREA 3FZWA 1DYUA 1M9GA 3HI7A 4WYKA 3OWSA 1QJGA 4R1KA 5KP4A 5IG0A 2QA43 3NBBA 4HM8B 4H61A 1DMMA 3CCR3 1WTHA 3BNDA 2W0QA 4XDVA 1PU4A 4BTWA 3DMCA 2CFDA 3GZXB 2HMOB 4CCVA 4JF8A 1EQKA 3IJEB 1RKYA 4U13A 5G2GA 2F99A 2MC8A 1Z1SA 4MEIA 3FCSB 5JPUA 3WA3A 1JB4A 3G0KA 1LOXA 1N5PA 1ZX2A 2CFWA 3ECFA 1VQ53 2M7OA 1UI7A 1K734 1IQYA 3CC73 1GY7A 4R9KA 3FG4A 1US1A 2HMLB 2V1LA 3BNCA 1NB5I 2W9QA 1RJOA 3KN4A 1HU9A 1STDA 5ELJA 3MSOA 1JN5A 3Q1CA 1FGOA 1OUNA 3U1WA 2BNGA 4MMXB 3OWYA 1M1K4 3NQYA 3OWUA 2E2UA 3CCE3 1Q814 3U97A 1OF5A 2CC3A 4HVNA 3CD63 2Z7AA 1IQXA 4HM3B 4KFEA 3EF8A 3G713 4XM4A 1IT8A 1NO3A 2KCDA 3RGAA 5AIIA 1MNLA 3CCQ3 4R9LA 2CWVA 4BTXA 4IT7A 4NHFA 1C7HA 1OHPA 3DXOA 1VQO3 5TGNA 3EX9A 3MG3A 4MMYB 1AVKA 3SX1A 3LZAA 1SQWA 1TUHA 4KZ1A 3G8ZA 3EB8A 4FR9A 3SXXA 1D6UA 3VSYA 4N6UA 4R80A 4Q53A 4WP5A 1TP6A 1A67A 1O7WB 1AR0A 2STDA 3FSDA 5AYSC 3FG3A 2K54A 8CHOA 2CIUA 1O7GB 3WDGB 4HM4B 2CFGA 3NM7A 1IK3A 1YGEA 4K1VA 1HKXA 1IU7A 2BHMA 3MG1A 5CF1A 1VQM3 1W5ZA 3LTDA 1OCVA 1W01A 2BMRB 2P0MA 2GXFA 4O8SA 3EQQB 3WOFB 5AEUB 1E97A 3CME3 3MG2A 1Q864 1NWWA 1LXEA 1Q824 3KFQC 1W6YA 1QAFA 2XSOB 2W03A 3JUOA 3H3HA 3T8NA 3V92A 4WFOA 1N5HA 5AI1A 2YFIB 3PCSA 3NBJA 5JBSA 4O02B 5ELUA 3O8YA 4N6V0 2CH9A 5CLKA 2QIYA 1OHOA 4MJDA 3D9RA 2FNQA 1KSIA 3CCV3 3DGNA 4N3VA 2W56A 3KE7A 3CXC2 2QEX3 2BT3A 3SLUA 3FH1A 3ALAA 2OQEC 3Q90A 4HZBB 2PNCA 5IG5A 1O7PB 2P05A 1U5OA 4IPBA 4N6TA 4OVMA 1GS3A 3FG1A 5AIHA 3OXAA 3MPHA 1VQK3 3H51A 2YFJB 4H3UA 2F86B 4HM5B 1E3VA 1OGXA 1VQP3 3LXUX 3CCJ3 4FCZA 4HM2B 5EEOA 1W02A 1TIJA 1K8A4 1CEWI 1WNHA 4EV2A 2BMQB 2KXGA 1WMPA 2CFKA 3QRDA 2OOVA 3X41A 2D1WA 2FXTA 1GY6A 2WGOA 1CYVA 1R4CA 1IVWA 2RFRA 2FGTA 1NU3A 3CNMA 4MMZB 4N6MA 4AKZA 2C11A 4EC6A 3UNLA 3AMOB 1W00A 2OWPA 4JRFA 3K0ZA 1K9M4 3PYJA 2CK3H 4HYZA 1ROVA 3PS8A 3A76A 3MKIA 1FGRA 1E3RA 1ZO2A 3PZWA 3T8UA 1VQ93 1MOLA 1L5GB 1FGMA 4N6NB 4RNYA 3EJVA 1M904 4EXRA 3K63A 1KWIA 2CG0A 6STDA 5I97A 1O7HB 2Y73A 3FLJA 3I0YA 3CU3A 3QK9A 1NDOB 2GEXA 4OUQA 1Q42A 3K7CA 3S67A 1S723 4FMDA 2ML5A 4HM7B 1SPUA 2YX9A 4J9AA 2E2TA 5BVBA 3N9HA 2W56B 5IG4A 2PZVA 1VQ43 1CQSA 1W4NA 1JKGB 3EBYA 3LTBA 2IA7A 4G1MB 3VGNA 2P38A 3OX9A 5DRVA 3KKGA 4LEHA 1DMQA 1W2ZA 2YFLB 3DGLA 3I553 4ZM8A 4IIAA 3E99A 3DY5A 3HIGA 3JUPA 1RRLA 3CCM3 3F8HA 4K90B 5JPPA 4KVHA 3NXJA 3S29A 3X3XA 3CMA3 1IVUA 3SEDA 4X2HA 5D83A 3NQZA 2BO9B 3CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7X A;  4K1U A;  1OHS A;  3BB9 A;  5IEO A;  3FF2 A;  3GZY B;  4PEJ A;  3NUV A;  2GBX B;  1BUQ A;  3F7S A;  3KSP A;  2B24 B;  1EA2 A;  3HZP A;  2HMM B;  4L8P A;  3HK4 A;  1GYB A;  1EG9 B;  3FKA A;  1IDP A;  2CKF B;  3NBR A;  5CXO A;  4HM0 B;  4HM1 B;  1VZZ A;  4GB5 A;  2Z76 A;  2QGU A;  1QMA A;  3F40 A;  1JKG A;  3GZR A;  2HMJ B;  5KP3 A;  2W2C A;  5IER A;  3B8L A;  3DUK A;  3DZL A;  2CHC A;  5IF6 A;  4WWU C;  4CDL A;  4FCJ A;  3JUM A;  4L7K A;  3GZB A;  4HZ9 B;  4LMI A;  4XBY A;  1O7N B;  5STD A;  3EN1 B;  2HMN B;  3B4P A;  2Z77 A;  1Q40 B;  3B4O A;  3NM2 A;  3EBT A;  1ULJ B;  3NV0 B;  3CPO A;  3HX8 A;  5IEP A;  1OGZ A;  5IG3 A;  1DMN A;  5AIF A;  5DRE A;  2B1X B;  1SJW A;  1S5A A;  3F8X A;  7STD A;  2GBW B;  3JUN A;  2RCD A;  2R4I A;  3OV4 A;  5HGR A;  4XDW A;  3LYG A;  3RGR A;  3NHX A;  5D81 A;  5CF2 A;  4STD A;  2XRX B;  1K41 A;  1OH0 A;  3STD A;  3IPT A;  3WMD A;  4XBX A;  3BLZ A;  2XR8 B;  2A15 A;  4I4K A;  3SOA A;  1WQL B;  3GRD A;  1UUV B;  4XBT A;  3F9S A;  4HM6 B;  3M8C A;  3FGY A;  3EN8 A;  5CK6 A;  1Q40 A;  5D82 A;  1ASK A;  5AEW B;  3S5C A;  3NV0 A;  4XB5 A;  3ER7 A;  5EVH A;  4WYK B;  4RZM A;  2HMK B;  3B7C A;  4HJL B;  4J8T A;  2I9W A;  3UJM A;  1JB5 A;  2RGQ A;  3KZT A;  4ORL A;  4LGQ A;  2IMJ A;  3JUQ A;  5AIG A;  4FCM A;  4HKV B;  3GWR A;  1GY5 A;  3SOY A;  1UUW B;  5IEN A;  2JQ5 A;  3EC9 A;  3F14 A;  1ULI B;  2INX A;  5KP1 A;  4L8O A;  2BMO B;  3DM8 A;  1O7M B;  2UX0 A;  3MHE A;  1JB2 A;  1JN5 B;  5FW5 A;  2XSH B;  2GEY A;  3FF0 A;  2F98 A;  1A2K A;  1OPY A;  3G16 A;  1OF5 B;  3MYT A;  3EHC A;  3ROB A;  1ISK A;  5BXQ A;  4X2O A;  3FZW A;  4WYK A;  3OWS A;  1QJG A;  4R1K A;  5KP4 A;  5IG0 A;  4HM8 B;  1DMM A;  4XDV A;  3DMC A;  3GZX B;  2HMO B;  4U13 A;  5G2G A;  2F99 A;  5JPU A;  1Z1S A;  1JB4 A;  3G0K A;  1ZX2 A;  3ECF A;  1GY7 A;  4R9K A;  2HML B;  1STD A;  3MSO A;  1JN5 A;  1OUN A;  2BNG A;  3OWY A;  3OWU A;  1OF5 A;  4HVN A;  2Z7A A;  4HM3 B;  3EF8 A;  4XM4 A;  3RGA A;  5AII A;  4R9L A;  1C7H A;  1OHP A;  3DXO A;  5TGN A;  3EX9 A;  3MG3 A;  3LZA A;  1TUH A;  3G8Z A;  3VSY A;  4Q53 A;  4WP5 A;  1TP6 A;  1O7W B;  1AR0 A;  2STD A;  3FSD A;  2K54 A;  8CHO A;  1O7G B;  4HM4 B;  4K1V A;  1HKX A;  3MG1 A;  5CF1 A;  1OCV A;  1W01 A;  2BMR B;  2GXF A;  3EQQ B;  5AEU B;  1E97 A;  3MG2 A;  1NWW A;  1W6Y A;  3JUO A;  2XSO B;  3H3H A;  3T8N A;  5AI1 A;  2YFI B;  5CLK A;  2QIY A;  1OHO A;  4MJD A;  3D9R A;  4N3V A;  3KE7 A;  3FH1 A;  3Q90 A;  4HZB B;  5IG5 A;  1O7P B;  1U5O A;  4OVM A;  1GS3 A;  5AIH A;  3OXA A;  3H51 A;  2YFJ B;  4H3U A;  2F86 B;  4HM5 B;  1E3V A;  1OGX A;  4HM2 B;  1W02 A;  2BMQ B;  1GY6 A;  2RFR A;  3CNM A;  1NU3 A;  3UNL A;  1W00 A;  2OWP A;  3K0Z A;  3A76 A;  3MKI A;  1E3R A;  1ZO2 A;  3T8U A;  3EJV A;  6STD A;  1O7H B;  3FLJ A;  3I0Y A;  3CU3 A;  1NDO B;  2GEX A;  4OUQ A;  1Q42 A;  3K7C A;  4HM7 B;  4J9A A;  5BVB A;  5IG4 A;  2PZV A;  1CQS A;  1JKG B;  3EBY A;  3VGN A;  3OX9 A;  5DRV A;  3KKG A;  4LEH A;  1DMQ A;  2YFL B;  4IIA A;  3E99 A;  3JUP A;  3F8H A;  5JPP A;  4KVH A;  3NXJ A;  3SED A;  4X2H A;  5D83 A;  3CNX A; 
#chains in the Genus database with same CATH topology
 1AQZ A;  1RNT A;  3F7X A;  4EV5 A;  2XH9 A;  1LNH A;  3LH4 A;  4HBR A;  4K1U A;  3Q2P A;  4FMB A;  1OHS A;  3BB9 A;  3LT8 A;  3BIR A;  4OK0 A;  5IEO A;  3AMO A;  1MWU A;  3FF2 A;  3GZY B;  1QVG 2;  3WOE B;  1YHQ 3;  4PEJ A;  4I5Q A;  2XF3 A;  3NUV A;  1AV4 A;  2L4V A;  1BNR A;  1C54 A;  2GBX B;  3CCL 3;  1B2S A;  1BUQ A;  3F7S A;  3NX0 A;  3KSP A;  1VQ7 3;  1BGS A;  3Q3F A;  1YVB I;  1DVD A;  2B24 B;  1EA2 A;  3HZP A;  2HMM B;  4L8P A;  1JJ2 2;  1JZO A;  4BL3 A;  2OTJ 3;  2E2V A;  1LQG C;  3HK4 A;  2LQV A;  1GYB A;  1EG9 B;  3FKA A;  1IDP A;  3BNE A;  2CKF B;  1J2B A;  3WOD G;  1W7C A;  3NBR A;  5CXO A;  4HM0 B;  4HM1 B;  2LYX A;  1MGR A;  1RCL A;  1I70 A;  3AHW A;  1YJ9 3;  1VZZ A;  1KC8 4;  2WGQ A;  4GB5 A;  2Z76 A;  1GD3 A;  3T0U A;  2QGU A;  1FGT A;  1QMA A;  3F40 A;  1D6Z A;  1JKG A;  2W9P A;  3GZR A;  1T2I A;  2HMJ B;  5KP3 A;  3WA2 X;  1VQ6 3;  2IUK A;  2W2C A;  5IER A;  4GHO A;  4J5G A;  3B8L A;  1A2V A;  3DGY A;  7RNT A;  4EBG A;  2CG1 A;  4DKI A;  2JDI H;  5FGO A;  1YJW 3;  2Q07 A;  2P0X A;  2ZDJ A;  2K3D A;  1FUS A;  2UUG C;  2XEP A;  3DUK A;  4FMC A;  3LT9 A;  4R4K A;  1TFO A;  1JRQ A;  3IMA B;  1BNI A;  1LVN A;  2Z6B A;  3DZL A;  1TFK A;  2CHC A;  5IF6 A;  4WWU C;  4CDL A;  4EYC A;  2H0H A;  4FCJ A;  3JUM A;  1IV7 A;  1OAC A;  1QVF 2;  1IVV A;  4L7K A;  1JBR A;  3GZB A;  4HZ9 B;  1UW1 A;  3HII A;  4LMI A;  6RNT A;  4KT3 B;  4XBY A;  1O7N B;  1YJN 3;  5STD A;  3G6E 3;  2P09 A;  5RNT A;  2W04 A;  3EN1 B;  1LNI A;  1EKM A;  1LQM B;  2HMN B;  3RDE A;  4O2H A;  1QAL A;  3B4P A;  3KII A;  2Z77 A;  3GAX A;  3DGO A;  1BRH A;  4RBN A;  3K5T A;  4HAA A;  1Q40 B;  3B4O A;  2CWU A;  3NM2 A;  3EBT A;  2O9U X;  3DGM A;  4QWT A;  1KD1 4;  1IYY A;  1VQQ A;  3LTC A;  1ULJ B;  3NV0 B;  3CPO A;  3HX8 A;  2XGL A;  3ZG5 A;  5IEP A;  1FA3 A;  1OGZ A;  1R4Y A;  1SAR A;  3V98 A;  5IG3 A;  1BIR A;  1DMN A;  5LC7 A;  2K0M A;  2XGN A;  3TDG A;  1YIT 3;  4HOH A;  2D42 A;  5AIF A;  5DRE A;  1M1X B;  2B1X B;  1SJW A;  2CW9 A;  9RNT A;  3D4A A;  1BNF A;  1S5A A;  1ZGX A;  3UL5 A;  1BNS A;  3S28 A;  1I8V A;  1X1Y A;  1W6G A;  3F8X A;  7STD A;  1DVC A;  2GBW B;  3MWZ A;  4NPB A;  1RRH A;  3X3Y A;  1I0X A;  1BUJ A;  3JUN A;  4K61 A;  1N8R 4;  4N6L A;  2RCD A;  3OW2 2;  2GU3 A;  1G96 A;  2R4I A;  2XFS A;  1MWT A;  1B2X A;  2MF7 A;  4N6O B;  3CCU 3;  1SIH A;  1QAK A;  2ZL8 A;  3OV4 A;  2CX0 A;  4O3V A;  5HGR A;  1IQ8 A;  1X1X A;  1TU5 A;  4XDW A;  1WMO A;  3LYG A;  1D6Y A;  3RGR A;  3NHX A;  5D81 A;  5CF2 A;  1GMR A;  3G4S 3;  1K28 A;  4FMA A;  1YI2 3;  4STD A;  3SYU A;  2XRX B;  1VQ8 3;  1Q7Y 4;  1NJI 4;  2OOV C;  1K41 A;  1GMP A;  1OH0 A;  3CPW 2;  3STD A;  3IPT A;  1SII A;  4RNZ A;  3WMD A;  1IV9 A;  3BLZ A;  1GD4 A;  2XR8 B;  4XBX A;  2A15 A;  3SVA A;  5LC6 A;  1T5Y A;  3KSE D;  4I4K A;  3SOA A;  3D5I A;  3J7Y d;  3X40 A;  2RSX A;  2HOH A;  1WQL B;  1BRK A;  3GRD A;  3CCS 3;  1UUV B;  3X3Z A;  4BTY A;  4KFD A;  1W2B 2;  4XBT A;  3F9S A;  1NNV A;  2OCT A;  4HM6 B;  3M8C A;  3FGY A;  2OQE A;  1B2Z A;  3EN8 A;  5CK6 A;  1Q40 A;  5IW9 A;  3WR2 A;  5D82 A;  2H0I A;  1ASK A;  2W6J H;  3V99 A;  3CC2 3;  1ROA A;  5AEW B;  3S5C A;  1STF I;  1GMQ A;  3LTA A;  3LOY A;  1BNG A;  1BOX A;  3GSP A;  3NV0 A;  4XB5 A;  3N8B A;  3PCR A;  1A2P A;  1BAN A;  2WOH A;  2OTL 3;  3ER7 A;  3CC4 3;  5EVH A;  4WYK B;  4RZM A;  2GU1 A;  2HMK B;  3K9M C;  3LML A;  4LSO A;  1BVI A;  3EE1 A;  2CFL A;  3B7C A;  4LZI A;  2L1S A;  4HJL B;  1PFP A;  6GSP A;  4J8T A;  2I9W A;  2R41 A;  1IT7 A;  3UJM A;  1KQS 2;  1BRN L;  2KRT A;  1JB5 A;  4WHA A;  2AAD A;  3PGB A;  3D3L A;  2RGQ A;  2SAR A;  1A90 A;  2RBI A;  2WOF A;  3KZT A;  1N9J A;  4LGQ A;  4ORL A;  2IMJ A;  3VF1 A;  5M1A A;  5AYR B;  3JUQ A;  5AIG A;  1T2H A;  1IVX A;  2IUJ A;  4FCM A;  4HKV B;  3GWR A;  1RGG A;  1FGQ A;  1GY5 A;  5EQL A;  1UUW B;  3SOY A;  4AEQ A;  4EW5 A;  5IEN A;  2JQ5 A;  4KFF A;  5A0O B;  1W6C A;  3EC9 A;  2WO0 A;  1RDS A;  3L0R A;  3S27 A;  3X42 A;  7GSP A;  3F14 A;  1V74 A;  1B27 A;  1ULI B;  1N9E A;  3UL6 A;  1CYU A;  2INX A;  1Y4K A;  1GOV A;  5KP1 A;  3UB1 A;  4L8O A;  2BMO B;  2F5M A;  3PXM A;  2XFT A;  4TX4 A;  3DM8 A;  3ZFZ A;  1BSC A;  1NB3 I;  1O7M B;  3BNB A;  2UX0 A;  3MHE A;  1JB2 A;  1JN5 B;  1FYS A;  1F8N A;  1JNQ A;  1X1U A;  3N54 B;  5FW5 A;  1YIJ 3;  2XSH B;  2GEY A;  1RGH A;  3FF0 A;  2C10 A;  1RGC A;  2CWT A;  2F98 A;  1A2K A;  1OPY A;  2SBL A;  2Y74 A;  3G16 A;  1U8C B;  1N8Q A;  3I56 3;  1OF5 B;  2F56 A;  1WMN A;  2H0G A;  3MYT A;  1JV2 B;  3EHC A;  4GL6 A;  1B20 A;  1RN7 A;  1ZS7 A;  1UI8 A;  3ROB A;  1AVL A;  4AKY A;  1VQL 3;  1VQN 3;  4CPK A;  1ISK A;  1FUW A;  1FUT A;  5BXQ A;  4X2O A;  2O3O A;  2ML6 A;  2BU4 A;  1BNJ A;  1MWR A;  3JVC A;  4BU4 A;  4RNT A;  4NRE A;  3FZW A;  1DYU A;  1M9G A;  3A5E A;  3HI7 A;  4WYK A;  3OWS A;  1QJG A;  4R1K A;  5KP4 A;  5IG0 A;  1BSB A;  2QA4 3;  3NBB A;  4HM8 B;  4H61 A;  1DMM A;  3CCR 3;  1WTH A;  3BND A;  2ZHX B;  2W0Q A;  4XDV A;  1PU4 A;  4BTW A;  3DMC A;  2CFD A;  3GZX B;  2HMO B;  2ZA4 A;  4CCV A;  4JF8 A;  4BL2 A;  3D79 A;  1EQK A;  1B3S A;  3IJE B;  1RKY A;  4U13 A;  1TJD A;  5G2G A;  2F99 A;  2MC8 A;  1EUI C;  1Z1S A;  3FCS B;  4MEI A;  5JPU A;  3WA3 A;  1JB4 A;  1UCI A;  3G0K A;  1LOX A;  1N5P A;  1ZX2 A;  2CFW A;  1RGA A;  3ECF A;  1VQ5 3;  2M7O A;  3WHO A;  1GSP A;  1UI7 A;  1K73 4;  1GOU A;  1IQY A;  3CC7 3;  1GY7 A;  4R9K A;  3FG4 A;  1I2E A;  1RMS A;  1US1 A;  2HML B;  1BRG A;  3AGO A;  2KF4 A;  2V1L A;  3BNC A;  1NB5 I;  1RLS A;  2W9Q A;  1RJO A;  3KN4 A;  1HU9 A;  1STD A;  5ELJ A;  3MSO A;  1JN5 A;  3Q1C A;  1FGO A;  1OUN A;  3U1W A;  1CH0 A;  2BNG A;  4MMX B;  1B2U A;  3OWY A;  4LYL B;  1M1K 4;  3NQY A;  3OWU A;  2E2U A;  3CCE 3;  1V57 A;  1Q81 4;  3U97 A;  1OF5 A;  2CX1 A;  2CC3 A;  4HVN A;  3CD6 3;  2Z7A A;  1IQX A;  4HM3 B;  4KFE A;  3DH2 A;  1RGK A;  3EF8 A;  3G71 3;  1RCK A;  1JBT A;  2AAE A;  4XM4 A;  1IT8 A;  1UDI I;  5M18 A;  1NO3 A;  2KCD A;  3RGA A;  5AII A;  1MNL A;  3CCQ 3;  4GSP A;  2CWV A;  4R9L A;  4BTX A;  4IT7 A;  4NHF A;  1C7H A;  1OHP A;  3DXO A;  1VQO 3;  5TGN A;  1YGW A;  3EX9 A;  3MG3 A;  1JBS A;  4MMY B;  1AVK A;  3SX1 A;  3LZA A;  1RGL A;  1SQW A;  1TUH A;  4KZ1 A;  1I3I A;  1MWS A;  3EB8 A;  3G8Z A;  4FR9 A;  3SXX A;  1D6U A;  3VSY A;  1X1W A;  4N6U A;  4R80 A;  4Q53 A;  1Q7H A;  4WP5 A;  1TP6 A;  1A67 A;  1O7W B;  1AR0 A;  2STD A;  1BU4 A;  3FSD A;  2RNT A;  4J5K A;  1LOV A;  5AYS C;  1I2G A;  3FG3 A;  2K54 A;  8CHO A;  2CIU A;  1O7G B;  3WDG B;  1G02 A;  4HM4 B;  2CFG A;  1HZ1 A;  3NM7 A;  1IK3 A;  1TRQ A;  1DET A;  1YGE A;  4K1V A;  1HKX A;  5G1L A;  1IU7 A;  2BHM A;  3MG1 A;  5CF1 A;  1VQM 3;  1W5Z A;  2F4Y A;  3LTD A;  1OCV A;  5M19 A;  1W01 A;  2BMR B;  2P0M A;  2GXF A;  4O8S A;  1BSD A;  1RN4 A;  3EQQ B;  3WOF B;  5AEU B;  1E97 A;  1T3B A;  3CME 3;  3MG2 A;  1Q86 4;  1NWW A;  3RNT A;  1LXE A;  1Q82 4;  3KFQ C;  1W6Y A;  1QAF A;  2XSO B;  2W03 A;  3JUO A;  1MGW A;  3H3H A;  3T8N A;  3V92 A;  2KAA A;  1N5H A;  4WFO A;  5AI1 A;  2YFI B;  3PCS A;  3NBJ A;  3ZG0 A;  5JBS A;  1UUG B;  1Q9E A;  4O02 B;  5ELU A;  3O8Y A;  1BSE A;  1YNV X;  4N6V 0;  2CH9 A;  5CLK A;  2QIY A;  1UGI A;  1OHO A;  3AHS A;  2IY2 A;  4MJD A;  3D9R A;  1I0V A;  1KSI A;  2FNQ A;  3CCV 3;  3DGN A;  1EEJ A;  4N3V A;  2W56 A;  3KE7 A;  3CXC 2;  2QEX 3;  2KF6 A;  2BT3 A;  1RHL A;  3SLU A;  1I3F A;  3FH1 A;  1UCJ A;  3ALA A;  2OQE C;  3Q90 A;  4HZB B;  2PNC A;  5IG5 A;  1O7P B;  1RSN A;  2P05 A;  1U5O A;  4IPB A;  3D5G A;  4N6T A;  1GS3 A;  3FG1 A;  4OVM A;  5AIH A;  1B2M A;  3OXA A;  3MPH A;  1VQK 3;  1AY7 A;  2YFJ B;  3H51 A;  4H3U A;  2F86 B;  4HM5 B;  4CJN A;  1UCL A;  1E3V A;  1OGX A;  4BIR A;  1VQP 3;  1UCK A;  5GSP A;  3LXU X;  3CCJ 3;  1LRA A;  4FCZ A;  4HM2 B;  1PY3 A;  5EEO A;  1G0T A;  1W02 A;  1TIJ A;  2KF3 A;  1K8A 4;  1CEW I;  1FZU A;  1WNH A;  2BMQ B;  2KXG A;  3URP A;  4EV2 A;  1WMP A;  2CFK A;  3QRD A;  1RNB A;  2OOV A;  3X41 A;  2D1W A;  2FXT A;  1HYF A;  1GY6 A;  1GOY A;  2WGO A;  1LOW A;  5HOH A;  1CYV A;  1RN1 A;  1R4C A;  1IVW A;  1JZD A;  2RFR A;  2FGT A;  1NU3 A;  3CNM A;  4MMZ B;  4N6M A;  4AKZ A;  2C11 A;  4EC6 A;  3UNL A;  3AMO B;  1W00 A;  2OWP A;  4JRF A;  3K0Z A;  1K9M 4;  3PYJ A;  2IYJ A;  2CK3 H;  1B21 A;  2GSP A;  4HYZ A;  1ROV A;  5BIR A;  3PS8 A;  3A76 A;  3MKI A;  1FGR A;  1E3R A;  1TTO A;  1ZO2 A;  3PZW A;  3T8U A;  1LOY A;  1VQ9 3;  1RGF A;  1MOL A;  1BRJ A;  3HOH A;  1L5G B;  1FGM A;  1BNE A;  4N6N B;  1V58 A;  8RNT A;  4RNY A;  1PYL A;  1BRS A;  3EJV A;  4EXR A;  1M90 4;  3K63 A;  2BIR A;  1KWI A;  2CG0 A;  6STD A;  3AGN A;  1O7H B;  5I97 A;  1I2F A;  2Y73 A;  2J8X B;  3FLJ A;  3I0Y A;  1UGH I;  3CU3 A;  3QK9 A;  1NDO B;  2GEX A;  4OUQ A;  2UGI A;  1DE3 A;  1Q42 A;  2F5W A;  3K7C A;  3KCH A;  3S67 A;  1S72 3;  2KF5 A;  3BU4 A;  4FMD A;  2ML5 A;  4HM7 B;  1BRI A;  1SPU A;  2YX9 A;  4J9A A;  1BAO A;  2E2T A;  4ILF A;  1YVS A;  5BVB A;  3N9H A;  2W56 B;  5IG4 A;  2PZV A;  1VQ4 3;  1CQS A;  1W4N A;  1JKG B;  3EBY A;  1BSA A;  2IA7 A;  3LTB A;  4G1M B;  2P38 A;  1RTU A;  3OX9 A;  3VGN A;  5BU4 A;  5DRV A;  3KKG A;  1TRP A;  4LEH A;  1DMQ A;  1W2Z A;  5G1K A;  2YFL B;  3DGL A;  3I55 3;  4ZM8 A;  4IIA A;  3E99 A;  3DY5 A;  1RGE A;  3HIG A;  3JUP A;  1RRL A;  3CCM 3;  3F8H A;  4K90 B;  2C4B A;  5JPP A;  4KVH A;  3NXJ A;  3S29 A;  3X3X A;  3CMA 3;  1IVU A;  3SED A;  4X2H A;  5D83 A;  3NQZ A;  2BO9 B;  1FW7 A;  3CNX A; 
#chains in the Genus database with same CATH homology
 3F7X A;  4EV5 A;  2XH9 A;  1LNH A;  3LH4 A;  4HBR A;  4K1U A;  3Q2P A;  4FMB A;  1OHS A;  3BB9 A;  3LT8 A;  4OK0 A;  5IEO A;  3AMO A;  3FF2 A;  3GZY B;  1QVG 2;  3WOE B;  1YHQ 3;  4PEJ A;  2XF3 A;  3NUV A;  1AV4 A;  2L4V A;  2GBX B;  3CCL 3;  1BUQ A;  3F7S A;  3NX0 A;  3KSP A;  1VQ7 3;  1YVB I;  1DVD A;  2B24 B;  1EA2 A;  3HZP A;  2HMM B;  4L8P A;  1JJ2 2;  2OTJ 3;  2E2V A;  3HK4 A;  2LQV A;  1GYB A;  1EG9 B;  3FKA A;  1IDP A;  3BNE A;  2CKF B;  1J2B A;  3WOD G;  1W7C A;  3NBR A;  5CXO A;  4HM0 B;  4HM1 B;  2LYX A;  1YJ9 3;  1VZZ A;  1KC8 4;  2WGQ A;  4GB5 A;  2Z76 A;  1GD3 A;  3T0U A;  2QGU A;  1FGT A;  1QMA A;  3F40 A;  1D6Z A;  1JKG A;  2W9P A;  3GZR A;  2HMJ B;  5KP3 A;  3WA2 X;  1VQ6 3;  2IUK A;  2W2C A;  5IER A;  3B8L A;  1A2V A;  4EBG A;  2CG1 A;  2JDI H;  5FGO A;  1YJW 3;  2Q07 A;  2P0X A;  2ZDJ A;  2XEP A;  3DUK A;  4FMC A;  3LT9 A;  4R4K A;  1TFO A;  1JRQ A;  3IMA B;  1LVN A;  2Z6B A;  3DZL A;  1TFK A;  2CHC A;  5IF6 A;  4WWU C;  4CDL A;  4EYC A;  4FCJ A;  3JUM A;  1IV7 A;  1OAC A;  1QVF 2;  1IVV A;  4L7K A;  3GZB A;  4HZ9 B;  1UW1 A;  3HII A;  4LMI A;  4XBY A;  1O7N B;  1YJN 3;  5STD A;  3G6E 3;  2P09 A;  2W04 A;  3EN1 B;  1EKM A;  2HMN B;  3RDE A;  4O2H A;  1QAL A;  3B4P A;  3KII A;  2Z77 A;  3GAX A;  3DGO A;  4RBN A;  3K5T A;  1Q40 B;  3B4O A;  2CWU A;  3NM2 A;  3EBT A;  2O9U X;  3DGM A;  4QWT A;  1KD1 4;  3LTC A;  1ULJ B;  3NV0 B;  3CPO A;  3HX8 A;  2XGL A;  1FA3 A;  5IEP A;  1OGZ A;  3V98 A;  5IG3 A;  1DMN A;  5LC7 A;  2K0M A;  2XGN A;  3TDG A;  1YIT 3;  2D42 A;  5AIF A;  5DRE A;  1M1X B;  2B1X B;  1SJW A;  2CW9 A;  1S5A A;  3UL5 A;  3S28 A;  1W6G A;  3F8X A;  7STD A;  2GBW B;  1DVC A;  3MWZ A;  1RRH A;  3X3Y A;  3JUN A;  4K61 A;  1N8R 4;  4N6L A;  2RCD A;  3OW2 2;  2GU3 A;  1G96 A;  2R4I A;  2XFS A;  2MF7 A;  4N6O B;  3CCU 3;  1SIH A;  1QAK A;  2ZL8 A;  3OV4 A;  5HGR A;  4O3V A;  1IQ8 A;  1TU5 A;  4XDW A;  1WMO A;  3LYG A;  1D6Y A;  3RGR A;  3NHX A;  5D81 A;  5CF2 A;  3G4S 3;  1K28 A;  4FMA A;  1YI2 3;  4STD A;  1VQ8 3;  2XRX B;  1Q7Y 4;  1NJI 4;  2OOV C;  1K41 A;  1OH0 A;  3CPW 2;  3STD A;  3IPT A;  1SII A;  4RNZ A;  3WMD A;  1IV9 A;  3BLZ A;  1GD4 A;  2XR8 B;  4XBX A;  2A15 A;  3SVA A;  5LC6 A;  1T5Y A;  3KSE D;  4I4K A;  3SOA A;  3J7Y d;  3X40 A;  2RSX A;  3CCS 3;  1WQL B;  3GRD A;  1UUV B;  3X3Z A;  4BTY A;  4KFD A;  1W2B 2;  4XBT A;  3F9S A;  2OCT A;  4HM6 B;  3M8C A;  3FGY A;  2OQE A;  3EN8 A;  5CK6 A;  5IW9 A;  1Q40 A;  5D82 A;  1ASK A;  2W6J H;  3V99 A;  3CC2 3;  1ROA A;  5AEW B;  3S5C A;  1STF I;  3LTA A;  3LOY A;  3NV0 A;  4XB5 A;  3N8B A;  3PCR A;  2OTL 3;  3CC4 3;  2WOH A;  3ER7 A;  5EVH A;  4WYK B;  4RZM A;  2GU1 A;  2HMK B;  3K9M C;  3LML A;  4LSO A;  3EE1 A;  2CFL A;  3B7C A;  4LZI A;  4HJL B;  1PFP A;  4J8T A;  2I9W A;  1KQS 2;  1IT7 A;  3UJM A;  2KRT A;  1JB5 A;  4WHA A;  3PGB A;  3D3L A;  2RGQ A;  1A90 A;  2WOF A;  3KZT A;  1N9J A;  4LGQ A;  4ORL A;  2IMJ A;  3VF1 A;  5AYR B;  3JUQ A;  5AIG A;  1IVX A;  2IUJ A;  4FCM A;  4HKV B;  3GWR A;  1FGQ A;  1GY5 A;  5EQL A;  1UUW B;  3SOY A;  4AEQ A;  5IEN A;  2JQ5 A;  4KFF A;  5A0O B;  1W6C A;  3EC9 A;  2WO0 A;  3L0R A;  3S27 A;  3X42 A;  3F14 A;  1V74 A;  1ULI B;  1N9E A;  3UL6 A;  1CYU A;  2INX A;  1Y4K A;  5KP1 A;  3UB1 A;  4L8O A;  2BMO B;  3PXM A;  2XFT A;  4TX4 A;  3DM8 A;  1NB3 I;  1O7M B;  3BNB A;  2UX0 A;  3MHE A;  1JB2 A;  1JN5 B;  1F8N A;  3N54 B;  1JNQ A;  1YIJ 3;  5FW5 A;  2XSH B;  2GEY A;  3FF0 A;  2C10 A;  2CWT A;  2F98 A;  1A2K A;  1OPY A;  2SBL A;  2Y74 A;  3G16 A;  1U8C B;  1N8Q A;  3I56 3;  1OF5 B;  1WMN A;  3MYT A;  1JV2 B;  3EHC A;  4GL6 A;  1RN7 A;  1UI8 A;  3ROB A;  1AVL A;  4AKY A;  1VQL 3;  1VQN 3;  1ISK A;  1FUW A;  5BXQ A;  4X2O A;  2O3O A;  2ML6 A;  3JVC A;  4NRE A;  3FZW A;  1DYU A;  1M9G A;  3HI7 A;  4WYK A;  3OWS A;  1QJG A;  4R1K A;  5KP4 A;  5IG0 A;  2QA4 3;  3NBB A;  4HM8 B;  4H61 A;  1DMM A;  3CCR 3;  1WTH A;  3BND A;  2W0Q A;  4XDV A;  1PU4 A;  4BTW A;  3DMC A;  2CFD A;  3GZX B;  2HMO B;  4CCV A;  4JF8 A;  1EQK A;  3IJE B;  1RKY A;  4U13 A;  5G2G A;  2F99 A;  2MC8 A;  1Z1S A;  4MEI A;  3FCS B;  5JPU A;  3WA3 A;  1JB4 A;  3G0K A;  1LOX A;  1N5P A;  1ZX2 A;  2CFW A;  3ECF A;  1VQ5 3;  2M7O A;  1UI7 A;  1K73 4;  1IQY A;  3CC7 3;  1GY7 A;  4R9K A;  3FG4 A;  1US1 A;  2HML B;  2V1L A;  3BNC A;  1NB5 I;  2W9Q A;  1RJO A;  3KN4 A;  1HU9 A;  1STD A;  5ELJ A;  3MSO A;  1JN5 A;  3Q1C A;  1FGO A;  1OUN A;  3U1W A;  2BNG A;  4MMX B;  3OWY A;  1M1K 4;  3NQY A;  3OWU A;  2E2U A;  3CCE 3;  1Q81 4;  3U97 A;  1OF5 A;  2CC3 A;  4HVN A;  3CD6 3;  2Z7A A;  1IQX A;  4HM3 B;  4KFE A;  3EF8 A;  3G71 3;  4XM4 A;  1IT8 A;  1NO3 A;  2KCD A;  3RGA A;  5AII A;  1MNL A;  3CCQ 3;  4R9L A;  2CWV A;  4BTX A;  4IT7 A;  4NHF A;  1C7H A;  1OHP A;  3DXO A;  1VQO 3;  5TGN A;  3EX9 A;  3MG3 A;  4MMY B;  1AVK A;  3SX1 A;  3LZA A;  1SQW A;  1TUH A;  4KZ1 A;  3G8Z A;  3EB8 A;  4FR9 A;  3SXX A;  1D6U A;  3VSY A;  4N6U A;  4R80 A;  4Q53 A;  4WP5 A;  1TP6 A;  1A67 A;  1O7W B;  1AR0 A;  2STD A;  3FSD A;  5AYS C;  3FG3 A;  2K54 A;  8CHO A;  2CIU A;  1O7G B;  3WDG B;  4HM4 B;  2CFG A;  3NM7 A;  1IK3 A;  1YGE A;  4K1V A;  1HKX A;  1IU7 A;  2BHM A;  3MG1 A;  5CF1 A;  1VQM 3;  1W5Z A;  3LTD A;  1OCV A;  1W01 A;  2BMR B;  2P0M A;  2GXF A;  4O8S A;  3EQQ B;  3WOF B;  5AEU B;  1E97 A;  3CME 3;  3MG2 A;  1Q86 4;  1NWW A;  1LXE A;  1Q82 4;  3KFQ C;  1W6Y A;  1QAF A;  2XSO B;  2W03 A;  3JUO A;  3H3H A;  3T8N A;  3V92 A;  4WFO A;  1N5H A;  5AI1 A;  2YFI B;  3PCS A;  3NBJ A;  5JBS A;  4O02 B;  5ELU A;  3O8Y A;  4N6V 0;  2CH9 A;  5CLK A;  2QIY A;  1OHO A;  4MJD A;  3D9R A;  2FNQ A;  1KSI A;  3CCV 3;  3DGN A;  4N3V A;  2W56 A;  3KE7 A;  3CXC 2;  2QEX 3;  2BT3 A;  3SLU A;  3FH1 A;  3ALA A;  2OQE C;  3Q90 A;  4HZB B;  2PNC A;  5IG5 A;  1O7P B;  2P05 A;  1U5O A;  4IPB A;  4N6T A;  4OVM A;  1GS3 A;  3FG1 A;  5AIH A;  3OXA A;  3MPH A;  1VQK 3;  3H51 A;  2YFJ B;  4H3U A;  2F86 B;  4HM5 B;  1E3V A;  1OGX A;  1VQP 3;  3LXU X;  3CCJ 3;  4FCZ A;  4HM2 B;  5EEO A;  1W02 A;  1TIJ A;  1K8A 4;  1CEW I;  1WNH A;  4EV2 A;  2BMQ B;  2KXG A;  1WMP A;  2CFK A;  3QRD A;  2OOV A;  3X41 A;  2D1W A;  2FXT A;  1GY6 A;  2WGO A;  1CYV A;  1R4C A;  1IVW A;  2RFR A;  2FGT A;  1NU3 A;  3CNM A;  4MMZ B;  4N6M A;  4AKZ A;  2C11 A;  4EC6 A;  3UNL A;  3AMO B;  1W00 A;  2OWP A;  4JRF A;  3K0Z A;  1K9M 4;  3PYJ A;  2CK3 H;  4HYZ A;  1ROV A;  3PS8 A;  3A76 A;  3MKI A;  1FGR A;  1E3R A;  1ZO2 A;  3PZW A;  3T8U A;  1VQ9 3;  1MOL A;  1L5G B;  1FGM A;  4N6N B;  4RNY A;  3EJV A;  1M90 4;  4EXR A;  3K63 A;  1KWI A;  2CG0 A;  6STD A;  5I97 A;  1O7H B;  2Y73 A;  3FLJ A;  3I0Y A;  3CU3 A;  3QK9 A;  1NDO B;  2GEX A;  4OUQ A;  1Q42 A;  3K7C A;  3S67 A;  1S72 3;  4FMD A;  2ML5 A;  4HM7 B;  1SPU A;  2YX9 A;  4J9A A;  2E2T A;  5BVB A;  3N9H A;  2W56 B;  5IG4 A;  2PZV A;  1VQ4 3;  1CQS A;  1W4N A;  1JKG B;  3EBY A;  3LTB A;  2IA7 A;  4G1M B;  3VGN A;  2P38 A;  3OX9 A;  5DRV A;  3KKG A;  4LEH A;  1DMQ A;  1W2Z A;  2YFL B;  3DGL A;  3I55 3;  4ZM8 A;  4IIA A;  3E99 A;  3DY5 A;  3HIG A;  3JUP A;  1RRL A;  3CCM 3;  3F8H A;  4K90 B;  5JPP A;  4KVH A;  3NXJ A;  3S29 A;  3X3X A;  3CMA 3;  1IVU A;  3SED A;  4X2H A;  5D83 A;  3NQZ A;  2BO9 B;  3CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...