1OQOA

Complex between g0 version of an fc bound to a minimized version of protein a called mini-z
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Fc Glycans on The Effector Functions Vary with the Antibody mechanism of Action
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords immunoglobulin gamma-1 heavy chain constant region
total genus 37
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA01
4M00A 1LDPH 3RGVB 3OKLA 3GSWA 4EDWH 4O2EB 4N68A 4AT6B 2O5YH 1X5XA 2F19H 5D6DA 3EO0B 3H9YA 4FQ1L 1RHFA 2J2ZA 3P40A 3WLBA 4IRJB 1CVSC 1OAUH 2EDNA 2PR4H 1S5HA 4WI6A 3TBWA 1ZEAL 5BO1H 4LLUA 1HH9A 2HTKD 1S7QB 2JB6B 5CEYA 2ESVA 4WV1B 4H20L 4UILH 1X5YA 2WQRA 1JZ8A 5EUOF 4YXLL 4B53A 2B7DT 2NMSA 4WUUE 4MQ7B 5C0RH 4K3EL 4XNQA 2HH0L 2B4CH 5I1EL 1NCCL 1P5VA 2ZCLH 3D6GA 3K4DA 5FM8A 4JPWH 4ZO8A 4R4NC 4U31A 1TJGH 3IXAB 4PLJD 4YHLH 4NRYB 2IANE 5ACMA 1MJ7H 5I1CH 2AEIT 1PBYA 3VFUB 5D1XC 2F58H 4OZHE 1IEAB 3RHWF 3OKYA 4M02A 4ELKA 2XKNB 1S78C 1B90A 1UC6A 3TZVB 4G3YH 4CN6A 3MV9A 4E41D 2B2XH 2H32H 2R29L 3C8KA 5I0ZA 1TPXB 1LNUA 3RZCD 4MWFB 1T1YA 4R8WL 5DRWA 3T3PE 1UFUA 2OXGA 1DBBL 4IOFD 2EZ0C 1BBJB 5FGCB 3LKPB 4GMSH 4RSVA 1MWAA 1YC7A 1OAKH 3SE4C 2DIBA 3FFCB 1SY6A 1YQ2A 3QO1B 5E8PB 5JOFB 4JJ5B 5L0QB 1MJJB 3OX8B 5DQ9A 3FFCE 1I1FB 1NL0H 3MGOA 4X9GA 4NHUB 3U83A 5TDNB 3GI9H 1ZVYA 3VWKC 3ARRA 2YBRA 4IS6A 4JRXE 1QRNB 2G5BB 25C8H 4JFEB 5DJ6A 4E41B 4OUUA 5FO7B 3K3QA 4GKNA 3HZVB 4NUJA 2YS4A 3HG1D 3R1GL 4JFEE 3UMTA 4E41E 5LBSH 4BZ2H 3DX8A 5CMAA 1ZSDA 3BZ4B 1RIVH 5IIEB 2AQ2A 2AJZA 3T3MF 1HINL 1Z2KA 3MCLL 5HHOB 4HK0A 3JV4B 4LK4A 3PWNB 3FMGH 3V7AG 1VPOL 4M6NH 3RA7H 1RUAL 5E08H 3TJHD 3JSSA 3S8WA 3MBXH 3QRFM 3DETC 2EIBA 2FNBA 1AE6H 5ACZA 1ZMYA 3V4PL 2X41A 4N5EC 5AG9A 8FABB 3O2VL 4IRJC 4U6XA 1J18A 3ZDYE 4PJDE 1U8MB 2A6JB 5EO0B 2BMKA 3MA9H 5ENWA 3KR3H 4PG9A 5J3HD 1DQLH 1U3ZA 5IF0B 4G6FD 4L8SC 3DXAA 4G9FA 4JANB 3SGKA 5C07A 2EH8H 3PHQA 5J12B 4LEXH 4JZOB 3RGVD 4I13B 5ADOH 1QKZH 5B8CB 3QI9A 1IM3B 4XMPL 2UYLA 3WFBH 1J0ZA 5D1QC 1FIGL 4JO3H 4D0CB 3U9PL 3SDAA 1AY1H 1LP9F 3B2UD 1ZT7B 2GFBB 4BH7B 5GGTH 1WCBA 1BWWA 2FATH 4PV8B 3IETA 1JTTA 5M95B 1NCDL 2E7CA 4NCC2 3QDGB 4C56B 3QFJD 4R7NB 2CH8A 1OD9A 5DT1H 5C0ND 4Z7UA 1SEQL 1N0XH 3O3UN 4LPXA 1RJLB 1FVEB 2H2PD 4JANA 2PYFB 3MGTB 3UTSA 4O5LL 5HYSA 1WK0A 1Z9SA 4UBDC 1YEDB 1JN6A 2APFA 3L9RB 5B39A 4HIXL 2BSRB 4Q6IC 1GGCH 1IGJA 5T1LA 5DA0B 3Q6FA 1SBBA 1FL3B 5TF1H 5IOPB 2CGRL 2FX7H 2VDRH 3T8XA 4DAGH 3KPRB 4HT1L 3SQOH 4MD5A 4JGJA 4YDKL 3T08A 4M7LT 3BPNC 4KK6C 2VH5L 4ZNCD 3T4AA 5CEXB 3D18B 3VFNA 2GITA 2CDEA 6CGTA 2R1XA 3UJTH 3EYSL 4KTEH 4NGHH 4Z7WF 4HKBB 1MHPL 1VB9A 4AEHH 4FHBD 4HUXA 5D7SL 2MNUA 1A6AA 5KS9A 4LSTL 3GJFK 4NNXA 4IMLA 3U82B 5D6DC 4W68A 1GRWA 1JHTA 3FO0H 4HULB 5J1AA 2A83A 2EDWA 1QSEE 5LXGH 4OTXH 1TZHA 3C6SA 5FDWA 1IM9B 4ALAH 3KJ6L 1CFSA 4H8WH 2BZDA 3HAEA 15C8H 5SV3A 3RU8H 4MXWL 2A2QT 1FRGH 1NEZG 1I4FA 1T0PB 1HXYB 4BUGA 3BQUA 3BDXA 4C83A 5BZDA 3HE7A 1EJOL 4WJ5A 3RY4A 2FJHB 1RU9L 4HIIA 4KJQD 2AERT 3DROA 4FQ2L 3SJVB 1SY6H 4HAGA 1U8JB 1F02I 4X80L 1I9RH 4TQEH 2JF1A 2B1AH 1KCLA 4PJ5B 3IKKA 4ZFOB 3MR9B 3V4UL 1AGFB 3MYJA 5INCB 4ZFZA 5IKCA 3TJEH 3T2OA 1QFWI 5FM5O 4PJ5E 2OTUB 1INDH 1ACYL 4WIQA 4QXWA 1S7UA 4NRXA 2WBJB 4C83B 5BZDB 3WIIH 4D2NA 3MUZ1 5A1AA 3BISA 3NA4A 4X8XA 3WHE1 2GUOA 4JR9H 1F4YL 4D0BB 4MJ6A 5DR5L 3ULVL 2HLFC 5HHQA 4MA3B 2OTWA 4K7FA 4KI5D 1B0RA 2B2XL 1NFIA 3MV7A 3AXLB 1I9JL 4PBVC 4LSUL 2ZG1A 4Q6YA 1F4HA 3L5HA 3VFTA 1GIGL 4TNWK 3VFPA 5AYQA 4FOMA 1F8TL 1JIBA 5IESL 4PG9B 5KVDL 3CXHJ 5BV7L 3TF7C 1KYOK 2B20A 3QXTA 4I4WA 5F7KC 2X7LA 3PV7A 4OF6A 4U0RC 5E8OA 2Z9TA 1NCDH 1F11B 1F90H 3RQ3A 3LPWA 4KTDL 2DQGH 1MRFH 1MVUB 2UUDH 4YXHH 3FN0H 3MMEB 1UWXK 3E6FB 4JHZA 1EFXA 5AG8A 4L3CA 4I2XA 3ZDXF 1FZOA 2X44D 4YFDB 3GSUA 5D1XB 3UZVB 4IHOA 1I1RA 3HC0A 4Y19E 4PJ9D 3JUZA 2YPKB 3ZYOA 3CNKA 3LOWA 1YDPB 3PWLA 2Q7YB 1YNKL 4N8CH 1QACA 4LPYA 2QEJA 5FHBH 1LO4L 4PJ7A 3B5TA 2VWEC 4GKOA 4EDWL 2XWJB 5IR1B 4Z7UF 1FC1A 2EDFA 4G43A 4JAMB 4OB5H 3NAAH 1F4WL 3GBNL 2XQBL 3HUJB 3VXTA 5GGTA 4M61B 2C1OB 1U6AH 3HUJE 1Y0LA 4KK9C 1R6VA 2ZP0T 3IRZA 3MFFA 4MLIA 2PW1B 2O26U 1D5ZA 1P9MA 2DQCH 5EBWB 3T0WA 1E6OH 3IDJB 3EOAA 2DQEL 3ARDC 5IHZB 3DURB 1V7MH 3HR5A 3I3DA 2VKXA 1OAZL 3QSKB 3F7VA 3LKSB 1Q9LB 3SBWA 3EDJA 5ABDE 3LHPH 4FFYL 1UM6L 4KKCD 1WIPA 2RGSA 4J6RL 3LDBC 5H37G 3UEZA 5GS1C 3RUGB 4N5UA 4UV7L 1QSFE 5DD5H 3WSQL 4NN7B 5H35B 4WWID 1U58A 5AZ2L 1T83C 1FNGA 5HHMB 1TJIH 4YE4H 3VJ6A 1K4CA 4HJJL 5I73B 1TCRB 2ADJA 3T1FB 3MACH 5T3ZL 5DDHA 5HHME 5EDXA 5B38B 1DBJL 3DYMA 5GSVA 1DFBH 4M5ZH 2ICEA 1FLRH 1Y6MR 3RY6C 3DTXB 5GS1A 2OL3A 4MD4A 4V2BA 2ITCA 4D9QE 5ICZA 3X3FL 1MHEB 3AUVA 2DWEA 4P4KA 5C0IA 2VIRB 5HDBE 2VLLB 2ZUUA 5JHLL 3MLRL 2PO6C 3ULUL 3I02A 1DBJH 5IESH 1AD9A 2V5TA 2X2YA 3T0DA 3GHEH 4NHCL 4NHUA 1VFUA 1TCRA 1ZT4B 5KSAC 5I66A 4NZUL 5ESAA 2ICWJ 1L7TH 2A38A 3C5SB 6FABH 1C08B 4PUBL 5F6HI 2NY4B 3TIEB 2DM7A 4ELMA 1RY7B 1UXWB 5EU3B 4QHKI 2IPUK 2ITCB 1NCWL 5DJZA 1NPUA 1CN4A 1KN2H 4GFTB 3VFPB 2PXYD 3TVMC 1OHQA 4YDLC 1YPZA 3IDIB 1NDGB 4URTB 3ARTA 4P9MH 4HQQL 4IDLA 1AHWC 3GSQB 3V5HB 3W2DL 5KOVC 1HHKA 4DZ8A 2AP2A 4OM0H 1Y6KR 3O45B 4XNMB 4UI2A 3VH8B 1DQLL 1KJVA 4LCUB 4WU5B 1FIEA 4KRPB 2BFVH 3SGKC 2BOBB 4WI3A 4PRAA 3MRFA 5DMGC 5ALCH 4LVNB 4TRPL 3OKNB 4NO0B 4XT1C 5I8EA 1FZMB 5DJCB 5IQ7L 4NZTL 1FZJB 2OQJB 2XQBH 1JYNA 1A7QH 2UV3A 2VOTA 3WIHH 5IMKB 4EUPB 1D5IL 4LVNC 4CMMB 2DM3A 1WLHA 4RNRB 3LEYL 4UQ2A 4X7TB 2ORBH 1YMMA 1DP0A 5B38G 1SHMA 4EEEA 3WD5L 4AH2A 1KT2A 1VESA 3QNXB 4NM4L 4WUUA 4XI5D 3U46A 3LSOB 5DR5H 5EBLB 2QQLH 2PO6D 3T77B 1ZEAH 3K0WA 1NC4A 2P24B 1MY5A 1XF2B 3CFBB 3LD8C 4Z7WB 5GJTH 5I1AB 1INDL 1RULL 4G8EB 5IROC 2V9RA 3HLAA 1DBMH 1PLGL 1JHLL 4UUJA 5E8DL 3GHBH 1WFOA 4OLEA 4EN3B 3DYPA 4Y4HB 3EZJB 3ARSA 1IEBA 3N06B 4JVWA 2ZSVA 3OSKA 1BZ9B 2BXYA 5C9KA 4LPVA 3DJ9A 5DJ0A 5I1EH 4GBXC 1C1EL 4JRXA 1W72L 1NH6A 2AXHA 1TJIL 4HJ0D 2BNRA 3CVHH 1GAFH 4LSDA 1SMAA 2C3GA 4UNUA 4LVHB 2VDMH 3RGVA 3CLEH 4QRRA 5IB1A 2WLYA 5D71L 5LWYH 4AT6A 3CSYB 3CXDH 1SJHB 1A6ZB 3MRNB 3F12B 4FTVA 5TF1L 5E6IB 5CP7B 1N5AA 3LIZL 3K4ZA 3MV01 1A7RL 3WNNA 5CEYB 1P7KA 5CLTA 3QUYB 2NY0C 5C09E 4YPGB 3FT3A 4RQQB 2CKBL 5I1DA 3N1GC 2WINA 4J8RA 3GHEL 3STZB 1C12B 4YJZL 4NOFA 1X6LA 1MCSA 4PB9H 4Z9KB 4KKNA 2CQVA 3VXOB 3O11A 3IXAA 2Z31C 4GBXD 3RVWC 1RZIB 3D0VA 4OB5L 1U8LA 3FTGA 4GG8A 4NNYA 5HYJD 1B4JH 1UENA 1XT5A 4NP4L 3H9SB 2H2SC 1BECA 4U6VL 2DJ4A 4Y16A 1D6VH 1VADA 5AAMA 3WJLC 4YUEH 4Z77A 4DVRH 3SCMA 4M1DH 4PJCF 4OLVH 3WXWH 3A6CH 2VYRE 4ODXB 4Q97A 1J0HA 4Q6IA 2F19L 4JFFA 3VI4E 4AEIL 2LQRA 5DD5L 5INDA 3WSQH 1JFQH 2ZOKA 1Y18A 4M6AA 4F7TA 4NZTH 4WRLA 2DJSA 2YD3A 1EVUA 1P69B 3QO1A 1FNEA 1EUTA 1DE4B 3ARGD 3JV6B 4G9FB 5EOCJ 3U0WL 4ZMAT 1UM6H 5CILL 1ZHLA 3C6LA 4PJ8A 5L8JB 4JKKA 5CINH 2UZXB 4G9FE 4P5TD 5HYQB 3ZT6A 1QVOA 2BY3A 2ADGB 5HY9B 2GTWA 1YEIL 3QUMH 4JM2A 5J13C 2Y07L 3T0EB 1T7ZA 4MZ2A 3MCKB 4MJIE 5MERB 1KJVB 4WU5A 3S4SG 3CK0H 1NC2A 3FONB 3AM8C 3ESVF 2ADFH 3JTSB 5SWQB 4YK4C 1ND0A 3D48R 1A5FH 1U3JA 4LQ1A 1D5XA 5JNYB 3HI6L 4YC2C 1XEDA 2BOCB 3FB8A 2BVYA 3P77A 1JBJA 1TZGH 1VEMA 2JJWA 3D69A 4FTVD 1BQLH 1YUHA 3O6MH 1PLGH 1CD0A 4OQ1A 2ZOLA 2R0ZH 4RNRA 5BJTB 2OZ4H 5DUBA 2NZ9D 3FFCD 1NKRA 4NYLB 4EBQL 2EDOA 3MUGA 2X4QB 4NZUH 5DJYA 1T1XA 4KROB 4YAQB 5EFIB 4IJ3B 3PDGA 1FL3A 3WIHA 1SJEB 4KZDH 3IDXH 5EH1A 3BPNB 2RB8A 5GGSB 3QH3B 5DLML 5B21A 2FIRT 3DO7B 4LP4A 4N8VB 4ODWA 2EXYD 2FLBT 2YA1A 5K9KA 4HK3J 4PRDA 2A6DB 3CDYA 3VGAC 1I8IB 3VFRB 3RWHB 3PWVA 5LJYH 5KG9A 3O2DL 3ZKND 4P9ML 1SYVB 3JWDL 4ZUSB 4D94A 2PO6A 2FSEB 1OP3K 2CKBB 3UPCA 2PKDA 4WW2B 1I9IL 3REVA 4H88H 1SJVA 4N0RA 1OAUL 4JRYB 3KLSA 5IB1B 4R7DB 3VRLF 1A7QL 3MJ8A 5HYEA 3ULVF 4KHXH 3VI3E 1XCQA 1KJMB 4P2OA 2M8XA 3DUSA 1QBBA 3BQUC 2HFFB 5FCSH 3PWUB 2EYTA 1AGDB 1MSPA 1DSFH 2K9UA 3P30L 1EBPA 1S9XA 4OLXL 4PLJC 3UTQA 4ERSL 1Z0MA 3FT4A 3FT3B 2VAAB 4ELMF 2BSED 1V05A 5BW7A 4ZUSA 3SGJA 1J05A 4Y2DA 4XP6H 1NBYB 5JHDE 3WXVH 2D0HA 4CNIB 5T3ZD 3UC0H 4ZUVB 5I1GH 4Z7VE 3WNMA 2P4AB 1HYSD 1MFCL 4X6DB 1I85C 3VXNB 4DGYL 1ED3A 4NO2A 1XGYL 4X0KB 4XP9H 2CLVB 5JTWA 5E00B 4HEME 3FN9A 3RWGA 1JRHL 5F96H 4XPHL 3L3GB 3VFSB 4QTHB 4ZQKB 3QXAA 5E7FA 5DRNB 2R0LH 2EDLA 5CIPH 4KUZH 4I3GA 2Z8VC 3L5WB 1KELH 1ZLVK 1BZ7A 4YH6A 1NFKA 1FO0B 3SE9L 4TUKL 3A6BH 4GRLB 3KS0H 4G3YL 4NQDB 1T6VN 3TT3L 4HLZG 1UKSA 4XNUH 4GOSA 1LD9A 2EE3A 3TO2A 2CLVA 5JPMB 4X7CC 4LAJH 2BDNH 4OD3H 2C4FT 3VWJD 3LKOA 5FCUH 1IZJA 4OI7A 4PRPE 2VXTL 4X6BA 4U1MB 1T7VA 5L2JA 1F4WH 1JZ6A 1R0AL 5D7LB 4ACPA 4PJFA 1OSZB 4JM2B 3EYSH 4KTEL 4NGHL 1OP3H 3GMRA 5FF6B 5B4MC 4PRPB 2DQIH 4DAGL 3PDOB 4BUHA 1DUYA 2E9WA 1UH2A 3CSBA 4FFZH 4QYOA 5JXAL 3VRJA 1NAMB 1KN2L 4QXGL 4G8FA 4FQ1H 4QGTA 3NIGF 2GSIA 4XXDA 1NBQA 3QPQC 1R3KA 1H8OA 2L7JA 4W6XB 3MV8B 3GMNB 4P9HC 1L9MA 3MUGB 2X4RB 4J4PC 4HHAB 2DI7A 1MCOL 1MNUL 3EHBD 3MV8E 2A73A 5EUKA 2CRIA 3VGHA 5C0DB 2V17H 4WUKL 2DWEB 3LZFL 5J13B 2VLKA 4ODBD 4LLVB 3IS1X 3L7EB 3IXTA 2QQQA 4NT6A 3INUL 5KSUA 2FBJH 3I75B 1QLFB 2H8PA 2DQFB 3PIQB 2FIKB 3TNNA 1SY6L 2BY1A 1UA6H 2FX8L 3QDHA 5IJVB 4RGMB 1T7YA 4Y2DD 3D5OF 1ZA3B 4GH7B 4RBPH 2FEEL 3NH7L 3UYOD 1REIA 1G6RL 5I75B 3LKQB 2BMKB 1ACYH 3D39A 5IV2B 1LE9B 5DD0H 2JJTC 2DOCA 3V0VA 4D9LL 1TFHA 3MJGX 5FYKD 1HHJA 2A73B 4I0KA 3MRMA 1TVHB 1OARL 5MHSD 1CD8A 3WUWB 3NABL 3GBML 4LLVA 3KG5A 4ZOCA 1X44A 5JO5B 3D18A 4W6YB 5DDHB 1UT9A 5IB2B 5GIRA 1RUKL 4P23A 1ITBB 1YMMD 2W91A 3L3HA 5IB4A 4OZIF 2E27L 5SX4I 2JCCF 3BN9D 4EBQH 1KCVL 2DQJL 4QHKJ 2UYLB 1RURH 2I5YL 2V2XA 5MI0C 3GK8L 3OB0H 4KI5F 2J7LA 3MO1B 5DD1H 4OZHF 4K8RH 2PYEE 5EBGA 1P7HL 2HRLA 2AGJL 2EEDA 1X5FA 5GZOC 1QFWH 1C16B 1BQUA 3HPLA 2VDRL 4JG1L 1N3NA 3EYFA 3MRCA 4XNUL 1FP5A 1J86A 3LH2H 4JQXC 1NCUA 5DGQA 4PRHE 1NMBH 3DOSA 3QIBB 1ES0B 1HHIA 3R06B 1KEMH 3FO2A 1M7DB 1ROWA 4G7YH 1MF2L 3D85B 3TBYB 2AV7B 5DRNA 2R2EA 3QQ9D 1N5YL 1JVKA 3KJ4B 1A9EA 3T09A 2BCKA 4MJ4A 4HWBA 4ONOA 4ZXBB 5ACLA 2ZSWB 1ZS8B 4O9HH 4TVPL 2R8SL 1LO0H 1MJUH 5DWUH 5T1KB 1OY3B 1CDUA 2R1XB 3L3KA 4R96A 4MNQA 2MPAH 1NGYB 3BUYA 5F7LB 4NNXB 1UQSA 3NGBB 4I18B 2ZSVB 1H5BB 4AG4H 1DUZA 1MRCH 3OQ3B 2F54D 5C0AB 3H6JA 1IGTB 4R90H 2FEDC 2HT4D 4UOW1 3HI1B 2BNRB 4AQOA 3JWOC 1QNZH 5D96C 1A4KA 5KVGH 2R2EB 3SGDH 2FH6A 4X6EA 3U0TA 2BSSA 1W2KT 2C3VB 3N9GL 5FO9A 5BRZE 2CK2A 4N0YH 5D8JH 1SM3H 3T0ED 3CUPA 1UWEH 4HV8A 5IFJA 1T1WA 4Y5YC 4F9LA 3FOMB 1DQTA 1MFCH 4JFDA 5DJAA 3SDXE 2IAMA 2A9ML 3MJ7B 5A3ID 1PKOA 5CKAA 5LG1A 3DBXA 5BQ7B 5C0AA 3VFGH 4OGAD 4X9HA 5J89A 4Z6AT 3SCMD 2R4RH 2WK2A 4XVTH 3QUZC 1BQLL 1K4DB 1G7MA 4FQXB 3L3JA 3S35L 2IQAA 3NACH 5FUCC 5BZWB 4GLRI 4ORGB 2EEBA 2O61B 2DMKA 4IHOB 3WD5H 1F3DJ 2GSGB 1D6EA 1NLDH 2XTLA 2VZ1A 1FO0H 2AQ3A 4OCSL 1MHHB 3VH8G 5IW3A 5DFTA 2CUHA 4FA8A 2P5WD 3IFLH 3H9SA 3BZFA 1FFNA 5E5RB 1QFWL 2KQNA 3MV9E 1MCWM 4IDJH 1ZA3A 1YEKL 2E9IA 5GHWH 2A77L 4JFEA 5DJ6B 4NNPL 2EIZA 5T1MB 4WHTB 1WT5A 3RRQA 5GS2H 3C09B 3WFEH 4XWOC 5K9JL 4XMKH 4XNXL 1CDIA 2MKLC 2X4OA 5BZWA 1UB5A 3HI5H 4HG4J 1TENA 3BW9A 5IMKA 3VWKA 4KKBC 1TLKA 4P57B 5JMRA 3ULVD 5I1KH 4M62H 4QRPE 4NUGH 4Q0XH 4FMFA 4JDZB 5JOPD 3MRRB 3ETBF 2H1PL 5EO1B 2W60A 2BRQA 1KG0B 4Y4KC 4UAOB 2XN9A 1VGEH 3PG2A 1MWAH 1MAKA 1CZ8L 1LO0L 2Y5TA 4ONHA 1U8KA 3HNSH 3U30B 4Q9RH 4FNLL 4JN2A 4GKZB 3DNKA 3OKEB 4M9PA 2IFFH 4NO3B 3EDEA 3K8MA 4FFVD 1NCBH 4PGZA 3QEHA 2A83B 5E8NA 4P2OC 3RWJB 1KXTB 5EORH 2SEBA 2AXGB 5D2NA 2OMNA 1JNNL 4D0DB 2BNQA 2ICEB 4PJXF 1BEYL 3ARGA 4WEBL 4FZ8H 5TQ2H 1CFSB 3VMPA 5IJKC 4NQCB 2YPLB 3FB6A 2ZOKB 3NH7H 2VXSH 4FQHA 4YDJA 5I0DA 1XCTA 4V1DA 1UM4L 4KKAC 3BPLB 5AWNL 5EC1A 3WE6A 5JA8B 3FQXB 1DQMH 2PF6A 3CX5J 3V0AC 3SN6N 3WJLA 4BQ8A 35C8H 2D3VA 4OF0A 2AXFA 3GIVB 1O5DT 5ERWB 4H1LG 1SVZA 1CVRA 3TO4B 5HBBA 2GT9B 4HXAH 3S34H 4TTDD 4POZD 3GBMH 1JV5B 1QUNA 4L3AA 2DYPA 1YMHB 5FCUL 1F45A 4X5LA 1IC7H 2EDYA 2J88H 2VZTA 1V7NL 1RULH 3D0VB 3STLB 4R3SB 4PGEA 1CT8B 5I6XB 1MJJA 4FQQA 1RD6A 2YEZB 4HCRH 3HZYA 3K2MC 3OBAA 5KSBA 4XZUB 1LVEA 3ULSB 2VC2H 4NKIL 1AXSB 4PUBH 4X6FA 4Y16B 4NKMA 2R29H 4Z0XA 4YHNA 4AIOA 1L7IH 1RSFA 3M45A 1Z9OA 1R3LB 5HJ3B 5IW6B 5GS0D 2XV6B 4GRWF 4HJGA 2BJML 4RMWA 3UAJC 2VQUA 4O9HL 1OTSD 5MEQA 1UEYA 4BZYA 2O61A 3V8OA 3IJHA 5DJ2B 1PG7L 1NDMB 3W9DA 3OJ2C 1IAIM 2GSIB 4UINL 2WV3A 3QCVH 1E6JH 5GRXG 1YMMB 3QXDB 2HN7B 4ZQKA 1NGPH 4JFXB 2IPKB 1QP1A 1MVUA 3DV4B 5FHAL 1XR9A 1NGXA 5EZOH 3LQAH 1K2DB 3QIWB 1WAAA 3RL1B 1JPSH 3T0EA 3O4LA 5IMMA 4JRYA 2DI9A 1T3FB 3AROA 3K1KC 1YY9D 3NA9L 5FIEA 4MDIA 2X42A 3DSNA 5F89B 3ET9F 1AGDA 3AREA 3MRBA 2AJUL 4MDJA 3ZDZF 5D8JL 2MWCA 3BPOB 4JPIB 3WFCL 3C5ZC 3QAZB 2DQTH 4X4XA 3UYRL 1YECL 3LKOB 5J12C 1UJTA 3PHOA 3N50A 4MAYD 4D0BA 3B6SA 4OM1L 2QQLL 4CNIA 2D31A 2DD8L 5L2KD 4FZ8L 3MJ6A 2FGWH 1CFTB 3BIKA 4R2GD 3GMQB 2QQKL 4IRZH 3D2UD 4L4TE 5DFVC 2APVA 5CP3A 4EIZC 2CRMA 4JO2H 1A02N 5DMGD 2Z8RA 1A3RL 3PP3K 4QOKB 3MLVH 3UJJH 2AJXH 3LVEA 3PP3H 4TPRL 3VXMA 1OPGH 1GGTA 2NXYB 4G8FB 1KJ2L 3QIUD 4LKXA 3VFRA 2FJFA 3QPQD 3B2VH 1MI5D 2HG5B 3P4MB 4O58L 4PY8J 1CLYL 4LRNH 5TE4H 1GPOH 4QRSA 5CJXA 5C1MB 4F57H 2WWMD 3WLWC 2AAVA 4WW2A 1F8TH 2HLFD 2R1WA 5EIIA 1EMTL 4Z7NF 1FFPB 2Q20A 1IQDB 4KVCL 4R0LB 3EFDL 5DZLA 3K8KA 3OJDB 1A7RH 3WNLA 1CL7I 1PJ9A 3SE8H 2YUZA 4LQFL 3S88H 4NQSB 3LS4H 5EZJB 4GG8B 1UEMA 1K3IA 1EJ6A 4YX2H 3CAFA 5KSAA 2B0SL 4ENED 3GMPB 5D5MF 5KSAD 1M05A 3VGFA 1HNGA 4FQCL 3LMJL 3RVUD 3FO9A 4Q6IB 3C5ZD 4EUPH 2UWEF 1GXEA 1FE8H 4KJQC 4NBXB 4P9HL 3I02B 4PRBB 1A1NB 4PP1D 4F8QA 1NAMA 5IVNA 4KV5E 5TDPA 1MRFL 3FQUB 1IBGL 2P43B 3OJDA 1DE4A 2CKNA 1OT1A 4YHML 1VFMA 1I7RB 3PABB 4MX7A 4Q9RL 4P3CH 1CF8L 5L2KB 4HKJB 3S37L 3I6KA 1AXTH 4K9EC 5F1KC 3RAJL 2FBOJ 4A2LA 3KS0J 4PJDB 2XKNA 3AY4C 2PYEA 4ZAKC 1MUJB 5IB3A 4Y8AA 5F7DA 4L29B 4YHNB 4APQB 3SKMB 3L6FB 2IJ0C 4PJHB 2LAGB 3T0VA 4ESKA 1FRGL 1MCLA 1H3UA 4PJHE 3RZCA 1S5HB 3TBWB 3ZE0E 3TZVC 3D2UA 2P5WE 4Z0BL 5DC4B 4LLAA 4QHNA 2XWBA 5KBNC 2WBJD 2JB5H 3GGWB 3VRIA 4PJFF 2K3TA 2WBJA 3LEXA 5L2KA 4XC3L 2UY6A 3ZKXB 2R23A 1AY1L 5F72S 1QLRB 2LE9A 2NY6D 5KAQF 5LKNA 1A0QH 2VZVA 1D5MA 2WUBL 5GSRB 2YZ1A 2Z4QA 4PRID 4XVTL 3GMOB 1OP5K 3EJYD 4HGKC 3ZE1E 1G9ML 3IT8D 4UB0H 5CHNA 5C0FB 1HHHA 1YA5A 4KRMB 3QEUB 4Y88A 3IGAB 3QUXD 2L0DA 2YD1A 3DGCR 4OCRL 5E2UH 5HYQA 3S34L 3HNTL 1UZ6E 1T04B 2AABL 4QO1A 2D7MA 4F15C 3G6JB 5ESQB 3MRGA 3CFEA 3OAYK 4HMCA 3VG0H 1FBIH 2X4NB 2C1PA 4P4KC 2PW2A 3QDMD 1N8ZB 5DRWB 5SWZE 1JGUH 1MHPH 4P2CG 5GSRA 4NM8L 2ZJSL 4KROD 3B5HA 1FV1A 4MJ5A 4OCWH 3WHE0 3RWFA 5DJ0B 2CMRH 2AJ3B 3ZLQC 3T3PF 5DXWA 1OAYL 4H5SB 3W82A 1NDGA 3Q1SH 4KZDL 2M2DA 1NC2D 3HB3C 1LDSA 5L9DH 1OB1A 4IS6B 4QOKD 3B9AA 1B4JL 4OZFG 3PL6A 5EU5B 2IADB 1QBMH 1AD0B 1Q1JH 3K7UA 4KI1A 4U1NA 4ZFFB 1CFVH 4HIJB 5BCAA 1LE9A 1PKQE 1WFNA 3S9DB 4PRDB 4WFFD 3QUKA 1FVEA 1NGZB 4YPGA 3QIUC 5HYSB 1EGJL 4WI4A 1MH5B 1JRHI 1Q94B 2R56H 2ZCHL 3QQNA 3VU2A 3ULUD 3ARGB 2CSPA 4GKSA 2Q86B 1QYGL 1DLHA 3ME0A 5EU7C 2YN5A 5HGHA 5ISZB 3ILQC 4ZODA 5JXEC 4CW1A 5CINL 1ADQH 1TTFA 1WWWX 4MSWA 4LDEB 3TH4T 1T1ZB 4N9GB 2VDNL 3QO0B 2OL3H 1YN7A 3VWKD 1RZGB 2EC8A 3RNQB 5E2JA 5EU7E 3ARBB 4WFEE 5A2JH 5I1IH 2JB6A 4WU7A 2V7NA 4J4PA 1KCUH 3TPUA 1HHIB 4PRHD 3MBXL 1ZE3C 2WUBH 3ZL4H 4MQSB 3TYGH 3SE3A 1CGXA 3EJZD 2H2SD 4Y7MA 1LP9B 4PJDA 4N0YL 3DTXA 4GBXB 4PJFB 1XGUA 2EDBA 4O58H 1I8LC 1NAMH 4L5FH 4YGVB 5D9SA 5IK3A 1AP2B 1GSMA 2AJVL 3RBSA 4F7TB 4X5XA 5CKGA 4JRYD 3LCYA 3MLYL 1SJHA 3MRNA 1A7OH 4KVNH 1ZA6A 5F70A 5CD5D 3LS4L 5ID1B 4JGMA 2V5YA 5ELIA 4R8WH 4S1DC 4UT7L 3RNKA 1HXMA 3RKDD 3B5GA 5TGBA 2XXCB 4QRRD 2G60L 2H9GB 3QXVA 5KTEH 5CCKL 1X6NA 5EUOE 1OTSC 4U1LA 5L6YH 3U4AA 4NN6B 1D7FA 3OXRB 1RAMA 3MXWH 3N85L 1XGRA 3P9MA 4NQCA 4K07A 1UG9A 4YGVA 1LEGA 1IMHC 2B4CC 1N0LA 5SX4H 3VWKB 1DN2A 2C4FU 4TUJA 4U7SA 3FQNB 4XCCL 5BXFB 1MCPL 4PR5B 4CL7A 4FQXD 4P5TA 1AI1H 1EHAA 5B8CA 4UT9L 1SVCP 5DRXA 5MEOB 1GGCL 1ZK9A 5F9OL 4Y4HD 3VD5A 4KK9D 3EYOA 3QCTH 4DGVL 4MAUL 4X4ME 3C87A 5C0NC 1ZHBB 5EZOL 5D2LE 2LU7A 2FH8A 2JELH 3QBTB 5ANMB 2G2RA 2A0LD 3EJJX 5AUMA 2XN9D 5T33H 4PGJA 1YEJL 2R2HA 2VXVL 2COQA 3MRLA 4POZC 5BV7B 5DF0A 1MCCA 3P0VL 4KAQH 5FYJH 1LEGB 5ANME 5IEKA 4HD9A 4HUKB 4EI5B 3ALWA 1HH6B 3PWVB 4O2CA 4I18C 5DO2D 4DKFL 4CU8A 4O2FA 3EYQD 2PETA 5JZ7C 4NQXB 1Z3GH 4EI5C 5JHDA 1KC5H 2P45B 4X6FB 4E5XA 3REVB 3MJ9H 3PDDA 4XBEL 3CFKB 1MREL 3MO1A 4JE4B 1D3CA 3ECBB 4KKAD 4OGZA 5C0AD 3SJVA 1F11A 5FV1L 1A6UH 1I3RA 8FABA 1A7NH 4D8PB 3LHPL 4KRPD 2YRPA 5KSUB 3TYFA 3AC0A 5I19L 1BJ1H 5L88H 3OTTA 3MLPA 1HSBB 5D5MB 2ESVB 3S5LB 3WDJA 2UZIL 3SGDI 2FHCA 3QDMB 5DD1L 1WAAE 2JJSC 1RVFL 4S0SD 5LCVL 3TBYA 4JO1L 4CADB 3EZ8A 5T3ZH 1YJDH 3QDME 1HOCA 1UM5L 1GOFA 3DMMD 2X4UB 1T5WA 4JY4A 1YMHA 3QUXB 3MRJA 4JM4H 4CW1B 4HKXB 1MJ7L 3MLRH 4LFHG 1F4AA 1AR1C 2APBA 2CDGB 1X4ZA 1JZ5A 3CMOH 1UH3A 5GIRB 4PJDF 1GL4B 2DL2A 1QQDB 3DX6B 1P7QA 2XZZA 3HR5B 4YXKL 5AD0B 1DBBH 1U95A 2CR3A 5DQJB 3MRIB 1ADQA 3SKOB 3U2SB 2EXYC 5IHZA 3GJEA 1A14L 3EOBB 3QUMA 3S3PA 2HRPH 5I75C 2BVQA 3GI9L 3O2WH 3E6FA 3MLUH 5HDOA 1SBSL 5B22A 3QEQE 3ARZA 2NXZD 1IGCH 5DJ2A 1Q72H 5FM4A 5JOFA 2HFTA 2DQHH 5F6IC 5BV7H 1CICD 2D7OA 1YY9C 1A47A 1KFAL 3GSNL 5FYJU 4UTAH 1VGEL 3MJ7A 4X4ZA 5F9WB 1RZKC 1ZWIB 2OZ4A 3T1FA 43C9B 5GS1B 4UNVA 5CJ8A 3GIVA 4LSSL 4MNGA 1V7ML 4QY8A 2FEEI 5E9DE 3N1QC 4I0PC 3E3QC 4U1SA 4JPVL 2OL3L 1AQDA 2V7HA 1KTKE 5DI8A 3MFFB 4U1JA 3HAEH 2CLZA 3G6JF 3CDGB 1MRDL 1HEZA 3C5ZB 5EC2A 2OBGA 3O9WD 5FGRA 2BNRD 4TUJB 1DN0A 3WKNA 5HHVL 3KR3L 4N0UE 5EO9B 2CO7B 4BZ1L 3RU8L 1BPVA 2APTA 2FJHA 1RUPL 3C5SA 4XRCB 3ARUA 5E1AA 3FB7B 4HIEA 3T2NL 3KXFE 4PJEB 1U3HB 4ZYKA 4I0PA 1ORSA 3QQ4A 4FZEL 3UJIH 1JF6A 1KCRH 2H26A 3VGDA 4MHHI 3BJ91 4NQEE 3BP7A 5T1KD 2Q87A 4L8CA 4ZS7H 1I85A 5C0FA 1DBKL 4XMLL 3DVNA 2HWZL 5FYLD 2F5BL 2FIKA 5K59E 4GAYB 3OKMA 2W9DH 4PP2A 4QXTB 5GGUA 3QUZA 3MROA 2VERN 1CLZH 1CR9L 1WWBX 3MNZA 3HI6H 5DUBB 3BGMB 2EYSA 2QSTA 3TJEL 1N8ZA 5I15H 1MI5B 4XRCA 1DBAH 3AY4A 4PJ9B 5C71A 2Y07H 3MRQB 4QRPA 1ZTXL 3U9PH 4N0FB 1MI5E 1MJ8L 4XPHH 1J0JA 4QLRA 4D0CA 1B2WH 2PW1A 5DQDL 1U92B 4JO1H 2X5PA 1ZHNB 4KXZH 5EN2B 4MD0A 3EOAB 3RTQB 1ZVSB 3L5JA 4JLRA 3ZKMD 4C56A 1PQZB 3PWPA 1EX0A 1HSBA 2MKWA 4I4WB 1IAIH 2XA8H 2DBLH 3OF6D 3LN4A 2LABA 2BP3A 3PL6B 4AZ8A 2NY6B 3MBED 3QHFL 5HD8C 5A2KH 2CRYA 1KIQA 1PZ5A 3VWJA 4M4PA 3GJFH 2IALA 4M62L 4RWYH 3X13B 1MCHA 3NFSH 3CFBA 1U92A 1IC4L 2H6PA 1XR8B 5C09D 5HYJE 2EICA 4RX4D 4Z7VF 3DECA 3FO2B 3RWCB 3P4NB 3FQXA 3TIDB 4QRRE 5GZNC 2R2CA 1IT9H 3FO0L 4I9WE 1CBVL 3BPCB 4TULH 1OGAA 4MA7H 1M71B 4X7FC 4YBHA 5J56B 5DQJA 1U3YA 4APQD 4XCFH 4NFCA 1T20A 4MSWB 4LCUA 1XZ0B 3BKJH 1KPVA 5T1KA 2BVOA 4O02L 3U36A 4NO0A 4YUEL 4TYUA 1JWMA 5I8EB 4GKZA 4ZUUB 3D0LA 3L7FB 1D5ZB 1X5KA 1RJYA 5C0JB 3RTQD 3QWRA 1U36A 3RZWA 3NFNA 1G6RB 4UQ2B 2Y7QA 2IFGA 4RQQA 5I1DB 5DRZA 2DWDA 3A67L 3ZKQD 4U1KA 1IC1A 2OM5A 1IILE 1A4KB 4ZFGH 1RUPH 3O6FB 2IH3A 3S36H 5KSAB 3UROR 3KLHC 3BRFA 5GS3A 5TQ0L 3HN3A 4J3VA 3TBTB 2EYRA 5J1TC 4ODHH 5DJXA 5FOBB 1MPAL 3O3EB 4LKCB 4MYWB 5A40E 3I2CH 4MCZB 2QQKH 3KPNA 1II4E 1JP5A 5GZND 3KYMA 2WSKA 4L9LA 3S35X 1HKFA 2Z8SA 5CZXC 2MQ3A 2GJ6E 3B9EA 4NKIH 5TH2A 1IKFH 4RAUB 4CVXB 3QG6A 1KIPB 3NZHH 5CJQL 5DRZB 3MLVL 2HN7A 4YDIH 2W59A 4YXKH 3CSGA 4WGVB 5IVXA 1U3HD 5E1AB 5I71C 1MUJA 1K6QL 3K4AA 1N6UA 4H0GA 3VW3L 4J3OC 4LMQE 3NCCB 2NY3B 4Z8FH 4KRLB 5CJBA 3O9WB 4DZBB 3C6LB 4PJ8B 4WV1C 3RVXD 1FVDB 1VHPA 3D2UB 1JGVL 2DBJA 3HZKA 2FWOA 2BX5A 1KT2B 5I1LB 4XVSL 4JFFD 4UTAL 3RWEB 5TH2B 1JI1A 1DVFC 4XBGA 4CU7A 1RPQA 5ESAB 3QDGD 4H0IA 4YIQA 3EDFA 4JG1H 4M8QA 4FMKA 1HCVA 5MP6H 1XGPA 5FUCE 3NA9H 1UXSB 1IFHL 3T3ME 5EUKB 4G9FD 5C0DA 1BX2B 3QB7C 5IMOA 1FL5A 4YK4B 1FJ1A 4WO4C 1LE5A 4HQQH 1UCBH 5MEPA 2IG2H 3CUPB 4U1HB 2IBZX 2MCG1 3L5IA 1QO3A 4JLRB 1PG7X 3P9LA 3PHQB 4Z7VA 4PJ7B 5JHDB 3KVQA 1PY4A 4B5EA 1DDHB 5E94B 2E9JA 1G0DA 3W0WA 2OJEB 4X6DE 5FA4B 4G6MH 5F7EH 2XWTA 2LU3A 2F53E 2AK4A 3OAUH 5KZCB 2NY6C 1XGYH 3ARDA 4TUOA 4WWKA 1V3LA 1RZGA 3T65A 1OP9A 3KLAB 1G7HB 1G7QA 1FYTB 2HP4A 5LCVH 2DF3A 1A64A 2GJJA 1QLEL 3BKML 1KF9B 2DD8H 1FYTE 1K5NA 4HFUH 4KK8C 3FOLB 4GAGL 4NIKB 4ZTPH 1VEPA 2DICA 4KJYA 1Z6JT 4HK0B 4F3FA 1YJDC 3WNOA 3HRZA 2N1KA 4H0HB 4L3EA 5I1CL 4YZFE 3F7PC 3HS0B 5C0CD 1XH3A 2HT2C 4HJ0C 4UV7H 5H94A 3DIFA 3CZFA 3RUGA 4LLQB 4ZAKB 1YYML 1RURL 2I5YH 4WHTA 5C6TH 2J8OA 2NY2C 4DN3H 3MRLB 2F74A 2VDPH 4JFHE 4EVNB 1KLGA 2HRPL 2VITB 4GS7B 5LQBL 1KB9K 4MX7B 4BK4A 5IFAL 1LO3L 1JNLL 2LTQB 5B38A 2HFFA 2P5EA 4QRSB 4HPOL 2YD2A 2GAZA 4PJCB 2X09A 3BE1L 1A22B 3LV3B 1E6JL 4K3DL 2HVJA 3IFNH 5CEZL 3QWOA 3QP3A 4K9EH 5DHXB 1IQWH 4PYGA 1QBLH 1ZLUH 4LKCA 1QEWB 1J05B 4KJPD 4CU6A 2A6KA 4RIRA 1E27B 5ETUB 5E5MB 4XPTL 1UCTA 5E03A 1P84J 5FGSA 1G6VK 1EAPA 5L6YL 4DUWA 1YNLL 2VITA 4PJAB 1MFAL 3QEHB 5E4EB 1YNKH 1MLCB 2GK2A 1EBAA 5A43C 3CLFH 1NJ9A 1BFTA 1XIWA 1A1OB 3L3GA 4MWFA 3VFSA 4BQ9A 5D2NB 2YSSB 2AJSL 1C08A 1MCOH 2BY2A 2XZQL 3PV6A 4PGCB 2XZAH 1MWAL 1EVTC 4ZFOA 2X4UA 1OGTA 3V5KA 5I16A 4X6EB 3U0TB 1XAUA 3IAGC 4RA0C 1IFHH 3GMOA 3UDWA 1OAZH 4ELME 4J1UB 4Q58C 2IBBA 1YEFH 2NY3C 3C08H 2WLZA 4NRXB 2I24N 4N8VG 4K94C 4JGUA 5TFSL 1NAKL 1XF5B 2FX8H 2FZ3B 4ODUA 4IM8A 3PL6C 4MJ6B 4XAKD 3L95B 3RVVD 4DCQA 3O41B 3UP1A 3UTQB 3DBXB 1K2DA 3INUH 4ALAL 1FSKB 1YQVL 3WNPA 3D85D 5GS0H 2VAAA 3O45A 1RZ8B 4WO4A 4L4JA 1WSST 3ULVE 4GO6B 3B9VA 4KJPC 5D7IA 4N8PA 4NCDA 1LEIA 1I3RB 2YUXA 1MCIA 3QH3A 4K7PH 5FYKE 4U1MA 1F4XH 3QA3B 4MAYC 2IAMC 2R9HD 4F80A 2ZPKL 2WMPA 3VFOA 3B43A 1T80A 4K2UL 3RPIB 1T03H 4PGEB 3STLA 5TQ2L 3BQUB 1FAIL 5HVHB 2BY0A 3L1OH 4RFOL 2VUOA 3MUJA 3O3DA 1HCFX 4G42B 1TCMA 3TT1L 4DWHA 3NZHL 4LCCA 4GAGH 1HQRA 4IRSC 3ZO0A 2EEAA 4PRHB 5JORB 3O6LL 5EWIL 5SWQA 3D3VB 4OGYH 1U8IA 5L8LB 4QWWD 2Q7YA 3MGAA 4DOHE 2WP3O 4K8RL 3PWUA 1KPUA 4X5WA 5D2LA 3D3VE 5MEQB 4K71C 5I18L 1U95B 1T7XA 2QADD 4JDVA 3IXTB 3SCMC 5T1DH 2ZUQC 5DJDA 1WF5A 5D72H 5TPWH 4M61A 3IKCA 2WBJC 4XHJD 5FV2A 2AEPL 2QHRH 1OQXA 4UIKH 3RL1A 5HGHB 1MCKA 2ICWA 4YBLC 3MRMB 3BYYA 5EIQA 5H94B 1QSED 3BGFB 2VC2L 3RWFB 5C0AE 3RVTD 4L8CB 3TESA 4K55A 1XR8A 5K9JH 1F97A 4P2QB 4ODWB 2WBWB 1D5BA 1MCPH 5DD6A 3WHXA 5DUML 4Z7UB 3U7WL 5D1QA 1KB5B 3D39D 3IJSB 5DLMH 4OZFB 2VDLL 3HNSL 1J8KA 2R4SL 4JFDD 2XTJC 2NY5C 5DMKB 2SEBB 3A6CL 3LKPA 2FB4H 4MXVE 1ERNA 4JKPH 4RAVA 5KVFH 1CFTA 1JNNH 3CD4A 1IL1B 2FDBP 3HC0B 3VXRB 4U6VH 1CL7L 4JDTL 3GSXA 4IRJA 3RGVC 4PGDA 3QDJE 1OW0A 5TDOA 2EYTB 4PLKC 5CILH 1LWRA 5GRUH 1UM4H 1IARB 3CPLA 2NZIA 1EFXD 3RNKB 2K7QA 5I8KL 3UXFA 3ARYA 3QDJB 3P73A 3LAFA 5ISZA 3ZE0F 3RIAK 3JWOL 4NQUA 4XVJH 5KVFL 4B7LA 4P4KB 4J3TA 2VLJB 4O4YL 4ZO9A 5HPMB 4ZXBC 1WZ1H 4MNQB 4OCXL 5J06A 4N5ED 3F8UB 4NUJB 3ARFA 5DQDH 3ZTJG 5IMLB 2DI8A 1TVHA 4LEXL 1KOAA 4WENB 1U8QB 4WU7B 4LLMA 5DT1L 4AJ0A 4DKEH 3U0WH 3UCRA 1G9EA 3QEQD 5FUZL 3MV9B 1CT8A 1K9TA 4WI9A 1R3KB 2EO1A 1A6WH 4HIIB 4I0PD 1B3JA 1UGNA 2GTWB 3AU1B 1F4YH 3TVMD 3H7LA 4XAKE 4Y4KD 3W5MA 5KN5B 3FAXA 5E2WH 3EGSA 3SDCB 2YUVA 4HX1A 2X05A 2V2WB 1UYWL 2XRAH 1MCNA 4LU5H 5DEGB 4TVPH 3MGOB 1NEUA 3SE4A 4HW6A 1OP5H 1G9MC 5TGBB 2R0ZL 3NFNB 5SWZA 3CVHB 4JJ5A 3SKJL 2B0SH 1AC0A 1P6FA 1H3GA 4BZ2L 3D85A 2IPKA 2AJYL 2I60H 1X4YA 5F7WC 2IWGA 3MPCA 5HHMD 4MNHB 3LRGA 4P4KD 3X13A 4MZ3A 3AREC 2R15A 3FMGL 4PJXA 1Q0XL 2VIRA 4M7JH 1VA9A 2X1XR 1AR1D 2H3NA 4FP8L 1GCFA 32C2B 1BAFH 5H2BA 4LIQH 2YXFA 4XX1E 1FG2A 2I60L 3LSOA 3HC3H 2YPLE 4YHZH 2PUQT 1DLFL 3VDAA 3GZKA 4RFEA 3MV8A 4YR6A 2R23B 1BJ1J 1NQBA 4PJ9A 1QHPA 3MLXL 1E28A 3TWCH 4AENB 2VLKD 2BXZA 4F7PA 3BYTA 4I48A 4ZTOL 5GS0L 1D5MB 5ADPH 4RGND 2Z31A 4JG0L 4MD5B 1FN4A 3ZKXC 1S7RB 4P0DA 3BGFC 2DLIA 4HV8B 5E2TL 5EO0A 3BSZL 3QEUA 1Q94A 3MREB 4OAWA 3U6RA 1LK3L 5HSFA 3L3IB 2D7QA 3LEVL 4UDTB 4PRPD 4NKOB 5FXCH 5I19H 3P4MA 3AS2A 1NUFA 4M8QB 2ZSWA 3SKNB 5C9JA 2HKFL 2M1KA 3QUMB 1MQKH 3EYQC 3EDDA 1PZ5B 1U8KB 2BRRH 1TVBB 4TUKH 2PNDA 3IETB 4YGAB 4IDJL 4IRSD 4WI8A 5FAAA 4DGYH 2DM2A 1N6QL 1JUFB 3I6LE 3VA2C 2ED7A 1YJDL 2XXMB 3RGHA 3R4DA 4JHBA 4OLUH 4R2GB 1MHHA 4NQSA 5AZ2H 5JR1L 1R3JA 4PV8A 5T1DL 3BVNA 4W70A 4LCWA 4QTHA 1T1YB 1OTTD 4ODVL 2NCMA 1CTOA 2OK0H 1G0XA 4PJ9C 1S9WB 4MGXA 5J9PA 1A6WL 3IDNB 1PKQA 2VSDA 1F5WA 3GNML 2D2OA 2ILLA 1MCQA 4NC1C 4HK3N 5IW1B 1HYSC 4OLUL 1A14H 2HFGL 3GJFB 2DQIL 3HZKB 3BKCH 5DTFA 3FQUA 5CSBA 5FUOL 1U8PA 3RVVC 4CGTA 4ZOAA 1I75A 1HILB 2YBRB 3QIBA 2MHAB 1O7VA 1LHZA 4HKJA 1HWHB 4XXCC 4LARL 4OUUB 1UWGL 2XYCA 4PJIB 2Q86A 2BVQB 2W1NA 1A1MB 2QJDA 3LMJH 2YA2A 5CEZD 1CD1B 2IH3B 4YHPB 3LD8B 1EZVY 5HGAA 4F9PC 4OFYA 4PBWD 2AXFB 3G5VA 3OR7A 3W81A 4UNTA 4PJ5D 2EECA 4EN3C 2G9HA 4G80A 4LIQL 1YC8A 1EXUB 1J8HB 4JVPA 2IH1A 4NJ9H 5TJWK 2X4PA 4QF1B 3TNMB 4RWYL 4LPCA 4QXGH 3KPLB 3U1SL 1U91B 3JTTB 4ONFL 4I18A 3R0NA 5DFVD 2P8LB 3MNZB 2PR4L 2CIIA 2JK5A 4Z95H 5EA0H 1DSFL 4KY1L 2HYMA 4WY7L 3DO3A 4L4TB 4TNVF 2J5LC 4P4RB 1RIHH 4QOKE 5F9WC 3KHQA 3O11B 5D1XA 3X3GH 4N0CD 1ZLVH 1IM9D 5ECJE 1A5FL 4TPRH 2NPLX 1FFOA 3V79C 3UC0L 4NT6B 5DHVB 4I3RH 5DK0B 4O2FB 4HGWA 3U7YL 5A16B 5DC9B 1W0WB 4XVJL 3NCMA 2OTWB 1VEOA 1JNLH 4GW1B 3QFJA 4WWKC 1DR9A 2NY1C 2WIIB 4DEPB 2GT9A 5IBTH 1DEEB 4J4PD 2IPUG 1XGPB 3DO7A 3HZMB 4DTGH 3FHAA 1F90L 3IDXL 4GAYA 4CDGC 2R4RL 3KPTA 1F3JA 1ZSDB 3BZ4A 1P2CA 2IANB 1J12A 1AC6A 1UACL 1BREA 5F89A 4G6AD 5IWLC 2PO6B 4PV9A 4Z8FL 2YPLD 4HWEH 5HYJA 3L95A 4JZNB 4PGBB 4NFDA 7FABH 1M71A 4OCSH 2ICWB 4ZD3H 1GC1H 5ITBL 3ELAT 1I7TB 2XWTB 3RDTA 3FQTA 1IGIL 1I1YB 3KJ4C 4JRXD 3B6SB 5I1AA 4G8IB 4PJGA 1WCQA 4MD0B 2D7TH 5F97E 4U0RB 4S1QH 2QV2A 3QAZC 4UU9A 5JPNB 2PXYA 4HF5L 4K3JL 3BWUC 3VGBA 3UPAA 1NKOA 2J8UE 4UT9H 3TN0B 5I6XC 5ID0B 4BSVA 3U9UB 1R3JB 2NR6C 4OT1L 2CKBH 3V9FA 1FYTD 3WS6C 3F7RA 1H0DB 2NY4C 5F6HJ 3PGCA 1WBXA 1I8KB 1T0NA 2VE6B 4TVPD 2R8SH 4G8GE 5M94B 1MCRA 3TBTA 1RMFH 1ZS8A 3R8QA 3CZFB 1KJ2B 1CCZA 4MB3A 4UOJA 2P7TB 3FFDA 3QQ3A 4WCYL 1JPFA 3QXWA 4HWZA 1RZKH 3UTZB 5AYUH 3QQ9C 3QUYA 2BNQE 2OX5A 5DSCA 4M3JA 2IBGA 3UO1H 5IJKA 5HHOE 3BPLC 2WINB 4KMTL 3VFWB 4G6KL 5KW9H 2BNQB 2NLJB 5D7IF 4IRSA 5D7KD 1G9MH 5J3HC 3HMXL 4J3SA 4D3CL 3GI8H 4OFDA 4ZO7A 3MTRA 4MQXD 3B9KD 4U7MA 2CLZB 3IFPA 4XC1H 3O2VH 5ILTL 3DETD 4RGNC 1FNSH 4UDUA 1I7UB 4G6AC 1RJZA 3TJHC 3WYRA 5KSBF 1D9KA 3VXUA 4PRBA 4U0QB 3JBG7 4I3SH 5HHQB 4TQEL 1WEJL 3V5DA 5CZXD 3WFHB 1UVQB 3MODL 1E4JA 4NQTA 4PJBB 3BFOA 2H26B 1XGTB 2P42B 1IZKA 2VLLA 3C9NA 1J5OH 4P99A 4UV4L 3ZKNC 5BOPA 3ARPA 4NN5C 2QLVB 4XMKL 4QXTA 5GGUB 2IPTL 4RAHA 2JJTA 2EE9A 3WO4C 4N90E 1NUNB 3KYAA 4TSAL 4H1LA 4NPYB 4BKLB 2A9NH 3W9EA 4LBEA 3IVKA 3NFPA 2VH5H 1J9CT 2LFGA 2QR0B 2VLKE 4QKXB 4HWEL 4X7DC 4Z7NE 1R24B 2I25N 1OM3H 4BFBD 1LK2A 4P3DB 4X8JB 5MERA 2VLKB 2XIDA 3TBVB 2F54B 4RMSA 1JPTH 1NMAL 3HLAB 2R0WH 3QHZH 4KMQA 1QLFA 2H8PB 2EDDA 3BKJL 5LAXA 3BW9B 3ULUC 3KYNA 4FQJH 2D7TL 5C6WH 2HLAA 2IANA 3H0TB 2D03L 5BJTA 3BH9A 5J6GB 4HFWB 1S7VB 2PTTB 1WQVT 3GSOB 4RFEB 1A4JA 2D9QB 1N64H 4XNYL 4AG4L 1ZGLB 4L4VE 3CLFL 3UX9B 3MNVA 1ORSB 3VMNA 3SKMA 3BEWA 3MZTA 3G9VA 3VXPB 3P4LA 4X99A 4ZSOA 1I7TA 2PXYC 2Z93A 1G7IA 4KZEL 3WUWA 1URLA 3O4OC 1BGXL 4TRPH 3F5WA 4HZAA 4LAQH 4P46B 1BVZA 5HD8D 3RPKA 4LSQH 4AL8H 1CU4H 1D9KD 1JWSB 5IM7B 3X3GL 3GBNH 2V2TB 4QCIA 2HJLB 5C0EB 4CN1A 1NGWB 1MFBH 3GMMA 3I85A 1TQBC 2H45A 2GYSA 1RUKH 3NBNA 4XXDB 1NC4B 3TA3D 5GGQH 3K74B 2HA1A 5C6PB 4MXQC 3FO9B 3WFBL 5C0BA 4ZFFA 3QNXA 1Q9OB 4M7LL 4WUUB 4BYHA 1GJIA 4HS8L 4LGSB 2WWKO 4PB0L 3VA6A 3QWOB 5IMLA 3D1MC 3GSUB 2X4SA 4LP5A 3SJVE 1RUML 4OJFH 3S98A 2Z91A 3C8DA 4N9OB 4CVZA 2D0FA 3FOLA 2OXHA 3LRHA 3I6KB 4LCWB 1E4XI 2ZUVA 1Y6NR 2EDEA 1AKJB 2D9CA 1KB5A 4G43B 4JAMA 2ERJB 1KGCD 4DN4H 1IAKB 3PQYB 1EEZB 4K3DH 4JPWL 4M1CC 5ERWA 2CGRH 3BKYL 3BE1H 4LASL 1IKNC 3PQYE 4Y8DC 3QRGH 3PNWB 5I74C 4PJBF 5K93A 3HCVA 1T6WA 4NBYB 3IFPB 2NY0D 5JUEL 1HI6A 3PGFH 4X0KA 5EU6A 1KLGB 5GGVL 2VDOL 4WEMB 3OG6B 1WTLA 5FYLE 3SGJC 5GS0C 3OKDB 3QXAB 1WUNT 1NEZA 3H42L 2IEPA 4FQLL 4M48L 3WFHA 1Z5LB 1M05B 4L3ED 5EOCL 1CXKA 4QY8B 4J8RB 1IGCL 4NWUH 1LEIB 3KLDA 1DCLA 3G08A 4OFIA 1RUAH 5KVEH 1ZVHA 1QRNE 5F7YC 5H35A 1BOYA 2H3NB 4Y89A 3RWIB 2N7AA 4JFZL 4LSRH 3QEGH 4DK6A 4NJ9L 4XH2B 3V6ZB 4JFPB 3QFDA 5ESQA 4IOIA 4NWTL 2F8OA 3BD4A 5K59F 2GTZA 1LO4H 1H3TA 4WO4D 2JJVA 3ARED 4K71B 2VO5A 3QIBC 2JTDA 4X6BB 3OWEA 5L2JB 3F7YB 1UH4A 4RMVA 3ARFC 1X5ZA 1OSZA 4ZNEA 1OGTB 4XCNA 4BZ1H 5JXEA 5HVFB 3W5NA 4PJHA 4P3DA 4X8JA 3ZTNH 2AKRA 2ESVE 3UTTA 1F4XL 3QULB 5K9QI 1HK6A 5IFHL 1GGUA 3P0YH 5BXFA 2NW3A 3MRDB 3IU3B 1FFQA 3P9LB 1IEAA 3DSFL 4KC3B 1MQ8A 5HI5C 5LGHL 3JV4A 1N6QH 4ETYA 1NBVL 3QIUA 4GXUN 2CR6A 1DUZB 3EUUA 4LLDA 2X7LB 4R4BB 1OPGL 1CFBA 3ROOA 4KUZL 4GJTB 4O51A 3QI9D 5D7JB 3ARQA 5EU5A 1TZGL 2WIIA 4OGXL 4XP9L 3BH8B 1TVBA 3D9AL 5D7JC 5D6CA 1N2RB 3SDCD 3VFOB 1O0VA 1G7IB 3MJ8B 1SYSA 1N59A 2ID5A 4XP1L 5F1OB 43CAA 1JGDA 4M5YH 4NQXA 2XICA 3HRZB 5DVKA 5LGJB 2VXTH 4RMQA 1GYAA 2ZOLB 3QEQB 1OCWL 5J0BA 1S7WB 1BFVH 2VKWA 3Q2CA 3BH8A 2GFBA 4BH7A 1GZPA 1NFDF 4I48B 4N8VA 2VN7A 3RFZC 3OKEA 4PG2C 3MOAH 1ORQA 4OF5A 4HPYL 1BD2B 1C8PA 1D6EB 1LEKB 3ZE2F 2BJMH 1VSCA 2EKJA 3KDMA 1CLCA 5I71B 5JZ7D 2Q76B 3STBA 2O93L 3FCTB 3SGEI 3L3HB 4RZCB 1EA9C 1RZFH 2O5ZH 2APXA 3EFFB 4XBPB 3VDBA 1A2YB 1R5IB 4UDTA 1H3WM 1OB1B 3QG7L 1FGNL 1U6AL 4XNXH 4N0UA 4Y2OA 2HFEA 2NTFA 1OWRM 3DHMA 5F44A 1KPVB 1IBGH 5JLZB 1CK0H 1IGJB 2GITB 2W0FB 1BJMA 3HC3L 3NAAL 4GRMA 4YDVA 1QFUL 3R0MA 4YHZL 3QYCA 2AEQH 2HVKB 4LDOB 1IC4H 1A7NL 1HI6B 5D93B 1B0WA 4N90D 5C0JA 1VPOH 1JCKA 1JHTB 4Q0XL 4E9LA 4JPVH 2OMBA 1YPZF 3LN9A 2Q76A 1CDGA 4Y5XA 1BQHG 3FT2A 4X4MA 5J7CC 1A1OA 1L0XA 1RZKL 3S3SA 2Y23A 1ADQL 3S4SB 5IQ9A 5J1SC 1I8LA 3CZJA 3LDBB 1ZXQA 4ZTOH 1YEJH 1CXFA 4HUNB 5KN5A 1RIUH 2ERJC 2YD5A 2R0LL 4HUVB 4ZAKA 3EGSB 3SDCA 2FHBA 1J1OL 3VD7A 4GXVH 3DUUB 5A16A 3ZYJA 1SMOA 5EWIH 1QKZL 2V7NB 2JLLA 3S36X 4M1GH 3QDMA 1ZTXH 4Y5XB 1ZLSH 4M3KB 5I1IL 1MCJA 2GY7B 4LCIL 2O5XH 4ZAKD 4HUWB 1Q0YH 1WT5C 1U0QA 5IB5A 1U8OA 2H41A 3T0XA 3KPSA 3HZMA 4GBXA 4JB9H 3CFJA 1HKLH 1IJ9A 5C8JB 4K8RD 2LV4A 3HTLX 1FYHB 4M93C 4YDJB 4E42B 3O3BA 1R5WA 3S35H 1VKXB 4XX1G 3BT2L 3RX8A 2BNQD 1QR4A 4R26H 3MCG1 4UTBH 5E5MA 4M1GL 3IFOB 1G7PB 3V52L 4JFXA 4HUUB 1NANH 3WO3B 3EYVB 4H8WC 3S37X 4ZG1A 4GRWE 1HHKB 5EFIA 4YAQA 3BMVA 5F88A 2NY2B 4Z77B 4Q9QH 4HH9B 1QSVA 4PRNA 2UY7A 4KUCF 3FQTB 4ZUTA 1CFNA 4GRWB 5M7QA 3V7MA 1U8IB 3U0PB 3OKNA 3BIAX 3P9MB 3CCHB 1XF3A 1HHJB 4UTBL 2VXUH 3MRBB 4OKDA 4G6FB 3NVQA 4IRJD 3K81A 2XQYK 3AMLA 3DI3B 5EOTB 4LHUA 2J3SA 5E8OB 3MUHL 4BSVB 5FKAB 2Y06L 43CAB 2HFGH 4P59L 3DARA 4Y19B 2FX7L 3MRHA 4DQOL 1W0WA 1ZGLA 4AH2B 2FO1A 1EERB 2E7MA 4LHQB 1DDHA 5E94A 4HAFA 1EDQA 5BV7C 2RR3A 1ZAGA 3T77A 4HLJA 3T1WA 4QT5A 5LBSL 2VXUL 2IADA 2JCCB 3FONA 5BRZD 1SM3L 3NIFE 2A6JA 5CGYC 3SPVB 5IQ7H 4WI5A 2V5RA 1JWSA 5IM7A 2VAJA 4G5ZL 1XGQB 3VGEA 3QJFA 1FNSL 2BFVL 4Z78B 2VLRB 4IJ3C 3D69B 3HB3D 4QRUA 5DZNA 4PJEF 1S7UB 4FFWC 5I8OH 3UBXB 2VLRE 5DMKA 3U1SH 2NXZC 1R3IH 2NY7L 1QYGH 3ZTNL 1U8NA 3EO9H 3ES6B 1IM3A 4BJLA 5I17A 4Q7DA 3IDYC 5J11B 3GHBL 1A6VH 1TQCC 4ISVA 1KG0A 1QZ1A 3NACL 3IDNA 4NC2B 5E00A 1NFDA 3IDMB 4Y16C 5JO5A 1KB5L 4DN4L 5BOZG 5C0BD 3RUGE 4YHLL 2GK0B 4JY6B 1RV6X 4GQPH 3GJFA 4XP4H 1ULVA 1I8IA 4RWHA 5LGKA 1U2CA 2FATL 5CGTA 3BHBB 2DQUL 1CGSH 1NCAL 4OCYH 3ZL4L 4POUB 1T20B 2UVEA 3RI5F 2HT3C 1BFOA 5CCKH 2M26A 5I17B 2V2XB 3CIQA 3GKZA 2YK1H 1J7VR 4N0FA 2CO6B 5FKPB 3TT1H 1G9NC 1V5JA 4HIXH 3ULVH 2H32A 4I3SL 1KACB 5DJ8A 2CDEB 5F21B 3SDDB 5EULV 2P7TA 3FFDB 2AK4E 1A9BB 4J7RA 2RQ8A 5FA3A 3LPFA 3GMMB 3JTTA 5FYKL 2CXKA 4LRIC 4WV1A 1IAOA 4P3CL 1AGBB 4WHCA 1J0YA 4LARH 1L7IL 3FAWA 3BPOC 3BP7B 2NLJA 4WHYG 2AV7A 5IB5B 3SDXF 2DQDH 3QWQB 3UZQA 1A8JH 1WBZA 2A9NL 3MLWL 4H25A 1YY8A 1AGEA 4V1DE 4LCYA 5FYKH 1J0IA 3CVHA 1MAMH 2QQNL 3OF6A 2VZ3A 4PR5A 1MCBA 3KYMB 1SQ2N 4S0TD 3WKML 1ZV5A 2X89D 3F7VB 4HC1A 4KY1H 5CD3A 3TIEA 4X6CB 2A0LC 5EU3A 4DGVH 1JPTL 1NMAH 3QHZL 2Y72A 1JWUA 4B7IA 3MJ9L 3VXSD 1LNUB 2F15A 1E4KC 1H3XA 4HLZH 2OI9B 4EQ3A 4GRWH 5FECA 1AGCA 3GMLA 2Q8AH 4DKFH 3UBXI 1SEBA 3BAEH 4UMGA 32C2A 5H2BB 4H25B 1F3JB 2I27N 4OIBA 3V6OA 4FFYH 5FOJA 1JTOA 3F6LA 2HAZA 2B5IC 2BC4B 1ZHKB 3ZE1F 2X4QA 4HIEB 4O4YH 5TDNA 4OSUH 2OL3B 2DQEH 1VGKB 1FZJA 2OQJA 2DLFL 4FXLA 2XKSA 4LOUC 1PFCA 4DZ8B 2DRUA 1FJ1B 2NY3D 3I6LD 2YD7A 2ITDB 1FN4B 4XP6L 3CH8A 3NIDF 5FM5M 1UZ6F 3WIFB 5LQBH 2IGFH 3GRWA 4S1DD 4UT6L 4U4BA 1BZQK 4Z7VB 1HQ4B 4MA8H 4PJCE 2FO4B 3KPQB 4OFPA 4WTXA 5HI3D 2ZUWA 3CFCL 4U1HA 4MVBC 1BOGB 2AJZB 1KTDB 4KJWD 3IB4A 1S7WA 1ZANL 5D70L 2AXGA 4E0RA 4BFEA 3QHTC 3EFDH 1H0DA 4NBZB 2X4RA 4OFVA 2N56A 1TTUA 2YD9A 5CBAA 3ULUH 2OR7A 2E8YA 4PIRF 4P2YA 4PJXB 2EDKA 3H3KA 4OKVA 3BD3A 1OD7A 4KDTC 4TUOB 1R0AH 3GKWH 2CJUH 1AR2A 4XCYA 4XPAL 1FH5H 1RK1A 1IRAY 4GLRH 2A74A 4L3EE 1CE1H 3O6FD 4U1KB 4N0CC 5IGXL 3FJTA 1IGML 2IPTH 1UB5B 1I3VA 4L3EB 1INQB 3MOBL 4NOBA 2W60B 5J1AB 2RAMA 4N8CL 4Z76B 1S9YA 3SKOA 3U2SA 4GG6A 4KJYB 4N1CA 3MLWH 5IVOA 3QO0A 4UIKL 3ZYZA 3O8XB 1I7ZB 3LKQA 4FQPA 3O4OB 2E8ZA 1FVCB 1GHFH 3GB7A 3TLRA 2X4SB 1XH3B 4ELKB 2Z31B 3SDAB 4MVBD 1FV1B 4MJ5B 4U05A 2NY0B 1CXHA 2P8PA 4L8SA 4CVXA 3OPZH 3Q6GH 1X5GA 2XNAB 1TETL 4KAQL 2IC2A 2G5RA 4PJIF 1J0KA 2JIXA 4XZUA 2P44B 2C7UB 1T5XA 5E8EB 1PY9A 5BS0B 3NCYP 1YNTB 5T5FH 4JDTH 1MWAB 5H8DA 1NMCC 1N4XH 3K2UL 4UIMB 1EEZA 1AP2A 3R1GH 1BEYH 1RZIA 2D0GA 5A2FA 2VDQH 2DQCL 5F71A 4WFHD 2RIKA 1CU4L 1TDQA 1FYTA 4LLUB 1KTLB 4HXAL 4XB8A 4NZDA 2OLDA 4JPKL 3FRPG 3ZTJH 2NX5B 3UTPD 2WP3T 3GEWB 4ZOBA 4PLKD 2RFXB 4L8BA 2NX5E 3DV4A 2H2PC 2VJXA 4KHTH 1KB5H 1MLCA 3MNWA 3WIIL 4I1NB 2FJGA 5K9OB 4AEIH 2DS4A 5JW4M 4LPUA 2I07B 3PJSB 2V9QA 2B8OT 12E8H 2F54A 4PREA 4U1IA 1IKFL 3UTOA 2YK1L 1JV5A 5C07E 3BKMH 4K8RC 4M43H 5CP7A 5JR1H 3TPKA 1NGQL 3BUYB 1H3VA 4DVBB 3QDJD 4KQ4L 2MOVA 1CDCA 3QRGL 3HE6B 2C9AA 1I3GH 3UYPA 3LN5B 3KNBB 4XHQA 2QKIA 1P5UA 1U42A 3DX7A 4L5FL 1GH7A 4DFIA 1W0YT 3JTSA 1UADC 2VL5B 3MOQA 4FQXC 3TA3C 2AXJA 4FTVE 4PPTA 4P2QE 3IU4H 4I2XB 4TSAH 4J23A 3I6GA 3V6OC 2WAHA 1E4XH 4I2XE 1I9IH 4LHUB 1OF2B 2ATKB 1NBZB 3O0RL 2Y36L 5I2IB 5HHXH 3IGAA 1RZJH 3RIFK 2V2TA 5F1IA 1BIIB 3V95A 2MCPL 1RK0B 1NGXB 4JZNA 1HXMB 2XN9E 5GGVY 2ARJB 2W0LA 1LK2B 4XNMA 3QHFH 4JHWH 4YWGH 1ONQB 1Z3GL 3H8NA 2EDXA 2XN9B 1WISA 4HT1H 3SQOL 4NQCD 4MA7L 3GRWH 2W0FA 4GRMB 2WANA 3RJQB 3MRPB 5IHUL 1NFIB 3CU7A 1XGQA 1G9NL 3FKUS 4JM2F 4ONGH 4TNWF 1AQKH 4Y5VC 2MCPH 3QCUH 1FPTL 5FYJE 1EK3A 1RJCA 3WFZA 4JRYE 4MDIB 3KLHD 1Q9KA 1FZKB 5DVOA 4DVRL 1H8SA 5HTSA 5F9AC 3IF1A 4KKBD 4YQXL 5DRXB 1ETZA 3WS6A 1OW0C 1HINH 3MCLH 3MRJB 3VXPA 1A7BA 1WBYA 3DRTA 3E6HB 3HMWH 3OR6B 5F1SA 5HHPB 5HVGB 4BQ6A 4U2YA 4LRIA 3LEVH 2V5MA 3RBGA 5DK2B 2VLRD 5ENWB 3G5ZB 1ZT1B 2OR9H 4Y4HA 4C56D 4ZTPL 4ZUUA 4IMLB 4MJID 5IUSA 1K8DB 5BRZB 4ZFOL 3B9KB 3FT4B 1X4XA 5IBUG 1I8MA 4DKDC 2E7HA 2ARJQ 3SDXB 1OLLA 1S9VA 3KPSB 4QGYA 3BXNA 4OQTL 2BRRL 2BCKB 3HAEB 3IDUA 4KHTL 2X9WA 3BI9X 5HDLA 5I15L 4QRTA 3WFDH 2QSCH 5HPOA 5C0IB 4J3WA 4OZIA 1XF4A 3H3PH 3KPNB 3GBLA 2DBLL 4F7CB 2FECL 3HE7B 1BQHB 4LSVH 4BQCA 2F5AH 4HUUA 4G7YL 1IGMH 3Q5TA 4MQXC 2KZWA 2OSLB 4XH2A 3V6ZA 1AGBA 1HYRC 3C8KB 1CDYA 3NCYS 1CFQA 4O5LH 5K33A 3MOAL 1DVFB 1KJ3L 3T0EC 3FHQA 3HKFA 1HOCB 3CXDL 5D71H 4OZIE 3HCVB 3I84A 3TO2B 1CYGA 2X10A 1YY8B 4R97B 1KJMA 4PB9L 1U2HA 4PJGE 4KI5E 1ZA6B 3E2HB 5D2NC 4JKWA 4JHWL 4WI7A 5JW4Q 1KPRB 1YZZA 1KULA 2VWEE 4YFEA 3O2WL 3JXAA 3G6DH 4S1SH 3ZKSD 1QRNA 4G7VL 3P4OB 3CFEB 3MRGB 5GSVB 2ZCHH 4M7ZB 1QRND 5C0CE 2XTJD 4ZS6D 5FDWB 2BOBA 2NR6D 1MHCB 2VISA 3C08L 3L3JB 4L29A 4M7ZC 2EC9U 3MA9L 3MRKA 1QNZL 5KVGL 2E3VA 4JPIA 2LU4A 1I7UA 4YC2B 5DS8B 3V4VL 4FQQB 5KS9F 4AY0A 1NBVH 4KK8D 4RGOH 3IKCB 1BWMA 1QLRA 4WY7H 1QPXA 1ZWIA 3I2CL 1KC5L 3WNKA 43C9A 2FHFA 4W4NA 2DIJA 2F58L 1MNUH 4WGWB 1JPGA 1DQML 2YWYA 5CBEA 2YPKA 1R5VB 1RIUL 5CHNB 4LVEA 4WEUD 4U1SB 2GHWB 5AUMB 3S96A 4HHAA 4Y1AB 1QLEH 1UZ8A 1S7TB 4MMXC 3T65B 3MR9A 4ZO6A 4JEGB 4P3WA 5IHLB 4NQCE 5HGGS 1YECH 3RKDC 2FO4A 2AGJH 3KPQA 4M03A 4Y1AE 2AI0L 1I1AA 3IJHB 4ODVH 1P2CB 4Y5VB 3KDMB 2HG5A 4GG6E 1NAML 3T2PA 1QRKA 5DVLA 2C1PB 1VCAA 3AB0B 3MRHB 1YEKH 5GHWL 1B9ZA 3IF1B 1ODAA 2J8UF 4GQ9H 1TXKA 3TGXA 3O6LH 4NC0B 4NQVA 1WZ1L 4OCXH 1KEML 3UZEA 1KLUA 1IAMA 2MFNA 5C70A 1HIMH 5I30L 5AAWA 1OARH 4D8PA 3MRFB 4M48H 1IGYB 2MTPA 4CVZB 1RK1B 2ZUXA 5IV2A 5HGBB 4OD3L 3G5ZA 2Q6WA 3R8BB 3ZHLA 3JWDC 3TIDA 2LTQC 3WDHA 3CPLB 2VUYA 4R4FH 1I1AB 1RJLA 5IVZA 4KK5D 3CMOL 1VACB 1QSFA 2H1PH 4O2EA 1MI5A 4KH2A 3FN3A 4HPYH 1J8HE 1MRCL 9CGTA 1MIEL 5JW3L 2J4WH 1VGKA 2Y36H 3ARFB 1D9KC 1A1NA 4U6HA 4Y5XC 1T21B 2O5YL 1LO5B 3FN0L 5MENB 4P46A 4XPTH 3VXME 2VDLH 2A6KB 3MLSL 4RIRB 2Q6WB 5MENE 1T0MA 5CLWA 4NZRL 3MA7B 4NKDA 2E6JA 3VXMB 1FG2B 3B8SA 1A6TA 5F7FA 1NGZA 3C60B 1ES0A 5ICZB 1LK3H 1YMME 3DUHA 1JE6A 2OI9C 4G7VH 2NY5H 3LZFH 2ICES 1PD6A 1C5CL 1MFEH 4L8DA 4G8GD 2FBJL 3BIBX 3RWIA 3OZ9L 1MFNA 1Y18B 2WM0A 4N1HB 1R3IL 2NY7H 3QNZB 1S7RA 4J1UA 5GGRB 4XGZA 4M8VA 3K46A 4ERSH 3CVIH 4PG2A 4TTGA 3UYRH 5F1NA 2BHYA 2RCSH 3CFCH 5AWNH 3IDGA 4K7PL 2AEWA 4LAQL 1GGBH 1JRHH 5F96L 4WNQB 3RWDB 4P48A 3V4UH 1RZ8A 4WO4B 2KL6A 1T2QH 4M6MH 5GRZA 1U8JA 1F58L 1OTTC 2AKRB 5SWSB 3F6IA 2VLJA 1YEGH 3O8XA 1MAJA 2NNAA 4LF3B 1T2XA 2DQUH 4OCYL 1UWEL 2KZ1B 5SWSE 1QPPA 4LSUH 4ZPTB 3KPLA 4J6RH 4PBXA 4AIZA 1TNNA 4AMKH 3BT2H 5AEAA 3QIUB 2YZ8A 4APQC 2C3VA 1A7OL 3D87B 1EXUA 2I9LA 3JV5A 5I8CB 5FGCE 3OMZA 2VDPL 4Y4HC 1AIFB 2HT2D 5TE4L 1UKQA 3BP4B 4DKEL 5E1HB 4CMHC 4LHJB 1B0RB 5BVPH 1NUDA 5D7KE 4DKAA 1FC2D 3AXLA 5CBAB 3L6FA 1SJEA 2E27H 3MXVL 1ZT7A 1F13A 3OG4B 1YNLH 3FQNA 4NKQB 1GHFL 1DQDL 4LMQI 3JZ7A 3LQAC 5A3IC 4OAWB 1BIIA 3W0WE 2IG2L 4NSKB 4PY7B 2DQHL 2NYYD 1NFDE 4Y5VA 3RWHA 3W0WB 1CE6B 1YEDA 1XF2A 1ZHBA 1VFBB 2Z0BA 3ARDB 2J1KA 4LSPH 3ZE2E 2ICCA 1WIUA 2W0KA 3EAKA 5CJOH 5T1LB 1CD1A 4YHPA 4OZHA 5MEOA 4QRPB 4G6ML 5F7EL 3THML 5BMFH 1T4KB 4KHXL 2AJSH 3MCKA 1X5AA 2C26A 2P8PB 2NX5D 5D1ZB 1G9NH 4X6DF 1P7QB 3CJJA 2P5ED 3EJZC 4R4BA 5A2LH 2CXGA 2ATPA 1KTDA 4GSDH 4S1RH 1CLOL 4FABH 4XPFH 3OB0K 1E28B 3HFML 3QI9B 3ROLA 1YPZE 1CIDA 1QFPA 2BVPA 1TETH 3MV9D 5F7UA 4KMTH 4EDXB 1HDMB 4LNRB 4NP4H 12E8L 3EO9L 2VLME 4OKVB 1E4WH 2A1WH 2Q8BL 3TO4C 3VMOA 2XQYG 5DD0L 4PJBE 3FQRB 4YZFF 3RWJA 2R39A 2C5DC 1FNAA 1E4KA 1F58H 4OZ4B 4K2UH 5B8CC 3BZFB 2BVTA 3PWPE 4NO3A 5FUZH 5CZKA 1T2JA 2DLGA 2W9EH 1CLYH 4LRNL 3A0OA 1RI8A 5JW5A 3QDGE 5ITFA 4POYA 1S9KC 5T1MA 3ZDZE 1CI5A 3VXQA 4I0CC 3WE6B 4KU1A 3OAZK 4U1NB 1KENL 3G9AB 3U36B 1MJ8H 3BEVB 1KCUL 4Q9QL 3DUUA 2VR9A 5GJSH 4GUPB 5CJQH 4HWZB 4KI5C 4HWNA 1UYWH 2RBLA 4EUPG 4HXBL 1DBAL 1BD2A 2C3XA 3G04B 3JVGC 4X7EC 2NY1D 5BVPL 3QUML 4ODTL 4HDIA 1NJ9B 4MJIA 3QXUA 1EUUA 3OKDA 5LVEA 1IM9A 3NPSB 3AU1A 5BS0A 1MVFA 4BFIB 5C8JA 5D72L 3G6JE 3KWWA 3QZWB 5I16B 1DANU 3SKUD 2ZG3A 1S8DB 3HC4H 4XVUC 2P46B 5C2BL 4OBSA 2VR5A 5HVHC 4Y2DC 4P2QD 1OM3L 1KXQE 5C09A 4P5TB 3MXVH 1QVOB 3PXHA 2B1HL 1AJ7L 3DV6B 1CIUA 3EYVA 1QSEB 1U8PB 1YYLL 3IAPA 1IGTA 1DQJB 5T5NG 1CICB 5IVXB 4BQBA 3EO1B 4M4RA 1EH9A 4PJ5A 4QTIL 2HJKA 3V5DB 2BOCA 3WUZA 2Z35B 3PQYD 4LDLB 1KBGL 4Y4FB 4M9OA 3RAJH 5T3XD 5JIIA 2DLTA 3M17A 2BNUB 4OZGF 4HMEA 1CBVH 2LVEA 5CSGA 4O2CB 4Z5RA 3SY0B 4B0MM 3IU3A 3PIQA 3H9SD 4TVSa 5GGQL 3NN8B 3WIHL 1FAKT 5F7NC 1BIHA 4EKXA 3S3JA 3RA7L 3UTPE 4M6OH 5TQ0H 2RCSL 1FFRA 2PW2B 3VFWA 2XFXB 5E2VH 4IEFB 1FG9C 4HUWA 3DVNB 4OZHB 3V0VB 1T66C 2DLEA 1UXSA 4AQ1B 5FF6A 4DW2H 3L5XL 2B4CL 1SYSB 3TFKD 1FFOB 4XPGH 1EEYA 2X6MA 3RIFF 3SY0A 5HHOA 3HZYB 3U6RB 4KUCD 3DHJA 4EZMA 3SDAC 5E6ID 1JF5A 4NQVB 2VB5A 2HTLD 4JY5L 1ZLUK 3ZSTA 4U3HA 1MEXH 1A3LL 1H15A 3TN0D 1TQBB 1YDPA 5DD3L 1RZJC 3O6ML 2DDQH 5D1QD 5GGTL 4PJFE 1OCWH 3DXAE 4YFLI 4OV5A 1G7QB 1TIUA 1HIML 5TE7L 5I30H 1A3RH 3VJ6B 3TCXA 1S9XB 2BK8A 1JGVH 3SDDD 5L7XL 3V6BR 3DXAB 4BSWB 1QTYT 1S5IH 4JRXB 2Y7QB 2GQHA 4FFZL 3IFNL 5CEZH 4JFOB 4LPTA 2JIXB 3W9EB 5JUEH 5SWZD 1KIQB 4K94L 1NMBL 2Z92B 1EO7A 3O0RH 4S1QL 3HG1A 1TNMA 3WN5B 1T3FA 5B3JE 3ARWA 4NZRH 3I50L 5L9DL 3O9WC 3IYLW 1YEHL 5IW1A 2VZOA 2FL5B 1WICA 2J8HA 25C8L 1FFPA 4JRWA 4KZEH 2JIXD 4KXZI 4OZFH 1EHXA 1UJ3C 3UTTE 1P4BH 4F37F 3TPUB 5E08L 3TBSB 3UBXA 1IVLA 4MXVF 2CKBA 4GRLA 3JWDH 2F53D 2RHEA 1I7ZA 4NO0D 4L8DB 1XGUB 3KWWB 3VD3A 5D93C 1CXEA 5FYJL 3P30H 4BELD 1G6RH 4YPJA 1RHHB 1TPXC 5F7HA 2VXVH 2VL4A 1XF4B 3BD5A 2VXSL 4WFED 2GK0A 4JY6A 4LBEB 1FORL 3O6FA 1RJYB 1QSEA 3IJSA 5E2TH 4YQXH 1KUMA 4QHLA 4L4TD 1QSFB 1GZQB 5EORL 3DSFH 5LGHH 4XBEH 4XVUD 5ICXB 5I1GL 1OL0A 3FQWB 1DVFA 3Q0HA 3MZGB 1NBYA 4WTZG 1ACZA 35C8L 4D9RE 3HZVA 1UZ8B 5GRVL 3V4VH 4ZUVA 1FZMA 5DJCA 4DEPC 4RAVB 3VXUD 2OR9L 4BFGA 5MEPB 2NZ9C 1J8HD 5DJ8B 4IIQA 4KPHL 4F33B 1AO7E 5DHVA 3BESR 1ZHLB 4JO3L 1A6VL 4JY5H 2C3HA 1CQYA 1G7JA 1OLZA 3WFDL 3CK0L 3DMMC 1AO7B 4NKMB 3A6BL 2FR4B 4MA1C 2CMRL 3O4LD 3GMPA 4XMLH 2OP4L 4KVNL 4L1DA 5GRJH 2OJEA 4HH9A 3KPRE 1BD2E 4WFGE 3BGAA 4GMTH 1FO0A 4WTZA 4YE4L 3L7EA 3O9WA 5L7XH 3WIFA 5EU6E 2R2HB 1UXWA 2OZ4L 3KLAA 5ISZD 3RL2B 1IEBB 3TV3H 4CUCA 5EU6B 3DVGA 5B4MD 3OKKB 5EOTA 5J6HB 2AABH 4U7KA 4CJ1A 3QG7H 4F37K 1OQOA 1CG9A 3ZKMC 3PF2A 3QIWA 5I9QB 3QCTL 2KH2B 4R90L 1Z5LA 3HMXA 2IALB 4P59H 4HC1L 4LGPB 3U7AA 1T22B 2EDRA 1E0OB 4XB7A 1H15B 3AGVA 4R9HA 1NBZA 4FQXA 1G7MB 3AS3A 3C6LD 4PJ8D 5GPRA 1FQ9C 3QCVL 2D03H 2E7LA 5GGRY 4NDMB 4Q74A 1TMCB 3GSNH 1AKJA 2EDTA 3ABZA 3MROB 3KHOA 4HKZA 1U93A