1OQOA

Complex between g0 version of an fc bound to a minimized version of protein a called mini-z
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin gamma-1 heavy chain constant region
publication title Impact of Fc Glycans on The Effector Functions Vary with the Antibody mechanism of Action
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA01
5CMAA 1AFVH 5GRJH 4Z7VA 3IU3A 2Z92B 1I8KB 2VZ3A 1IARB 5ICZA 2ERJC 1S7RA 2R4SH 1T7ZA 5EOTB 4XTRC 5CJOL 3BZFB 2ENYA 2K7QA 3WN5B 4DQOH 2YN3A 3H7BB 2GSGA 4OQTA 5I71C 4LIQH 4ZOCA 5BRZD 2C9AA 1TQCB 4BSJA 4O02H 4LL9A 3EJYC 4JPWH 4M62H 3KJ6L 5JZ7C 4Q9QL 3MLRL 2QQQA 1QQDA 2D9QB 2KZ1B 1EIBA 4WHYH 1FL3A 4LRIC 3VI3E 2ESVB 1C8PA 3RVVD 5JIIA 4BUGA 1F3DJ 2DQGL 4NKOB 4CAGA 1NL0H 4X7DC 5GHWH 2NXYD 1Z2KA 1I8LC 4OLVL 4NKIH 1OSZB 3QDMD 4OD2B 3D3VB 2GFBB 2IALA 4NNYA 1Z0MA 2AQ2A 2EDDA 4P2OD 3P4NB 1EEYA 5F96L 5D7LA 3LMJH 1F4WH 2H32B 2ZOKB 1HXYA 1ZA3B 5GRXG 3RY6A 2R56H 1GZQB 1HYRC 4MJ6A 1MFNA 2YN5A 5IQ7L 4GH7B 5JXAH 2B20A 5I0ZA 4F58H 4XB7A 4WTZA 4ZPVA 3MRQA 2ED7A 2WLYA 3UO1H 1A0QH 3GSQB 3FCTA 1YY8B 1MCOL 3BWAB 1NEZB 1WZ1H 2WP3T 3MRMB 1G0YR 2D3VA 3HG1D 5HYFA 3F12B 2P46B 2EDQA 2R29L 5FHBL 5DJYB 4IIQB 3HRZB 1IGTB 4HG4K 3RWHB 1AJ7L 4M6NH 3CMOH 1XGPA 5D6CB 4WW2A 3GO1L 3MRCB 4FZ8L 3MLPA 4WI8A 5FHAH 3TPKA 3G04A 5HI3D 3AXLA 3EYSL 5CCKH 1D5XA 3UEZA 1WBYA 3ULVF 3DX7A 5IWLC 5GZND 5FECA 4LSRL 1RJZB 5EBWA 3TN0C 1U58B 2LTQB 5E4IA 2VDOL 2YRPA 5GGUB 3LHPH 1AD9B 4X6CB 5KOVC 1ZHNB 4JM2F 2UVEA 1A4KA 2PUQT 5A40E 1PJ9A 2EE6A 4E41B 2XRAH 2MHAA 4LLUA 4NKDA 4JO4L 1NC4D 2FSEA 4PJXE 1NGPL 2LE9A 3SKJH 5KS9A 1TZIA 4LU5H 2X4OB 3LIZH 4HWEH 4LAQH 4NQEE 3F8UB 2VSCA 4M7LT 3TWCL 1P7QD 15C8H 4X6DF 1BQHB 5ADPL 2OTPA 4NP4H 5D71H 3C08H 1LE9B 4F2MA 1F4XH 1JL8A 2JJSA 3QDGD 3RWIA 5E8OA 4GAGL 1C12A 2I5YH 5E7BA 2KQNA 1SMAA 2K9UA 2Y6SD 1O5DT 5F8QC 5FGBC 1JWMA 2H45A 3L5XL 4NGHL 3EO9H 5TDOB 4BZYA 3UDWA 1N5YL 3TZVB 1F4YL 4ZFFA 5E8PA 3V79C 4LDLB 3ARBA 3U9UB 1SQ2N 4HGWA 1BFOB 1JZ3A 1IM9D 1QLRB 5DUPL 1N59B 1BPVA 3TBSB 2D7TH 1QYGL 3LY6A 5T3XH 1AHWC 1HYSD 2PR4H 4Q0XH 5I8CA 2FX7L 3WE6B 1T7WA 3ARDA 3ULUC 3O2VH 1YN6B 3MQIA 1YNTB 2BX5A 5DUMH 2BNRA 3QQ3A 1RULH 4PRNB 5CBEB 4G6KH 2JELH 4RCAA 3C5SB 4JDVB 4D0DA 3VGEA 5T3ZD 1NCCH 4TSAH 4R8WL 3QAZB 5JIHA 5GGQL 5SWZD 1PKQE 2JCCF 3KYAA 3NIFE 1KV3A 3DV6A 4PJXB 4YR6A 1XGQB 4K23H 4F7PB 1J1PL 5IF0A 4AEHH 4RQQB 1T21A 1DVFB 1H5BB 4OJFL 4XXDA 3X3GL 1H3UA 4XH2B 5GXBB 2DMCA 3QIWB 3VXPA 4MAYC 5D1XB 5IFJA 1WC7B 1FFNA 2H2PC 3KPSB 4NT6B 1HHGB 1X5HA 3JWOH 4PJ8C 3C5ZA 3UP1A 4DUVA 5KTEL 1CICB 3DRQB 1PSKH 3WHXA 2Q3AA 2X4RA 4NRYA 4LOUC 1G0DA 2UY6A 5I9QC 2BCKA 5TGBB 3QG6B 4WHYG 4P48A 3MLVH 2PTTA 4G8GE 3R8BB 1L0YA 5L2JA 5IBTH 4TNVK 1J5OL 3B5GA 4YUEL 5FYKD 5HY9A 1QG3A 5CD5D 4KMQA 5FCUL 1MRDH 3R8QA 3O81A 5IT2H 1T2JA 1A3LH 5T33H 1B0GA 3OJDA 1A5FL 4Z76A 3HCVA 1KCSL 4OAWA 3BXNA 2VISB 5BMFH 5E1AA 4XP1H 4K3JL 4M7ZC 4JN2B 5MEPB 4KUZL 3TFKC 4Q2ZA 4NO3A 3VD3A 2Z8WC 1NMCC 1IM3A 4P4RA 2APFA 1XT5A 4PJIF 3ME0A 3CXDL 1PKQB 1ZHKB 2VXQH 3BP6B 4KK9C 4GO6B 4RFEA 1JGLL 2YA0A 3DMMB 3I2CH 4J3TA 5IR1A 4X7FC 2X9XA 5KSVB 5LGHL 1DBAL 4LASL 1FVDB 2FATH 5E0QA 3T3PE 1ZOXA 3VMPA 5C07D 5F9JB 4XGZA 3RIAK 1HWGB 3ZE2F 5INDB 3QI9B 4M02A 2CIIB 2CRIA 1ED3B 1WSST 2J88L 4G8IA 1I8MA 4X8JB 4PJDE 2GSIA 2IPTH 5TDPA 4JPKH 5EORH 2VUYA 3QEQD 3BX7C 2IWGA 4G8GB 4OGAC 4QCIA 1B6DA 12E8L 1BD2A 3GMNA 3QZWA 3MX0A 2VXVH 4K3EL 1WZMA 4HAGA 5GRVK 3TM6A 5JLZB 1M7IA 2YD6A 4JY4B 4H88H 5EZLB 5IMLA 1DUZA 3GMPB 1FV1B 5EOQL 1SYVA 1MY5A 4M8QA 1IAIH 5GGSB 4BUHA 3MUHL 3MNZA 3MRIA 5AD0A 1X5FA 4K7PL 3HZYB 4ELKA 4MD0B 1A1MB 4JM2C 1H8OA 5EU3A 3TBYB 2IFFH 3BDXA 1RMFL 4OKDA 3QIBD 2N7BA 4GAFB 2AJXL 1NCWL 1VGKA 1RIVL 1KG0B 1KIUA 3UJTL 4P57A 1AY1L 2B5IB 1C08B 4DEPB 2NTFB 4KTDL 4YPGB 3WFCH 2NY4B 5DD1L 5IB4B 1MHEA 4OSUL 3ZDXF 4ZOAA 4WENB 1I3GL 3IFNH 3V4VH 4KQ4H 2FX8L 3BIBX 2I25N 2JB5H 2VZTA 1QNZH 1NBYA 3NH7L 4UIMB 5D70L 2E7HA 2R2HB 4G80B 4I3GA 1BBDL 3PGCB 3FZUC 3DIFA 2GT9A 1E28A 1Q0XL 4CN1A 2EYRB 5GPRA 4HW6A 2BY3A 4LCWD 2GEEA 3G6JB 3P4LA 4KV5E 4XXCC 2CUHA 4GAJL 4RSVA 4NDMA 1YUHB 3DROA 3TO2B 2X4QA 1NBVH 4OBSA 5JDSB 5ETUB 4LLDB 1YNKL 5E99L 5KSUB 3S5LA 1R24A 3D39A 2OL3B 4QRPD 5H94A 1KN4H 1NCDL 1JNJA 1UWGH 1V7NH 1S7VA 4KTEH 3QA3A 1NCBL 3MJ6A 5DJCB 1RVFH 1T89A 5C09D 1TVHA 2YZ1A 1A7QH 2ZZUT 4V2CB 5D6DA 1QA9A 4EXPX 3V6BR 4S1DD 2D7NA 4HUNB 1T1XB 3UTTA 1KJMA 4HWZA 5HHXH 1MCFA 2DQEL 5MENA 3P9LA 5J3HD 1XF2A 4HKZB 4I0PB 4NQDA 5MEQB 2YXMA 4X7TA 4XC3H 4M4RA 3TESA 2Z8VC 4P3WA 3O3BA 4NM8H 4P46A 4M1DH 4ODSL 1KPVB 4IRJB 5CIPH 5BV7H 2ICWJ 4Z7OE 2I24N 4Y4FB 1G7HA 4JLRA 4LSVH 1I7UA 5IB5A 1R3IL 5I15H 4LEXL 3PL6B 3GMQB 1ZGLM 2VLJB 5ACLA 3D87B 2AK1H 3X12A 4HBCH 1HI6A 5EUOB 4ZG1A 1R3HA 3U0TA 3VWKA 5B3JE 4HWBH 3TIDA 4JM4L 3WUWB 4FQ2H 5D72H 3KYMA 3GSRA 4MSWB 3FQWB 3VFGL 1NH6A 2H2SC 1OTSC 3GSNA 2WLZA 3BD4A 2P5WD 3KLDA 1RD6A 2NW2B 3BPOB 4DN3H 4WRLA 5HI4C 4KKNA 3HFMH 5EBGA 5C2BH 3QRFM 1EV2E 4WEMB 2Y25A 5LCVL 4JO3H 1MI5A 3S34H 5DJ6A 1C5CL 3QRGL 4OFYD 4OFDA 2BVQB 2FCBA 4RMVA 4LSQH 3GGWA 5F9AC 4D3CL 5C7XL 2X09A 3ARUA 4IS6A 4MHHG 5TQ2H 3MYJA 4NFDA 2DBLL 4YO0A 3EKCA 2NY5H 4ZS6D 5DRWA 3EYUH 4MGXA 3FN0L 1YMHB 5I1KH 1IC7H 3A6OA 4YXHH 2CSPA 4AT6A 2D7MA 1XF4B 5KVFL 2C1PB 3SQOH 4O2CB 3V6ZB 2V6HA 5F7EH 5IHUH 3RIFF 1NAMH 3TYGH 4RISL 1BM3H 5FIEA 4M7KH 2DKMA 3VWJA 1KCRL 1VKXA 5GQBA 2CLZA 1RHHA 4Y4HD 4P5TA 5D1ZC 5B8CA 3IKCA 1C5DB 4S1QL 1HK6A 3CVIH 2AXJA 1TZGH 1FYHB 3PV7A 1CFSA 5IHBA 1N2RB 1T7XA 1YYLL 2OCFD 4U6HA 2N56A 3ZE1F 4XBPA 4Q9CA 3MV7B 5EOTA 4N0FA 5JUEH 4JHAH 4IHOA 1EJOL 1E4KC 1XR8B 1G84A 4FFZL 1NFDE 4XVSH 5KS9E 3VFTA 5MHSD 2GI7A 5EZJB 4M5ZL 4NQED 3ARYA 3BD3A 4G3YL 2B7DT 3VFSA 4M5YH 4PRID 4XWGL 1LEKB 3F5WB 1BQUA 3AREB 5L0QB 1M7XA 3X13B 2QV2A 3RFZC 1OQOA 4X83A 2AXHA 4OCSH 1UB5A 2ZSVA 1CLCA 4ODWA 5DVNA 4AL8L 3U4BL 4Y0GA 1F6LL 3RVWC 4YHIB 2F5AH 3ULSA 5I1GL 1WGOA 1Q8MA 2RCSH 1KJ3H 3V4PL 1FNSH 4M43H 4DOHE 3GK8L 3RVUD 1CWVA 4OI7A 2OX5A 2NY0B 1AGFB 2VABB 2ZUYA 2VDPL 4QTHA 1GZQA 3RVVC 4PB0L 4XCCH 5D7IE 1DQQB 3DRTA 1AIFA 2YA1A 5I1DA 4JO1H 3KPPA 2DM2A 3MA9H 2NXYC 4U1LA 1R5VA 1PX4A 3OPZL 4OZIE 5D96B 1IEAB 1YY8A 3JUZA 2DIBA 5F9OL 4M61B 1UJ3A 2EDWA 5DEFB 3OF6A 5J6HA 1KTDA 1KYOK 2R0ZH 3QULB 5E08L 3Q0HA 1A1OB 4IIQA 1QSVA 1KEML 4K71C 4N1CA 5I30H 2G9HB 5D6CA 2VLRA 1N6VA 3UBXI 2B2XH 5DQ9A 2Q7YB 1PG7H 5DVMA 1UC6A 4OTXL 5C0CD 4MQ7A 4G9FA 4Z7UB 1NFDB 3A0OA 4KZEL 3IDNA 1RZIA 1TNNA 1XGRA 1ADQL 1FIGL 1X44A 2OR9H 4IBLT 5D1QD 5F7KC 1GVIA 1AD9A 3ZHLA 3W9EB 1NJ9B 4KHXL 1AQKH 4AEFA 5GJTL 3WNPA 3BPCB 2CLRB 2HFFA 5HI3C 1G9NC 1HHIB 3RWFA 3S37H 3U7WH 3CC5A 5DMYA 1IAOA 3TT3H 4EQ3A 1X5YA 2EH8L 3ES6B 2HG5A 4IRSB 2BOBB 1AQDB 2NY1C 3BQUA 3GI8H 2VAAA 1B4JL 2KKQA 3QDJD 3ROOB 2WV3A 3GJEB 5TPWH 3N9GL 3MNVA 5HYEA 3RZCA 5KOMC 2A6JA 3ARFD 5E95B 2NLJA 4FXGA 5BS0B 1MELA 4UV7L 5HYSB 4I0CC 3VFUA 4N0UA 4OZIB 1MIMH 3MJ8B 4V2BA 3WDIA 3KYKL 4PJ7F 4MXVE 3P9MB 2DN7A 1XCTA 2DJ4A 2R0KL 2HKHL 4YDJA 5JHDA 2F5BL 2FBJL 2HAZA 1ZT7B 3KLAB 4P2QD 1KPRB 3QPXL 3B2VH 5C0DB 1XR9B 3GSNH 4EUPA 4O58H 4PB9L 5BCAA 3QHFL 5HDLA 1D6VL 2Y6SC 1A6PA 5TFSL 3WIFA 5DS8B 3VXSA 3DGGA 4BA8A 5CEXA 3B3IB 3HUJE 1TVDA 4WIQA 1LHZA 3RUGF 3O4LB 3GRWA 3SDYH 4KDTC 3C6SB 1YNTA 1ETZB 3OKDB 2ITDB 3OXSB 1FCCA 4HIEB 3QXWA 1ITCA 3P3YA 4PRNA 3SKUD 1B2WL 2AXGA 2AABL 3P4OB 3O2DH 5D8JL 2UZIH 5C6WH 1T0NA 2P8PB 1HYSC 4RZCA 3QFDA 2QQNH 4PJHF 2HKFL 2IAMB 4MXQC 5SWSB 3MODH 3GHBL 4JZJA 1CBVL 2H8PA 1BD2E 4BKLA 4APQB 2CUIA 1F2QA 3IVKB 2O61B 3LOWA 4XPTL 1LVEA 1RHFA 4LCUA 4LLMB 3WEXB 1RV6X 1X4ZA 4DVBB 2HVJA 4NT6A 4WI7A 1TPXC 2BSTB 2XKUA 1I1CA 4B7IA 3O6FA 1DLFH 3VH8B 4JY5H 3OR7A 4ETQB 5JW5B 3DYOA 3IFPB 4RX4D 3PWJB 4TULL 4U1SA 3QG6A 3O6KL 2BNUA 3JVGC 4OF0A 1OL0A 2BOCA 3BRFA 5FO9B 4BQ9A 1P4LA 3LAFA 4WO4A 3P30L 4LCCA 2FB4H 1FAIL 2EH7H 4RMRA 3CX2A 3VXOB 4UT6H 4WFFD 3HUJB 1UM4H 4JQIH 2FEEL 3BZEA 2MKWA 2GK0A 2VISA 3C09C 4F33B 2A6DB 3ETBF 3IS0X 4POZD 4HH8A 4ORGA 2X70B 3EOTL 4IMKA 4NO2A 5TE6H 3VFNB 5LWYH 2BERA 35C8H 4Y4KD 1EAPB 4KROC 4LGPB 4MA1C 1TDQA 3SGKA 4M03A 4OIAA 4EN3A 4JFDA 1MFCL 2ZCKH 4LPWA 4NO0B 1U8LB 5FYJH 6FABH 3KS0H 1JFQL 4ZD3H 1RUAH 4X5WA 1IAKA 1OP5K 2GJZA 3U6RA 1I8IB 5C3TA 1U91A 4KPHL 3VXQB 1S7TA 4YAQA 2H32H 4KC3B 3QEUB 3QUZB 3HAEB 5H2BB 1B6UA 1AGCB 4IRZH 4NBZB 3CFJA 4O2FB 5EU6D 5AYQA 1UCBL 1DQML 1KSRA 5ACZB 4PJGB 4Y5VA 1OF2A 1BBJB 3D39E 2BHYA 2AEIT 4FMKA 3FFDB 4YIQB 4J3SA 1Q9KA 1WV7T 4O2EB 3L7FB 2XFXA 3RVXD 3LKNB 5DR5L 1P7KA 5IIEA 4HK0A 1IE5A 3HE7D 3K4ZA 1FG9C 5FOBA 4NZDA 3Q5OA 2ZCLH 4PGBB 3BGMB 2WNGA 3LV3B 4HK3J 3HNVH 5GJSH 3RIAF 4XNUH 2CMRH 2QQKL 2VXUH 1OAQL 2NY6B 3HB3D 1WZLA 3MLTB 2VR4A 5KAQF 1UQSB 3NCJL 5IGXH 4XBEH 2H26B 2J6EA 3D18A 3L7EB 1HDMB 2PO6D 2NMSA 2NXZB 2Q8BL 1HEZA 4KI5D 4WI5A 4BSWA 4PY7A 2OBGA 3BRDA 5B39A 4PLJD 3VRIA 4ZUWB 3SDDB 2NTFA 3DI3B 5ICYB 3QIUB 4MDJB 1JNHA 5ESVB 4CADA 4LSSL 3L3KA 1T6VN 4NSKB 2VDML 3QIBC 5DQDL 5HYJB 3PIQB 5CSGA 4KRPB 1QRNA 4R3SB 1ZXQA 3FB7B 4LQFL 3PWVB 3VMOA 4U49A 5ALCL 1WEJL 3PGCA 4MX7B 1RUPH 2J2ZA 1KOAA 3OBAA 4YC2C 5E2JA 4F8QA 2ZG2A 4NPYB 3QO0B 4U1HA 4FZEH 3FQTB 5CJXC 2CDFA 3M07A 5KJRL 5CP3H 2NPLX 3PNWA 2HVKA 1ORQA 1RIUL 3LCYA 4Z7NE 5D7LD 1ZGLA 3MJGX 4R4FH 4B7LA 1MI5E 2IFGA 4JFYB 1KTLB 4Y1AA 1J1OL 5JXEA 2OL3A 1CFVH 4R4BB 1DL7H 1G9MH 4X0KA 4HV8A 3SBWC 1ND0A 3KAAA 1YQVL 5I19L 2Z0BA 5SX4I 4PUBH 4XHJC 1VPOL 3X14A 5DT1H 4QRQA 1X5KA 2R23B 1T66D 3T4AB 5HGHA 1CL7I 2FYYA 3QUYB 1WUNT 3JV4A 3OXRB 3FAWA 1S5IL 5MEOA 4JFHE 5I74B 3DBXB 3KWWA 2JIXA 4ZFGL 2ARJA 4YK4C 2ADJB 2YA2A 3O6LH 5DJAA 4HF5H 4QYOB 4KAQH 2J8UF 2QR0B 3MFFA 4S1DC 5ANMB 3BP7A 3RKDC 4RAUB 5BVJA 2DQCL 3T04D 4TSCH 43C9B 5DC9B 1DJSA 1PQZB 2VLKE 4N8CL 4UAOB 1NGZB 1RJYA 3V6OA 3HE6B 4GW4A 5J3HC 1UADC 1ACYL 3SDXB 1NLDL 1YN7A 3GMQA 4HIIB 4X9FA 4EI5C 3LVEA 3G6AB 4I2XB 4TVSa 3DO7B 3HR5A 3L95A 1CXKA 3DOSA 5HHMB 2ZPKH 5T5FL 2YPLD 4D9RD 1R5WB 2R2BB 3TH3T 2A1WH 5JW4R 4Z6AT 1YEGL 1IBGL 1JGVL 2WWMC 1D5ZA 2EDFA 2ZNWA 5HHVH 2UY7A 2IEPA 5EZOH 5AWNL 2ZUXA 1I3VA 3QJHB 1GGIL 1BIHA 2I9TA 1IGIL 1P4BL 2YBRB 4UNVA 4KKAD 1BGXH 2DM3A 5D4QA 2CIKB 4JANB 3U4EA 1DQLL 4X4ZA 3ARBD 1NEZG 3KJ4C 4PGCB 1DLHA 5DRZA 5C6PB 3MBEB 5KSAB 1DBBL 3RWDA 5CEZH 1U8IA 3VW3H 5AG8A 2D31A 2DQTH 3CXHJ 5GRZA 5SX5H 3T0EB 1JWSB 3AB0C 1QFHA 2KDGA 4P9HC 4R7DA 3ARDD 4E5XB 4BH7B 3QCVH 3KPQB 2WUBH 1MVUB 2BNRD 2D2OA 5FV1L 3GUTB 4OCYH 4YNYB 2Z31B 3AMLA 1I85C 2VLRE 3BN3B 4LVNC 5GGTL 5JA9A 2PKDA 1A7RH 4H0GA 3DUSB 4CW1A 4XPHH 4MDIA 5BJTA 5C9JA 4PJDF 3G5XA 4OD3L 4XNMB 3OKKB 1NBQA 1ULVA 1CF8H 1KB5L 3Q1SH 1FNGB 3P2TA 4ZODA 4JFQA 4X4XA 1MLCA 4P5KA 3RA7L 1OAKL 1J12A 2EZ0D 4PGZA 1N2RA 3E6FB 5DK2B 4J7RA 3C5ZD 1U2CA 5CINL 3QUXB 2WWKO 4HPOH 5IJKC 4R96B 5T1LA 1CGXA 5DTFA 4OFIA 2VDRL 1IGCH 2DQFB 5JDJA 1BX2A 2GJ6A 3G5YA 3WL9B 5KSBA 2X5PA 1LEIB 1P4IH 4JE4B 3FFCB 3ZTJH 3S3JA 1DQJB 2AI0H 2PETA 4ZDHB 4XNYH 4I4WB 2ZG3A 2FD6L 3O45B 4UUJB 5GS0D 1HE7A 3PJSB 4HGKC 3ZKND 1WFUA 4W6YB 3BDYH 5BVPH 1HN1A 2QHRH 1MQKL 5ALBL 3NIGE 1DFBL 2Z93A 1G6RB 3OZ9H 1G7QA 3DVNB 4HJJH 1V3KA 5IVOA 3LDBB 4OLUL 3TPUB 3W2DL 3VFOB 1J8HB 4R26L 1T5XA 3L3OA 4K3DL 1KPUA 2VABA 1AD0B 1MHHB 2ARJQ 1IGJA 4U1KA 5E2TL 5DDHA 4NNXA 5JOPD 4YFLF 5IOPA 1MAKA 1T1ZB 1JF5A 3HMXL 2FR4A 1J10A 2G5BB 4ONGL 3TYFA 1AXTH 4HUMB 3MV8E 1W0YT 1ZVYA 3IDGA 3RVUC 4UINH 3QULA 5EB9A 2EDKA 3MA7A 1A1OA 4AMKL 1MLBB 3WJLA 5DK0A 4QHUA 1A3RL 4R0LA 2BVEA 3CH1A 1QHOA 5IP4A 3X3FL 3NCFB 5TDNB 5EC1A 1FYTE 2Q7YA 2X10A 5FO8A 4LLVA 4BFIB 2Z9TA 2B4CL 4GG6B 4MJIE 5J1AB 4NN7B 4JHBA 1FVEA 2LV4A 3P4MA 1UWXH 1UACH 3GMOA 5CFHA 5D2LF 3DVFA 5TQ0L 3S4SA 4PLNC 4U1GB 2F58L 2AJUH 3FJTA 2CLRA 2HFEA 3U0PB 3RDTB 1WIOA 2ATKB 4MA8L 3VU2A 3ULUL 2IPUK 3FO9A 4ZAKA 4P59L 3BGFC 4OLZH 2BOBA 2H9GA 3THMH 2EKSB 4QNPE 5D1QC 3HNSL 3MUJA 3INUL 1T83A 1OW0A 1B4RA 4WNQB 4WUKH 4UB0H 4KU1A 1FO0L 4X99A 4KI5F 5F89B 5IW3A 3SKMA 3LEXB 4CVXB 3STLB 1FHGA 5T1MA 4K9EH 1MOEA 4R7NA 4XCNB 3WSQH 5HYSA 5GIRB 1CL7L 4Z7VF 5E24E 5GGVY 1CD0A 5I1EL 4QXTA 1OP3K 3C2SA 3CZJA 4FABL 5AAMA 3DX8A 4YXLL 2LQRA 1N0XH 4CKVX 4OCNC 2FJGA 1LO4L 1BREA 1DN0A 4HQQH 3K8KA 3BWUC 4JFFA 4ODHL 5HYIA 3BPLB 2X42A 1OD9A 4O5LH 4IJ3C 1NFKA 4GJTB 5C0DA 4YDKL 1MAMH 5EU5B 5IQ9A 4K7FA 4QTIL 4LBEA 2VDLL 2IANB 3O3AA 4CU7A 4MJIB 3ZSSA 4F7TA 4G5ZH 4JFDE 4Y19B 1SBBA 1OAZH 4HJGB 1HIMH 2A9MH 2DQIH 5C0AB 1MFAL 1YEDB 5L9DL 3O4LA 5JMRA 3OMZA 1F3RB 1ETZA 4PRHA 1HILB 4C56A 3UZVB 1U92B 2AXFA 5HVHB 4JGJA 2XZQL 5IKCB 1YDPB 2WQRA 1NGQH 3QPQD 4R6UA 4YHMH 3D39D 2AJVH 4WUUE 3RRQA 2IAMA 2VO5A 5GGTA 5E6IC 1CE6B 1RZJC 2XWJB 3IVKA 1FORL 1I9IL 5I1JH 5AYUH 5EFIB 5BW7A 1U9KA 5DMGD 1KB5A 1YEIH 3UTTD 3CH8A 3WLWD 2IADA 3VH8A 4WW2F 5EO9B 3MRLA 1T3FB 5MEND 4JN1L 3OKOB 2FO4A 4MD4A 5EU7C 3JV5A 1A7OH 4JO2H 1PYWB 3MFGB 4NQDD 1QRKA 4JHWH 4Z7WA 1CI5A 4J1UB 4M1CD 3GJFA 4P46D 4U1MA 1HXMB 4PJCF 4D0CB 2DD8H 5JPNA 5CILL 5DMKA 2DB8A 2WINA 1R3JA 3PWLB 4FNLL 5GGVH 3CAFA 1MNUH 4YHZL 5ERWB 3IU4L 1EGJA 1RSFA 1T0MB 1UKQA 4JKKA 1FFRA 3CK0H 5H37H 1KULA 4YHNB 3RNKB 5E2VL 3MLWL 4BM7A 3ZTNH 1NCAL 2ATPB 2J12B 2V5MA 4O51A 2XWBA 4OZHA 1QRNE 1IGFH 3VWKD 3I3EA 3LB6D 2OS7A 5C08D 3HZMB 2DI7A 3QBTB 4NUJB 2X1WL 4LEOB 4WUUB 3IRPX 4LP5A 2V7HB 5LXGH 4L9LA 1IQWL 2PNDA 5B3NA 3TJEH 4G6FB 1Z6JT 1MCBA 3BT2H 1G7IA 4NFBA 5IHZB 3MLXL 4IMLB 4POZC 3JWNC 2X05A 3HMXA 1H0DB 3C9NA 3H9YA 5C1MB 4Y4KC 5HI5C 3SOBH 5H2BA 4XMLH 1MI5D 2Y5EA 3GNML 5JNYB 5C6TH 4PV9B 5IV2A 4L29B 5C0RH 3IDJB 2OTWA 2CKBL 1LK2A 4J8RA 4HEME 3O3EB 3HNTL 1JWUA 3C5JB 5D7JC 1K4DA 1H3TA 2YC1B 1I1YB 3HC4H 1K9TA 1EJ6A 3ZL4H 1K8DA 5DVOA 2DWDB 1CZ8L 5BQ7A 4BZ2L 4S10A 3X11A 4L1HA 4EZMA 1G7MB 2JJUA 2V2WA 1AE6H 2Z4QB 1KLGA 3GM0A 4PJAA 3HE7C 4K8RH 3DARA 5I6XB 1ZKAA 5LBSH 1AHWA 5IMKA 4L4TE 3FO0L 4KVNL 3VWJD 1WITA 3WD5L 5DRXA 5FUCE 1YECH 4KJYA 2B1HH 3WFEH 3B9KB 1QR1B 3H9ZA 3FRUB 2VYRE 3BYYA 3HB3C 2B39A 3ARQA 3O6MH 3CLEL 5DJZA 4RBPH 3T0WA 2A77H 5IEKB 5ICYA 1YNLH 4AZ8A 3PDOB 4LKCB 4MDJA 1FO0A 2C3GA 3L5WA 5ESVA 2O5XL 3EOAA 3WUWG 4KI5C 2DAVA 4OZGF 4Q9BA 5HYJA 3PIQA 1Q9WA 4PRPB 4PLJC 1A4JA 3V0VB 1LNUB 5I1HH 1CVRA 3RX5A 4KXZI 3I6GB 4XP6L 1HQRB 3CFBA 2ESVD 3BKMH 2HP4A 4OT1L 1BEYL 3CSGA 3B6SB 3PE9A 4MX7A 4C4KT 4PJ9B 3UAJD 2IQ9H 1VACB 2VH5H 2W9DL 3S35L 3FRPG 4ACPA 1UZ6E 3SGDH 1EERB 1TVBB 3D3VD 2VOTA 5HDBE 3SHSA 1K2DB 4AG4L 2C3VA 2DDQL 4HEPG 4HKJA 3SDAC 4KY1H 1FJ1B 4MVBD 4QHMB 4YX2L 5JMOC 1D9KC 5IG7A 3I02A 2KZWA 1F3JB 4ZXBA 1C7SA 5T1DL 4JFYA 2JK5B 5I1IL 4QRSA 1U8JA 2FJHA 2IBGA 1L7TL 1Z9LA 4X5XA 4CVWA 2DLFL 2QADD 3NCCB 1FG2B 3O0RH 3RAJH 1S7QB 4L4TB 1R0AH 4KHTH 3OF6D 5C0BB 1QVOA 4B41A 4LVHC 4RNRB 3RY6C 2Q8AH 2R23A 1DE4B 3T2NL 3EDJA 4WFHD 5IVZB 5CUSH 3QUYA 4X6BB 5K9KA 2AGJL 4G9FD 5DD3H 2N7AA 2M26A 2Y7QB 4FQPA 1UXSB 2XTJE 3SJVA 2H1PL 3CDCA 4R97C 5F7UA 3NZHH 5DD5L 2D9CA 4GFTB 1S7UA 3FB8A 2WIIB 2VDQL 4WW2C 4QRUB 4QXWA 4NUGH 2ZCHL 1TCMA 1LQSR 4JY6A 2G75A 3BP5B 3K1KC 4XAWH 2E9JA 3MLRH 1CD1A 4YHLH 4Z95L 5C0ND 1OAUH 5EC2B 5J1TC 5I75C 2P5EE 1GIGL 4Y2OA 1KEGH 1LP9E 2EDBA 3BQUD 4R9HA 1YPZA 3E2HB 3L3JA 1HINL 2GJ6E 4ZUSB 5SWQA 3CUPB 1T2QL 3H9SB 4GAYB 4JRXB 3VI4E 3RZCD 4JREB 3TA3B 2ZUQB 1KLUB 1JI1A 2H6PB 3MZTA 5F96H 3JTTB 4JFPB 2AQ3A 1TLKA 1BZ7B 2E8ZA 4HK3N 5GISL 2H41A 4FMFA 5F8RC 1KELL 4Z0BL 1LD9A 2O26U 4HZLB 3T77B 2BSSB 3O11B 3FB5B 5DI8B 1H15A 2YBRA 3DXAB 3DTXB 5JHDD 3VFWB 2IH1B 2P49B 1WICA 1A8JH 3U82B 1UJTA 3EJZD 4L8BA 5FHBH 2P24B 4Z7QE 2JJSC 1LE5B 5KSAA 3KS0J 5F1NA 4PTTB 3ALPA 4CMHC 4KKCD 4NQUA 2XTJB 3GO1H 3CSBA 3VXSD 2NX5B 4LF3A 4KKAC 3O41A 3UJJL 3HZVA 4X6DA 3ILPA 2W59A 3ARBC 1JI2A 3ZYIA 4I0KA 3HAEH 4F9PC 2CKBA 1IGML 4F7MB 3CGTA 3CMGA 3QXTA 1CK0H 2P5EB 3WNNA 3GBLA 3PGFH 4NN5B 5L88L 3LEYH 1IKFL 2DBJA 1LP9B 4PJFA 1F90L 4QHKJ 2BZDA 3RP1A 1HOCB 2HJKA 4BK5A 3ARDC 3RNQA 1KCLA 5B38B 1QPXA 1QSZA 4WHTB 4NQCE 4JO4H 1YYML 4NYLB 1MRCL 3V5DB 3A6CH 4NN6C 2CO6B 1N26A 4GOSA 4RFNB 4RGNE 5E00B 1AI1L 4N5UA 2FDBP 2AKRA 4R96A 1BZ9B 5FUOL 2JJWA 4LLAA 4XMPH 2DQFA 1B0RB 2MNUA 5FO7B 2IMMA 3KPNB 4GMSL 4HFUL 4GAGH 3KPLA 2X4NB 1EO8L 3D69A 3HHRB 2EZ0C 1INDH 1UB6A 2ICWI 5D9SB 4LARH 2R2EA 3L5XH 3FFCA 1AKJA 2V17H 4WY7H 4AQOA 2R1YA 4N8VB 2JCCA 4WO4D 5BV7C 3FT3B 4UUJA 3SE4A 5HD8D 1I3RA 5DUPH 3LZFH 4OD1L 4Z0XA 2UYLB 1NSNH 3O4OB 1JPGB 2NY7H 5GRWA 4JFFE 2D03L 2M2DA 3WFHB 3GB7B 1DZBA 1DTUA 1OT1A 4UU9B 1RZFL 2VKWA 3VGFA 5GS0C 2FX7H 5DD0H 4A6YB 2R4RH 1UYWL 1CIDA 1ZVSA 1YY9D 4ZQKB 1PEWA 1N3NB 5DWUH 1U8QB 4EN3D 4JFDD 5CEZD 3ELAT 5LGKA 4D9QE 3SEPA 4H26A 2F9BT 5KVMC 3DMMD 4U3CA 4IOFC 3SCMA 1U93A 5I18L 4NQSA 1RZ7L 5EU4A 4HC1L 1ZHBB 4PRHE 2DQJL 4LLWB 4C56E 4RGNB 1B9ZA 3P0GB 3DX6A 2FX9H 3QUML 3TEUA 1JV5A 2HN7B 1FNLA 4PBXA 2Z91A 4ZUTA 4I48B 2VRAA 4F37K 1AP2B 2EXWC 4GG6A 4JJ5B 5FGRA 5HHPB 4RWHA 1S3KH 1AGDB 3ZKQD 7FABL 1XF1A 2YMXH 2WUCL 3T08A 3PWNA 3RJDA 3WDHA 3HLAA 5IMOB 2UUDH 4PJIA 1CG9B 4XAKD 5BOPA 4L3EB 4NOBA 1TJIL 2VZVA 1HCFX 2JB6A 2YWZA 3VMNA 4HAFA 2VN7A 3SO3B 5I1AB 2ATKA 5K9JH 1J5OH 3V5KA 2AJSL 4XNXL 1UH4A 3L3GB 1N6QH 3MNWB 2NW3A 1I4FB 1QFWI 1NAKH 4W4OC 3LN4A 3KDMB 1G6VK 2OZ4H 4YHOH 2EIEA 1A5FH 3EFFA 1QFWM 2DI9A 3D5OF 1JK8B 5DC0A 3PGDA 1BQSA 4F80A 1OGAB 1FNEA 1ZT1A 3HZKA 3NIDF 5HHOB 4TVPL 3TCLA 4EDXB 1NUNB 1P2CB 2ERJB 5E8NB 4QHNA 3LEVH 3R0MA 5I71B 5C8JA 4NKMB 3BAEL 3U9PL 3D6GA 5ESAB 4ODXA 1HWHB 3VA6A 3LS4L 4NZTH 2PXYA 1QRND 5HDQL 1S9WB 5D1ZA 1I3UA 2A0LC 4OZHE 4ODTL 2VITA 2AEPL 5LJYH 3BO8B 1DBAH 4X80H 4TPRH 3UYRH 1AXSB 3P11H 1YZZA 3FT4B 4G43A 3L1OH 4K94L 4F3FA 3EUUA 2XPGB 4NHUB 1WQVT 1QSEE 3EOBA 3HAEG 3UMTA 4BH8A 2Q76B 4LNRB 5F3BB 1G7PB 4XP9L 3EZ8A 2DICA 1AR1C 4UOJA 4JFOA 5F44A 3T65B 4JVPA 2EC9T 4PJ5E 4XVTL 4FQHA 3MJ7A 4FQIH 1V7MH 2X4SB 3SKOA 4K3EH 1MEXL 4S1SH 4Y1AD 1T0PB 5JXED 3ARZA 3CNKA 4OCMC 2DIAA 5FYKL 1YEHH 3EYQD 5C0FA 1A1NA 3MLSH 4QOKA 4KTYA 5EWIL 4DGYL 5FAAA 2VERN 2BXZA 4M7JL 3F7YB 3ZT6A 4FFYL 4P3CL 4B50A 4X7CC 1PLGL 5I76A 2R0WL 4G8FB 1A3QA 3B9DA 1PZUB 2A38A 4WJ5B 1ZSDB 1R5IB 4WV1C 2I26N 4BQ6A 1JGUL 5CD3B 4N0YH 1RU9L 4TUJB 5EULV 1ZLVK 2AJXH 4XC1L 1RIVH 1YMMA 4TUOA 2JIXD 1T89C 3ZYJA 1PYWA 2OMBA 3CPLA 4L9DA 3TN0B 4YHPA 4KTDH 1KGCE 3BP4B 2VUOA 2BDNH 1JF1A 5FOJA 2HJFB 2DQHL 3GBNH 3ULUE 1L7IH 2FGWL 5DMGC 3OTTA 1Q1JL 1RK1A 5TF1L 5MI0C 3PWLA 4X6CF 3GI9L 1J0JA 4I9WD 4Z8FL 1LILA 3S7GA 3FQUB 1QFUL 1JRHH 1QSEB 3MJ9H 3GSWB 3DI2B 5I8OL 1NDMB 1KJ2B 4NRZA 3OKMA 4HMCA 5EOCH 1E4WL 2W60A 3QCTL 4Y5YC 4PJ5B 2ADGB 4M1CC 2GTWB 3UTSB 3WJJC 4P46C 3VE0B 2FIRT 4MA3B 3C60A 3H9HB 4PFEA 3VFMB 1E27B 2F19L 4R90L 4PREA 3UPRB 5EUKB 4KJQD 4P5MA 1CD9B 1CR9H 1INQB 1T5WA 2VLLB 3RQ3A 1WFOA 3EO1A 3IDMA 5F9WB 1YNKH 1G6RH 2WQ8A 1NC2B 2CK2A 1KNOA 3PXJA 5F3HA 4WFED 5KVDL 1WCBB 4ZPTA 3VWKC 3B9AA 4WTWA 5ESQA 3LB6C 1T20B 4JPVL 2Y36H 5FKAA 2VDKL 3QWRA 4TOYL 3TV3L 5MP6H 4PV9A 3NCBB 1U8PA 4NQVA 4NNPL 2XKNB 3QNYB 4HC1A 3IDJA 4WHDA 4U6TA 3D0LB 4DGVH 2ADIB 2DQEH 4JKLA 3MV11 1QBML 1HSBA 4D9LL 3PWPA 2YC1A 1JNNL 2HT3D 4XPBL 2DWDA 3ARPA 1MWAL 1Q9OA 4GS7B 4OGXH 2C7UA 5EH1A 2WANA 1ZWIB 3X17A 4H25A 5IHLB 4E42B 4FQCH 3EDFA 3JV6A 4OCLC 4GBXA 1MRFH 4U6XB 3DYPA 3C8KA 1BWMA 1S9YA 2HFTA 3HPLA 3MXVH 4HXAL 5F6IC 2AP2A 4RGOH 5CZKA 5GRUL 1KF9B 4MAYB 5FV2A 3HRPA 5KN5B 1SJHB 3GJFK 5ADOH 4PJ8B 3WXVH 3NPZB 3V6FB 3MV7D 5CGTA 5T1LD 2EYSB 1SYSB 2XWTB 2X9YA 4WI2A 1JZ7A 1LO0H 3VWJC 1YPZE 5C0JB 2GJ6D 5B8CC 5DD6B 3NAAH 4AENA 4PRPA 3WIIL 3NTCL 3PV6B 1QFOA 1LNUA 1QUNA 4DTGH 3MCKA 3ARED 4GRWF 1A9EA 4KGLA 4FG6C 5FCSH 1VACA 3I50L 3R06A 1TQCC 1DSFL 4H1LA 5JOFA 1C5CH 1EZVX 3QRGH 2RB8A 2XQBL 1QFWL 2QHLA 4CJ0A 1U3YA 4AQ1B 5E9DA 5KVGH 1OLZA 1JP5A 5IB3B 4P9ML 5EZIH 3IRZA 3GSUA 2JK5A 2VXSL 3PABA 1NMCB 5E4EB 2HFGH 4KQ3L 3UAJC 1NCNA 3MV01 2J5LC 4LLYA 3ZKMD 1T22B 4KMTH 2R0LL 3FN0H 2XN9B 3NGBC 1S7QA 3BIKA 2R1XA 4ZTOL 3CVHB 1LGVA 3IXTB 4MVBC 1FBIL 5TE4H 4X6DE 1A6WH 1CDYA 1LDPL 4WCYL 5GGRY 3VCLB 3F58L 5HSFA 4RISH 3OAYK 3VXME 1KCRH 1X7QA 1KB9K 5DHVB 1OAXH 4DK3A 4UDTA 2XZZA 5EIIB 1OGTA 5F88A 4KKLD 3KPRB 5T1KA 1UJ3C 4HUWA 4P4KA 3IDYC 4PJFE 4YXKH 4KK8D 4K8RD 5E2WH 4CU6A 1YEKH 2DM4A 4IIQC 2Y07H 3MRJA 1J1XL 3MRBB 3SY0A 2IH3A 4D0BB 1QSFE 4RDQG 2PF6A 3GMMB 4U33A 5HHQA 3EFDL 3QXAB 1INEL 3ARGB 1ZLWK 2GUOA 4EVNB 3TO4B 3RL1A 1K6QH 1JGEB 1M7DB 4P9HL 5D5MB 2W1NA 4ZAKD 2XY1A 4JFXB 4X7SH 3I6LE 4IRSD 4XP4H 5IW6A 2J4WH 1MH5B 1DBJH 3MC0A 4PV8A 2HLAA 5HGAA 3OB0H 4RWYH 1RJLB 4MA7L 5EPMA 4Y2DA 4ZUSA 1IGYA 3EBAA 1DQDH 3H9SA 2DTSA 5JORB 1WAAA 3MLUL 1N4XL 3LD8B 4EKXA 4DW2H 2WM0A 3ZT7A 3T3ME 3JSSA 2NY2B 5C0NC 5BS0D 2JCCE 1U6AL 5I1CL 1HZHH 3BQUC 1NLBH 4NKQB 3MBXL 1FZMB 3ZKSD 1NDGB 5I16B 2OJEA 1MREH 3L9RB 3DXAA 4HKBB 2DWEB 2IH1A 3OPZH 3TVMB 4CBPA 3IKKA 3VXMB 1ZANL 4S2SB 3VFVB 4L8SB 5ISZB 5DRNA 5D93B 2I07A 3P0YL 5HGDB 1P53A 5GRVL 2KUTA 2DTML 1I9JH 4X4MA 4YFLI 3TT1L 5A2IH 1MHCB 2Y5TA 3RWEA 3R1GL 1BVLB 5EG6C 2F53B 1GC1L 1MFBH 4GG8B 4MNQB 4JFEA 2ICWA 3VXUB 2QSCL 4PRDA 4RMQA 5DGRA 3D85A 3MUZ1 1AO7E 2W0FB 3O4LD 5F1SA 3G6JF 5JZ7D 4PRHD 2VIRB 1QSFB 3EJZC 4C56D 3LQAC 1DQTA 1ORSB 4CNIB 4JHZA 4PRAA 3T8XA 2YOCA 1ADQH 3NPSB 3G5VB 4UOW1 3TLRA 2RBLA 3KNBB 2WP3O 5A2FA 4D2NA 3BJLA 2IAMD 3ARVA 4LSDA 3VGBA 1PW3A 2DQUH 1K8IA 4U6VL 4DZBA 5AZEL 1SEQH 4PRBB 3Q6FA 5ICXA 5CJXA 4E0RB 2P8MB 1A6VL 4AIZB 4NYLA 5L2KB 3LN5B 4PJIE 1GSMA 4ONFH 1UVQB 2QKIB 3QAZC 2I60L 2ITCB 1JIBA 3NA4A 3KYNA 3OG6B 3V4UL 4XMKL 4PJBB 2XA3A 2AJYL 3OKLB 4JZJC 2XIDA 4LCWA 3O3DB 3BH9B 2FLBT 5EO1A 3T0BA 4UV7H 4L3AA 4O9HL 4HS6B 5I2IB 1A6ZA 1CT8A 4Z77B 1FZKB 1IC4L 4NHCH 1NMAL 3KR3L 3ZE2E 2CDGA 1DANT 1CN4A 1EO5A 3QIWC 5CEYB 1UH2A 5D1XC 4CDHA 3BUYA 1CICC 1D6EB 3KXFA 3FT3A 5HPMB 3ABZA 1D5BA 3IAGC 4GKNB 4Q9RL 1S7XA 4ZSOA 1N5AB 4RFOL 3EYVA 1JHKH 3OB8A 3RWJB 2UYLA 1CU4L 1AO7B 43CAB 1JPGA 3MGOA 3FTGB 4QHLB 4M7LL 4PTUA 5GSRA 1HHJA 3QXDA 4WO4C 5EUOF 4NRXA 4J3WA 4PD4K 4XP5H 4FQXB 4YWGL 1MF2H 3MPCA 2Y06L 4MXWL 1N3NA 3QFJE 5CZXC 1VCAA 1I1RA 1B2WH 2AABH 4KJWD 4L4VE 4NO0D 1YC8A 3EGSB 4X6EA 2BMKA 3VXTA 5GRJL 2PTUA 3RTQA 2YPKB 4EI5A 4IMKC 2R4SL 3EDEA 3B5TA 4DQOL 2HKFH 2QQLH 2W65B 1CBVH 1M71B 4LIQL 2Q3ZA 2CDEB 3SGKC 5DFVD 4O02L 1EH9A 4JPWL 4LKXB 4ZO7A 4EN3C 2UZYB 4QRTB 4XPTH 4V1DA 1F13A 3ZDXE 3DMMC 4B0MM 2EC8A 1X5IA 5BRZE 3RWGB 1VGEL 2DRUA 3HI6H 2BC4B 2HRPH 2CLVB 2OK0H 2L4OA 3MRHA 2R1WB 1P5VA 3QI9C 4G6ML 1NL0L 1CDGA 3AS1A 5GHWL 3TGXA 4NKIL 3QP3A 4Y5VC 2A9NL 3HKFA 3D0VB 2GJJA 1YA5A 4F37F 4OF3A 5FK9A 1F4WL 4NJAH 2V2XA 4HJ0D 3VRJB 5JA8B 3QDME 2NXZD 1CXEA 2G60H 2KL6A 5JXAL 1IAII 1SBSL 2OQJB 1ZGLP 3RX7A 3IDUA 1WBZA 3UO1L 1A0QL 4QRRA 4MZ2A 4OQ1A 4IDJH 5A1AA 3G08A 1IAIM 4JRYB 3QG7L 5HHOA 3UJIH 4EDXA 5E8NA 1OPGH 4L4VB 4Y8DC 3MROA 1KCVH 4M6NL 3CMOL 4HCRH 4MCYB 3AS0A 3VG0H 2EEAA 5CBAB 5HYJD 1MFCH 3ALWA 5CZVH 3M17A 5FHAL 4KRPD 3CFCL 1HQ4A 4G42A 5CCKL 5KSBF 4DEPC 2X1PA 2UWEA 3M8OH 4OKVB 2AJ3B 5BRZB 4MB3A 4LOUD 3WHE1 2Q76A 1I7RB 4OGYH 1DQMH 3BEVA 3WCYA 3LSOB 1JTPA 3L3HA 1KIQB 1IL1B 3IDXH 2XRAL 2IPKA 4LLQB 4ZXBD 3UZEA 4OV5B 3LKQB 3DETD 2RIKA 5LAXA 3SKJL 1GPOL 4HPYH 3GMRA 4HWEL 4LAQL 1TTUA 2NXYB 3RGVA 2QQKH 3D25A 1RFDH 3QDMB 15C8L 1WBXA 1MFDH 1DEEB 3N1MC 4P2OB 5HJ3A 5D71L 3C08L 4F7EA 3NCJH 1ZAGA 1F4XL 3UYPA 1S9VA 3PWPE 1WFNA 2I5YL 1W0VB 1SY6A 2CPCA 5DMIL 3DSFL 1WT5A 4Y7MA 1ZSDA 5JXEC 1Q72H 3OGCB 3QUYD 3D48R 3LQZB 4XVUD 1KT2A 3EYQC 1D5IL 3IFLH 4JZOA 5IM7B 4CDGC 1QD0A 1MCWW 5JHLH 4KK9D 1M6OB 4AEEA 2F8XC 1J0ZA 3HG1B 4YDVB 1OVZA 4OM0L 3SJVD 3BP4A 4Z7UF 1CXHA 5FA4B 4ALAH 2HJFA 3RWCB 3QHZH 2D7TL 3FOMA 5T3XL 5A43C 1CFNB 4Q0XL 3L3IA 1CGSH 1P9MA 2YPVH 2FHCA 3CSYB 2NY3D 1KJ2A 1RULL 2DLTA 4G6KL 1EK3A 5B4MC 1NCCL 1ZLUH 5HHMD 4OUUB 4ZMAT 3CDGB 4XI5D 3H9HA 5ACMA 5IMMB 4K23L 2EICA 3IAQA 5KJRH 3PP3K 3VXRA 1FN4B 3V6OC 1RIUH 4AEHL 5T3ZE 5M95B 4F57H 5I73C 4MWFA 1INQA 3PL6C 3LKSB 4HFWA 1N7MH 1NC4B 2DLHA 1CE1L 5DHYA 2V2TA 2GIYA 1NAMB 4E9LA 1NC2A 1RURH 3B4NA 1WCBA 1PSKL 1P7QB 4YDIL 4GUPB 1RZKH 3MOBL 3RY5A 5CGYD 1UXWA 4P2RA 3ZE1E 4KJQC 3QNZA 4A6YH 3I6KB 4CVUA 2GY5A 3MLVL 3OQ3B 1JZ6A 5KSAD 3QDGB 5IBTL 2VE6A 4ZS7H 1EBAA 5D2NB 3QWQB 4HKXA 1BHGA 3M1BA 1XF3B 1RZ8A 4GMTL 3BPOC 4WU5A 1ZTXH 1MRDL 5IT2L 1T04A 4JKPH 3NFPB 5L8KB 1HHHB 5T33L 5DHXB 1IM9B 5FYKE 2R8SH 5CHNB 1C7TA 4RA3A 2Z31D 3L3DB 3MXWH 4JG1L 5BMFL 4PG9A 1OOAA 4XP1L 4ETYA 1QTYT 5L6YH 1VEOA 2DQCH 4ZTPH 2R15A 4U6XA 1KC5L 1YEJH 2A73B 2HT3C 2MTPA 2PN5A 2B1AH 3FT2A 1CFQA 1GHFH 1RPQA 5DZOA 3GKWL 2VXQL 3VFPB 1FLTX 4U0RC 1CFTB 4M6OL 2AK4A 1JBJA 1KXTB 2YEZB 4MJ2A 1WWWX 3I2CL 2CGRH 2X4TB 3EDDA 1BVKA 2HRLA 5T5FH 3QUXD 5SWZB 3V6FA 5EBLA 3MRGB 1SYSA 3VGGA 1GAFH 5DEGA 2AEQH 4HH9B 4LSPH 3FMGH 5EIQA 4GXVL 5C0JA 2EE3A 2YS4A 4BFEA 1IQDB 5E6IA 2IPTL 3RPIB 5EORL 3IJSB 1XCQA 5C07E 3FFCD 1GGIH 1AKJD 1W0WA 2YZ8A 4MJ5A 4Z7WF 2XQYK 1KBGL 2APVA 1JGDB 3EIFA 4JFZH 1FE8H 1XF5A 2IBBA 3CFKB 3MRNA 4OLXL 2VXVL 1XZ0B 3EYFB 3SDCB 1BWWA 3W39A 2LAAA 4N68A 1DBBH 5FKPB 3ARWA 5DJ0B 2Z8RA 3F6IA 3MV9A 3AREC 1B88A 1IAIL 5TH2A 4NO5A 4S0SD 1Y0LB 4U2YA 1F8TH 1FVCA 3NOIA 4OB5H 5BZWA 2YD2A 2ZG1A 2IFFL 2A83B 5DJXA 3C2AH 1DR9A 4YQXH 5ITBH 1FL6A 2W0KA 3QDAA 4H0HB 3W9DA 3SCMD 5DYOA 2VXTH 4RAVB 4J23A 5C0EB 3WNLA 4LSUL 4X7EC 3WFCL 3VCLA 4TUKH 1TQBB 2XYCA 3OX8B 4Y8AA 4YGAB 4XZUB 2ORBH 3IFNL 3ZKMC 1LO5A 3REWB 3V4VL 3WS3A 4KQ4L 4G9DA 5B38G 4PJ7E 2OJZH 5D96C 3UBXG 2H2SD 3RA7H 1OAKH 2JB5L 1IEBA 1QNZL 5K9OB 3TIEA 4ZFZB 4PJGF 2X2YA 2Z8SA 1ZEAL 5JIPA 3OAZH 3K4AA 1LMKA 2CK0H 3CU1A 4R0LC 5C07B 1T1YA 1FFOA 2AJZB 1HHKB 1T80A 4L8DA 2FGZA 2FIKB 1O0VA 4POUB 4LQ1A 5D5MA 3QSKB 2UZXB 3QEQB 5E5MA 4K8RC 3HPJB 1I7ZB 1ROWA 1VENA 5FB8A 1NBVL 3B43A 3RUGE 3LH2L 5AG9A 4LCWE 1MH5A 1EFXA 4N8VG 1NCTA 1QO3B 3BKJL 4HIJA 5CWSB 3CLFH 4KK6D 4PJAF 5KG9B 4HUVA 4QEGA 5D7JA 4XWOD 5EO0A 5T5NG 1MQKH 2V5YA 3BFOA 5ALBH 1KN4L 1UWGL 1V7NL 4KTEL 2RFXA 4LCYB 4PJHE 5EOCJ 5FGCE 1A7QL 4IRSC 4XNZC 1KJ2H 5E2TH 4ZSOE 3Q6GH 1T83C 2CJUH 1OW0C 3IJHA 2AW2A 1NDGA 2E7MA 1JYVA 4KH2A 8FABB 2DWEA 3QIBB 4H20L 3TVMA 2ICEB 2PXYD 2YD4A 3AS2A 3RHWF 5D1ZD 5E6ZA 4G6JH 3VFVA 4L8SA 4PJ7B 2K3TA 2Y1VA 2APBA 4JKWA 1KFAL 4XC3L 1A3RH 3LKOA 4NM8L 1BOGB 2F53A 4M1DL 1PZ5A 4MNQA 4PJEA 1ZA6B 4RGMB 3U36B 5BXFA 2J8HA 1U36A 3FQRA 3QO1A 5GS2D 5BV7L 1JZ8A 2X1OA 2YD9A 4I18A 1GGYA 4LSVL 2VIRA 3FO2B 3QWOA 4IOIB 3N85H 5I15L 1JMZA 1EAJA 4MD5B 3KNBA 1I1AA 4Z9KB 4V1DE 5K59F 2EDJA 3RUGB 4HWBL 3DV4B 3P0VH 4HIHA 5KANG 1OARH 3RVWD 4QOKD 5DJ2B 3GIZL 5GS0L 4MA8H 5AUMA 1EHLL 3BE1H 4E0RA 4HWUA 3CFEA 1GGTA 3GSOA 2BNQA 3DHMA 3SDAA 4NOFA 2RAMA 2LABA 1D9KA 4M4PA 3INUH 1PY9A 4L3CA 1UVQA 3BEWB 4PJHB 2QKIA 2DLIA 2DJSA 4QRPB 1S9KC 1ZS8A 3O2WH 4DN3L 1H9VA 2IAMC 4PJBA 5C2BL 2GITA 2P5WE 1YMMD 3ZKXB 4LNVA 5ENWB 3S34L 5C09B 5HHNB 1U8OB 3N1QC 5I1EH 4DAGH 1IZJA 4ESKA 4XCFH 1U3HA 2FL5B 1ZT4B 4YXLH 5CEYA 5BW7C 4J6RL 1LO4H 4LSQL 4YGVB 4RIRB 5TQ2L 4W68A 5F9DC 5HPMA 3DVGA 2NY5L 2FJFA 3EYUL 2MPAH 4YDKH 4WU7A 5F7WC 2FHFA 4QTIH 1MY7A 2XNAB 4GRLB 3MO1A 1RUMH 4YXHL 2FHBA 1YPZF 2I27N 3C60D 3SQOL 3MMEB 1MFAH 3NCYS 5F7EL 5IHUL 4C83A 4CN6A 4FQXA 3TYGL 1BM3L 3CX5J 4M7KL 5C3LD 1QBAA 1G7LB 4KDVA 1J87A 3CVIL 3EGSA 3T1FA 1ONQB 3N1GC 1A9BB 2YPKA 4FXKB 2NY1D 1VFUA 5IB2B 1F11B 1HSAB 2OTUA 3H7LA 4PJCA 1M05A 3IJYB 2WSKA 5IEHB 4HDIB 5JUEL 4JHAL 1KTRL 4C54A 1H8SA 3QWRD 3KJ4B 1CTOA 4L9LC 4XVSL 1FORH 1I9IH 5C0IB 2P5WB 3QEGH 4KJWC 3HI1B 5F1IB 2X7LA 4MQSB 2MCPH 4M5YL 2H3NA 5IJVA 5FA3B 1U8NA 3TBWB 5GS1B 3S35X 3CVHH 4HT1L 1KTKE 1FGVH 3AB0B 1FFPB 4NZRH 5MHSE 4OCSL 3PWPD 2YPLA 5FF6B 4PRIE 5DFVC 4Q6IB 4YHYC 2RCSL 1KJ3L 4QHKI 5DHVH 4YDLB 1FNSL 4M43L 3D0VA 1G7JB 1ZHLA 2FNBA 1EHNA 1N8ZA 5CILH 1NBZB 4U6YA 3REVA 4GBXD 4FNLH 4I3RL 4PBVC 4ZUUA 4CVZB 1UWEH 4XCCL 4PJFF 3S36H 2B4CC 1D5MB 1F97A 2CRYA 2BJMH 3OKNA 4JO1L 3MA9L 2A74B 4S11A 1E4XH 3KPOA 4LPUA 1NCAH 4F9PA 3ULVH 5I17B 3KYOB 1BP3B 3BIAX 2R0ZL 3QUKB 4YBLB 3K74B 3P73B 4HJ0C 4DKEL 4YFDB 1O7VA 4EIGB 2NXZC 2Z35A 1LEGA 2GY7B 3FHQA 4MXQD 4PP1C 4Y4HB 4TVPD 2C26A 5CBAA 3RL2A 3RBGA 4GW5B 1GYAA 4PRPD 1U8HA 3FONA 4YFEA 1JPFB 2EO1A 4EJ1C 4L4JA 3VXRE 3QIUC 3N06B 1HH9A 4PJ9D 2BVOA 2OR9L 3T3MF 5C0CE 4OLWH 4LHQB 4OF5A 1AGBB 4WFGD 1JHTA 2GCYA 4HUXB 1NCUA 3K8MA 1GJIA 2J8UE 1T1WA 3LRSA 4KRPC 4NQEB 4WDIB 5BZDA 4KZDL 3S37L 4LGRB 1L4IA 1NGYB 1SJXA 1MJUH 5E9DD 3F7VB 4LFHD 3TT3L 1NGXB 3MGTB 4LLQA 3HNTH 1YEEH 4KRLB 3T4YA 3GI8L 1A47A 32C2B 1OTUD 3MACL 5CIPA 4ORZC 4P3DB 3NMEA 1EA9C 5TPWL 5JIKA 4OZGA 3MGAA 3R0NA 3WDJA 3AROA 1F6AB 4JG0H 1KJVA 3PHOB 3QDJE 5INCB 1KIPB 4TSBH 2DS4A 4L8CB 1Y18B 4MAUH 4ZXBC 1MIML 2DYPA 3DETC 4C55A 5H35A 4HWBA 2W07A 1S9XA 4JR9L 1JE6A 4KVNH 3V8CA 1Y6MR 4HWNA 3K1DA 1IZKA 2I9LA 2F8OA 4KROD 5LGJA 2V7NA 3H42L 3WLBB 5T1KD 4P4KD 3O9WB 3QB7C 1QEWB 3B2VL 5J4MA 3MRRA 4YDVA 4GG6F 3G9VA 3GSNL 4O58L 5FA4A 1DUYA 1URLA 3W0WA 5JW4N 1XGUB 1FCGA 4P2QE 5DSCA 4XHQA 3PQYA 3QUYC 4XVUC 4FTVA 4NFCA 1P7HL 4NWTH 4ONHA 5C0CB 1EXUB 4M00A 3A67H 3BH8A 3SDYL 1VFOA 2X89A 4OF7A 1SHMA 1JTOA 3CSYA 3ROLB 3Q5YA 1H3WM 2J8UB 2VQTA 1UGNA 1F45A 1A2YB 3O2DL 5D1QB 4P23A 5IB1B 2VQ1A 1XH3B 2UZIL 3BKYH 5CP7B 4Y2DD 4OUUA 4X98A 3T2QA 1N6UA 3OHXA 3H9SD 4YHKH 3FKUS 4DCQB 4UAOC 1BJMA 2IG2L 4AG4H 1FN4A 1I1FB 3HE6C 4FQQA 2NY3C 2HTLD 2VDNL 3QJFA 1E6OH 3RI5F 3V7MA 4MNGE 1V3JA 2QLVB 5T1DH 4N90D 5I1IH 4OCRL 3QDJB 4ZYKB 3MRFB 1FGNH 1R3LA 4EQ2A 3PP4L 5EU7E 1FAKT 1NAMA 2EECA 3VRLF 2X40A 2DLFH 4X4YB 3DXAD 4W4OA 1ES0B 4XI5C 3BI9X 1DLFL 3MV9E 4JY5L 1S8DA 3K81A 3ARFB 1OSPL 5E5UB 3HI5H 4UTAH 4OFVA 4PR5B 2CRMA 3KGRA 3S96B 1TIUA 1KIRB 3T2NH 1S78D 2NQCA 4GSDL 4JFED 1FZJA 3H3PH 3S9DB 2F54A 1RK0A 3D85D 2FB4L 3L6FA 1MPAL 4U1IB 3WKMH 3OKEA 2EH7L 5CGYC 2AGJH 1HHHA 4P2QB 4UT6L 1RUKH 1H3PL 1J05A 5KSAC 2Q86A 4M48H 2YK1L 4JQIL 3HN3A 3SE8H 1DP0A 4HHAA 3PWUA 1KCUH 4YE4H 4AM0B 1WLHA 2ZCHH 4WFFE 3T0EC 5TE6L 3WO3B 4QT5B 5LWYL 5AAWA 3E6HB 35C8L 4MCZB 4JCLA 3JWDH 2FZ3B 1WTGT 3ZMRA 4Y16A 4GKZB 4ZFOB 2Z31C 3IETA 4BQ8A 4EI6B 5FYLH 3BMVA 2ZCKL 6FABL 5FYJL 3DVIA 4UQ2B 4XCEB 3NFNA 1RUAL 4ZD3L 4PJDB 4LHUG 2F74B 2G2RA 3BKCH 3B9EA 3ECBB 2NYYD 4AIOA 2D0GA 5T3XE 3U46B 3JTSB 3CCHB 3KPMA 4XHJD 2LU3A 5EA0L 5GISH 4EIZC 1BLNA 4F7CA 3FQXA 3MRKB 4NC1C 3BW9A 4YH6A 2DL2A 1LO2H 1U8MB 2BFVL 4TQEL 5ITFA 3QUXC 2GAZB 4XCYB 3KXFD 5E94B 4FQJH 5D7SH 5EU6E 3STBA 1RUQH 4WV1A 2ZCLL 2C4FT 4QGYA 5E2UL 3UTZB 3EYFA 2PYEA 5KZCD 1UZ8A 3SDCA 1NGWB 3HNVL 2YRZA 5GJSL 3QQ9D 1MCNA 1IILE 2BVYA 2CMRL 1W72B 2VXUL 5J89A 5D2LE 5IK3A 4I5BA 3SPVA 1TZHB 5DUBA 2Q6WA 3H8NA 4G6AD 5I8EA 4YJZL 3UJJH 5HGBB 4TNWK 4WI9A 3SE4C 5DJDA 4ELMA 4H5SA 3RKDD 2BVPA 3MREB 1HNFA 2IMNA 4MB5A 3QNXA 1KACB 4LSTH 2CQVA 4ZO8A 5I66A 3AY4A 1JZ5A 3RTQD 3ZLQC 1JN6B 3QQ4A 5FDYA 2FWOB 4EI5D 5KVEL 2A6KA 4KI5E 4Y5YA 3WMSA 4R2GD 4HX1B 1S7WB 4QKXB 4AIXA 5C0GB 2MOVA 3WJJA 3UTQA 1XAUA 4Y4KB 4MNHB 5HYQB 2YSSB 4XZUA 4Z7VE 4ZUVA 1F2XK 1JUFA 3REWA 1Q9LA 1YYMH 4N9GB 4V1DD 1BIIB 5IVNA 1MUJA 3HC3H 2WWMD 3BPNC 5JO5A 5K9OA 2VZOA 2EIZA 4G7VH 3SCMC 1RZGA 2CH8A 1R3KA 2ZSWA 3VDBA 4XBGA 3DX9B 2HH0H 1RUPL 1I7TA 1OM3H 2BNQE 1MCPH 4GMSH 3U1SH 3IXAA 5C08A 2P4AB 5EU6B 4FZEL 5IFHH 5FEBA 2W0PA 3GDBA 3BN9C 1VFAB 1MIEL 5EBMA 4NN7C 5LG1A 4JAMA 1C16A 1QBBA 4WI3A 2BSRB 4Z5RA 4R4FL 4OZ4B 4XNQA 3HE7B 5D2LB 1TETH 3LQAL 5J6GB 3S98A 3QDHA 2XT1B 3IFOA 5CWSA 2MSPA 5KG9A 4JPIB 4OD1H 2C5DC 2WBJA 1CFVL 5D7LE 4U1GC 1AGEB 1DL7L 4PGDB 4YZFF 4QRRD 3JZ7A 4QXGH 3LS5H 1X6LA 2VL5A 1EMTL 3RDTC 2IBZY 2ZOLB 4PUBL 3O2DA 3DWTA 4I3SL 2OMNA 2DQDH 1S7SA 5HHOD 1G9NH 3GRWL 5DT1L 1IKNC 3U0WL 1Z5LA 1TCRB 3EO0B 2PO6B 1NPUA 4KK6C 2PCPB 3D2UA 8FABA 4XWOC 5IESL 5K9QI 4K55A 3OR6B 2ICEA 5CMAB 3ISWA 3HTLX 4JEGB 4UDUA 5K93A 3IU3B 1VFBA 2ADFH 3PHQA 5ICZB 3NN8B 1S7RB 2MCG1 3O6LL 4BFGA 3TNNA 4ZO6A 3QISA 2YKLL 2GSGB 2DQJH 4KAQL 2MMXA 2E8YA 1JTTA 2XG4A 3QUMH 5IVXA 4LRNH 4KXZH 1DCLA 5MERB 3BPLC 4TSCL 2C1OA 2PXYC 4DKAA 4CMMA 1M4KA 1T7VA 1QQDB 4PJCE 3VGAB 4U1JA 4EOWL 1UENA 4RMWA 4PLKC 2Z92A 1I8KA 3UZQA 3BYTA 4MD5A 4J3OC 2RR3A 4HXBH 4ZNEA 3DYMA 3BZFA 3WN5A 1MCWM 3H7BA 2E7CA 3RGVD 2C3XA 1TJIH 4Y5XB 2IALB 4NNYB 2A1WL 4XNXH 4P49A 1EEYB 5CGMA 5D7LB 3L5HA 2DL9A 4LVHB 1HXYB 4I13B 2YPLE 4D9RE 5F7MC 5HVHC 5HHVL 1K3ZA 4TTDD 2ESVA 1CD8A 5EZOL 5F1KC 4ZPVB 3MRQB 3Q3GB 1BGXL 4NKOA 2N4IA 1TJHL 4W4NA 1V3MA 1P5UA 4IOSD 1D3CA 1OSZA 4OBRA 4OD2A 3D3VA 2GFBA 2LVEA 3P4NA 4DZ8B 3TJHD 5CEZL 2FL5A 3FAXA 2H32A 2ZOKA 1ZA3A 1XGPB 4LPXA 2DQTL 2VZUA 5T3ZH 2QL1A 3U9PH 2D7PA 2VC2H 3LS4H 3AXLB 1D5XB 1BMGA 3QCVL 1OCWH 4ODTH 3GSQA 1WBYB 2WUBL 1A7NH 5FECB 3BWAA 1NEZA 5EBWB 1IFHH 3DGCR 3MRMA 4GRLA 2ICCA 3F12A 5DJYA 3UTSD 3HRZA 1A7RL 1IGTA 2BNRE 3A6BL 4XP9H 3RWHA 1A4KB 1ZLSL 3MRCA 1WJ3A 3VXRD 1WAAF 3F6LA 1T03H 2MHAB 4LLUB 1AH1A 4XPGL 3NACH 5KS9B 1ONQA 3T2OA 1CXLA 1RJZA 1MEXH 1U58A 4FXKA 1NC2D 5FM5M 3C60C 1WISA 1YEFH 5GGUA 4X6CA 4YEEA 2J6EL 3SGEI 5IEHA 1UM5H 2IJ0C 1ZHNA 4P2RD 5EWIH 4DGYH 1IGCL 3TH4T 2ID5A 2NCMA 4F2MB 1HNGA 1WIUA 3T0AA 5E8OB 4P99A 1C12B 3RPKA 5C0IA 1E4JA 4E41A 3HI1A 1JWMB 4OZGE 1P4IL 4CMHB 5F71A 5H8DA 4DOHB 3D9AH 4U7KA 2AI0L 4OZFG 4XNYL 2MFNA 2X4OA 4ZFFB 5E8PB 2HTKD 4XC1H 3ARBB 4HGWB 3ET9F 5D7IB 2XG5A 1A6UH 3BDYL 4UMGA 1BQHA 1CDJA 2QHRL 2ZWLT 1LE9A 3OZ9L 4HJJL 3G5ZB 2XKSA 2OXGA 1XIWB 5I8CB 1NFIB 4CVZA 5TDOA 5C86A 3ARDB 5GSVB 1WFTA 1KENH 3TZVA 5CP3A 2BNRB 3PUCA 3QQ3B 3UROR 3C8DA 3U9UA 4D0DB 1BFOA 1QLRA 2X9WA 3AAZB 2AK4D 1AXTL 1N59A 1DEDA 3CXHK 5JOPE 1UA6H 1MCRA 3TBSA 3QUKA 4YR6B 4GBXC 5I6XC 3WXWH 1D7FA 4M9PA 3HMWL 1T21B 3WS6C 3WE6A 4R4ND 2E6QA 4XXDB 1YN6A 2OL3L 2ZNXA 5IW1B 5E6ID 3MCLH 3VXPB 2PYFB 5CBEA 5IFJB 1FFNB 3C5SA 4JDVA 3C5ZB 1JPFA 2VLMD 1NMBL 3WHXB 2X4RB 3E3QC 4NRYB 3D1MC 2CD0A 4JPVH 2EIBA 2BCKB 4PJXA 1UACL 2ZUWA 1XGQA 3I84A 4AK1A 4F7PA 2PTTB 5L2JB 2DKSA 2LU7A 2AJUL 4RQQA 1DVFA 1H5BA 1PEZA 1FFQA 3MV9D 4XH2A 3F7VA 5HY9B 3SGDI 3MGTA 3UYOD 3QIWA 3ZSTA 5D1XA 1WC7A 3THML 3KPSA 4PJ9C 1HHGA 1JPSH 1QBMH 1CICA 4P3DA 4FFWD 3DRQA 1G0XA 4WUKL 4UB0L 1B0GB 1KN2H 2MJWA 3OJDB 1CLYH 1CQYA 4Z76B 3HCVB 5TGBA 2XN9D 4MS8C 4OM1H 5JW4M 4OAWB 4XVJL 3BXNB 3BZDA 5E1AB 4K9EL 4K94C 1KIPA 2W38A 3WSQL 2BRQA 1FSKB 4Q2ZB 1OTUC 1REIA 1WK0A 3BDBA 4NO3B 1N0XL 4P4RB 1GXEA 4JVUA 4HQQL 1OHQA 4DKFH 4MJ4A 5DVLA 3ARXA 4HXAH 4G7YH 4RFEB 4O5LL 3O9WA 2EDLA 5IR1B 3GSXB 5J13B 2WMPA 3MTRA 5DXWA 2VTFA 1MAML 2XA8H 3K7UA 5SV3A 4XGZB 3SGJA 4G5ZL 4JN2A 3VA2C 5MEPA 3C8HA 4GKSB 5HI5D 1HIML 2A9ML 4GQ9L 4G8IB 1I8MB 3ARGD 5IROC 2GSIB 3WIIH 1PKQA 1ZHKA 3BP6A 5E5RB 4P4KC 3V0AC 3ZYOA 1O7SA 4QCIB 5T3XD 3DMMA 1BD2B 4LVEA 1P6FA 5B21A 1EFXD 3GMNB 5KSVA 2EDYA 1FVDA 4YHML 1U8KB 2AJVL 5D7JD 1M7IB 3T0VA 5F9JA 5INDA 3QI9A 1GCFA 5IMLB 1DUZB 4PS4H 4DCQA 1QFWH 1SYVB 2CIIA 1ED3A 4J2XA 3GHEL 4X8JA 2NR6D 2E7LA 1Q0YH 3HR6A 3MNZB 4P9MH 3MRIB 5AD0B 2DM7A 4G8GA 1GRWA 5I1JL 5AYUL 3E1F1 3S3PA 4ELKB 4KQ3H 4NJ9H 1K5NB 4Y2DC 5EU3B 2QEJA 1EFQA 3TVMD 4ZTOH 4C4KO 5JLZA 4JREC 2IF7A 3C87A 1VGKB 4JY4A 3ILQD 5ISZD 1FBIH 4P57B 5EZLA 3GMPA 1FV1A 2HTLC 4JO2L 3UTTE 2AV1B 4HD9A 4G8EB 2E27L 4JHWL 1KIRA 4K2UL 5GGSA 3SE9H 1MHEB 5MENE 1RQ5A 4UILH 4B53A 2F53D 2UWEF 2WIMA 4MNQD 3VXUD 3HZYA 4OFKA 4MD0A 1A1MA 4UT7L 1FRGH 5GGVL 3SKNB 3TBYA 1MNUL 4UIKH 3NABH 4NQDE 2ZJSH 3H6JA 1JHLH 1NBYB 5J0BA 2CR6A 4YBHA 4XPAL 3ALXA 3CK0L 5IFAH 1RJCA 1KG0A 2GQHA 3DIFB 3ZTNL 1C08A 2GT9B 5TE7L 1E28B 1I1AD 1S78C 4YPGA 5IB4A 1IGFL 3EFDH 1CLZH 2GTZB 3BJ91 4NDMB 3DROB 5LXGL 2BNQD 3NCMA 3SDAD 4ZFOA 4EI6A 3TJEL 1D9KD 3BT2L 4UIMA 4XCEA 2R2HA 4G80A 5C08E 3S5LB 4NN5C 3D39B 3OV6A 2B8OT 5H94B 2EYRA 1N4XH 1CXFA 2IGFH 4KWUA 1S7VB 3QA3B 3G6JA 4XMLL 5CKAA 1BFSA 2ED9A 5I1CH 3BSZH 5C6TL 5HBBA 1YUHA 4UOW0 1U3HD 1CLOL 4WEUD 3TO2A 1QA9B 5C0RL 4RFNC 5JDSA 5ETUA 4MQXC 4LLDA 5LQBH 3UTTB 5MI0B 4XCYA 5KSUA 1C5BL 4HWZB 4OCWH 2B0SL 5MENB 2NYYC 3P9LB 5JW3H 4RA0C 3ZL4L 4NCC2 1XF2B 4JB9L 4OCXL 3B9VA 5DJCA 4ISVB 4NQDB 1OB1B 3GBMH 4X7TB 1B3JA 2W0LA 3O3BB 3H3KA 1TZHA 4P46B 3ZYZA 1QKZL 1FLRL 1AE6L 1QLEL 5HGBA 4K8RL 5LBSL 4OI9A 1T1XA 2A6IB 4FQXD 1G7HB 4JLRB 1I7UB 4S1RH 2V5SA 5AZ2L 3QQ9C 2B1HL 1RIHL 2YD7A 3OWEA 4HKZA 3X12B 4I0PA 1JN6A 2E5EA 1H3XA 3O6ML 1PGRB 3MLZH 5MEQA 2A77L 4G6AC 1RZKC 1R3HB 1YNLL 1S7WA 3U0TB 3TIDB 3VWKB 1XFPA 4CUCA 3NIDE 4OIIH 3KYMB 4WI6A 3GSRB 1KPVA 3E0GA 4TNWF 4MLSA 4IRJA 3L5JA 4Y4FA 3PL6A 3RTQC 5I1HL 2VLJA 1XGTB 1JNLH 3EZJB 4UV4L 5EUOA 4R2GC 4XPFH 4XMKH 3DX9A 2KBGA 2IQ9L 1QACA 2XZAH 2VH5L 1MI5B 2XZCL 4O9HH 3WUWA 5DJ6B 4MSWA 5HPOA 2ESVE 3FQWA 4KRNA 1PD6A 4KY1L 1WIPA 4IS6B 2BSRA 4OI8A 5FYJE 3MYJB 5J6GA 2NW2A 2QSTA 3D3VE 4YO0B 5DRWB 4DVRH 5IUSA 3FRPA 3O0RL 5F6IB 1R0AL 4AT6B 4KHTL 2BVQA 4M7LH 1BFVH 3GM8A 4NWUH 1YJDC 1EHXA 3S36X 3ZZ1A 2FLRT 1CDBA 4YWGH 3VWJB 2PCPA 1VKXB 4MXWH 2CLZB 1RHHB 4P5TB 3PG2A 3IKCB 5GS3A 3OR6A 1JCKA 1EEZB 1CFSB 1BJ1H 5DD3L 1U2HA 2VLKB 1YMHA 2BRRL 1TJGH 4U6HB 3NN8A 4WFHE 1RAMA 1QOKA 4XBPB 1MCKA 4N0FB 1CDIA 1XF4A 3NZHL 2C1PA 4IHOB 4O2CA 3VXNB 4G9FE 4NUGL 3OJMB 3V6ZA 4EBQH 3G6DH 3EHBD 3VFTB 1MCJA 4XAWL 5MERA 1TFHA 5FDWB 3VFSB 4YHLL 1OAUL 1C5DA 1LK3H 4X6CE 1VGEH 4PIRF 5JR1H 1ITBB 1KEGL 2O93L 1UB5B 2ZSVB 4ODWB 3MV7A 4G6MH 3PDDA 1WVZA 4E41E 3ULSB 2J5LB 3EDKA 3B8SA 4FA8A 3NGBB 1XR8A 4Y5XA 2A9NH 2OSLB 2OR7A 2HT2C 5EZJA 4QY8B 4N9OB 1EGJL 1QBLL 4LPTA 1CVSC 3U48A 1GC1C 2DYPD 1LEKA 3F5WA 4QTHB 3AREA 3ZDYF 3X13A 3DRTB 1AIFB 5L7XL 5M7QA 1SBSH 3WHE0 1MCEA 4X5LA 5I1DB 3KPPB 2QADB 3Q3GA 4U1LB 3RGVC 1R5VB 4N0UE 3U7YL 4YHIA 3ZE0F 1OLLA 1UJ3B 4M1GH 5KAQG 3IDYB 3TNMB 3C6LB 3QG7H 5JQ6H 5J6HB 1KTDB 4IOFD 1GGCL 1RZJH 5JHDE 4QF1B 4DZ8A 4RMSA 3W0WD 1WT5C 4TTDC 4F9LA 2QJDA 3M45A 1AGFA 2VLRB 3PQYD 1DQQA 4FTVD 2XV6B 5DQ9B 3SN6N 1DBMH 3CFCH 4MQ7B 4KGJA 4G9FB 2X89D 1IEAA 5DLMH 2EXWD 4M61A 3VXSE 4OLYH 3RBSA 3IDNB 1RZIB 3LPFA 5D5MF 1XGRB 5DEFA 3TJHC 4P23D 1JRHI 3NA9H 1CK0L 2AS5M 3PGFL 3N0PB 1Y6KR 3LEYL 2G9HA 5C9KA 3PHSA 5KBNC 1P9MC 3QCUH 2JTDA 2BVTA 2HFFB 3WFBH 3RWFB 3WO4B 3CC5B 1IAOB 2IC2A 4F15C 2HG5B 3BQUB 3A6CL 4Z7UA 2VKXA 5DFWH 1GPOH 1NFDA 2VAAB 1UEMA 1W72H 4AJ0A 4WWKB 3S88L 4FQLH 2X1QA 4UT9H 2V9TA 3RVTD 3MNVB 3W9EA 1NJ9A 3RZCB 2A6JB 1XGYH 2NLJB 4FXGB 3GEWB 4XMPL 3BPCA 3KPSE 3TH2T 3K46A 4NZUH 1HHIA 3VFUB 4N0UB 1L0XA 5DMIH 3DSFH 4A2LA 5F9WC 1INDL 3ES6A 4LARL 4IRSA 1XCTB 1AQDA 2V17L 4ERSL 4WY7L 4YDJB 9CGTA 5JHDB 1D5IH 3ROOA 2F54D 3GJEA 1EEUA 1MVFA 4GRWE 4PJEF 4GLRH 5D7IA 3VD4A 4K07A 3LZFL 4OM0H 2A0LD 4EUPB 5BS0A 2BSED 1NSNL 2E6PA 2NY7L 3WIFB 4KFZC 4OZIA 3G5ZA 3MJ8A 5E8DL 3VXSB 3DGGB 1XIWA 2O5YH 3MV8B 5CEXB 1NFIA 3ARTA 3P9MA 4WGWB 1OAYH 5BO1H 2HTKC 5DD0L 5GSVA 2R4RL 3U7AA 3LPWA 1AR1D 5DWUL 4JQXC 1ZT7A 1F4AA 4Y16D 4GS7C 3KLAA 2L0DA 1KPRA 5I1LB 1ZV5A 2AXGB 3AAZA 1VSCA 1FYTB 1XR9A 1T0NB 3AVEA 4RZCB 3ESVF 3QFDB 5CEZE 4JZJB 5DS8A 2H8PB 3B3IA 3LRHA 4N0CD 4BKLB 2HJLB 4PJBF 3WIHH 2FX9L 3U79A 1HKLL 3C6SA 1N64H 5IW1A 2R69H 3OKDA 1JF6A 2ITDA 4LCUB 1CE1H 3OXSA 3L5IA 4DFIA 4MMZC 4HIEA 5FUZH 2PYFA 2HVJB 1F5WA 3N1FC 3P4OA 1S3KL 1MJ7L 2LU4A 4Y88A 4OF8A 3O6FB 2YMXL 4YDIH 3MOBH 3OR7B 2P8PA 4U1SB 4KKBC 2PYED 2X41A 3SDCD 2LVCA 5SWSA 2BNUB 4R4NC 2BOCB 4GRWB 5K9JL 4APQA 1MFEH 5CJQH 5C70A 2O61A 1CDCA 2V9QA 1JYNA 4GMTH 3ZHDA 4LLMA 1P4LB 3WEXA 3MOAL 1N6QL 2OP4H 4WO4B 4XAKE 4LCCB 4DVBA 3O8XB 1NAKL 3WFDH 2BSTA 3VD5A 2OZ4L 4OQTH 4YHOL 4AYFA 3V0WH 4PG2C 5A16B 4ETQA 3NCEB 5JW5A 3IFPA 3PWJA 3BZEB 2HWZL 2GK0B 2X4UB 5DO2D 4JG1H 3KG5A 4ORGB 5FO9A 4NO2B 2MQCA 3RU8H 1FDLL 3LEVL 2EDHA 1KC5H 3IB4A 4WEBH 5E4EC 3VG9C 2FRGP 4FFWC 3BHBB 3GKWH 4POYA 4EN3B 4JFDB 3VXOA 5JTWA 4NZTL 1X9QA 4M6OH 1A14H 3HUJA 4X5WB 2EDTA 1IAKB 1JPTH 2GJZB 3U6RB 4I77H 3GSXA 1I9RH 2G5RA 1U91B 4F33A 2A6DA 4X80L 1S7TB 1G9EA 4TPRL 4YAQB 3UYRL 2DLGA 3OAUH 3P11L 3NFSH 3L1OL 2X70A 4UQ3B 3VFNA 4FP8H 4GKSA 4GXVH 3CFJB 1EAPA 4Y5VB 1OF2B 4DGIL 5F93C 2DMBA 1Q9KB 4NO0A 1KBGH 1U8LA 2XFXB 5IIEB 1P7KB 4HK0B 1G1YA 3FO1B 4FQIL 3G6JE 5FOBB 3O3UN 1NEUA 1V7ML 4OLXH 1QPPA 1I8IA 3VXQA 4S1SL 5GGRB 1U8KA 1YC7A 2WBJD 1YEHL 3QEUA 3QUZA 5GRYA 3HAEA 3ARGC 1AGCA 3ULVC 3MLSL 3TO4C 4O2FA 1JVKA 1X3DA 4Y1AE 4PJGA 4H8WH 5ACZA 1BBJA 4DKDC 3FFDA 4YIQA 3D18B 4O2EA 3L7FA 2RGSA 3LQMA 3LKNA 4O4YL 3T0XA 1BAFH 3KHQA 1HEZB 1K5NA 2O5ZH 3D2UD 4BSWB 3SE3C 4PGBA 3BGMA 4PY7B 4N0YL 2JE8A 3MRPB 5B39B 2ZKHH 3LD8C 3LV3A 1P84J 3U30C 1BQLL 3GIVB 3VRIB 1Z3GH 2FECI 2NY2C 4HMDA 5HDOA 3WYRA 2NR6C 4GKOA 2X1XR 4W6XB 3MLTA 5JW4Q 2AV1A 4LSUH 4G8EA 2BDNL 1UQSA 1JNHB 2H26A 4CADB 1CDHA 3N50A 3PXHA 3GBNL 3L3KB 1L7IL 1MHPH 3L7EA 1HDMA 5DK3A 1LO3H 3SKNA 4MYWB 3TVMC 1QRNB 2ZUTA 3BD5A 4HUUB 3ILQC 1JRHL 4L8SC 5D93C 2K1MA 3MJ9L 2ARWA 2D4FA 3TBTB 3U2SB 1ZEAH 4GRMB 1MCQA 3JWOC 4ZUWA 5EOCL 3SDDA 1KXVC 4I9WE 1TTFA 4CN4A 1SM3H 4FG6D 3V6OE 3QIUA 3MUY1 3AU1B 4LMQI 4U1HB 2CDFB 2VLJE 4NSKA 2GTZA 3PNWB 2HVKB 1ORQB 5EUOE 4I18C 1A22B 5KW9H 1ZGLB 1CR9L 1VA9A 4R3SA 5E7FA 3LH2H 4JQVC 3NPSC 3FB7A 1WCQA 2JJTC 3BKJH 2Q87A 3PWVA 1I1AC 1G6RL 4J4PC 2YUZA 4Y1AB 1OP5H 5IBUG 4X0KB 4HV8B 4QXUL 1ND0B 2ZP0T 4OFPA 4EDWH 2Y36L 4NPYA 5FYJD 3QO0A 3X14B 3FQTA 2AVGA 5MP6L 4QRQB 4WFEE 1TNMA 5A3ID 4DN4H 5SX5K 3GFUA 3ZO0A 5HGHB 4GQPH 2FYYB 3JV4B 1KTLA 4H20H 4DGVL 4HG4J 5MEOB 4R4BA 5CKGA 3WNKA 2EE9A 3KWWB 2JIXB 3B2UD 2VN4A 2ARJB 5DJAB 2IBZX 4GRLD 3IF1B 1OB1A 4ISVA 4OGXL 1KFAH 1U3HC 3MFFB 3W81A 1OWRM 3R4DA 4FQCL 1M1SA 3BP7B 4TRPH 5DURB 3T