1OQOA

Complex between g0 version of an fc bound to a minimized version of protein a called mini-z
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Fc Glycans on The Effector Functions Vary with the Antibody mechanism of Action
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords immunoglobulin gamma-1 heavy chain constant region
total genus 37
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA01
4UDUA 3IT8D 5DJYB 5C0IB 3VFVA 3IFLH 4AY0A 4HUXB 2ZUQB 4D9LL 5GXBB 2IFGA 3MNVA 4KJYB 5FB8A 1FH5L 2IH1B 3T3MF 3DO7A 3RWHA 2EH8L 3NFPA 4JRYD 5FGCE 1KEGH 1QLRB 2R23B 1IC7H 4CL7A 5EA0H 1BIIB 4IS6B 3ZE0F 4FXGA 2EDJA 4EJ1C 4PJXA 5D7IF 1DFBH 3VXUB 2WBJA 1QUNA 2O61B 1SM3H 2YKLL 5CBEA 1G9NH 1YEKL 4GMSH 4XP1L 3SDDD 5CEZL 2AJYH 5HYSB 1DBBH 3C5SA 3L3OA 5DJDA 3N9GH 4KV5F 3NH7L 3DV4B 4CGTA 4WW2F 3SDCB 1KJ2L 1KCUL 3MFFB 2P4AB 2AEQL 4GG6E 1JTOA 5TE6L 1AGDA 1OCWL 2OJZL 2IPTH 4XVJH 1ZWIA 1CR9L 3TO4A 1BREA 3EOBB 2R2HA 5D1ZA 4ZDHA 4OCRH 2WQ8A 4CNIA 2I9LA 3WIHH 3G9AB 1BIIA 1MCKA 1HEZB 4NJAL 3QDGA 4UINH 4Y4KD 5TH2A 3DUSA 1A9EA 2OMBA 5BOPA 5FCSH 4R8WH 4Y4FA 1PSKL 3RVTC 1W8OA 3GJFH 4UT6L 5CIPH 2CLVB 5I15L 4PRHA 2ZG2A 3VXSE 2VRAA 3L9RA 2VITB 3L6FA 2OYPA 3QCUL 2CUHA 3DVNB 4ZAKB 2YK1H 3A67L 3GSNH 3T04D 1J11A 1CLYL 1ETZB 5I8EA 1N59A 3F65A 1MFEH 1NCBL 2ITDA 3KAAA 1GH7A 3DSNA 1C12A 4LBEB 1MCWM 5L2KD 5EU4B 4HWEH 1S9WB 5HHOA 1T6VN 5LCVH 1UXWB 3VGAC 1AJ7H 4CMMB 3AVEA 3QHZH 2Q7NA 3ULVH 4YUEL 3ARTA 4MSWB 5D7JA 1T21B 1HSAB 1KLGA 4JM2B 3B83A 5KN5B 1MJ7H 3V6FA 2ZWLT 4L8DA 1ZLSL 1S5HB 4GXVL 4G6KH 2VISB 3ARUA 3U7YL 3QG7H 1CFTB 1FCGA 2BERA 2FBJL 2H3NA 4XP6H 5M7QA 1BEYH 2AK1L 4N0YH 4X6CF 4HIHB 1ZS8B 1RUAL 3FT4B 5E2TL 3TIEB 1FIGH 5GS1B 3TT3H 3ZDYE 1T2QH 5D71H 2DQTL 4F3FB 1HCFX 2IANB 3CFBB 3N1FC 4M43H 2P5WE 5JOFA 2BNRB 2EXYC 4Y5XC 4JGMA 2VE6A 4YX2H 4FFYL 1A6WL 5IJKC 4GJTB 1N64H 2B0SH 4HH9A 1U6AH 1Q9OB 4C56B 2H45A 3U30B 1NLBH 2OXGA 4JO1H 1C5BH 4Z7UA 1YEHH 3L3JB 4NQED 1S7VA 4O4YL 1U95A 1T83A 1Z3GL 4FABL 5F70A 5ICXA 3MBXH 1DDHB 4P2OD 5IHLB 2H6PB 3L1OH 2VLKD 2VL5A 3WHE0 1H3VA 1RUMH 4BZYA 4HJGB 1FZOA 2DD8L 1I9RL 3HRZB 3MZTA 1MY5A 1X5YA 3VXMA 1FRGH 1N8ZA 1MCEA 1N2RA 1S5HA 4OJFL 4Z7WB 3ULUE 4L8DB 4Y16B 3U0PB 5TDNA 4P57B 3A0OA 1NGQL 5D7JB 3RTQC 2A9ML 1FL6B 3QDMD 2FO4A 2VLME 3EZJB 5JHDA 5SWZE 5DJCB 4Y16D 5BV7B 2CXKA 4HCRL 1E4KA 3BPCA 4J8RA 4ONOA 5FUZL 2FR4B 3QA3A 3GMLB 3K4AA 4TSBL 1HHIB 1CT8A 3P0YH 4X9IA 1J10A 1CS6A 1OAKL 1FQ9C 1KJ3H 1CLOL 1QZ1A 3TJHD 2F8XC 2FDBP 3TNMA 4NN5B 3WNMA 5DO2C 3QAZC 2VZOA 3BZ4A 3G08A 5KSVA 3QEQE 2RCSH 3OR7B 3O9WA 3FOLA 4UI2A 2P24A 4NRYA 1NBQA 3HNTL 1L0XA 3MV7A 2YWYA 2EYTA 5HYFA 2VR4A 3QCTL 4YBQC 4KI1A 4BFGA 4PS4L 1DVFA 3PWPD 5CGYD 3HPJB 2Q86B 3VXRD 4PJ9C 3JWDH 1JNJA 1RD6A 3V7AG 1C5CH 2C3XA 4G8EB 2B2XL 1D5BA 1K2DB 5IB1A 1GRWA 4JM2C 4XVJL 1I3RB 2VXQH 4PJ7B 3TJHC 2YPKA 1JWUB 1FL6A 3EIFA 2PO6D 1CDBA 2A1WL 1JP5A 4NO5A 2J6EH 2XQBH 4KVNL 5DK2A 1A3LH 2QEJA 5I1KH 5IFJA 4UNVA 5KVGL 1I1YA 4H8WC 4I48B 3B2UC 4PV8A 2R1WA 3H7BB 4KXZI 2CLRA 1ITCA 3FMGL 3H8NA 5CZXD 1EAJA 2DQIL 3WIHA 3W39A 1JHLH 3HNTH 3OG6B 3QQ4B 5IBTH 5JO5A 2EDOA 5IBUB 4ALAL 3FFDB 3GBML 3QIWD 3BJ91 4JQIH 5DJ2B 5JHDE 1PYWA 5F7WC 4ZOCA 5GJSL 3VWKA 4D9QD 4F9LA 3U4BH 1IC5H 1BLNA 4LRNH 1W8NA 2MKWA 3NMEA 5C7XH 3QDJD 3LQAL 3ZDXE 3ILPB 2WSKA 1NL0H 2V2XA 2VDRL 2VABA 3BAEL 3DTXB 3CFBA 4RBPH 1UENA 5FDWB 3FRPG 5GSVB 4U33A 3B2UD 1HH9B 2P47B 2EDXA 5FA4A 3SDCC 1X5GA 3BFOA 1PY4A 4LCYB 4JDTH 3P0VL 4KUCF 3RX7A 1R6VA 2H26A 1NBVL 3U0TA 4RZCA 2H3NB 4WI8A 4F58L 2IAMA 5D2LB 2F74A 3QIWA 3D18A 2CDGB 5L88H 4WI5A 1A0QL 5J89A 2OL3L 2J6EA 2YPLE 5DHXB 2AJVH 4NC2B 4PV9B 3RL2A 2R29L 5TFSL 4XC3H 1I85C 1JPST 3QIBC 4NZDA 5IK3B 1A22B 3DECA 4YHOL 3S3JA 1MIEH 2HFEA 4YE4L 5DFVC 4PUBL 5GGQL 1ZTXH 2A9NH 4I3RL 4POUB 2ZUQC 5AAWA 3F62A 3HI6H 4X5LA 4XX1G 5E1HB 4BYHA 3VFSB 1C5DA 2AJ3A 4FFZL 4OQTL 3VFNA 5HI3D 4BQ9A 2F54B 1GZQB 4JRYA 1F00I 1HI6B 4BKLA 4HKBB 4ZQKB 3GGWB 2ADIA 3QXUA 4N9GB 5F7HA 3QYCA 5DTFA 1P4LB 1MRCL 5DQJA 5F7YC 4Y0GA 2VDNH 3LRHA 3T77B 1OGTA 3UTZB 3MLSH 5HYJB 1BWMA 3TVMA 5K9JH 5DUMH 3FQUB 1KGCE 4OZ4A 1XCTB 5TE4L 2D9CA 4ODVL 4OZHB 3D25A 3WJJA 1ZE3C 1OM3H 2XPGA 5FKAB 1ACZA 3K8MA 1F8TL 3LKRA 3LN4B 4JVPA 4LCWE 2GW5A 4XI5D 3O8XB 3MLPA 2YEZB 4H88L 3CC5B 1S7UA 1F3RB 4UBDD 3I3BA 1ZGLA 4JY6A 4OLYL 1SEQL 2BVYA 5D6CA 3RA7L 3MQIA 5I74C 5C0BB 2A74A 2BNQD 4AIZB 1D9KC 4L9LA 5EA0L 1RK1A 3QUXC 1DUZA 2YD3A 4OFDA 4PLJC 5LGHL 5GISL 2EDWA 4OLVH 1NLDH 3HG1D 4ZFZA 4JZJC 3SN6N 4O4YH 1T83C 3QNXB 4WWKC 5SX5K 3V2AR 3SKMB 2EXWD 4UUJB 5E8OB 5M94B 3LKOA 2ZUTA 2BSTB 3ORJA 5EUOB 3ARPA 4PGDA 2X5PA 4Z7UF 1U8NB 4M5ZH 6FABL 1AR1D 4F7TA 1CF8L 2NY7H 3ECBB 5EB9A 1IEBB 5J1TC 4GQ9L 5SWZD 1UM5H 2A6KB 3BEWB 1OCWH 3CZFA 1CLZL 1UEYA 3UYOD 3L3IB 4NQSB 3P73A 4OF8A 1JGVL 3O3AB 4U2ZA 4BSVB 4HWNA 3CDFA 1BBDH 4LPTA 4Y19E 5E8PA 4I9WD 1ES0A 5IROA 5EIIA 3KJ6H 4AIOA 2UY7A 3CSBA 3L3KB 4Z78A 2DBJA 2R0LH 2OR9H 4QCIA 1KJ3L 1F2QA 5T33H 1MFAL 5JIHA 2DLIA 3MLWL 3QO1B 4G6AC 2EC8A 5J6GA 1YDPB 3OPZH 1CL7H 4Z7UE 4WVRA 1RZ7H 2YRLA 4L4TA 5E8EB 2FEDD 5E8DL 4S1RL 2EDKA 2R0KL 1MFEL 3G6AA 5D1XC 5LXGH 1OAXL 3HFMH 4IOFC 3OJ2C 4PP2A 2B1HH 4ODTL 3X13A 5BV7L 5AWNH 6CGTA 2VTFA 3GMPB 3FB5A 3LKOB 5F6HJ 4X5WA 4CKVX 1SYVA 4U31A 3N85L 5DD3H 4DGVL 3LN9A 3QDJA 3VFUA 3ZYOA 4R97B 1ZHKB 4RAUB 3GSNA 1X7QB 4JREB 5HHQB 3MLXL 1V3MA 3KJ4B 1CK0L 4DUXA 4HT1H 2NZIA 4EI5A 5C6TL 4WWID 3WJLA 3DMMA 5BMFL 1N5AB 1X5JA 2NYYC 3U7AA 3RWFA 4KRPC 2WP3T 3D85D 3U0WL 1GC1L 3EYFB 5C0BA 1X4YA 4XB8A 2AJVL 2PR4L 5IVZB 3LIZL 3KPTA 3V0VB 12E8H 1S9YA 2EIEA 1HNFA 4JB9L 3UPRB 4NP4L 3PQYB 3VA2C 1FGVH 4MD0B 2G5RA 3RVVC 4OD2A 1WZ1L 1RIUL 5I1JL 4W6WB 2FD6H 1YECL 4JRXB 4KDVA 5DMGC 4PRPE 3RL1A 2SEBB 1CFQA 4NFDA 1QSED 3QQ9C 3RIFK 2VLLA 4HC1A 3AB0B 5FO7A 1NGPL 1IGIL 2LQRA 4X4YB 2DWDB 1TNNA 4LRIA 3VCLA 1WCQA 2X4OA 4LF3B 1EO8H 1Z9SA 3FQRA 4KK6C 3NAAL 1GZPA 1MCCA 2Z31A 3QEGL 4ZTOH 3QT2A 5JQ6H 1G0XA 1GGBH 2IQAB 3H42L 4JHWL 5I1AB 4OBRA 2V9QA 1IC5L 4LRNL 1CK0H 1T7YA 1F3DJ 1MFBL 4X98A 5DD1L 1JCKA 3C2SA 2OLDA 3U1SH 3UTTA 1W2KT 3U0WH 2FH6A 4K94H 2DKUA 1WT5C 2A38A 1WTGT 2W91A 4ONHB 1DBKH 3MLTB 1QLEH 2V5TA 2N7BA 4IIQB 2ATKA 5HHPB 3G6JF 4QLRA 2QADB 5IVXE 4OTXL 1WC7B 5I18L 4HF5H 1FPTH 1NMAL 1XFPA 4OAWB 1VPOH 1QLFA 3BKJH 3KPOA 3RDTD 1OSZB 4XWGH 4LQFH 1L7TH 1MJ8L 4JFDA 1AGFB 2Z91B 3HPLA 5MHSD 1AP2B 2PETA 1WTLA 1Y18B 1V3LA 3PHOA 3Q5YA 2KBGA 1EJOH 4YR6A 3Q5OA 3CVIL 2QJDA 4MGXA 2VLKA 4Z7NF 4U6YB 3OZ9H 4BZ1H 1A8JH 1WJ3A 4TPRH 1QBBA 4ENEC 5F6IC 2K7PA 2VABB 3GZKA 3QG6B 4FZEH 3D48R 2OS7A 4HBCL 5JOEA 3E2HC 5KSUA 5FM5O 3RGVA 4Y4KA 1DBKL 4JE4B 4IDJH 3OX8A 3L5XH 4PREB 1EO5A 2IPKA 1K9TA 5F21B 1HDMB 3WNOA 2FEDC 4LLUB 3V5KA 4BELD 4MXWH 4N0UB 4G42A 4K3EH 1M7DA 4U1IA 1YEIH 3KWWB 4JRYE 1MREH 1YYML 2GJZB 1HILA 4KJWD 4KK5C 3TN0D 5DEGB 1A7PL 2UZXB 2Z92B 1KB5A 4HFUL 1RMFL 4QOKA 1G0YR 3ARXA 4U1NA 1T7VA 4Z6AT 3FB8A 3W0WA 4LLVA 5I8CB 1LP9F 4EUPG 2CDEB 5INDB 1CZ8L 3QQNA 1TLKA 3EJZC 3FHQA 4OUOA 4JG0L 4YEFA 1FLRH 1X4ZA 2HKFH 2IAMD 2AXJA 1N26A 3TN0A 1YQ2A 2Z8WC 3UJTH 4LDEB 3PHOB 2VNCA 4LSQH 3L3GB 1GC1H 5DHYA 4LVNB 1X5ZA 5CCKH 4JR9H 4L3AA 1KB5L 2NTFA 4HZLB 5EOCJ 3QIUC 4OFIA 3BPNB 3HZYB 3AY4C 1N6VA 3BWAB 1JYNA 2GY7B 3OR7A 4P2RA 5BS0B 4Y4HA 3BEVB 4Z77A 4BUGA 5BJTA 1PQZA 1YMME 1LO5A 3MRQA 2OSLA 1R3LA 1U2HA 3U7WL 4HJJH 5JXAH 1CL7I 1AXIB 2A6DB 3MYJB 3N0PB 5D2NB 3ARFB 1TCRA 4IMKA 1OAZH 4AG4L 1RFDH 2X70A 3LEVH 1BHGA 4XX1E 2ARJQ 5BCAA 2BVPA 3ULUF 4HXBH 4GKNA 2IQAA 1CL7L 3LN5A 5CEYB 4JQXC 3FQRB 4N8CH 3KPNB 1JN6A 4LF3A 2ZSVB 1L7IL 2OP4L 4OLUL 5C0AD 4MWFB 3RWJB 1QHPA 3ARDB 4PJDA 3BP6B 3BGMB 4LSQL 1J18A 3BIBX 4BFIA 3RRQA 1OB1A 2DQEH 2NY2C 1YN7A 4LVHB 1DLFH 2GSIB 3MA7B 4LHJB 4LIQH 1DEEB 1G6RH 5C8JA 1W0VB 3LS5L 4ZO8A 3D1MC 4NJAH 1J7VR 1RHHA 5A3IC 5CFHA 1DQDH 1I4FA 3RBSA 5CILL 5FHBL 1R3KB 4OF0A 1FZJB 2X9XA 4KC3B 3V6BR 1Q9OA 3QXTA 4HH9B 1VFAB 4PYHA 4C56A 5JNYB 3IFLL 4NYLA 4DTGH 1H5BA 4TOYH 1A2YB 5C2UB 4MJ5A 1UWXK 4R90L 4S1SL 1YPZE 1YZZA 3T1FA 3HE6D 4Z7OE 2LAGB 5JXEA 4OQ1A 1FNHA 3FB7A 2F8VA 4J3WA 4UOJA 3O2WL 4P46D 3D69B 2PXYC 5E2WH 4ZPTB 3ETBF 1JIBA 3CFKB 1DBJH 3QI9B 4NQCA 4WV1B 3VA6A 4JFFA 1OLZA 3INUH 4N8CL 1SM3L 4NHCL 1DL7L 3V6FB 3ARBD 1CXEA 4ORGA 4NNPL 3VWKD 1AC6A 2P5EE 1NLDL 3RVTD 3N9GL 5DSCA 3KLHC 1YMMB 4G6KL 3CMOL 1F4HA 3HNVL 3RP1A 4Y4FC 1BGXL 1NFDA 4XPBL 4NKIH 4CMMA 1ZGLM 3IETA 3BDYL 1QRNA 2OK0L 3GM8A 4P2QA 5IF0B 1GGCH 5I66B 1PLGH 4FFVC 2CIIB 3FAXA 2NY6D 1PD6A 3L3KA 3FQWB 4JM4L 4P46A 1N59B 4UQ2B 1EUUA 1A6ZB 4GG8B 1NGYA 3ZTJH 4OD3L 1I1AC 2X4UB 1UB6B 4XHJC 3WL9B 2YXFA 4G8GD 1WVZA 4PJXF 1TETH 1G7PB 2BSRB 3SQOL 1A7NH 4P9MH 3TWCL 1JHLL 3SCMA 1BAFL 1QBAA 5F96L 5FYKE 2GQHA 3V6OE 1MRFL 1K3ZA 5ESVB 3PDGA 3BE1L 4HH8A 2Y1VA 4EZMA 3CH8A 5HY9A 3GSVB 3CX5K 3HE7C 3X12B 1MEXL 5K9KA 4LFHD 4RNRA 2Q8AH 5T33L 1B4JH 1I9IH 1JMZA 2JB6A 1KPUB 1KN2L 3JWOL 2AGJH 2BP3A 1LEKB 3ISWA 4TN9A 3VMOA 3BPOC 4HIJA 3ZHKA 3EJYC 3IDNA 4WFHE 1FAIL 1N3NA 1U91B 4C58B 4Y5VC 4NKIL 2VL4A 4JDZA 1AHWB 1NJ9A 3SQBA 4GUPB 2AI0H 5E2UH 1QRND 3BISA 3VJ6A 5D7SL 5DD5L 2AQ2A 5EU6A 3OKYA 2HJKB 5FGCB 3OKOB 2EE6A 4AQOA 3MLYL 4BK5A 2BCKA 1YJDH 5E5UB 5GRJL 5EH1A 5D5MB 3MPCA 3OKDA 2JJUA 5FYKL 4DOHE 5C0GA 3PG2A 1U91A 3UJIH 3GMRB 2PCPA 3BIAX 4JLRA 1FGNL 5JOPE 1W72L 5FB8B 2WUCL 1YEIL 3MREB 5C0CE 1PKQE 2D31B 3SGKA 5J56B 3TGXA 4DFHA 4P4KB 4PJGE 5E1AB 4K2UH 2G5BA 4KUZH 4MA3A 4JY4A 5KANI 5ALCL 2QHRH 2FIKA 4QRTB 5C09D 4YHLL 5C0FA 1FC2D 3UDWA 3PGFH 2APBA 3R0NA 4DW2H 5CEZH 4ODHH 1RJLB 3F58H 4Q7DA 1NGYB 3RGHA 5IWLC 3IDGA 4LSUL 3T2PA 4XXDA 4BUHA 5MERA 2N4IA 1LWRA 1G6RL 2H2SC 1S7RA 4NT6B 3RZCB 2F15A 4PJ8A 4M8VA 1LEIB 4PGBB 2ESVD 2ADJB 1J0YA 2GTWB 4L1DA 3KVQA 2MOVA 2YS4A 4XZUA 4GBXC 3KPSA 2D7QA 1XF4A 4PJFA 5A16A 4BFEA 4R90H 1AO7D 4ZOBA 1O5DT 4FTVE 3JXAA 2IFFH 3GMQA 3I9GL 3B9EA 4M6NH 3FN9A 1PG7X 4JFED 2X09A 1A5FL 2W9EH 2O5YL 3JVGA 1V8HA 4LPCA 4LDLB 3MRGB 1T4KB 1MVUB 3D69A 1KIPA 1KJMB 4KK8D 3QO0A 3U7WH 3QXAB 5DFWH 1CDYA 5JA8B 2EDFA 1YN6B 3BUYB 3Q6GH 5HGBB 2G60L 3DTXA 2BOCB 4J6RL 2ESVA 1Y0LA 1H5BB 2P5EB 4U1JA 5ILTL 5L2KE 1MNUL 1CICC 3DX7A 4OQTA 4HIXL 2V17L 2VDOH 1W0WB 2PUQT 5GRVL 2XKNB 2P8MA 3KPRA 1NUDA 1WCBB 2DKMA 2LTQC 5B3NA 1RJYA 3ZDXF 3VG0H 2CO7B 1U8OB 3O41A 3J8F7 3VXSD 1JGVH 5IQ7L 3TC9A 4ZUSA 1A3QA 1XIWC 3KPSE 2AK4A 4V2BA 1HWGB 5D70L 4QHUA 1I1AB 3F7RA 3MV8B 4HEME 4ZS7L 3ET9F 4LK4A 3QDHA 3STZA 3SQOH 3V4VH 2FHCA 4JZNB 4HQQL 4WI9A 4K7PL 1I1FB 3NCEB 3LV3A 3SDXE 3HLAB 2EH8H 4HJ0C 2G9HA 1HQ4A 2AV1B 4H0IA 3F12A 3QUYB 3QWOB 1F13A 2C7UA 1T5WA 3GJFA 4LFHG 3ES6B 3G5YA 3RY5A 1PDKA 1HKLL 5KG9A 2AAVA 3MRDB 4IRJA 4WU7B 2APFA 2X05A 1FSKB 1E27B 4RGNE 4LKCB 2GI7A 5FM8A 4HIIA 1JUFB 2P8LA 3E8UH 5DQDH 2Z35B 2IANE 1HHJA 2Z93B 3GNMH 2FL5B 1IQDB 4F57L 1VACA 2JIXA 3ALWA 3QWRA 3OB0H 4LLWA 3D3VD 3U9PL 1K5NA 4HX1B 3LQMA 4PG9B 1JF1A 1A7BA 2X7LA 3LPWA 2DM4A 5FYJU 1TJIL 4C83B 4GO6B 4HLJA 3FQNB 2GYSA 2HKHL 4IRJB 5K9QG 3HZVA 3MOBL 4QRRD 1H8SA 4AZ8A 3ULUC 3LKNB 3MJ7B 4P2OC 4KFZC 1YMMD 1JGDB 4K3JL 1SJXA 4MJIB 3LRSA 4X4MA 4ZFOA 4P2QB 4G6FD 3VD7A 2YWZA 1YUHB 4FFWC 3TV3L 4V1DA 3RWGB 1FFQA 2AK4B 3P0GB 1JGUL 2CIKB 4LVHC 3AS2A 5L6YL 3WS3A 2HWZH 4D0BA 4NC0B 2V2TA 3FMGH 5H37H 1KIQB 5DQDL 1JJUA 4J1UA 4PBVC 3QI9A 5LGKA 3C09C 3RI5F 1PJ9A 5ICYB 3HKFA 1KBGH 4PJ9A 1T0MA 1XIWD 5FKPA 3QP3A 2X10A 3S4SG 3TIDA 4HXBL 2I26N 1A1MA 1XZ0B 2X44D 4G9FB 5D7LA 4HS6A 2DQUL 1FP5A 2ZOLA 4WUKH 4XP9H 4LCWB 5TGBA 1UM4L 1UGNA 1LDPH 4FQLH 3S5LG 4HK0A 2I07A 3KYNB 3BVNA 1QACA 1G84A 1KIPB 4YAQA 3NPZB 4OLXH 2PO6B 1I4FB 2B8OT 5C0DB 2HG5A 5FOBA 4XP5H 1FBIH 1QO3A 2WWKT 3IAQA 4MYWB 4OZFA 2AS5M 3QIUB 1MH5B 5A16B 5JXED 3A6BH 4NKOA 5SWSD 5DC9B 3VXMD 1S7QA 1UACL 2OM5A 2GTWA 2DKSA 4WWKA 5CHNA 2PW2A 2ADJA 4HK0B 2R69H 4S1SH 4PB9L 1OGAD 1YMHA 2CR6A 2DF3A 1G9NL 1YEKH 2NZ9D 4GMSL 2ZOLB 5DJ0A 2BFVH 4PJ5D 4J2XA 3IFPA 4JFFE 4G8GA 3GBMH 4NCC2 3TIDB 1NCWH 1QTYT 1N7MH 3IF1A 5C0BD 1CGVA 2JIXD 3IFOB 5EC1B 1G9EA 3BQUD 4QRPE 3UTQA 3MLZL 5EO9A 4CAGA 3UO1H 1MCOH 1AGEB 1IGYB 2XZCL 3HI5L 4X6DA 5DVOA 2G5BB 1RK0A 1WAAF 3IXAB 1TITA 2VLJA 4M6OH 1F6AA 1SHMA 3MO1A 1KLUA 3RIAK 5C0AB 1VA9A 4Q2ZB 1NC4D 3GJEA 5F9DC 1R0AH 2CGRH 2YPLD 4N0UE 2PCPB 1X9QA 2XN9B 5DJZA 3T2OA 3AGVA 3DUSB 2VQ1B 1A7QL 4OCXH 3P9LB 1ERNA 2VUYA 3QR2A 4P4RB 4OB5H 4TULH 3JV6B 4Z95H 5FYLD 4NKMA 1X3DA 3WNKA 2VN7A 3OHXA 2RCSL 5I1CH 1K4CA 4P9ML 4XHQA 1JHKH 1VEOA 4XWOC 2QBWA 5ESAA 1TZGL 1XGPA 2VLRB 3VG9B 5F6IB 4JDZB 1MIEL 3RUGB 3U46A 4NO0A 4ZTOL 4JKPL 1XF5A 4JHWH 1U8JA 4JY5H 4NNYB 1QPXA 2E27L 3C08H 4CVWA 3MNWA 3WHXA 4JPWL 1ZANH 1UFUA 1SMOA 4Q9BA 3O6KL 3CFDB 4POZD 2BVEA 2Y7QB 1KCKA 5E8NA 2ZUVA 3RNKB 1H9VA 4HZAA 4IS6A 5F88B 4G42B 1IAMA 2BY1A 4KV5E 5EU7C 4XVTH 4UTAL 3FHAA 3QEUB 5DVMA 1P7QB 4TRPL 3IVKA 4TSCL 3M17B 2NMSA 1R0AL 5JZ7D 4NWTH 3HLAA 1OL0A 4GT7A 4L3EE 1MJUH 1WFOA 2VWEE 1NMAH 1Q9WA 1RZKL 4X4XA 4IIQC 5HDQL 4X6CE 2XZAH 4HJJL 1P4BH 4HSQA 4LRIC 2ICCA 1AC0A 2M2DA 3TF7C 2BMKB 3DRQB 4I0PC 3MJ8B 1A3RH 3VFVB 3MRHB 4KK9C 3VFGL 3E3QC 1U8LA 1XEDA 3GB7A 4XNQB 3BMWA 5HVFB 4K3HA 5DMJB 4OLYH 3B9VA 3GKWL 8FABB 4LGSB 4KJQC 2E6QA 4K2UL 5SWQB 3MBXL 4AM0B 3U36A 1UZ8B 2WBJC 2HLAB 4RRPA 4XCCL 2D03L 4NCDA 4IM8A 4QXGH 3SE4A 5IMMA 1LO0L 2NY1B 4GXUM 5LXGL 2DQEL 3NFSL 1A02N 3T0AA 3LZFH 1QBLL 2V7NA 2GITA 2VB5A 4JGUA 4MS8D 5C6WH 2VDKH 1QVOB 3WXWH 1DR9A 4MDJA 3PWUA 4DGIL 1JI2A 2FX7H 4P3WA 2D7TH 5I16A 4YDJB 3X3GL 2F58H 4O2FB 4J3VA 1JUFA 2P8LB 5H94B 5D1ZC 2BVOB 2NY0D 3RWCA 3AREB 4DVBA 5T5FH 4KRPB 4ZS6C 5AAMA 4K3JH 1BBDL 3P9MB 5ELIA 1HQ4B 5GJTL 3I9GH 4M6NL 1AD0B 4JREC 4LSPH 4CW1A 1VB9A 1SBSH 3HMXH 4WI2A 2O5YH 5KW9H 3PWPE 3MUY1 4TVPL 1YN7B 3FO9A 3QFJA 3CVHH 4JDVB 3PJSB 1NFIA 2P45B 1IGTA 3EO0B 5T1DL 3BP6A 1I75A 2Q76B 4GRMA 4HDIB 5JOPD 3CC5A 4NNPH 4MWFA 3RWJA 3OPZL 2C4FT 4TYUA 1KB9K 5FUCC 1F4XH 2H1PH 3F6LA 3LKRB 4WRLA 1IZKA 5DHVA 2YC1B 5C0FB 4UT7L 1Z3GH 2KH2B 2CRZA 2VLMD 4ODTH 4OZHA 4CDHA 5EULV 3KPRB 5GGVY 5C0CD 1QFUH 4JFEA 4PG2C 5CCKL 5DO2D 5F89A 3BPLB 5HYJA 1S9YB 2V6HA 1DE4B 2Y5EA 2MQCA 5H94A 4N9GA 4P99A 2ADIB 5BW7A 2IG2H 3RWFB 5E00A 5EU3A 4XCNB 3AC0A 2NX5A 3OGCB 5JUEH 4DJMA 5CLWA 1N6QL 2FATH 3U82B 1QSFA 1J1OH 1IFHH 2F54A 2HRPH 1IVLA 3OKDB 4K9EH 3C60B 1UC6A 4X7TB 5FM5M 4MAUH 5CZVH 3VFSA 4M3JA 1HIML 4UIKL 3VXUD 1MFNA 3FO2B 4WWKD 2RFXA 4RGMB 3K8KA 3ZDYF 3BP4B 4P5KB 3GMNB 5DR5L 2NNAA 3PXHA 2IBGA 5HGDB 4WFGE 4K8RH 4APQB 4S0TD 1A6VH 3BKJL 5IK3A 1XF4B 3O6LH 5TE7L 5IKCB 4H20H 2H8PB 3K1DA 4JZJB 3FONA 4UT7H 3T08A 3BH8B 2QSCH 1OGAB 4M61A 4JCLA 2WIIB 3X3FL 3GFUA 1I7RA 4L8SC 5D6DC 1HYSD 3GB7B 5E2UL 4X6FA 3DI2B 5FYKD 1F90H 2CK2A 3QQ9D 5JIPA 4U0RC 5EZLB 3GSOB 4M7LT 2NW2A 2APVA 3GSQB 1INQA 3ARQA 4JEGB 1ES0B 5EIIB 4JJHA 3KYNA 3RVVD 1J8HD 1QQDB 1NCAL 1KB5B 3KYKH 4IMKC 2VDMH 3MGAA 5B8CB 4HS6B 1UCTA 3DYPA 4JR9L 1A1OA 2QQQA 4XMPH 3MACL 3ZE1F 5DD0H 4K9EL 3F7PC 4GW5A 2K9UA 4L8BA 3ARVA 1PZ5A 4OZHE 1KULA 1N0LA 5EZLA 3DPBA 3IDXH 3TZVD 5I75C 4ORZC 2P42B 3KLSA 2OL3A 3OAZH 2GT9B 5I1DA 5FGRA 3S97C 1FNGA 4M5YL 3QXWA 4D8PA 5JW4R 4OLZL 4DUVA 4XMKH 1R3IL 3THMH 5L9DL 4KKNA 1IKFL 5I6XB 4Y5XA 2A6IA 3E3QE 5IOPB 2DDQH 1T80A 4R4ND 5AZEH 2VYRE 3PHQA 2EEDA 1FZMB 4XNMA 4GKSB 3RGVC 3QEUA 4YR6B 2DLHA 2DWEA 1EHNA 1Q1JL 1A14H 1KELL 4PJ7A 4FQXC 3MRJA 3QXDA 1JPTH 3QNZA 5BVPH 4OJFH 3ESUF 1HH6A 4DOHB 2R9HC 3DETC 4TTGA 1J0HA 43CAB 25C8H 4HXAL 5J57B 3QDGE 4PGCA 3MUHL 3SGJA 4I5BA 1X6LA 1I7TB 4IRJD 4KAQH 4DKEH 5FIEA 4HGWB 1P4LA 1H3GA 1A0QH 4LSPL 4K71B 3FFCE 3FRUA 5I2IB 3WFEL 4HKBA 4WEMB 4Y4FD 1KCSL 1P6AB 3QDJE 1NDMB 1E27A 4KKAD 4UU9A 2HT4C 4S10A 5JORA 3MJ9L 3TH4T 4MXVF 4LLYB 4U0QB 2YSSA 1QYGH 1KXQE 1Z5LA 3C5ZB 4X98B 5C09B 5IJVB 3JV5A 2CIIA 5DJZB 2W9LA 1KCRL 1YY8B 2XN9A 5IF0A 1G7JB 4KDTA 1F3JB 4R9HA 2VWEC 4ZS6D 5IMOA 3QCVL 4DEPB 4JFOB 4XBGA 4NSKB 2DWDA 2HT3D 4Q9RH 4XPGL 4G8FA 2KL6A 3O9WC 3GK8L 1IKNC 4ZO7A 3K81A 3QNYB 3LRGA 5TDNB 1CBVH 3ZDZE 4KPHL 2I24N 2AKRB 4P23A 3QHFH 2J3SA 4Z7WA 5EOQL 3H9HB 4JFFB 4OZGF 1F6FB 1GGCL 5DUBA 2EE2A 5FYLL 4EDWH 1FO0L 2IAMC 4NZRL 2HTLD 3PWUB 3BEVA 4Z77B 1T7ZA 1NKRA 4HPYH 2MSPA 1RV6X 3TA3B 3EJZD 1G9MC 1WZMA 2D0GA 1DQLH 5HGBA 4XXCA 3OMZA 1RULH 2EZ0D 5IUSA 3R8QA 4U7KA 1N5AA 1NKOA 1YNLL 3MRJB 3EOAA 2FRGP 4I9WE 3QXAA 2AV7A 5TF0A 1D5XA 2DWEB 4PJ9B 5CINL 5E24E 1R3HB 1RHHB 5C07B 4MXQC 2HVJA 1BF2A 1VCAA 4XNQA 1N4XH 4PRDA 5KSAA 3SDXA 4YGAB 3HCVB 1TJIH 1WFTA 3QEHB 3G6AB 3NCJH 4CU7A 1S3KL 4IJ3B 4XZUB 5J12C 1MWAL 5E08H 3TT1L 1QHOA 1A6UL 3ZHLA 1MQ8A 3IDMB 4X7SH 4TTDD 4YXHL 3KYKL 2DLFL 5J6HB 1RJCA 1BGXH 4XPBH 4WFFE 5KS9A 3KS0J 3FT2A 2VC2L 4LIQL 1T21A 3FJTA 2VO5A 1V7ML 1DN0B 5EORL 5DGRA 2X4PB 3MBEA 4E0RB 1I7ZB 1RUPH 4K7FA 4U1LB 4D0DB 3B5TA 4L3CB 2HH0H 3MXWH 1F11A 1MJUL 3BW9B 2W0FA 3ULSB 1A4KA 4HGKC 4OF6A 5FUOH 4Y1AD 1JWMB 1IGML 5KSUB 2Y6SC 4FRWA 5I8EB 3W2DL 4BQCA 2NY6C 1TZHA 1VACB 3LHPH 2P1YA 2QSTA 3CGTA 3OBAA 5CEZD 2ZG1A 3MLVL 4FN0A 1T0PB 4L9LC 2M1KA 4X6FB 1YNTB 4EBQL 5DC0A 1DBAH 2UYLA 4PJIA 4NN6B 3LEXB 4L4VA 4YHLH 3ZO0A 1DP0A 4K8RC 2EXYD 3CLEL 3SDYH 3V0AC 4K7PY 1CDGA 4OFPA 2VQ1A 3RPIA 2FJGB 2DM3A 5I1LB 3FQNA 2B7DT 4Y5XB 1KG0B 4KJQD 2EDQA 4UDTB 1D9KD 1TCMA 5IHUH 4QHUB 2Y6SD 5C6TH 1RUQH 3SO5A 3S35L 2ZUUA 4PLJD 3HR5A 4N9OB 3DV4A 1G7QB 3NN8A 4M43L 4N8VG 3S34H 4Y16A 4HKZA 4NQDE 2OQJA 3T2NH 1B6UA 4FQJL 3FO1B 3TYFB 4KMQA 4JN1L 4O2CA 4A2LA 4G3YL 1EBAA 2J88L 5LWYL 2EECA 2JJVA 1BZQK 1TTGA 5GJTH 1DDHA 2ARWA 3F12B 3QUYA 4P5TC 2WZPD 4GG6B 3DWTA 4NKDA 3BH9A 2DLEA 4OZIE 3QPQD 4UV4L 4D94A 3DMMD 2BOBA 4MMXC 4X6CA 5B39A 4QRPA 5DRNA 5LGHH 3TNNB 3BOVA 4OKVB 3E6FB 4V1DE 2AJ3B 3S35X 1T4KA 3UJJL 1X4XA 3TYGL 2ZNXA 4ZAKC 4LOUD 3RDTC 3MRRA 1GGBL 1PX4A 3H42H 5DHVH 1U8OA 2SEBA 1LO3H 1LEGA 3CSPA 3HC0B 2OTUB 3PNWB 2UWEF 5C0DA 4ZFFA 1CLCA 2PO6A 1SJVA 4UOW1 2CPCA 2MCPH 2D4DA 1IILE 3HMXA 3DUUB 4FFYH 3BQUC 4ZS7H 2DM7A 5JUEL 3T09A 2CDGA 4ZFOL 3BN3B 2FBOJ 5E2TH 5EWIH 3GMNA 4AL8L 3TA3A 5JDSA 1YN6A 2DQTH 5HGHA 5BXFB 4YHYB 5GZOC 5CUSL 3KPQB 4WO4B 1A4JB 3RVXC 3JTSB 4JO4H 2WUCH 3ME0A 5IW1A 5EZOL 2ZCHH 4KRPD 2CSPA 2KQNA 1LNUB 2BZDA 3PP3H 1JNLH 4WNQB 5AD0A 4P59L 3T1FB 4GLRI 2VDQH 3UTPD 4RIRA 5C08A 3CH1B 4LSTH 3SGDI 5JNYA 3I3DA 1OP5H 2XN9E 4D2NA 1OAYH 3HAEG 4FFWD 4XP1H 1AKJB 3WKML 3CMOH 3HNVH 1HKFA 5C3LD 4TQEH 3L1OL 3BO8A 5HHXL 1AY1H 5DD3L 4DGVH 2X4NA 4Z0BH 3P3YA 3QDGB 5K9OB 1OB1B 1FRGL 3WCYA 4NJ9L 3CNKA 4OM0L 5TDOA 2QSVA 1A9BB 4OT1L 4S1DD 2DM2A 2I60L 4FQ1L 3PJSA 4QRPB 5DRNB 3TNNA 4X9HA 4J7RA 4NPYA 1IGCL 1UWEH 2HJKA 1B9ZA 3O3AA 4UNUA 4NQSA 1AD0A 4GUPA 4MHHG 5EBLA 2Y5TB 4YHYC 1FNEA 2A77L 4Z7VF 5TDPA 3QXVA 4I5BB 4ODSH 3IDXL 1N3NB 4I18C 5LKNA 1QSFD 4ZAKD 1UKQA 4Y19D 2EIBA 2NW3B 1NMCB 1I9EA 5H2BA 3BQUB 4RMVA 4XNYL 2NQCA 3CFDA 5IVNA 4OZIA 3CXHJ 1PQZB 1TQBC 2NY0C 2FECL 3MNWB 3G6DL 5DRXB 3EDKA 4PJBF 3V5DB 1JV5A 2V5YA 3SDYL 4MAYD 1X7QA 4FQQB 5EG6C 4XNMB 3UZQA 2X1OA 4GAGH 1OP3H 1D7FA 5F7DB 2R56H 1P53A 3RDTB 1G7PA 2Q6WB 3STZB 5IEHA 3ZTNH 2D3VA 1OSPL 4G5ZL 2QKIB 1LDPL 3BZ4B 4GH7B 3O0RH 4ZFGL 3TNMB 1MI5E 5E99H 4ZUSB 4IRSD 4WDIA 5C0RL 1ADQH 2A0LD 4M03A 1U8QA 1CT8B 4NQUA 2AXHA 4WTWA 4MA1B 1L9NA 2MNUA 4HS3A 1NEZG 1Z9MA 3H9SB 4U7MA 4JKMA 5GGVH 4HQQH 1CDCA 3MC0A 2X4TA 1BPVA 3MRHA 1BD2B 4GW1A 4TUJB 5F6HI 4ZG1A 4QTHA 1J88A 4Q0XH 1JK8A 3T77A 5FCUL 5B4MD 1PG7L 5GJSH 2B0SL 3FN0H 1JZ6A 1QEWB 3LPGA 3HHRB 1GAFL 1A7OH 1RURL 4CN1A 4GBXD 3F58L 3UTSB 5F88A 5IM7A 1R5VB 1DQQB 1TVHA 3G5VB 35C8H 2NW2B 5BXFA 5HGHB 3N1QC 4Y2DC 1BOYA 5J3HD 4ODWA 2F53D 4HAFA 4YHPB 3K74B 1RZJH 4YH6A 5FHAH 4FZ8H 3CLEH 5J6HA 3PIQA 1ZT4A 2MKLC 4KKCC 5CHNB 2VZ1A 4NN6C 3PV7A 4NNXA 1RK1B 2Q8BH 3O2DA 4Z9KB 2VLRA 2IFFL 4XNXL 4MX7B 3NA9L 3DSFH 4XCYA 5IT2L 3TIEA 3MRRB 2UWEA 2VXVL 4HKJA 4FQPA 1YPZB 4X6BA 1T6WA 1Q72L 4OV5B 5DZNA 5MP6H 5DMIH 3ABZA 5EN2A 1P69B 4N5ED 4N0RA 1QSFB 1NDGA 4HEPG 1OY3B 4OCYL 3RVUD 5EIQA 2X89D 1ZA3B 4LLMB 1S7SA 3GJEB 1OAXH 4OLVL 2VQUA 2YPVL 4G9FA 4KKBC 3X3FH 4Y88A 1OAYL 2R2BA 1Q9LB 2VLJB 5FKPB 2MWCA 4X4ME 5EOCL 5L2KA 5CGMA 5JLZA 3INUL 2WAHA 3WFCH 4Y5YA 5LVEA 5TE6H 5GS2H 4N5EC 1FYHB 1WUNT 4QXWA 5J12B 3W9EA 3BAEH 4X8JB 3OTTA 3HMWH 2BDNL 5I19L 3IFNL 4NFCA 2GJ6D 3MACH 3ARDA 4OGZA 2VITA 1J0IA 3L9RB 4XPTH 3MRKB 3K0WA 4JB9H 3MJ9A 3OKKA 4NBXB 1HQRB 5D7KD 2PF6A 2VAAA 4H26B 5AUMB 4AT6A 2LVCA 4RFNC 4ONGH 4PJDF 1YMHB 5BRZA 3MZGB 1C08A 1VGEL 1IJ9A 4R6UA 3TO4D 3QI9D 3WS6C 4YPJA 1U8PA 4KUZL 1MCQA 1FNFA 4XNYH 3LEXA 1E4JA 1CFQB 4OZFB 2NY1D 4EN3B 2X7LB 3LOWA 5C9KA 3RIAF 4PPTA 5FYKU 5JW4M 5LGJB 3IS1X 1CXFA 3W0WB 4I3RH 4U1NB 3WEXB 1K6QH 4FQCH 3M1BA 4YNYB 1WWCA 2KKQA 4HUKB 3EFDH 3FQXB 1YA5A 2Z92A 4URTB 1GIGH 4H8WL 2H9GB 2GEEA 4HIEB 3VXUA 5DMGD 3WKMH 5I19H 1G7MB 3CK0H 4FQ2H 4J3TA 3RVWC 4B7IA 1OW0C 1FDLH 1UQSB 2AK1H 4N0YL 4YPGA 5L0QB 1T5WB 1QLRA 1UZ8A 1NPUA 4HGMA 3VWJC 5FECA 1AE6H 4JQXA 4NQEA 1U3HB 3O3EB 1VADA 2EDTA 1RPQA 5D4QA 2R4RH 3C5ZC 4RFEB 2EDYA 1BQLL 4XBPB 4OIIH 3ZT5A 4ERSL 4EDXA 4HUXA 4AEEA 4WJ5B 4KMTH 1S7XB 5HI5C 2UY6A 1LE9A 4L5FH 2IEPA 4LIQE 5GGTH 4Z5RA 5I1DB 1OAUH 2ZUXA 4PJGB 1T66C 3HRZA 4NO2B 1U3HA 2YD5A 4PIRF 4GRWH 5IMKA 2JCCB 2XOTA 3FB7B 3EO9L 1TVDA 3UEZA 4ZD3H 2YMXL 3T0XA 2P5EA 3HPLB 3WJJC 4KTEH 4S1RH 2ESVB 5CBAA 5AZ2L 1FJ1A 2H9GA 4GFTB 4LVOB 3ARDD 3OX8B 5GGSY 3BUYA 4RX4D 1K8IB 5CJQL 2ENSA 4OAWA 4QRSA 1LP9E 4YNYA 5HGGS 2F8OA 1RJZB 3GM0A 5D1QC 5D2LE 4MD4B 5IG7B 1FC1A 3SE9H 1FE8L 4F7PA 4TRPH 2QQKL 1ZT7B 4X80H 5F9OL 4ZFGH 4M61B 3BHBA 3FOLB 4MXQD 2FSEB 4WGWB 4QRRE 2RR3A 2J12B 5D2LF 2FD6L 3AM8C 2NX5D 5F1SA 2XRAH 1IFHL 4JZJA 5CJXC 4XBGB 4K3DH 2G9HB 1E6OL 3FRPA 1C16B 2QSQA 4AL8H 3R1GL 1YY8A 4M6ML 1HQRA 4GKNB 5C0AA 4HG4J 4I2XA 1VEMA 5JHDB 2IC2A 1UKTA 5EZIH 1MHPL 3S36H 3CVHL 5CIPB 3ZKMC 4OFYD 4OZGB 3Q48A 1NC2A 4NRXA 5HDOA 5EU4A 4XCNA 3KPSD 5D5ME 5GSRA 1KEMH 2BVTA 2JB5H 1CDJA 3KR3L 3S37L 3B6SA 4D9RD 2VIRB 5FO9A 2J8OA 5F7FA 3UTTB 4MA3B 4S1QL 3KXFD 4Y2DA 4YZFE 1KNOB 1NC2D 3OB0K 4XMLL 2O26U 4ELMB 4PRPB 5JTWA 2R2BB 4U49A 5ICXB 5IVZA 3SKNB 1AKJD 4YBHA 3S96B 3BX7C 1XF1A 1NGWA 2ED7A 5SWZB 4LMQE 2NTFB 4HZLA 3T65B 2IGFH 2ADGA 2NX5E 3M07A 3EHBC 4XB7A 2ZKHH 1A7QH 1AD9A 2FZ3B 2ITCA 3CMGA 4Y4HD 2B20A 2Q8BL 3TCLB 2AJUL 3VCLB 1PAMA 4AEIL 5D5MA 4FG6C 3JV0A 4PJHE 1G7IB 2ZP0T 3ZKMD 3IDJB 4OLWH 3SOBL 3P2TA 1TVBA 3A6CL 2VDLL 5IOPA 2RBLA 3FB5B 1I1CA 3BGFC 1XR9A 4GRLA 4MX7A 1SEBB 5GS1A 3C60C 4PP2B 3FT4A 1T7XA 4FABH 1NBZB 4IOSD 3WO4C 4YAQB 1WITA 4UAOB 3BD5A 2A2QT 3UPRA 5HJ3B 1KTRL 5BO1H 3W5MA 4C54A 3BIKB 1P1ZB 3C5SB 1EEUA 3C8DA 5EO0B 4LCWA 1JPFB 1CGSL 3V52H 3X12A 5HY9B 3OV6A 4MNQE 4LCYA 2ERJB 3BKCH 5F7LB 3EYVB 4P2QE 4U1KA 5HHQA 3ZE2E 4LLQA 3RWEB 4PREA 5EUOF 1UCBL 5F3BA 1XR8B 3HZMB 1FIEA 4PJCB 4IDLA 3SKOA 4OGYH 2Q3ZA 4L3EA 5GGUB 4BH8B 5IMMB 3GJFK 3QQ3B 2OTWB 4G43A 4I13B 3S8WA 2C3WA 2L7JA 2XA8L 1X5LA 4PFEA 4UQ2A 5DJYA 5C0IA 4AM0A 3O2VH 4M00A 1Z2KA 4K3EL 4WUUD 5FYJD 4FQIL 2VZ3A 1YYMH 4JLRB 3LRSB 4LLQB 5ACMA 3NGBB 1MFDH 4OFYA 5FV2A 1NFDB 1RIHL 2VLKB 3L7FA 3GSUB 1IL1B 3MRMA 1F4YL 2I9LB 5DSCB 2H8PA 5DJXA 4LKXA 5IKCA 3AAZA 4PJCE 1G6RB 4WFFD 4NZUH 1UJ3C 5F1OB 3LAFA 4XMKL 5EO0A 4PP1D 4BM7A 4H25B 1OPGH 1QBLH 4EXKA 3GSWA 5E9DB 1KIRA 5JR1L 1K5NB 3B3IA 3UBXB 1E4WL 4L8CA 1JPGB 3TBTB 1U8MA 1ZSDA 5HHVH 4XPGH 3H7LA 1R5IB 32C2B 4JM4H 1OOAA 4NOBA 4IMLA 3D25B 2HN7A 4NO3A 4GAYA 3HC3H 4PRAA 3BDBA 1M7IA 2FX8H 2Y4SA 3JBG7 1TQCB 1VFAA 3O6FD 5CWSA 2HMIC 3TVMB 4DK3A 3K2MC 4PJEA 1JI1A 3WXVH 4PJ9D 1E6OH 5DK3A 5DK0A 4U6XA 1G7LB 3KHOA 3DIFB 4N68A 5ADPL 2WWKO 5IBUG 1I1FA 5D6CB 4RISL 2EYSB 5J4MA 1T20B 4QHLB 5GS3A 1K4CB 1CGWA 2BC4B 4JM2F 3DURA 1FV1B 3TA3D 4I3SL 2Q76A 4GRMB 4HDIA 4JZOB 2R0ZH 5ENWA 5FO7B 4DVRH 1DL7H 3IJSA 5C07D 1VFOA 2GIYA 3FB6B 4V1DD 1MSPA 3H0TA 2R9HD 4PLKC 2FNBA 4MJ2A 2NXYD 3VXSB 3VRLE 2G75B 4LCUA 4YO0A 4IRZH 2D0HA 2NXZB 4ISVA 4M1CC 4YC2B 1A1NA 3MLYH 1BM3H 5GRJH 5C08B 3PL6A 1XT5A 1HZHH 5ISZE 4NC1E 1UWXH 4MQ7A 3VXMB 4OIAA 4YBLB 3ZE0E 2HVKA 1BEYL 1TENA 3WXVL 4FQHA 3FO0L 3JTSA 2HT3C 5T3ZL 5IHZA 3RHWF 5KZCD 5JIIA 3A6CH 4PJ5B 3NCBB 2DIAA 4KHTH 4Y1AB 3KXFB 4YHZH 1AIFB 5HGAA 1MCPL 5D8JL 3VI3F 1OF2A 1T1WB 3GMOB 1G9MH 2PTVA 3UTTE 1XGUB 1QKZL 4Q9QL 4CJ0A 4C4KO 3MGOA 5I1GL 3C2AH 3VRJB 2P44B 4MVBD 1DSFH 2C4FU 3EO1A 1LEGB 4NT6A 2DTML 3PWNB 1LP9B 4PJ8D 1Q8MA 4EIZC 4OF7A 1XGQA 1K6QL 4FQCL 4KK8C 3DRQA 2HTLC 5DURD 1I3VA 3PUCA 1OP9A 3ARGB 5I17A 5FGBC 3ROLB 2FGZA 4G6JH 4PJGA 5ISZA 1YQVH 4ONFL 2FJFA 4Z7VB 2V2XB 3RIFF 2GJZA 2AK4D 1S7XA 2WWMC 1KTLB 5L8KB 3MXVH 4FTVD 1SJEB 2X70B 4NKQB 1S9VB 5IV2A 3O2VL 2DJUA 1EERB 4M93C 3RPKA 4PLOB 4M1CD 1NFKA 4PB0L 5DUPH 4WHDA 3ARFA 1U93A 5CUSH 2V2WB 3TYFA 4G9FD 4WI6A 4X6DF 3NIDF 5HDQH 2NXYC 3OAZK 1SYSA 3WE6B 4EQ2A 1G9ML 5E03A 5E94B 4P9HL 5E6IC 1T03L 3REWB 1YNLH 4O51A 2CIKA 1DBBL 3F8UB 5C0JB 5L7XL 4ZUVA 4NRYB 4XVSH 3FQXA 4QRRA 5IJKA 2PO6C 4M62L 1MPAH 4EBQH 4P3CH 3SE3C 4KDWA 1JRHL 4XRCA 3O8XA 3WNNA 1K3IA 2R2HB 5MENE 1AP2A 1NBYA 1AGFA 1YPZF 3X14B 3TBSA 1T1YA 1LD9A 3CFEB 4P0DA 3MO1B 4HXAH 2EKJA 1CFVL 3HPJA 1B90A 1RK0B 4P2CG 4P57A 2GUOA 1HIMH 3RGVD 4RMUA 2UWEE 1OGAE 3PWLB 1HHJB 4LP4A 2IBZX 4HCRA 1ORSB 2ORBL 3W11C 3SCMB 1BQUA 1HYSC 4BKLB 5CBEB 3DX8B 2P24B 2ICWI 3U9UB 2XRAL 4U1SB 3SDAD 1PEZA 4KTDH 3REWA 5IR1A 4R0LA 1M7DB 1JMXA 1E6JL 3CD4A 1SBSL 3IRPX 2J88H 4ZO6A 3TBWA 5KS9B 1JWSB 1IM9D 4U1GC 4U3CA 5CKAA 2V2WA 3G5ZA 1UB5B 4E41B 4U1GB 3DUHA 4JFDD 4PBWD 4XNUL 1QSEB 1HE7A 1T1ZB 3PGFL 4DKAA 3OJMB 1ZLSH 1I8MB 1UT9A 3ARGD 2VLLB 1MAJA 4DAGL 3C8KB 1NCAH 4UILL 1BFVH 1J1PL 4PGZA 1G7HA 2CH8A 4HV8B 5IFAL 3SCMC 3U0TB 4S2SB 2OCFD 3V4PH 4MQTB 4X4ZA 3C5JB 4NRZA 4ZPVA 3GMMA 3Q1SL 3HNSH 2FCBA 3I6KA 4ESKA 4ZSOE 2W0LA 4EI6A 1FVDB 3CCHA 3EYUH 5L88L 1I8KA 3EZ8A 4HMEA 1A2YA 4ODUB 4XGZA 3D9AL 1MOEA 5ACLA 1A1MB 5I1EL 1MCNA 3QUYC 4P5TA 3G9VA 3NPSB 4MHHI 4JFPA 5A3ID 4U6VL 4A6YL 4XC3L 4M7JL 5JPMB 1YEJH 1AIFA 5FV1L 5C70A 4OUUA 4M4RA 4J1UB 4ZTPH 3FFDA 2AKRA 2ATPA 2GJ6E 3QQ4A 4PJ5A 2E8YA 3LPFA 4Y19B 4FXLA 1AFVL 3VH8G 4P59H 1IM3A 2EYRA 3H2WA 2VH5L 5K93A 4H5SB 4LSDA 3VFPA 2VDQL 4JPIB 1U2CA 1NUGA 1WFNA 1DUYA 3DX8A 1U3JA 3RWGA 3DXAB 4QXUL 5E6IB 5IMOB 1U41A 2JELL 4C4KT 4U05A 2O5XL 4F7CA 1CE1L 1CICB 2NXYB 1I3UA 5JPNA 4UTBH 2BVPB 1FL3A 1K4DB 3CXDH 5JW5A 1FVEB 1NAMB 4HC1L 4RAVB 3DNKA 1H5BC 2X4SA 1BJ1J 4NBYB 1UVQA 4GLRH 5INCB 4Z76B 8CGTA 1D5ZA 1Q72H 4JG1H 1BQHA 4DCQB 4IRSA 2YPLA 4X9BA 5DMIL 5SV4A 4RGOL 4JHBA 2X9WA 4XNZB 3MUZ1 1BBJA 4U6VH 2CJUH 4ZXBA 3FT3B 3SDCA 4OCSH 1YEJL 1A64A 4JRWA 1D6EA 4LSRH 3W9DB 1T04A 3IAGC 1D6VH 3HZYA 1QFWM 5HPMA 4MAYA 1N6UA 5TF1H 5BS0D 4GBXB 3VXPA 3WLWD 3DBXB 4ZFZB 3SGEI 5HXMA 2B2XH 2Z0BA 1MQKH 4EI5B 1OP5K 1EH9A 3L3HA 3GK8H 4HWEL 2AV1A 3RZCC 5CEZE 2PYEE 4FP8L 2OR7A 2IH1A 2DBLL 2FYYA 4KJYA 4JZNA 4P4KD 3GMPA 1T04B 32C2A 4JPVL 3NIDE 2H41A 3VRIA 4HBQA 5IV2B 1AQKH 3IDIA 4PGEA 3BZEB 4F80A 4RGNC 4JG1L 2H32A 2Q3AA 1J1XL 1BQHB 4DCQA 4POZC 4NPYB 3UZEA 1WCBA 3KPLB 2DS4A 4TUOA 1X5IA 4P4KC 4DUWA 5FO8A 2X4SB 4XCFL 3RUGE 5C0CB 3VMPA 5IBTL 1QSVA 2WM0A 5CGTA 3MRMB 1KJVB 2HYMA 4GW5B 3BKYL 1RZKC 3KYOB 3LB6C 4N5UA 3S3PA 5CD5C 4X8XA 5DMYA 1VFBB 5SX5H 1FAKT 3IS0X 2AQ3A 3TFKC 4ELMF 5J8OA 3L7EB 1UB6A 3ULVE 4KK9D 1L0YA 3TYGH 3ALPA 1D5IL 3RU8H 5EUOA 1MCOL 5IGXL 3LS4L 3JWOC 1H0DA 3ILQC 3WUWB 1CD8A 3NBNA 3WUWG 3GMQB 2FJHA 4WHTA 1AHWC 3DGGB 3QUZC 3MRPB 4PJFB 4JFDE 3RZWA 4JFPB 2E9JA 1A7RL 4PR5B 1UXSA 3JZ7A 1OD7A 1TQCC 1F8TH 2D7PA 3RY6A 3OKEB 5GGTA 2WLZA 3HE7B 3QUXD 4JAMB 5D70H 4PRBB 1R3JA 2P7TB 3PHSA 4JFYB 1LILA 3MJ6A 1JHKL 3PDOA 3GKWH 1PSKH 4DN4H 1GGIL 1LK3H 1IAII 4ZTPL 2YZ8A 2DJ4A 1VHPA 3MLTA 3KYMA 1BJ1H 1MLBB 2DQCL 5IB3A 2APWA 3KGRA 4HWBA 5HD8D 4P23D 1L7IH 1UJ3B 2OP4H 4OLUH 4NWUL 5DZLA 3L6FB 1C1EL 1CG9B 2BOBB 1FFOA 2YRPA 2R1XB 3MREA 5FYJE 5GZND 35C8L 3GGWA 4HMDA 3EFDL 1JWSA 2CDFA 2AVGA 4ZQKA 4Y4FB 3SKJL 2HT4D 3T65A 3STLA 5CSBA 3OAUH 4PJEB 3KYOA 3TJEH 1LO2L 1CFNB 4NGHL 4PRPA 2NY4C 4G7YL 4YFDB 2ZPKH 3VXRB 4Z7WE 1WICA 5ID1A 2XFXA 4PY8J 4R7DA 4P2YA 4UQ3A 3B9KA 4QHKI 1BQSA 3K80A 3TO2A 2ZSWA 4WV1C 1FNLA 3GIVA 1EEZA 3JVGC 3V4PL 3PXJA 2PXYB 4FQJH 4Q6IC 5C08E 1G7QA 1TFHA 2J8UA 3IJHB 3B9KD 2VKXA 3WJLC 3KPPB 1GGIH 2Z8VC 3PQYA 5MENA 2ERJC 3VRIB 4JPKL 4KMTL 3MLWH 1VGEH 1F4YH 4JAMA 2ZG3A 3B9DA 1ZVSB 1TMCB 3MODL 3O4OB 1K2DA 4JY5L 1U6AL 1WBZA 3H3PH 2AK4E 3WNPA 3VXOB 1GGUA 2BFVL 4MJID 2P46B 4ETQB 2YD4A 2Q87A 4MDJB 3WO4B 5L7XH 4JVUA 3SDDA 7CGTA 5FAAA 3E0GA 3SJVE 1DTUA 4F7PB 2YUXA 3GI8L 2DRUA 4RQQA 3DX6B 5FA3A 5HHNA 3MNVB 1U8HB 3MYZA 4HS8L 2NY5H 1K8DA 3I2CH 3O4LD 3TPKA 5GS2D 4GG8A 1JHTB 3ARZA 5JQHC 2GSGB 1GJIA 2V9TA 3SKOB 5BZWA 3H3BC 5F9WB 4M6AA 4NQDB 9CGTA 4W70A 5JO5B 4QCIB 1F11B 5HHOE 1NCDL 5DJCA 1UVQB 4KI5F 4D0DA 3MBEC 1U8LB 1KJVA 4MXWL 4DKFH 2A83A 5BVJB 4TNVK 3L95A 3WD5L 5D2NC 1AI1L 2B1AL 4QT5A 3AMKA 5FO8B 2AXFA 1J8HE 4N0CC 3I3EA 1NCUA 3SPVA 3DETD 2GTZA 3JWOH 1OT2A 2AJZB 4GKZA 3O2DH 1IEBA 2WMPA 5IMLA 1ITBB 2DAVA 3KWWA 1I1AD 3MV8D 5C0BE 4PRDB 2BRRL 1F45A 4M1DL 4JHAL 1I3RA 1RZJL 5FHAL 1U42A 2BNQB 3C9NA 4LAJH 3DV6A 1ZVYA 3I02A 3OKLB 2CKBL 1N4XL 1TVBB 1JZ2A 3QUMB 3VG0L 2OJZH 4OZIF 3G6JA 3K46A 4JANB 4DK6A 1KJ2B 1FZJA 1IBGH 4KH2A 1QSZA 4LP5A 1GVIA 2DBLH 5C92A 1CFSA 4HWUA 4ODUA 4XGZB 2FATL 1KXTB 3MOAH 5HHMB 2N7AA 3NIFE 3TPUA 2GSIA 3DOSA 1GCFA 3I6KB 5MEPA 4L4VE 2HRLA 4QHNA 5DDHA 1JYVA 4UT9H 1KXVC 2XZZA 4CADA 4LDOB 4HPOH 2OZ4L 4K8RD 1MHEB 4GRWF 2WK2A 5D1QB 4PRID 1CLYH 2XYCA 3AUVA 1RIVL 5IVXF 5GSRB 2JKXA 1GPOL 5TE7H 4PJHF 5F7KC 5KVDH 1IAOB 4LVOC 4OZ4B 1ZHBB 3U4EA 1KPVB 5EZOH 1H3UA 2HLFD 2HT2C 3AS1A 2EEBA 3RNQA 1C08B 4JCMA 4OZFG 2Y06L 2HTKD 1MFBH 4R3SA 3DJ9A 5HYSG 1C16A 1C12B 1B2WH 3OKKB 4QYOB 3CVHA 4YXKL 4G7YH 3CDYA 3HS0A 4HD9A 1J9CT 3V52L 4CADB 4RMRA 1ZLWK 2MCG1 2XACC 4P2RB 5BS0A 5D5MF 1BJMA 5EDXA 3CX2A 1JF5A 3IFPB 2DQHL 2HRPL 5DJ0B 1G7LA 1UADC 12E8L 2NY5C 3QRGH 2FEEI 5DUPL 3O3UN 3F5WA 3L3GA 2R1XA 5EU7E 3MMEB 3S4SB 1F6LL 3IGAA 2E7LA 5GHWL 2B4CH 3MRLA 2NY2D 2E9BA 2OMNA 5L0QC 5AYQA 4M1GL 3TO4B 1MLBA 1FGNH 1I8KB 4QHMB 4JRXD 3VI4E 1DFBL 3LSOA 4MJ6A 3DX9B 4OLWL 4DVRL 4MD5A 3T3ME 2F74B 1BECA 3MRFB 4J6RH 2HG5B 4HFWA 1XCQA 1U92B 1RZFL 4L8CB 1ROWA 2QADC 4Y4HC 1QA9A 2BHYA 2VLRE 5E4IA 2I07B 5DDHB 3OF6A 1OTUC 4HLZH 4R2GB 1BOGA 5KVMC 1Y6MR 3C8KA 1VESA 2WLYA 4I77H 1QNZL 4FXGB 3REVB 2VSDA 1TIUA 1FYTD 2A83B 4W81A 4TSAL 2GFBB 2DI7A 2X9YA 4EDXB 4JFXA 1AE6L 2ZNWA 2CMRH 2HLFC 2HT2D 5D7IA 1UG9A 1M7XA 5KVEL 3QDJB 1BFSA 1Q0YH 5FOJA 3WIIL 3GI9H 3SO3C 3TJEL 5F7UA 2FJHB 2ZJSL 2WV3A 5HD8C 1H0DB 4YHPA 5T3ZH 3NACL 1P84J 5GHWH 1UCBH 2YN3A 3W39B 3TVMD 4YPGB 1KYOK 1N6QH 2OX5A 1VPOL 4D0CA 4XT1C 4ELKB 5KSBE 1MCFA 4XMPL 1KCSH 1S7WA 4KTDL 2JK5B 4PY8I 3OAYK 3MJ9H 1QG3A 4MA7L 3NCCB 4PG2A 2EH7H 3O4LB 3MX0A 1QQDA 5KSBF 2AJXH 3EDJA 5I30H 4GS7B 4ETQA 5E5MA 2BNUA 4YDVA 4QY8B 1MFDL 4W4OC 1ZHLA 3RQ3A 3MODH 3TP4A 4JG0H 4G80A 2CR3A 2WW8A 3OXSB 3PWJA 2DQGH 3E6HB 4MJ6B 1BWWA 1LD9B 3QUXA 4NQDA 1P1ZA 2AJYL 4X9GA 4ODXA 4QF1A 4HHAA 3TH3T 1C8PA 3RWIB 1J8KA 4XRCB 4R97C 3SEPA 1EIBA 3QG7L 2DDQL 1G9NC 1OF2B 1EXUB 2J2ZA 4TQEL 4IRZL 5DJAA 5J7CC 2NLJA 1EMTL 1U8HA 2CRIA 5IEHB 1MHCB 1OVZA 3PWPA 3S37X 2WANA 3Q1SH 1A14L 4PJBA 4GW4B 1B3JA 4ONGL 5D1XB 5JW3L 2BHZA 4RRPG 1G1YA 3N1GC 3KLDA 1MUJA 5HDBF 4G9DB 4X8JA 3UPAA 3KLHD 1DQLL 4GBXA 4XNXH 1J5OH 2OBGA 1OAZL 5I0DA 5FYLE 1SBBA 2HJFB 4WO4D 2AJXL 2Z31B 1GZPB 3KJ6L 1U93B 3IJYB 5B22A 4D9QE 5F89B 4DN3L 1IMHC 3KPPA 3V0WL 5E9DD 3AFLA 3IJHA 3JWNC 4F15C 1ZHNB 4S0SD 2ADFL 2CKBA 2APTA 3MGTB 5T5NF 5DHVB 4N8VB 4XVUD 4MB4A 5GS0D 2I5YL 2XKNA 5GPRA 1KCRH 3B9KB 5I17B 2QSCL 1FV1A 1NANH 4HWBL 2ICWA 5DVNA 3CUPA 3RAJH 4U1JB 1HXYA 3IJYA 1VKXB 3UZVB 3FTGB 2HKHH 1IGJA 4NGHH 5F3HA 2D0FA 2ZKHL 4Z7UB 3LKQA 2BDNH 3DXAA 3I6LE 3C87A 1FNSH 1LGVA 4NM8L 4Q6YA 3P0YL 2Y25A 2Y9RT 4NHUA 1UH3A 1A3RL 2W59A 1BVLA 3WIFA 2R29H 4H1LG 2JJTA 1EEQA 3OKMB 3BHBB 5C9JA 1U58A 4LU5H 3V4UH 3FKUS 4HK3N 4IMLB 4WCYL 1CCZA 1H15B 3LQAC 2VXUL 1HHKA 2XV6B 1MHCA 4XTRD 5IG7A 1LNUA 3NIFF 3O8XC 1TVHB 3DYMA 2F5BH 1DBJL 2XKUA 2W9DH 2NYYD 3QZWG 1A4JA 2E7BA 4YHML 2DIBA 4JO1L 2ICWJ 1N7ML 1YDPA 4LHUG 2IQ9L 5ETUA 2KZWA 1TQBB 2NY0B 2E8ZA 5F7NC 1A21A 5EBMB 2CUIA 1QSFE 2XNAB 4RA0C 3VFTA 3OF6D 5D7KE 4X7SL 4BQBA 3WNLA 1NMCC 4KMLB 4YO0B 1OQOA 1MNUH 4I18B 4LCUB 1IT9H 5E5MB 1NQBA 1RU9H 4NO2A 4C59B 1AQKL 3NCJL 5HHOB 3WFBL 4QGTA 2BXYA 1A47A 1NGXA 5EU5A 3RVUC 2C1OB 2DYPB 3CFCH 5I8KH 4HUMB 1ZLVH 1OARL 3AMLA 3D85A 4RA3A 4A6YA 4HWZB 4E42A 3HC4H 5C0ND 4PJAB 4LASH 1OWRM 1F4WH 5ANMB 2VR9A 2Z9TA 2EDNA 4Z95L 4F37F 1P84K 3MXVL 2CLVA 2E6PA 4PJDE 3VDBA 4AMKL 1P7QD 2MPAH 3T8XA 3O3EA 2E7LC 4M8QB 3QIBB 4UV7L 5I18H 3IVKB 3JTTA 4MNGE 4U1KB 1WLHA 5GRUL 3O3DB 2X1PA 2DN7A 3MOQA 5I76B 2RB8A 3GBLA 3SCMD 1FVCB 5BQ7A 4XWGL 3A67H 3GSNL 3W2DH 3TZVA 1TZIA 1ORSA 3LEVL 4OD1L 3L5JA 2B5IB 2VZUA 5HJ3A 1FG2B 5FGBA 2Q20A 4J3SA 4ZO9A 1JPGA 2DTMH 3TBTA 1U92A 3IDIB 2XY2A 2UUDH 3QB7C 5HI5D 2MFNA 4HHAB 4QTIH 3RVXD 3U6RB 1E4XL 1YEFH 4Q97A 4WO4C 3CXDL 4XXCC 2GK2A 3LSOB 5T1KB 4ZUUB 1TZIB 1WEJL 4KKLD 4G8EA 2HP4A 3O3BA 4OD3H 4F2MB 2X4RB 4TNWK 5CJOH 2WBJD 2ARJB 3CSYA 3IGAB 3QFJD 5CZVL 1E4XI 3NFPB 2V5SA 4JQVC 2BSED 4MA8H 4G7VH 1KCLA 3OB8A 2XTJC 4Y8DC 5KSAC 2EIDA 3CPLA 1EBPA 1NGWB 4FXKA 5F1NB 3O6FA 4MNHA 4R4FH 3EBAA 1IC1A 1MCLA 3QQ3A 3S6CA 4K55A 3WFZA 1IM9A 5C0AE 3BRFA 2HFEB 4IBLT 5LAXA 4OZGE 5IVXB 3LDBC 2VDKL 4RDQG 4P5TB 5DD6B 5K59E 2WBKA 4PRHD 3TBVB 2W0PA 4XP4L 4QWWD 5HVWA 3AS0A 1NL0L 3WLBA 2XTJD 5KSAD 3D2UA 4J3XA 1CWVA 5SWSA 3WIHL 1SY6A 1J1XH 5E6ID 2DICA 2VXTH 4ZYKA 2BNRD 1M05B 2VL5B 3T0BA 2OTUA 1AXSB 3QIUA 4MD5B 3BESR 5DRWB 1HHKB 1I1RA 4LSSL 2V9RA 2OL3H 2A77H 3GKZA 4CN6A 4YGVA 2HFGH 4B53A 1B6DA 4LAQH 3QAZB 1G7IA 3QJHB 4W6YB 5KTEH 1FYTB 3PE9A 4PJ7E 2G2RB 3SOBH 4J12A 3T2QA 4E41D 5MEQA 4PJEF 4KDTC 3Q2CA 5DJ2A 4Y1AA 5IW3A 1IGJB 5IHBA 4QNPE 3RTQB 5IHZB 5D7JC 5IM7B 3CUPB 3KS0H 5IMKB 2D03H 4LHQB 4Y16C 4YXLL 4S2SA 5T1MB 1T22A 2W60A 1BP3B 2ZSVA 4OFVA 3ULVF 4WFEE 3KPNA 1AXTH 1ED3A 1YQVL 4K94L 2O5ZL 3TEUA 5E2VH 1C5CL 1T3FA 3WLBB 4WW2B 3AROA 3B9AA 3MGTA 2NY3C 4PRNA 3S9DB 1IE5A 4Q74A 1OHQA 2XZCH 1BFVL 1DEDA 1J1PH 3W0WE 3BZEA 1T1ZA 4YFLF 3ZL4L 5B21A 1Q0XL 2G75A 2PW1A 2GK0A 4DKFL 4HS3B 3EDFA 1RUQL 3G5ZB 2JJSC 3HI1A 5GGVL 3TBSB 1S9WA 2B1AH 4LAQL 3WFDL 4F9LC 5I1KL 3U30C 1D5MB 4IOIA 2PN5A 3CDGA 3GSRB 4DTGL 3LCYA 1FO0A 5L8JB 2YSSB 2WUBL 2FGWL 4L4VB 1SJHB 3VXPB 4IJ3C 1F5WA 4I3GA 1BZ9A 1RY7B 1NC4A 5GS1C 3QDME 5CLTA 3DRTA 2XXCB 4XPHL 3D6GA 4HX1A 5B38B 2NLJB 1U3YA 3B43A 5CAYB 2QHRL 2V17H 4GG6F 2COQA 1I9RH 4P5MB 5H35A 4E5XB 4JHZA 4WUKL 1QFHA 4N1EA 3G6DH 4HT1L 2CUMA 4MLSA 1A4KB 3QA3B 2E7CA 3UJJH 4Y7MA 4AH2B 3BSZL 1GGYA 4LSVH 4OLXL 4YEEA 4R2GD 4GSDL 1I85A 3VGAB 2PNDA 3TA3C 1ULVA 4NQEE 2Y5TA 1FVEA 1NAMA 4PY7B 3ZTNL 1FL3B 1K4DA 3P40A 3PV6A 2Y07L 1FZMA 3DSFL 3PHQB 4NJ9H 3OWEA 1JYWA 4NWTL 1JGUH 4H25A 3EDDA 3HRPA 5C0RH 3BYTA 4ZUVB 2LVEA 3TO2B 2L4OA 2L0DA 5F72S 1IGCH 1UWEL 5T1MA 4D9LH 2OTPA 1YEGL 3L95B 5C2BL 1SVZA 2MTPA 4D0CB 4ELKA 3SDXB 2XTJB 5KSAB 5CINH 2MPAL 2WINA 1R3IH 3W9EB 4BZ2H 5ADPH 1P5UA 3EOTH 5I1GH 1GYAA 3NCMA 3O11B 3VE0B 4RDQF 3MV8E 4RISH 5C07A 4Y5YB 5D7LD 1MI5A 4DN3H 4YHIB 2IF7A 3EFFB 3Q6GL 5ANMA 1D5XB 1XGTB 3UO1L 3REVA 4FZ8L 4I0PD 3UJTL 4DWHA 4OGAC 4RX4A 4RQQB 5FA3B 4PTTA 5JOFB 1FDLL 1C1EH 2Z4QA 4YFEA 3CFIC 3NH7H 3VXQB 2FJFB 3SJVB 1RZGA 4NUJA 3NFSH 3ARBA 2R2CA 1E4XH 1NMBL 3GMMB 5ACZA 2B5IC 2Y07H 2VZTA 3I85A 3MRGA 3HNSL 3CJJA 1R3JB 3QDMA 5FF6A 2GCYB 3VXTA 2YD2A 1NUFA 2F54E 3KHQA 4NM4L 1ADQL 3QNYA 2ICEA 3P4MA 2VKWA 4WHYG 4O00A 4MSWA 3LMJH 5DD6A 2DQIH 1FG9C 1QSEA 1EGJA 4KHTL 4MDIB 5TQ0L 5HGAB 1IEAB 3DGGA 4I8DA 1XR9B 1X5FA 3HR6A 3R4DA 4J3UA 5BZDB 4M7LH 3IDGB 2PKDA 4OLZH 5ID1B 1QD0A 1Z5LB 1R5VA 1NGPH 1P4IH 4FQHB 3DURB 3HS0B 2UV3A 5JORB 1HHHB 4PJEE 5JA9A 3RWDB 1D5IH 5CSZB 3RU8L 4R4BB 5DJ8B 5I2IA 4YQXL 1JGLH 1BFTA 4FMKA 4GAJL 4POYA 4L8SA 5D6DA 3SE9L 1J8HA 1KCVL 4WFGD 3HA0A 5I75B 1CGTA 1RU9L 5HHVL 4P46C 4GAYB 2BXZA 2XWBB 3OJDA 4PRAB 1WBYB 4PJGF 5IB3B 3PABA 3KYMB 3H9SE 1S7SB 4GQ9H 3IU4H 3T2NL 2HJLB 3HAEA 1CQYA 1ZHNA 4CU6A 4PJHA 1B88A 5ENWB 3TH2T 4P49A 4PGEB 2VXVH 3QH3A 2ZCKL 2QKIA 4JFYA 1S8DB 5GGRB 1FH5H 4QHLA 1HXMA 3FO9B 2Q6WA 3EYOB 4S1DC 4U0RB 3JWDC 3VGEA 5EU6B 3OKEA 3HI6L 1EFQA 2HJFA 4YHNA 1MJ8H 3QULB 5DS8A 1MFAH 3QWQB 3KPRD 1YEDA 4AEHH 3KDMA 3O6LL 2DQJH 1RZJC 1B0WA 3IKKA 4Q58C 5GRYA 1FFNA 4D8PB 1GIGL 1P7KA 4PJFE 1MELA 2R0KH 5E6ZA 2FSEA 1PVHA 3PIQB 2NCMA 5CJ5A 1CI5A 4HAGA 4JFZH 3FN3A 4PJBB 3WXWL 3BSZH 4LSVL 3S7GA 3HTLX 4JVWA 4APQC 4UMGA 4F8QA 3VDCA 2CKBH 3W9DA 1KB5H 3B9KC 2RQ8A 5DJAB 1KN4H 4RGMC 5ITFB 4I2XE 4K23H 3IU4L 4ODXB 4QF1B 3VFMB 1J12A 5D96C 2GTZB 1W72B 3DMMC 2AW2A 4DFIA 2FIRT 4DQOH 3ARED 3JV4A 4LARH 2J4WL 1YEGH 4Z78B 1EEYB 5T1KD 5B3JE 1TXKA 1RZ8A 3PL6C 4K7PH 1DQTA 5JPNB 1E28A 2LU3A 3BPLC 2ORBH 2RJMA 4ALAH 5JHLL 4X6DE 4TTDC 3UC0H 3ZHDA 5I66A 4J4PD 1JZ5A 1CLOH 3NCFB 1RIUH 2RAMA 5BZWB 1RMFH 3I6LD 2GSGA 1BFOA 3B2VH 5DGQA 3VGFA 4F7TB 3IAPA 2QL1A 4X5XB 5EUKA 4XBPA 1K8DB 3RKPA 4K3GA 1HWHB 4BH8A 2ATPB 1NEZA 1Q94B 2AI0L 3D0LB 5E7FA 1VADB 1NGZB 1AY1L 2YMXH 4KZEH 3IDJA 4PJIF 3X17A 3ULVL 1Z0NA 3N1PC 4U1HA 5AZ2H 5FECB 2ED8A 4LCWD 1P7KB 3ARFD 4Z7QF 1Q1JH 3DBXA 1YEDB 4OZIB 5D1XD 3HI5H 1CXHA 4LLDA 1GHFL 3IDUA 4J4PC 1J1OL 2UZIH 2W65A 5H2BB 2XG4A 15C8H 4P23C 1VKXA 3V6OC 4N90E 1QA9B 4M4PA 3NZHH 1XF5B 5EBLB 1Z6JT 1IQWL 4PRHE 1PG7W 1LO4L 3GRWA 3ILQD 5ESAB 4OB5L 4M1GH 4GRLB 4YLQT 5EZIL 5EU6D 2IAND 4C57C 3WDHA 4I4WA 4Y4KC 4WW1A 3UAJC 3E6FA 5KVFH 3TESA 1TZGH 5IROC 4G8IB 3T4AA 3QBTB 2MHAB 2AQ1A 3N06B 1AO7A 4PYGA 3C6LA 3UTZA 5JR1H 1UB5A 3SO3B 3F5WB 2EIZA 4NUGL 1Z0MA 5J0BA 4H26A 2CDFB 4O9HL 5CJBA 2XZQH 1HI6A 1LO3L 4GG6A 4GMTL 1KCVH 4Z0XA 3VU2A 4ELMA 1DQML 2BVUA 3IU3A 1MUJB 3IXAA 3RX5A 5CWSB 4CUCA 3WSQL 4DVBB 3AREA 3BP7A 1GHFH 1I8IB 4I0PB 5FO9B 1G1CA 1MVFA 1N0XL 3CK0L 4FQ2L 1J0ZA 2HN7B 4QRQA 5J11B 4LGRB 2OSLB 4R3SB 3P77A 5ADOH 2QLVB 2R4SL 4XVTL 4UTAH 1NC2B 3P0VH 4K07A 2FHFA 3NFNA 2DMBA 5DR5H 4EDWL 5A1AA 5BJTB 1WISA 1Q0XH 4OGAD 2UUDK 3RWIA 1F4AA 1J87A 1ZHBA 1EPFA 4J3OC 1HYRC 4PRBA 2FB4H 4AJ0A 4FOMA 2IWGA 3SJVD 2UZYB 1T5XB 5DHYB 5I1LA 2XWTA 5L8LB 1XAUA 3LQZA 3DUUA 3S3SA 3D3VB 4MA7H 2N56A 5DI8A 1ZHLB 3FL7A 4U3XA 5DQ9B 1MHEA 1U8IA 5IP4A 4NC1C 4M7ZB 3WN5C 4F9PA 2IJ0C 4XCYB 4ZNCD 4B50A 5FDWA 5I73B 1QFUL 4JFFD 1NANI 4O51B 4MZ3A 4LCIH 1ZEAL 5CZKA 3ARWA 3SE8L 4QRUA 1WIUA 3D0VA 3NCYS 4NM8H 1KOAA 5C07E 3CU7A 4G6AD 4KI5E 3SY0B 3OKLA 5KS9E 1MLCA 1MI5D 4JO2L 5HPOA 5D7LB 5AG9A 3WS6A 2EDRA 3GI9L 5IIEA 5IEKB 3G5VA 5ECJE 3CLFH 2IADB 2Q7YB 3V5KB 1HDMA 4QEGA 2GAZB 2YD6A 2Z31D 1MIMH 1RQ5A 4MCYB 4M7KL 5MI0B 4LEOA 2B39A 5JXAL 3S5LA 5C2BH 1JZ7A 1IKFH 2BVQB 1IARB 1RSFA 2B1HL 4HFWB 3HCVA 1RZFH 1JNLL 4OM1L 4RFEA 2V5RA 1B4JL 3MLRH 3HG1E 1OGAA 2DMKA 1KFAL 3C5ZD 3F7VB 3UPCA 4Z7QE 5F7EL 4KROD 3BUTA 3CDCA 3QUYD 4P3DA 4XTRC 5H35B 3P4LA 4P4RA 4P2QD 3D3VA 4MCZA 3D39E 4E9LA 4MAYB 5DD0L 3JUYA 2DLGA 3S96A 4ZUWA 3QFDB 4FQQA 5CD3A 2QADD 3C60A 1D6EB 4X7TA 3WEXA 1A7RH 4X7EC 3W81A 4UV7H 4JKKA 5JW3H 1B0GA 3GSRA 4HLZG 2E9WA 3OGCA 4FNLH 1U8KA 2XA8H 4WFED 4WUUE 1YJDC 5D1QD 2XZAL 1HSBA 3QUZD 3PP3K 4NQVB 5DA4A 5EC1A 3VFGH 3IKCA 3K3QA 5MENB 2X4PA 3MBEB 4KKCD 2BJML 4E0RA 3V5HB 1HNGA 3SBWC 2C9AA 4M62H 4YZFF 4G8GE 4IRSC 4PJFF 5I8OL 4L4JA 3R8BB 4UOW0 3D5OF 2R0ZL 2J8UF 2DQFA 5EN2B 3IDMA 3T1WA 1JGEB 1S7QB 3VFPB 4H0GA 4F7MA 2X89A 1LK2A 1IM3B 1II4E 4UU9B 3I75B 1KC5H 3OAYH 5F93C 4PRIA 4CW1B 1CXLA 2XT1B 4MLIA 1DVFC 3NA9H 2ZPKL 5K9JL 1CFSB 3EJYD 4O58L 3L5IA 4MA8L 1FORH 3P30H 1O0VA 4PGCB 4R7NA 2AV7B 3O4OC 2AXGB 4PBXA 2LV4A 4MB3A 3KXFA 3HUJA 4KQ3H 4Y2DD 5D72H 5TGBB 4YFLI 5FEBA 4B7LA 4BQ6A 1FVDA 1H3PL 1LVEA 3TWCH 5EU6E 1HOCA 3GIZH 3O2DL 1P9MC 2CK0L 3F7QA 1NAKL 3PQYD 4Q6IB 4Q0XL 3KPQA 2HVKB 2F53B 1CXIA 4F57H 3GSWB 5E9DA 1AJ7L 4M1DH 1OTSC 1NFDF 5A2JH 5T1DH 5J13B 5IESL 2AXFB 5A2IH 4XP4H 3R06A 4YIQB 3TBVA 1FSKC 2NY4B 4G6JL 5BVJA 1BFOB 3MFGB 3GSUA 3HC0A 2PXYD 3I84A 1KPRB 2C3VB 4PJ8B 1OTTC 5AG8A 1UH2A 3T4YB 4Y1AE 4PJXE 4EUPB 5MERB 4ODWB 5BOZG 3I2CL 1A3LL 5I1HL 1NCCH 1R5WA 3MJ7A 1PZ5B 3O6FB 4MNHB 1RJLA 3UTSA 1DQJB 1N64L 5DEFA 3UDWC 4FXKB 3RDTA 1AGCB 4BK4A 1RZIB 3WFHB 1S78D 3ZZ1A 4RMWA 4HUUA 1A9EB 2W38A 3EYVA 1U8NA 3MCLL 5KJRH 1CE6B 2X4TB 5E8NB 2Y7QA 43CAA 1QFOA 5SWSE 4BSJA 1IC7L 2W9DL 4EN3A 2YUZA 1A6AB 1EAPB 5C7XL 1HH6B 5HYQA 4F37K 4M3KB 3E8UL 4OBSA 4R26H 2WP3O 1S3KH 3PGCB 3GSXB 3T0EA 1PBYA 3HR5B 3MROA 3OZ9L 5CMAA 3V7AE 1WK0A 1NBZA 2MQ3A 3QUZB 3B3IB 3UBXA 4JFEE 1QFPA 1IGFL 1SEBA 2EZ0C 1SVCP 4K9EC 4MQSB 3QIWC 5E6YA 1HN1A 1S7TA 3DXAE 3FO2A 1ORQA 1JPSL 2W0KA 1FVCA 3BDXA 2XY1A 3TCLA 5K9OA 5F1KC 4MVBC 3LN4A 4OLEA 4JGJA 1MRDL 4P2RD 3P4NA 5HVGB 2A73B 1SYSB 5F9AC 3WE6A 2MJWA 4PB0H 4NZTH 4LSRL 2WUBH 4EIGB 4PTUB 1MCHA 1OAUL 3BE1H 5E95B 1F6AB 3RJDA 4RNRB 1RFDL 2NW3A 4KJPD 2EDEA 4E42B 1TZHB 1FNEB 5TDPB 1EHLL 4QOKE 1IGYA 1KN2H 5EO1A 1NCWL 1NCNA 1O7SA 1JBJA 3I50H 5GGUA 4PS4H 4U6TA 1I8LC 5CSZA 5B8CA 1H8OA 1UJTA 3IB4A 4RGNB 3DVGA 3HZKA 1NDGB 5DEFB 5I9QC 3RWEA 1YEHL 4BFBD 5INCA 1B0RB 4Z76A 1CGSH 1QNZH 4MNQB 3OR6B 3PF2A 5J06A 4GAJH 1TPXB 4DGIH 5JW5B 3EYSL 3HE6B 5CKGA 4L4TD 5B4MC 3MA9H 4YJZL 1D9KA 4JJ5A 4MNQD 5GGRY 1UWGL 3VRJA 3IETB 4LGPB 4X80L 4EI5C 5B3JF