1OQOA

Complex between g0 version of an fc bound to a minimized version of protein a called mini-z
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin gamma-1 heavy chain constant region
publication title Impact of Fc Glycans on The Effector Functions Vary with the Antibody mechanism of Action
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oqoA01
2OCFD 1K8IA 4HPOH 4YBLC 3LRHA 2Z9TA 3KXFB 2ED9A 5ISZA 5TFSL 1T80A 1ZTXH 5IWLC 4Z76B 4S1QH 4U2ZA 1LK2B 3QIUC 2DM7A 1MFAH 5E5MA 3LY6A 4F57H 5IBUB 3CLFH 5T33L 1S7TA 3HR5B 1FN4B 1J1PH 3V5DB 3WNKA 1IZKA 3HNTH 2VXUL 1KENH 4WFGE 1A3LL 2E5EA 4HC1H 2X9YA 2CK2A 3C2AH 3MR9A 1BLNA 2HVJA 1V7MH 4HW6A 4OB5H 1XAUA 2YWZA 5IFJB 1FVEA 4XX1E 3NFSL 4NP4H 4S1QL 4WGWB 3NAAL 4FMFA 1MHEB 3O6FA 1J1PL 4AH2B 4O51B 3HNTL 1FGNH 4XP1L 3D5OF 4IRJB 2FIKB 1AXTH 1WWBX 1QRNB 4HC1L 1TVHB 4L8DA 1NAKH 3C2AL 1CTOA 4GJTB 2JIXB 1OTUD 1KC5H 5T1LB 1QSEA 3HS0B 1V7ML 1WAAF 4PRPA 3OMZA 5GGVH 4TTGA 4LPXA 3ALPA 4JCMA 2Q3AA 5CEXA 5KSAA 4FXKB 3MRPB 1T66D 2ATPA 3U9UA 2W1NA 3FRUA 3N85H 3S35X 1FGNL 2Z35B 2Q8BH 4CDHA 2FH6A 5KG9A 1SY6L 2VH5H 1RY7B 3D3VA 3UO1H 1IGYA 3VFRB 1TZIA 4RAVA 3OKLB 4KY1L 2JKXA 5FUCC 4F58H 5HDLA 3V7MA 3U6RA 4R2GB 3P0VH 1T5WA 2Q7YB 5HYQB 2A6IB 5L0QC 1S7WB 2P7TB 2XG5A 1TJHL 4ZNCD 3MLPA 2N7AA 4U05A 3N85L 3VFSB 4IRSA 3PL6B 5INCB 3LKOB 5A16A 2VH5L 3SDCB 2BC4A 5D70L 4PJFB 1DBKH 3LB6C 1HYSC 1IL1A 1OLZA 4ODVH 2CGRH 3BPLB 2J88L 5JPNA 4QOKA 4LOUC 1A6ZA 4KK5C 4PRHD 1IKFH 1CGSH 3ARBB 3QJFB 4J1UA 5TE4H 1INQB 2PXYA 3BZFB 2NNAA 4Q9QH 3VD5A 2UZXB 4XPAH 4WUKH 1G7IB 4G3YL 2P45B 4RRPA 3AREB 4BH8A 4ZTOL 1RIVH 3GHBL 4I0PB 4K3DH 2QR0B 5JA8B 3NCJL 1DBKL 1YECH 4LF3A 2NW2B 4GBXA 4Z7WB 5CIPH 5L9DH 3S34H 1CFTB 2D0GA 2VNCA 5F7DB 2HN7A 3S4SA 1MFEL 1U95B 4JFQA 2BVOB 4PJBF 2YOCA 4LVNC 4H1LH 5TE4L 4HCRL 3MRKB 4X6EB 5C6TH 1NUFA 3JXAA 4BUHA 2KQNA 1N6QH 3TCLB 4X99A 4Y89A 4UIKH 1N2RA 2VDOH 1EEQA 4WFHD 1HILA 1F11A 3IDNB 1F5WA 4K8RD 3DMMA 1JHKH 2CJUL 3VGAB 4R7DB 1TETL 2FECI 4Y16D 3BEWB 1AO7E 2EYTB 4TULH 1F3JB 2XXMB 4HGMA 3RHWK 4PYGA 2VDOL 5DK0B 3HPJA 4KHXL 4FQJH 4X4ZA 5TQ0L 1MFNA 5C0AB 4Z5RA 5ILTH 4LU5H 3HR5A 1H8OA 2V9RA 4JRXE 4DN3H 3MBEA 3G5VB 3TFKC 1EX0A 1KB9J 4P2OB 5E2WL 2HMIC 1EFQA 5LJYH 1YEHL 4LKXB 4YDVA 3ZSTA 5DJ2A 4TULL 3OGCA 3QFDA 5DD0H 2YPKA 4P49A 3T4AA 1FAIL 1VFOA 4UDUA 5DHXB 5KSBE 5IFJA 2V7HB 4AQ1B 5C0CB 4GRLD 3B3IA 3FRPG 3GUTB 4FQJL 5FYKE 5CEYB 3LD8C 4CN6A 5BV7B 3MQIA 2GSGB 3OJMB 4R4ND 5D9SB 5C3LD 4OZHE 4EBQH 1QRNA 1F00I 3ZKNC 1TVHA 2X1PA 4D8PA 1AP2B 1YEFH 3W0WE 4QKXB 1BF8A 2IPTH 5DD0L 4X8XA 1Y6KR 5F8QC 1PKOA 3QI9C 2BVPB 5CSGA 3QJHA 3GEWB 4RQQA 1B0RB 3HRZB 3QO0A 3H9SD 1OAYH 4FXKA 4OQTL 2A9MH 3S37X 1K3ZA 3DRQB 3C8HA 1CCZA 4EBQL 4LPVA 1QLFB 3VI3E 4MZ2A 2V17H 3CXHK 3OKLA 2ZUXA 3HG1B 5HDOA 3U48A 3CUPB 4YEFA 5HYQA 5ICYB 2A6IA 5DURB 2AXHA 1NMCB 1OAYL 1S7WA 4FQXB 5I2IA 2A9ML 1I1FB 1E4WL 5F9DC 3VFSA 1TLKA 3P4NB 4OZFH 3IAPA 3PL6A 5INCA 1HINL 3LKOA 4PJ9B 4U4BA 1OGTA 4OLZH 3VXMD 4LLAA 2V17L 1AO7A 2VKWA 3IFPB 2B4CH 1BGXH 4D9RD 3JV5A 1E6OH 3KLAB 3ARBA 2IH3B 4IM8A 3BZFA 4PB0H 4JN1H 5DO2D 5EU6A 4WY7L 4OLUL 4JRXA 5HVFB 4BYHA 1JP5A 5JHLH 1G7IA 2OTPA 3LN4B 3GI8H 4QLRA 1WWAX 2QR0A 4A6YB 4OLZL 3MFGB 1FNSH 1OW0A 2NW2A 4U1JB 3VXRE 3LH2H 4PJDB 5F9WB 5SWZE 5F7DA 4PRAA 5GS1C 5KSBA 4JFFB 5J6GB 2JB6B 3UJJH 3MRKA 4X6EA 4PB0L 5D2NE 3JWOL 3RDTD 1BFOB 1T1WB 2VQ1A 3PDDA 4GAJH 5JHLL 2ERJB 4FZEH 4JM2C 1RJYB 2HKFH 4OZHA 4APQA 3ORJA 1ZGLB 2EKSB 5FM4A 4WU7A 1BD2D 3W0WA 3VGHA 2IANB 1ZEAL 3MODL 3SE3A 3LH2L 2XWJA 5AUMA 5INDB 3H7BB 1OCWH 4R7DA 3CVHH 1HNFA 1A7PH 4KJPD 4JJ5A 2P8LB 4LCIH 3DROA 2P49B 1TZHB 3FQUB 4FZEL 4J3XA 4UINH 3TVMD 3L5XL 5SV3A 3LOWA 4ONHA 1R24B 4XBEL 2EDYA 1IGTA 2AVGA 4GQPH 5DK0A 4N8VG 4QXTB 2VZOA 2AK4B 1K2DA 3FAXA 4U3CA 1NBYA 5C0AA 1NCAH 1UJ3A 1VACB 3X17A 3EO0A 1OCWL 4P2OA 3CVHL 1MI5D 3RWCB 4PJAF 1A7PL 1BX2B 4LCIL 3UTQB 4LKXA 1WTGT 3THML 4GRWF 3CDFA 4KC3B 4AL8H 4UINL 3SPVA 4DJMA 1K85A 4NWTH 3MV7E 1FCCA 5C0CA 2HH0H 3V4PL 2XZCL 1DTUA 1A2YB 5SX4H 4DFIA 4X5WB 2AEIT 4ZAKC 5I8CB 1YMMD 4C4KT 2FIRT 3CDGB 4LSPH 1OTSD 3QDJD 1AP2A 1UVQB 4N8CL 3U0WL 3K4DA 2IQAB 3VGGA 4AL8L 3IU4H 1ZT1A 4MJ5A 1FG9C 1NBZA 2IF7A 2DYPB 4QF1B 3T09A 3QEUB 4OZIF 2OX5A 4QHUB 1T0MA 3BHBB 3VD7A 4ZFOB 3QG7L 3QZWA 4IMKC 3DRQA 4WW1A 3QIWB 1U8KA 1IEBB 3QULB 2E7MA 2VQUA 1A14L 4OCWH 3RIAF 2DBJA 2FHFA 3U83A 3HG1A 4MDIB 2X4TB 3IU4L 4UAOB 5GS2D 3BQUC 1MQKL 1IVLA 1N4XH 2E9IA 2BCKA 1NCCH 2FZ3B 3CUPA 3P2TA 1JNJA 2J4WL 2WWKT 3FAWA 3ILQD 2Y25A 4FQXA 4M5ZH 3DVFA 1HCVA 5KSAD 1I1FA 4XXCA 3ZT5A 3HAEB 2AJVH 2NCMA 1UQSA 3S3JA 3HI6H 2WAHA 4WCYH 3GBNH 1RJLB 2WP3T 3L7EB 3CD4A 2Y4SA 5FV2A 5BVPH 2NXZB 3GB7A 3QUYD 1U8LB 3D2UA 1HH9B 2YA2A 3H9HB 4N1CA 2MQCA 1K4DA 3BGFC 4O2FB 2AJVL 3LN4A 5CGYD 5FGBC 4PJGF 2M8XA 3BAEL 2X05A 4UTAH 5J7CC 1JGUH 3RL1B 1PEWA 4U1JA 4G8IB 5E8DH 4KI5E 1OAZL 4U1GB 1LK3H 2GK0B 4PJDA 4KDVA 4KVNH 1VADA 2FNBA 1I9EA 4JM4L 3MV7A 4JFFA 5I1IH 5D1QB 4MAYA 3UTZB 2P1YA 1T1WA 3PIQB 4WI9A 3SJVD 4HHAA 2BJML 4I1NB 1F4WH 1EVTC 5C9JB 1QSZA 3QP3A 4EI5C 5BZWB 3C6LB 1JGUL 2EKSA 1IILE 3I02A 3QDGE 3QQ9D 3CMOL 2IANA 1HDMA 3HI1B 2NTFB 2R4SL 4U1IB 5INDA 1N5AB 2UYLB 3LQAL 3FN9A 4QEGA 5SX4I 1X6LA 4YZFE 4HUNB 1IGIH 4LSTH 5IBUG 2IALB 2NY2D 3BW9B 4CU6A 1TTFA 1ZT4A 1QFUH 1EFXD 3FQUA 4NO5B 3VWJC 4D0CB 1Q72L 3E1F1 4LCCC 3ARXA 3MROA 3WUZA 3WLBB 3HNSH 1QFHA 2VXQL 3E6FB 2AAVA 3TA3B 2JB5H 1VACA 5JW4R 2R1YB 1VSCA 4M7KH 3HE6C 3M17B 4YK4B 2V2WB 4OCLC 1G7LB 3QT2A 1I75A 1HXYB 5E5RB 3ARFA 4HIIA 5D6DA 4PJCE 2X7LB 1DLHA 3V0WL 1XFPA 3KXFD 3ULSB 1ACZA 5E4EC 1UZ6F 4QHMA 2X4NB 5KZCB 1V8HA 1MNUH 1SEBB 2JB5L 3FFCE 5F6IB 4HXAH 3PWJA 4X5WA 1EMTH 4M7KL 3LPGA 5I8CA 4JQIH 4KK6D 1FZMB 2X9XA 3HFML 2LAGB 2R4RL 4XH2A 4TSBH 3ILPB 1BBDH 1LO5A 2NZ9C 3PUCA 1B6DA 2C3VB 4RFEB 4G8EB 2DKSA 4M7JH 2R0WL 2DYPA 3M45A 1MRCL 4QF1A 4Y5VA 2VWEE 4M4PA 4QHUA 5D1ZB 3BHBA 4L4TB 4OGYL 5CCKH 4XPHL 3QUMA 4KZDL 1MCIA 5JLZB 1PEZA 3OB0H 3QIWA 1BBDL 4X7TB 4F7PA 3GK8H 4IRJD 1QRND 3KPRE 5B4MD 3LKQB 1LEIA 4NC1E 3QQ4A 2JIXD 4D3CH 1IKNA 5T1LD 1R5VB 1VEPA 2ICES 3QDGA 4N90E 1PAMA 1C7TA 4KDWA 1ZVHA 4HH8A 1KYOK 4RGND 5EO0B 5CCKL 3UC0H 1FC2D 5TQ2H 2B39A 3MLVH 4JO4H 4LLDA 1XCTB 3DSFH 1JF6A 3GK8L 3MYJB 3NIFE 1RJLA 3T0EE 1KN2H 3DX8A 2Z31B 4YHPB 4CN1A 1LO0L 1ZWIA 4LVOB 4QRQA 5D2LE 2O5XH 4ODTH 3NCYP 4R2GD 3LMJH 5E8EB 4Z0XB 4JZJB 5J13B 4W70A 4O2CB 5IJKA 3MLVL 1TNNA 2CKBL 4UV7L 4P4KC 1MCWW 2DIBA 2RGSA 4XHJC 1FIEA 4PJCA 4G8IA 4HEME 3SDCD 2QADC 2XQYK 2AJ3A 4P57B 3GMPA 1Q38A 1G9EA 1P9MA 2O5XL 4ODTL 5HHQA 3QDMB 1AI1L 3G6DL 2R23A 3LMJL 3UTZA 3FFCA 5CWSB 3MUY1 2FHCA 2DQEL 3FQWA 2YK1H 1R3KB 4M8QA 2IPUK 3G6AB 2PW1B 5C9JA 1MELA 3SN6N 4XCEB 3ARED 2O5ZH 1VHPA 2R0ZL 4I0PD 3KPTA 1PVHA 5T3XD 3X13B 3EYFB 4XP5H 5MERB 5C86A 2JELH 4U1IA 1N5AA 4IJ3C 3BIBX 4V1DB 1BWMA 1GGIH 4XTRD 4JG0H 2EE6A 3U7YH 1B3JA 2VL5B 1EVUA 2IALA 5H2BB 3FHAA 4JB9L 4XP4H 2YK1L 1OB1B 2EIZB 3ARDD 1NAMA 4NO5A 1G7PB 1S7UB 1WFOA 4UILH 4WV1B 4D0CA 1QP1A 3TN0D 1E6JL 3F7QA 1YNKH 1P7HL 3FN0H 4I4WA 3GNMH 5F7LB 1UT9A 5DXWA 5BJTB 5KVEL 3JV4B 3MRRB 3C60B 1HXYA 1LO4L 1MWAL 1BVKB 5HHMD 2FEDD 4XP4L 2VIRB 1DQJB 1I8IB 4UILL 5ADPL 3Q6GL 3DUHA 3EO9L 4L9LC 4NKOA 5DI8B 3FN0L 3I2CH 2VLLB 1SEBA 1GOFA 3QH3A 5L2KE 2DQTL 5KOVC 1XZ0B 2FX9H 4GMTL 5DJDA 1EEZA 5D7LE 3V0VA 2BVQA 4IHOB 4JO3H 1FFNA 5F97E 3RUGE 3DV6B 4U1MB 4P2OD 3PWUA 5DJ0A 4J3OC 4MWFB 4EI6B 2OQJA 3MJGX 4RFEA 3O3BA 3HUJB 5CZXC 4R9HA 3TBWB 1AJ7H 1FL5A 5EUKA 1YDPA 1BVZA 25C8L 4NO0B 2L4OA 4YXLH 4L4TA 4WRLA 3I2CL 5E03A 4NQVB 4GAGL 1Q0YH 2EXWD 3U4EB 3QAZC 4DW2H 3LKQA 4OIIH 4MB5A 3DV4A 2VUYA 2BVYA 4Z0BH 3U4AA 1OWWA 3ABZA 4LSVH 2Q76B 1JNHA 1KUMA 2LABA 3RWIB 1JHTB 1X6NA 2UZIH 1S9VB 5FYKU 4KRPB 5EO0A 4LLMB 4UOW0 4WFHE 5JXAH 4MB3A 4RX4A 1BPVA 2B1HH 4F9LA 1CF8H 1MCFA 5IHZB 3MYJA 4TOYH 1JYXA 1RZGB 3C5ZC 1ZLUK 2Z31A 4OIIL 3K8KA 1S9YA 4H8WH 5I74C 2X4PB 3HZMB 5LQBH 3S36X 5MEOA 4LSVL 3G6JE 2UZIL 5DURD 4JZJA 3P30H 1TJIH 3H7LA 1JPFB 3MLWH 4A2MA 1IEAB 3STZA 1T66C 2EH8H 2YN5A 3DVNB 4PJ9D 5DEFA 3E3QC 4AM0A 3LZFL 2AABH 4RNRA 4WI2A 5E08H 3NBNA 3MX0A 4P57A 2W0LA 5EZIH 2Z91B 5C0GA 3DXAB 1JPGB 2GJ6D 3NOIA 3QDMA 5L2KA 4QYOA 3RI5K 3S98A 2QTEA 4KFZC 1R3KA 5D7LA 3VFVA 2Y36L 1GH7A 3MLWL 5K9JH 4FS0A 3RUGA 4XCEA 5E95B 3HE7A 1T7XA 1BIIB 4F7EA 5J3HD 4XNZB 4DGVL 4L3EB 2QQLH 5C6PB 5CIPB 5I17B 3KPQA 3CC5A 5EZIL 3GSQB 4LHUB 2EDXA 4HPYH 5E8NB 4S2SB 4IRZL 3QEQE 4H1LB 1IARB 1OB1A 2EIZA 2VAJA 2AK1H 1G7PA 5K9JL 2J6EH 3OGOE 5C08B 4AENA 5DVOA 4C59B 5F1SA 1HOCB 2OJZH 4P3DB 4D0BB 2DQDL 3WIHL 1INDH 5K9KB 1VERA 4UQ2B 3UJTH 5CD3A 1BVKA 4KPHH 2QSQA 1FFPA 3SKNB 1ZANH 1KIQB 4HJJH 2AK1L 2PW2B 1DQJA 1I8IA 3OXSB 3MJ6A 3RWGB 4RFOH 3ARWA 2J6EL 4F7MA 5DI8A 5LGHL 4KH2A 3K2MC 3MA7A 5E6YA 3CCHB 1R3IH 4HKXB 2AK4D 3OJDA 4WTWA 1INDL 4JFXA 1DN0A 4KK9D 1EHLH 3G6JA 4U1MA 3UJTL 2J3SA 2VZTA 1EPFA 1JUFB 4EI6A 5IF0B 1IGJB 3HUJA 5H37G 4Q0XL 2AXGB 4LSUL 2APVA 1T2JA 2FX8H 3CNKA 4NO3A 2AI0L 1WGOA 4XPGL 2Q3ZA 3RIFF 4NQVA 4XMPL 1F13A 4J6RH 1CXKA 1RUPL 3LRGA 3U4EA 3KYNB 2IH1B 5F93C 3D48R 3UEZA 1YY9D 4XAKE 4JFEE 2OI9B 3UCRA 1YUHA 4PBXA 5FYLE 4GUPB 4QXUH 1OAQH 3STBA 3BZEB 2FX8L 1KNOA 2X4OB 3RNKB 2DYPD 5B38G 1JHTA 4KMTH 1OP9A 4J3VA 4N9GB 3MGOA 4LLMA 1F6AA 4Y4HC 3GMMB 2LV4A 1I7ZA 4GRLC 4TPRH 2BNUA 5I6XB 3QEQA 2ZJSH 4NQXB 3LEYL 1RZGA 1BEYL 3SO5A 4QXUL 4G43B 1OAQL 2X4PA 3HZMA 4QRPE 5J1AA 5E8OA 2XZAH 2J7LA 3TO2A 3HR6A 4NJAH 4P5TC 3TNMA 4XWOD 4MSWB 4PJHB 4YDJA 1JPFA 3LV3B 4NQSB 4PB9L 2E6JA 1IEAA 3RY6A 3FRPA 3B4NA 3OKKB 1CGWA 4OZFB 4Y7MA 3DVNA 4RWYL 5KVGH 2EDRA 4PG2C 3IXTA 4P3CH 2ZG2A 4ZOBA 1JPGA 2NXZD 5I18L 2ITDB 3R8BB 2R69H 3MSPA 3P11H 3QXVA 3O81A 1E4KC 4KJQD 1CVSC 3MNVB 2VXTL 5ICXB 4UIMB 2XTJB 1D9KB 3DARA 3L3IA 1AQKH 2X2YA 3U9PL 4OLWH 1UACH 2A2QT 1LWRA 1G84A 1BIIA 2IBZX 5DVMA 4QTHA 1BQLL 4YIQB 3QCTL 5E7FA 5DMYA 1KCVL 4ERSH 5I17A 2K7PA 4JQVC 1R5WB 3GSQA 5AZEL 2Y6SC 4LHUA 4Z7UB 2M2DA 1KFAH 4S2SA 5D1QD 1G9MC 3SE9H 4H1LA 1KG0B 5CP7A 4YHKL 1VB9A 1X5YA 2ARJA 4OF6A 2GFBA 4WWKC 1T5XB 1AQKL 1WZ1H 4HS6A 5DQJB 4JFEA 1NPUA 3DIFA 4MGXA 2ZCHL 3BGAA 3C6LD 4TUJB 15C8H 2F9BT 4WEUD 2BERA 4D0BA 1NDMB 5JMOC 4FQQB 2YD6A 3MJ7B 1CR9H 1KFAL 3CVHB 1OAXL 5CEZD 1UC6A 3D1MC 4PGDA 3IAGC 2C1PB 3O2DH 4KRMB 2PW2A 3OXSA 3RWGA 1B0WA 4JPWL 3FMGL 1WZ1L 1MHHA 3RDTC 4OFVA 1AD0B 2VLKE 3DVIA 2XA8H 4KQ4H 2Z8RA 1G6RH 4NM8H 3P9LB 4DWHA 3TA3D 4Y19B 3PHQB 1I7UB 1LMKA 4QRPA 43C9B 5ITFB 5C09E 4OFKA 1ORSB 4ZUWB 5HD8D 4X8JB 3IKCA 1CFQB 4B7LA 2WQRA 3ES6B 2EZ0D 2AXGA 1C12B 3KJ4C 3OX8A 1T1ZB 5FO8B 2Y5TB 3IDMB 1FSKC 5E6IB 4L3AA 4OLEA 5C07E 2V2TB 4S11A 2G60H 1A4KA 3TIDB 2FWOB 2VRAA 1ZHBA 5C2BL 3KYNA 4OLXL 2ZSWA 3H0TB 1CICC 2IBZY 4JFDB 1AQDA 3VRIB 4GUPA 4JY4B 4U0RC 2YZ1A 1T7VA 2XY2A 1FL3B 4LRIC 2X4OA 3RNKA 3DVGA 3R4DA 3SOBH 1P4IL 3AROA 3C8KB 2G60L 2WBJB 4PREA 1UM5H 5D1ZD 3HLAB 3GMMA 3VWKB 3MLTA 3ARUA 1Q9LA 1LP9E 4TNVF 4UBDD 1LO3H 3GO1H 2FYYB 2G5RA 4NPYB 5F1KC 3PWLB 4LVHB 3QQ3A 5D7JD 1MAMH 2H1PL 3LEVH 5F96H 3OR7B 4MCZB 2MWCA 4PGBB 5BVJB 3RWFA 4NQSA 2E8YA 3FB6A 2A9NH 2NYYC 5I73C 1LO3L 4PJXB 1JWSB 3O6FC 1A3RL 2FB4H 3DX7A 1QKZL 5AWNL 1MCLA 2VLKA 3S35H 4JREB 5GRJH 2NY7L 1E4JA 1WCQA 3LEVL 2GT9B 5F96L 1I1AB 4UTBL 2KKQA 2PO6A 5ICXA 2CIIA 4UIMA 5C09A 1TJGL 3OZ9H 3VXUD 4NBZB 2XWBB 2A9NL 2MCPH 4X4ME 5JDSB 5KSAC 5A2IH 2FB4L 1A6VL 5FYJD 1R5WA 4Z7UA 5C07A 1OP3K 4KQ3H 4XPBH 5ITBH 4U1NB 1DEEB 3GSXA 1KG0A 4OI8A 3GFUA 1GGCL 4I2XE 4G8FB 1T5XA 3OZ9L 1EHXA 1X7QA 1VGEL 2MCPL 4KTYA 4RAHA 3ROOB 2A74A 5CHNA 2BHUA 2E27L 5CJ8A 1FNFA 4YNYA 5I1KL 4CMMB 5CJOH 1RZIA 2A83A 1NDMA 3WXWL 4NKQB 4V1DD 5D5ME 4OI7A 4KQ3L 2Z93B 4XPBL 1KLGB 4XNYL 2C1PA 1F3DJ 5D96C 1HE7A 4JY5L 2AJYH 5ID0A 1VGKB 5T1KB 4RGNE 1ZSDB 1CLYH 1VENA 4JDZB 1LP9A 5CINH 1HQRA 1AD0A 2AW2A 4RA3A 2Q8AH 1GPOL 2PXYC 2VTFA 1C08B 4FNLH 2R39A 4XP9H 4HF5H 4PRNA 4WFFD 1C7SA 3P9LA 5F7UA 3CU1A 1XCQA 3CZFB 2XKUA 2COQA 43C9A 2V9TA 5HI3C 5IIEB 4KROC 1RHFA 5FA3A 2VISA 4OCSL 3KPNB 4WENB 4V2CB 2EC8A 4X8JA 4GBXC 3C60D 1MJUH 4JZNA 4HIEA 5DUML 2R1XB 4NBYB 3ES6A 2AJYL 3RVWC 4JJHA 3PDOB 1MJ7L 4G9DB 2Y5TA 5DSCA 1ES0B 3TJEL 3STLA 4ELMF 5E6IA 2VLJB 1NEZA 2Q8AL 4LIQL 2V2TA 1RSFA 1AFVH 1A6PA 3N1QC 2C4FU 4HF5L 4HH9B 4Z7QE 2FWOA 1IQWH 5JQHC 5AYUH 4NCC1 1DQDH 4OD2A 2MMXA 1MJUL 4GG6E 3DMMC 5A3ID 4O9HL 2RAMA 4JY4A 1KB9K 5A2LH 5DQ9B 4Y2DB 4LLQA 2MTPA 1CZ8H 2F19H 5IB2B 2YPLB 1WFUA 2WBJA 4NO0D 4OIAA 3HLAA 3UTOA 4OGXL 4P9HC 5FO9B 3IETB 1FNEB 4Z7WE 1AE6H 1DQDL 3O0RL 1UYWH 2NMSA 4EUPG 4TRPL 1FZJA 2DM4A 1FE8H 4NPYA 4PJ5E 1NUGA 3KLHD 5T5FH 1UA6H 3MBEC 4XC3L 3PWLA 5I1LB 4JPIB 1YNTB 3MO1B 3R0NA 1OSZB 1J5OH 1RZKC 2F19L 5TDOA 4PGCA 3OR7A 3SCMD 1A6WL 1KIUA 4R97B 3BMWA 4KRPD 1XGPA 3QIBB 2C4FT 5D5MA 3LKRB 1LE9B 1EO8L 1QBAA 4ODUB 2YPVH 5F6HI 4YX2H 1JGLL 4PJXA 2E3VA 2VB5A 4Z7OF 4AQOA 4OKVB 1E4XL 1OM3H 5HHME 3O3UN 2XACC 3QUZD 1OWRM 2ADIB 3LKNA 1BAFL 1Y6NR 2GITB 3UP1A 4AK1A 3EHBD 3MXWH 1FAKT 2GT9A 5EG6C 5F7HA 4OLYH 3REWB 1ZHLB 2H45A 2HT4D 3HMWL 1DVFB 1D5MA 1OTTD 1U8QB 5LAXB 4PTTB 1ERNA 2YPVL 5JDSA 1S9WA 3WIFA 2MQ0A 1P5VA 4YX2L 5EIIA 3R06A 5B39G 4EIGB 1ETZB 1CIDA 4YHNB 3ULUH 4X5XB 1SHMA 4JDTH 3MCKA 4HLJA 1GYAA 3DXAD 2JF1A 3Q6FB 4YHZH 4U1NA 1DEEA 5DK3A 3MXWL 1VFBA 4OLYL 5FB8B 3SE4A 2VE6A 3O3DA 4HLZH 4ZQKB 3GMLB 3QRGH 5ACMA 5TE7H 3MV11 3NABL 4UNUA 4OUUB 5CMAB 4BKLA 5IT2L 1J8KA 4YLQT 2O61B 1MCQA 5GGSB 4LEOA 1W8OA 4L3ED 3PL6C 5ABDE 1U6AH 4R3SB 1LO2H 3P4OA 4QRRB 2Z93A 2HVKB 5DRWB 4OM1L 3OKDB 4LHUD 4KJYB 1KLGA 5HHXL 4B0MM 4YHZL 3FB5B 3IFOA 3IAQA 3BDBA 5F89A 4P5MB 1OOAA 3HC3L 5T1MB 5T1KA 5E94B 1ZSDA 5D93C 3ARBC 5IQ7L 4JDZA 2VDRH 3MJ9H 2DL2A 3AMLA 3BRGC 2AJSL 5DA0B 5C08D 4M6NH 4EQ2A 4PJ5A 2IG2H 5BO1H 3L3KB 4UT7H 1YEDA 3CZFA 3VDBA 2AEQH 3HZVB 1EUTA 3DLQR 4FFYL 1OW0C 1NKRA 5HHNA 1IM3A 3ARPA 4M62H 1OSPH 3WLWD 3MACH 4XMLL 4QXWA 4TUKL 1OGAE 3BKCH 4FQ2H 4C83A 4KKNA 1HCFX 3TV3L 2VLJA 3MJ9L 3SEPA 1WZMA 3TT1H 2OL3H 1IE5A 1E4XI 2GHWB 1QA9A 1CD1A 5BO1L 4UT7L 3L3HB 3RHWF 3OB0K 4P2QE 1GAFL 3UX9B 5DTFA 5EWIH 5KS9E 1EAPA 1JV5B 3RVUD 4HKZA 4APQC 1MFBL 1TVDA 4F3FB 3DJ9A 3K4AA 2RJMA 4AEIL 4TVPE 3O3EB 2W60A 4M62L 3VFGH 3GJFH 2GJ6E 4JZOB 3SE3C 4OSUL 3FKUS 4FQ2L 3PGFH 4Y2DA 5J56B 2K7QA 4LMQE 3SKOB 3TT1L 3L6FB 2P8PA 5IMKA 1YEJL 5JTWA 1F3DH 3JVGA 2WLYA 3BD3A 5SX5H 3EOTH 2V5RA 5HVHB 3IETA 4BFIA 1F97A 2K3TA 4X7FC 4M93B 5JOEA 4P23D 2X4QB 4R4FL 1UJ3C 1AHWB 3C09B 1OLLA 2K1MA 1P4LB 3RJDA 1RK1B 1T1YB 1XF5B 4P2OC 1YNTA 3BKJH 1OSZA 3MC0A 5HGBB 4HWBL 1GGBH 3OKYA 3PWVA 3QG6A 2YEZB 4Y4FB 4NRXA 3MBXH 3LKRA 4PFEA 2OR8A 5A2JH 1OL0A 4LVEA 4YBLB 4N0YH 4PJFF 5BV7C 5GZOC 4OKVA 5HGDA 2NQCA 5FM8A 4MNQB 3NH7H 2Q7NA 3BE1L 3TGXA 2D7PA 3LQZB 5F1IB 3MRNB 1GGBL 4G6MH 2X10A 3NA9H 4GOSA 5M94B 4FQIL 1U8JB 3REWA 1IAKA 4QNPE 2F54D 1DVFA 3W5MA 3DO7B 4PTTA 3JBG7 3P4MB 1L7IH 4MXQD 2I5YL 3WIIH 1KTLB 1R3LB 2ICCA 1MCCA 1WFNA 1OGAA 2O26U 4YHNA 1IFHH 3NH7L 4X5XA 4UT6H 5FF6B 4ZO9A 2ZUVA 3Q6FA 2FO4B 4P2QA 2DDQH 4M3KB 5KS9A 5C0FA 4G6KH 2RBLA 35C8H 4ZQKA 2R56H 5GQBA 2EXYC 3P3YA 4FFWD 2XTJD 1D9KD 4M9PA 3B83A 1L7IL 1NMCC 2AXFA 5L2JB 5EU5B 1NGYA 4FQXC 4OUUA 3BO8B 5CMAA 4YE4H 1ONQA 4XXCC 2EE2A 3GHEH 5IHUH 2EDLA 4C56E 3GSOA 3ZKQD 5JOFB 2D0HA 5DRWA 3OKDA 4KJYA 4Q6IB 5CBAA 5EC1B 3FB5A 2H6PA 3ZDYE 2GTZB 5T1MA 4Y5XB 3S7GA 5E94A 35C8L 1JPTL 5EZJA 2R56L 3SDYH 1J11A 1XT5A 1NUNB 2VXVH 1FGVH 4Z7VB 1NCDL 3VXTB 4ZNEE 2OZ4L 3C5JB 4YE4L 2VDQH 5TDPB 1LEKB 2DAVA 1A0QH 4WEBH 4XBPB 1JYVA 1PZ5A 5L0QB 2GY7B 2ADFL 3MA9H 1JF1B 2BXZA 3KHQA 2YD1A 4HBCH 1QSFB 1CDGA 4MAYC 4L3CB 3PGDB 2KUTA 4PRDA 1FGVL 1L0XA 3TZVB 1H8NA 2H26B 3PP4H 3QXWA 3U46B 3WHE1 1VKXA 2Y06H 3L3HA 1KOAA 2ERJC 3ZE1E 5LWYL 4F3FA 4Y19D 1AGCA 1A0QL 4WEBL 1P84K 4Z9KB 3KDMB 5KSUA 3O3EA 5LCVL 3ZTJG 1DQLL 3MA9L 5IW6B 1JK8B 3NCMA 3SKOA 1WCBA 3BP6B 2YRZA 4OZGE 2G2RA 3PP4L 4ZUTA 3ARRA 1J7VR 8FABB 2FBJL 3UROR 4X4YB 1I85A 4UU9B 2UWEB 3DYPA 3NIDE 4KZEH 4LVNB 1QNZL 4HIXH 5JIPA 2X4QA 3TH3T 4KK9C 4YPJA 3FQNA 1LE5B 1P4LA 4JFDD 1RK1A 2H2PD 4NO2B 1QQDA 1XF5A 1OPGH 3U79A 1FPTH 5HGBA 2FSEB 5D6DC 1U91A 1K3IA 4LCYB 5CGTA 4P5KB 1NC4B 1V3LA 3HI5L 2YEZA 3MLSH 1M7DA 3FB8B 4Y4FA 3GMOB 5A2FA 4C56A 2LTQB 2ORBH 3QWRA 3O9WA 3VWKD 4HIXL 2ICWA 5E2UH 3NZHH 4MA7H 3GMRA 3RZWA 5LBSH 4OLVL 3R8QA 1HIML 3O8XD 1VDGA 4Y5YA 3H6JA 2AQ3A 1KT2B 3LQZA 1NUDA 4ZNEA 1U8MB 3U36A 1F4AA 3MRNA 2OMNA 1YMHA 1ZLSH 1FIGH 5BS0B 3Q1SL 2D03H 1X9QA 2HJFA 4XI5D 2QEJA 5IW3A 3MNZA 4Y5VC 4LLVB 1WUNT 2MHAB 3B43A 4KI5C 5J8OA 4ZTPH 1R3LA 3NZHL 2C3HA 4MA7L 4NN6B 2C7UB 1KN4L 3WO4B 3QIWC 3PWNA 4PJDF 5FF6A 1ZA3B 3KPPB 4JRYD 4ALAH 5FECB 5DJ6B 2FO4A 1NC2A 4WGVB 4UB0H 1ZLSL 1S78C 3LD8B 4MDJB 2GW5A 1I1AD 3I6KB 1IKNC 3ULVH 5B38A 2WM0A 4RDQG 3TBTB 5DA4A 2Z0BA 1SM3H 1X4YA 4ZTPL 5EU5A 4OF3A 3RY5A 3TIEB 5L2JA 3MCLH 4N1EA 4UV4H 4RMSA 3BI9X 5JZ7D 5ID1B 2IAMB 4OZGA 3PV6B 5JOFA 2OBGA 4Q6IA 3HZKA 4UB0L 4L1DA 1GGUA 4Y5XA 3PG2A 1WICA 2NXZC 3L3OB 4BFGA 1HHGA 1U8IB 5CAYB 3DRTA 5K9OB 4PGJA 4Z7VA 1UWGL 5MEQB 1JI2A 1F58H 4TTDD 3TYGH 3C5JA 2ADJB 1MHPL 4EDXA 2DL9A 5IJKC 3OAUL 5TDPA 1HZHH 1LEKA 1EH9A 4M7ZC 4Y8DC 1UZ8A 2DI7A 3CMGA 2HFEB 4BH7B 1ORQA 4OJFL 5TGBA 1KCRL 1RV6X 2BSRB 1P9MC 2BXYA 5T1KD 3EOBB 1MCPH 1A1OB 1NBQA 2WUBL 3TZVA 4K71B 1F58L 2C5DC 3TYGL 2JCCE 1S8DB 2ZNXA 4CU8A 2DS4A 3MRMA 1G6RB 1S7SB 1IGFL 1X5IA 3T0XA 3VXSE 3V4UH 3RKDD 3TBYB 1JZ4A 4BQBA 2G75A 2BMKB 4O02H 3WSQL 4JDVA 3UTSB 1Q1JL 3MRGA 2F53E 4Q97A 2B7DT 2VWEC 4ORGA 3BP6A 5EUOB 1MY5A 4MXVF 3VXUE 1GJIA 4RGOH 4QHNB 4LPTA 3C9NA 5EOQH 8FABA 4X4YA 1J8HB 4GLRH 3T08A 1YNLH 1RMFL 2UWEA 4HK3J 1I8LA 4PJ8A 1D5IL 5DD6B 5IB4B 5CUSH 1ZA6B 3TA3C 1A1MA 2E6PA 1WZKA 4MQXC 1FVCB 5IESH 1LE5A 4P59H 4YK4C 1B4JH 4JM2B 4UMGA 1SEQH 3ZE2F 2ESVD 4JKKA 2I27N 3GM0A 4LCYA 1JYWA 4P5KA 1NC4A 4O2EB 2YPLD 3EDDA 2NPLX 5EOQL 1CG9B 4JY6A 4YH6A 1B9ZA 1A6UL 5BZDB 1NGZB 1G9ML 3K1DA 3B2UC 3ZE0E 5CUSL 5JHDB 3B6SA 3GBMH 1CFNB 4NN5C 3QNZB 4V1DE 1JFQL 3L7FB 3WNPA 3QUKB 3WXVL 5IESL 2P44B 3F6LA 1JBJA 5J9PA 3INUL 3UBXB 1DUYB 2EDWA 1IEHA 1I7RB 1H0DA 2FATH 5BS0A 1MJ8L 2AJZB 3GSNL 2Z92B 1CXHA 4LP4A 1Q0XH 4M1DL 4RMUA 5FOBB 4LLVA 4HIJB 1KSRA 3HNVL 2MHAA 3L3JB 3PWPE 3QIBD 4K9EC 3SDAD 5CSZA 4DGYH 2LAAA 2YHGA 2V2XB 4YDIH 2N56A 4X6BA 5GJTH 1IC5L 5JQ6H 3OTTA 3BUYB 4PUBH 4E41E 2FATL 1FFOA 1JHLL 5AAWA 2X89A 3H2WA 4MDJA 5DRZB 3I6KA 4ZAKB 3VXSA 4HMEA 4H0IA 1KIRB 1A9EA 5D7IB 5JXED 2APBA 4S1RL 4DGYL 4K07A 1I8KA 1U8PB 3PF2A 3MOAH 1EDQA 2JK5B 3RVTD 1CS6A 3MLUH 3QUXD 5JQ6L 3ZKXC 4F9LC 5ID1A 1R5IA 3PV6A 5E9DB 4X6DE 2Y7QB 2Z31C 1YEIH 2AV7B 4KJWC 4LVOC 3WFHA 2A6KA 1T7YA 4BSWB 4L4VB 3GGWB 5MEQA 1A6TB 4JZJC 4ZS6C 3MOAL 1P7KA 2VXSL 4DVBB 1F4XH 5J13C 3MLUL 2H32A 3BQUB 3F8UB 1CVRA 3W2DL 4YFDB 2NY3C 2A6DA 2MNUA 4QRRD 3BKYH 2HFEA 2CO6B 1JZ2A 1YEIL 4YDKH 3O2DA 2PR4L 1EHNA 4KTDL 2W9EH 2X4RA 2E9BA 5ICZB 1FLTX 2P43B 1S8DA 1F4XL 3NCEB 2HFGH 5EA0L 2JJUA 1G6RA 1QD0A 3GI9H 4FQLH 1IM9B 3NFNB 4JFPB 3WUWG 1F6LL 4X9FA 3HE7C 3TBYA 1Y18A 2EO9A 1ZKAA 5DLMH 1CFVL 4XVJL 2R9HC 3UTSA 1Q94B 3PJSB 4WI7A 1FJ1A 3BGFB 3PWPA 1EHAA 4F7CB 2W9EL 5EUOA 4PGZA 2QL1A 1KPVB 2R2CA 4HJ0C 4ZDHB 1F45A 2CXGA 2VDLL 3AMKA 3KYMB 1ZOXA 4KKAC 4OAWB 3WJJA 3WYRA 2HFGL 5HHOB 2UV3A 2LU4A 4U6HA 4Y4KA 2CXKA 4FQLL 1QPXA 3T65A 5DD6A 4ZUSA 1TFHA 1YZZA 4GFTB 4E42B 5L8LB 1DE4B 2R1WB 1CGVA 1FVCA 2YXFA 2CLRB 5DFVC 1Z2KA 4WI8A 5GGUB 3QR2A 5SWQB 5DJCA 4O58H 4YGVB 4XVUD 3B9AA 3LN9A 1YA5A 3ESUF 3QEGH 5GRZA 1FV1A 2X5PA 5B3JF 5GS0H 1DLFH 2UY7A 4LBEB 4X6DA 2BVEA 3B2VL 4K94H 1CFNA 4GXVH 3SKJH 4KKLC 1KJ2L 1KCSL 1N5YL 3UBXA 1MCBA 3VWJB 1X5XA 1CN4A 3T4YB 1AGFB 1TPXB 2HLFD 4RFNC 5MENB 1KIPA 3LRSB 5CLWA 3BP5B 2Z92A 4D9LH 3VD9A 1RURL 3HE6B 4HIJA 4RZCA 5TE6H 1RUMH 2V5SA 1YPZB 4PBVC 1FNGA 4PRIB 4GXVL 2YKLL 1IGML 1DSFH 3SKJL 1CYGA 2XKNA 5GSRA 1JGDB 4Z77B 4HWUA 2BRRH 4MNQD 4X6FB 2X4SB 2L0DA 1BFVH 2ZKHH 1RHHA 3U0TB 5CD5C 4YWGL 3VCLA 2HJLB 3B8SA 4L4JA 5DQDL 5F3HA 5DRZA 3HHRB 2C3GA 4XZUB 4KVCH 2ARWA 5E0QA 3SKMB 2PCPB 4IDJL 3NMEA 5D7IA 3NPSB 4HBQA 5F7FA 4L29A 5FK9B 1KTRL 4NGHH 2VKXA 2GK2A 1G1CA 2BRRL 3O4OC 3IDIA 2ZKHL 2Y7QA 5ALCH 2AV7A 4U1LB 5FCUL 3LKPA 3WHXB 1N59B 4BM7A 4KVCL 4BSWA 4IOIB 3RI5F 3EHBC 5EU3B 3T04D 1MAJA 2G5BB 2NR6D 2UUDH 3GGWA 4D9QD 2KZWA 4DVBA 3ZT6A 4X0KA 1AKJB 1II4E 3V52H 5LGJB 5SWSB 1AGDB 3U7WL 1CT8A 1IRAY 3RY6C 1RZKH 1CXLA 1K4CA 3K8LA 4EN3B 2IFFH 4P9HL 3T8XA 1BZ9B 2ZCKH 3VXNA 3MZTA 3D9AH 3TBSA 3BPCA 2FBOJ 3V4VL 1P5UA 2X1QA 2YN3A 4WNQA 3SDXB 3OAYH 3AUVA 4YHMH 4XC1L 1RZKL 1IM9A 5HYJD 3CGTA 1S7VB 1WK0A 2WV3A 4JFPA 2NTSP 4FQHA 3RVVC 5D72L 3V5HA 2WK2A 3DBXB 4KUZH 1GZQB 4XNZC 5EZLB 2KPNA 2HTLC 1DL7L 5FGCE 4YHLL 2J5LB 3HUJF 1QBML 1YEKL 1DBJH 3OSKA 1FYTB 2F54E 1AIFB 1YC7A 1QSFD 3GBLA 4NYLB 4R4BB 5IVXB 3KYMA 4FA8A 1KLUA 4HUKB 3ZTNH 1HYSD 4G6JH 3LB6D 4MJIE 1OHQA 2AEWA 1WT5A 1F4YH 3GMQB 4LOUD 2PYEB 4ONFH 4D2NA 4KK5D 3J8F7 1AGEB 3C2SA 4OCRL 4E42A 3KHOA 4MYWB 4HQQL 3VFWB 5GGUA 3KPSD 5T3ZE 5FDWA 1UXSB 1N6UA 5I9QC 4FTVD 1DBJL 2XT1B 1G0YR 2R8SH 4YGVA 3ARGA 2B20A 3OXRB 1T21B 1S5HB 4F8TA 3AXLA 4IJ3B 1F4YL 4LBEA 3H42H 4XCCL 4JANA 1L6ZA 3RVUC 3EFDH 4GG8B 4YC2B 4GW5B 3QEHB 4WU5B 4NQCB 3SKUD 1AGFA 2R8SL 5MENA 1W72A 1RAMA 3LRSA 3M1BB 5ESVA 2UVEA 4LGSB 3G5XA 4EEEA 3OF6A 3S5LB 3IJSB 4BZ2L 4M02A 4DQOH 4MA3B 3N9GL 4WUUE 3H42L 3MPCA 4PRIA 2ID5A 2AXJA 4NWUL 2HG5B 3IXAA 4PV9A 3QXAB 4TQEH 4XCFL 5KTEH 4X6FA 5FYKH 2AJUH 3IS1X 3ZHKA 1S7QB 3AGVA 2CRMA 2OI9C 3U0TA 4QY8B 1N64L 4F80A 5F70A 2AKRB 2B1AH 2P24A 3AB0C 4XZUA 5T3XL 3QXDB 2PCPA 1RUQL 4JHAL 3VFUA 3TFKD 4MX7B 2HMID 2J8UB 1RZ8B 2CDEB 4ZFGL 4TQEL 2P5EB 4N1HB 5I6XC 5KN5A 5ALBH 4AEEA 4P4RA 5FYKL 2AJUL 1ZVSA 1HEZB 3QO1A 4JO2H 4YXHH 4FP8H 1JPST 3SE8L 4MJIA 2I07B 3WHXA 1S3KL 1L7TH 3CFDA 1XR8B 1PLGL 1NGQL 3IDXH 1B6UA 1GZPA 2PTTB 3QAZB 4K2UH 3ZKND 5LGJA 3F5WB 1BMGA 4PJ7B 5SWSA 2MKLC 5HHVH 3RQ3A 5ALBL 6FABH 2QBWA 3S8WA 2ZWLT 4NT6B 4MQTB 3SHSA 4JO2L 2IAMD 3CPLA 3TCXA 2AJXL 5DK2B 5F1NB 2C3XA 4EN3A 4P2RE 1NFDB 4PLNC 3VI4F 5MHSE 5LXGH 2B4CC 2QKIA 3BPOC 4JG1L 1G7QB 3IDXL 1CGTA 3ZDZF 1I9IH 3MV8D 1WIUA 1YQVL 1SBSH 4DKFL 2PO6C 3DX9B 4XB7A 2XTJC 3C5ZB 4OCYH 5I74B 3Q2CA 4RMWA 1CDJA 1RU9H 4E0RB 1EZVX 1W2KT 4LQ1A 3IFLH 5EZLA 3LCYA 2EDNA 3ARYA 4ZSOB 5HTSA 3EKCA 1C5BH 1B2WH 2BSTA 5GISL 4WUUA 2I26N 3O6KH 1NMBL 1QUNA 5EN2B 1AIFA 1I9IL 1T4KB 5BV7L 2OL3A 3K8MA 2HAZA 1WWCA 2M1KA 4R26H 1ZLVH 2R0LH 3T1FA 5CGMA 2BOCA 4OCYL 1NFIA 5DRXB 3GMQA 4XRCA 4G80B 3P73B 4U1HB 1AGEA 1SYVA 3QFJB 3IFLL 2ENSA 4JRYE 4N0UE 5I1JH 3GJFA 4OM0L 3VFWA 4ZXBB 5DJ8B 1UXSA 4TNWK 5K59E 2Y5EA 5DD1H 3MCG1 3O41B 1S5HA 4R26L 4QHLA 3W11C 5JW4Q 3RAJL 1AR2A 4EQ3A 1QPPA 5EBWB 1J8HD 3WL9B 1ADQA 3OG4B 5L8KB 4DKAA 1TCRA 5EOTB 5EORL 3S9DB 4GG8A 1G9NC 4GW5A 1BQHB 3MZGB 4TN9A 4WU5A 3I3EA 4MQSB 5DD1L 4JM2D 3R0MA 2HRPH 3M1BA 1FNAA 4TSAH 3IF1A 3IJHB 5E2TL 3S5LA 4ZUUB 3A6CH 4PJHF 5E6IC 5FKPA 1U3JA 1U9KA 5BQ7A 4HEPG 1MCOH 2HKHH 2CRIA 4P2RA 1RVFH 3ZKMD 1D6EB 2HG5A 5JHDD 3RX5A 2ZP0T 4Q9CA 3KYOB 4F9PA 2RB8A 4ZFZB 2DQUL 3QXAA 5CZVH 3NIGF 5FOJA 2VLRD 1S7QA 5DJAA 1MF2L 3NN8B 1EZVY 2HRPL 2VDPL 5M7QA 5JOPD 4QY8A 3VFOB 4Z95H 5HYSB 1XF2A 4OD1H 3DX6A 4NZUL 5L88H 2EDTA 3QSKB 4F15B 4JQXA 3QCVL 2WBJC 5FV1L 3VXPB 4DN4H 1I3GH 1F8TL 1JGVL 2J8UA 3X14B 4NM4H 4NUGH 5FHBL 4LK4A 2CDEA 2LU3A 3WFEL 4AT6B 1DBAH 3BDYH 5CZVL 5BMFH 1NGPL 4Z7UF 1PW3A 3JTSA 2OP4H 2I07A 3TBVB 2EYRA 2DQHH 3F7RA 3G5YB 3D0LB 4OD1L 2BSSB 3EIFA 4ZAKD 1NSNH 3K46A 4JAMB 43CAB 3GRWH 2O93L 1I3GL 3G5ZB 3F5WA 4NUGL 5J11C 1BJ8A 4GMSH 2PTUA 2GAZB 1B88A 2EICA 3EYSH 1MHCB 4NT6A 2BNQE 1B0GA 5E9DD 5T1DH 3BGMB 5I1CH 2ESVE 4DOHE 4WO4A 2DQHL 3MLRH 4Y4HB 1I8MB 1A6AB 3FQXB 4JFYA 5D4QA 4JREC 1NSNL 4NFDA 4L4VD 4O5LL 2DB8A 1H5BB 3PABB 5DC0A 3TPKA 1V05A 4NKMB 1CFBA 3EYSL 1N7MH 1J0JA 3EYVA 3BQUD 3V9FA 5I1CL 1I3UA 1X5JA 4PJEB 2QQKL 7FABH 1MVUB 4JRWA 5F7EL 4H88L 4FG6C 1TVBB 3MLZH 1RIUH 3QHZH 5EN2A 2XKSA 2VJXA 2YR3A 4ZS7L 1T4KA 4YQXH 3SE4C 3QUMH 3BP7B 4HWZA 4WHCA 4HJGA 3WKMH 1J1OL 1N3NB 4JPKH 1QEWA 1Q9OB 1RJZA 1FG2A 3MNWB 4K7PH 3UZVB 3IDYB 4G80A 1N7ML 3P73A 4U1HA 2WBKA 1U0QA 5EFIB 2YXMA 1P1ZA 3MLXH 3PQYE 1MPAH 4ZXBA 7FABL 3VFTB 2D31A 2Z8WC 1RIUL 3EJZC 3QHZL 5KW9H 4H20L 5JW3L 1C5DA 1CBVH 3WKML 4JPKL 2CIKA 3V79C 1A9BB 5HHOD 1JNNH 1YC8A 3ZL4H 3DHJA 4PLKD 4MLIA 3HC0B 4JGMA 5EOTA 4MXWH 5FEBA 3MLXL 4K23L 1GGYA 3RKDC 4ZFFA 1BQHA 4ODHL 3VRJA 5C92A 3BRDA 4NDMB 5KW9L 3BEVA 3F12B 2OTUB 5JMRA 3IJHA 1KCUH 1DDHA 4LSRH 1SMOA 1CBVL 1E27B 4ZUUA 3W9DB 5IMMB 2Q86A 4JR9H 2BNQA 1JNNL 5E99H 3ZL4L 2EDFA 1C1EL 3KYOA 4PJXF 2WINB 2NY4C 3ZKSD 5TDNB 4GAYA 4YHYC 1RULH 3KGRA 3REVB 5I1HH 3ESVF 5H94A 2F8OA 4GS7B 3VWJD 3NN8A 3WN5A 3H3BC 3W9EA 1KCUL 3CDYA 3HZYB 3VFOA 4LSRL 5EC2B 3GJEB 5IBTL 4Y2DC 1MREH 4ORZC 4JR9L 1MRDL 2F58H 3HE6D 4YHOL 1CLZH 1G0DA 3WV0A 1DFBL 3JVGC 4NSKA 4PRID 4HKBA 4XP6H 5C0RH 5FUOH 3T2NH 4XVTH 3KJ4B 1RULL 3CSYB 5EBGA 1FSKB 1CI5A 1HHKB 3DYOA 4ENEC 1KEML 3SY0A 4FXGB 1NAMH 1JGEB 3FB7A 1HH6A 2CKBA 1MREL 4KAQH 3G5YA 3PHOA 3D0LA 2A0LC 1Y0LB 3EOYG 4X6CB 2F58L 3GIVB 2YD3A 4FQ1H 2CUIA 4M3JA 1PKQB 4LPWA 3G5ZA 4G9FB 4PJIB 4HDIB 5FUOL 4F2MA 3T2NL 5C0RL 5DFTA 3QA3A 4ONGH 2NZ9D 2GAZA 4CVZA 4D94A 5CEZL 3ALWA 3VFNA 3PXJA 4NZJA 4U0RB 1MHCA 2FRGP 1UWXH 1WAAE 3EJYC 1BFSA 1I1CA 2CMRL 1NAML 4U1KB 2XN9B 1FBIL 4J12A 1HHHB 5ISZB 4KAQL 3FQXA 4EZMA 5E7BA 4MB4A 1BJ1J 4UT9H 1EK3A 1H5BA 4WFEE 3PABA 4UOJA 1OAKH 1S7TB 4NNXA 2B8OT 1DVFC 1AKJD 4LRNL 2Y9RT 1I3RB 4DKDC 1ZS8A 2YD4A 3E8UH 3C5SA 4P46A 1T89A 2XI9A 1L9MA 4PJEA 2HVJB 1UB6A 2N7BA 2YBRB 4B5EA 5DT1L 1C5CL 3WFCH 4UT9L 3BP7A 1OAKL 2VC2H 3VH8G 5JPMA 4GKZB 3MNWA 4M1GH 3JTTB 3E8UL 1L0YA 1WTLA 2DD8L 3O6LL 4FFZH 1C16A 3VFTA 3D18A 4PRPB 5HHPA 4K9EL 4XMKH 2A77H 2GY5A 4G6FD 4PY7A 1JZ7A 32C2A 5F71A 1FYTD 3TM6A 4XHJD 2J12B 4F37K 1OARL 1UEYA 5E2VH 2WBWB 5B22A 3U9UB 1P4BH 4RBPH 4M1GL 4XT1C 2XRAH 5KJRH 4ODBD 3HB3C 4JPVH 4XAWH 5KG9B 1IQDB 1GOHA 4PJBE 2PYED 4G8GE 3WNLA 2EDEA 3OPZL 4FFZL 1TZIB 4RAVB 3FQTA 4M03A 3MV9B 5ESAA 3TO4B 5GGRB 3U6RB 2FR4A 3DGGA 1T5WB 2A77L 2CO7B 3F12A 1XF4A 2OTUA 1UM6H 1KJVA 3AAZA 2KH2B 1MH5B 5IMMA 4D9QE 5I15L 4W4OA 5E2VL 5E00B 4IRSB 5A16B 4XAWL 3CLEH 2BC4B 1IL1B 1RPQA 1W0VB 4QOKB 5I71B 1A6ZB 1DQQB 2Q20A 5IK3A 5I1AA 3HTLX 5TDNA 4OT1H 3REVA 3RNQA 1H3UA 4J1UB 1JZ5A 4NQCD 2PXYB 2IC2A 1S9XA 3HZYA 4R90H 1KEGH 2DLHA 5IW1B 5EC2A 1YEGL 4LSQH 4OTXH 3LDBC 4M6ML 2OK0L 3MRQB 1PG7X 4WEMB 4BH8B 4M4RA 3CLEL 4KROB 3VG9C 5HYJE 4LF3B 4POZC 4GBXB 2PETA 5HVHC 1PSKL 3C6SB 5DWUL 1I85C 5I8KH 3NCYS 4UDTA 4M00A 4OT1L 3RU8L 3S4SB 2R0KL 4CNIA 1XF1A 2DIJA 1WEJH 2I60H 4FXGA 1A1NB 3C09C 1XEDA 4Z8FL 1KPRA 4LSQL 1KJ3H 1RIHL 4XNUH 5IGXH 3PDGA 4X99B 3JZ7A 1A7QL 1Y0LA 4X6CA 5DJZA 3TC9A 1N2RB 2GQHA 1D5BA 1PKQA 1HILB 1HSAA 1F11B 4G9FA 4PJIA 1J0IA 4Y4FC 3GDBA 3DMMB 4NJ9L 5FM5M 3O9WC 1D6VH 3KPSE 2P5ED 1YYMH 1WEJL 2Z8VC 2I60L 1OT2A 2C26A 4FTVE 4U1KA 3OJ2C 2XN9A 4K8RH 1HHHA 5JNYA 4H8WC 1VFAB 3BZDA 3OWEA 1A5FH 4NRYA 4PJBA 4G8GA 12E8H 2RCSH 1R0AH 1KB5H 4QGYA 3HPJB 4PS4H 1AXSB 4JHWH 4Z5RB 3V7AE 1QFWH 4ODXB 3MBEB 5HGHA 5I16B 4MJ6B 2XZQH 1I3RA 1D6VL 4HPOL 4OGZA 2BSED 2XQBH 1YYML 1UH4A 4X83A 1VFMA 1X5ZA 4YDVB 5DJ2B 4NNYA 4FRWA 3OGCB 3QFDB 4M43H 2YPKB 5DUPH 3T4AB 1ZTXL 2CLVA 4UDUB 2YBRA 3HMXH 1W0YT 4NZRH 12E8L 2DWDB 2X6MA 5E4IA 2BNRD 1QOKA 4HUWA 3B3IB 4NUJA 1GCFA 1MFAL 4F57L 3WNNA 3CLFL 2NR6C 5HDBF 4GKZA 3C5ZD 4YXKH 1A47A 3QPQC 1KENL 3JTTA 4XWGH 4D8PB 2MPAH 3NCCB 1UCBH 5FO7B 2Y07H 2ICEB 4OB5L 4WDIA 2E7CA 3QJHB 4RQQB 5GHWH 5GIRB 4NZRL 4Q6IC 3QO0B 4NP4L 4ZYKB 2SEBA 3VE0A 1T2QH 2FECL 4Y5XC 1IAMA 3NFPA 4WTXA 3ZYOA 4YXKL 3PP3H 1S7XB 1AXTL 1IQDA 5IMOA 3UTPD 1BJ1H 3VMPA 1Q8MA 1NAKL 3K0WA 2Y23A 3H9YA 3QFJD 1KC5L 3MV9A 5F9OH 3TO4A 5FHAH 4GW4A 2MSPA 5GGRA 2KZ1B 3HA0A 1WIPA 4LEXH 4ZOEA 5GGVL 5GHWL 3KG5A 1MH5A 5I2IB 4NHCH 3I6LD 5E00A 3FT3A 3O45A 2Q8BL 3TZVC 4IOSD 1OGTB 3CVIH 5CSBA 1TQBC 1W0VA 3UO1L 5HYSG 1AO7B 2NX5E 4G42A 1DQQA 4F58L 4WVRA 5FHAL 4HUUB 5D93B 4LEXL 3P0VL 1EA9C 1N8ZB 4R96A 1X3DA 2VUOA 5EU6B 5DHVA 5IW1A 4JRXB 2MCG1 3CH8A 5AD0A 4M7LT 3MV8E 1T7ZA 3MRQA 4M5YH 1UH2A 4I77H 3WO3B 3CVIL 4ODVL 2CGRL 4NC0B 1BP3B 1PZUB 4PJAE 5J1TC 4X9IA 3C6SA 1IKFL 4PRAB 4X7CC 5KSBB 5ADOH 1CGSL 3FT2B 4GRWE 5DDHB 1I8LC 4PJ8C 1MJJB 5CJQH 2IADA 1D5ZB 1A1NA 4Q9QL 2VQ1B 4XPAL 2VAAB 4WUKL 4NRZA 2BRQA 4OZHB 2UUDK 3L5WA 4P99A 4APQB 1RIVL 4K3DL 4M5YL 4I77L 4Q58C 3BN9C 2CK0H 1YECL 4JKLA 5FYLH 5GGVY 4WU7B 2DICA 3W0WB 4JHZA 1SBBA 2W38A 5L9DL 3RPIB 3S34L 2XWJB 2YMXH 4X4XA 5AUMB 5IVZA 5KOMC 5CP3H 2LTQC 5IEKA 4Y1AE 5CJQL 5C6TL 4JJ5B 3DROB 1HWHB 2FJHA 3AU1A 4OZIE 1INEH 3V5KB 1N6QL 3D85A 1VFAA 4ONHB 1FNLA 4UIKL 4IEFB 1IGTB 4ZD3H 3VFPB 5FYLL 3JWDH 2YRLA 3OAYK 1AXSA 1K2DB 1CU4H 4Z7VF 1NBYB 4I3GA 4WWID 2X1XR 1UJ3B 1MRFH 2YMXL 4ODXA 1JHKL 3QWOA 1NKOA 5I16A 4MJ6A 3EO0B 2D7MA 3MUJA 4H5SB 2IPKB 1T0NA 3I75B 4NN6C 3V6FA 4OIBA 3WO4C 1OVZA 1CXEA 2NY1C 3SPVB 4XPFH 5C0BE 3JUYA 4Y4HD 2DWDA 4AJ0A 4WW2B 2NX5A 4YPGA 2D3VA 5ILTL 4LU5L 4OFIA 4DN3L 4QCIA 1MCJA 1NL0H 4CBPA 4X98B 1L6XA 2VLRE 2ED7A 5FO7A 1U42A 2ICEA 1ZT1B 5JOPE 4MJ5B 2IAMC 3EYUH 4P5TD 1NBZB 5GIRA 1KGCD 4ZYKA 1T0MB 3VXRB 4PJGE 1DR9A 4P48A 2LVCA 3QZWB 1VEOA 4WW1B 4XHQA 5D7SH 1U8KB 1S7XA 3H3PH 1J05A 5D2NB 3QB7C 2OTWA 1BF2A 2UWEF 4CADB 4KGJA 1MIEH 3GKWH 1YEFL 5F7MC 2IPTL 4UNVA 2FJGB 2BCKB 1UG9A 3F7PC 4IOFC 5BOPA 4HUXA 1QYGH 4J4PA 1CD8A 1L0QA 4P9MH 3RBGA 2YUWA 4OBRA 4Y1AA 4FN0A 2BY2A 3UTTD 5BRZD 1UQSB 1TQCB 3MRBB 4K71C 2Y6SD 4OZIA 4I13B 2KQMA 4XCNB 2CUHA 5K93A 3B9KA 3HC4H 3GB7B 4HUUA 1N8ZA 3D2UB 4I5BB 2P5WE 4WWKD 2IQ9H 1DQMH 1GIGH 4NQDE 2C4XA 5F21B 1JIBA 1K8DA 3CU7A 4AYFA 1K4DB 1OAUH 4DKEH 3P4LA 3Q5YA 3WJJC 4L8CB 2PNDA 4PY8I 3EGSB 2B4CL 4Y4KC 1BGXL 5C0BA 4LASH 1VADB 1E6OL 3HC4L 5EO9A 4J3UA 3I6GB 3MV7B 3FT2A 4ESKA 5DDHA 1MJJA 3VA6A 4MAYB 1GIGL 1D5ZA 4JN1L 1UZ6E 3O6MH 2VAAA 4CUCA 4HHAB 4LGRB 3VG0H 1LNUB 5HI5C 2PKDA 4JFOA 3GI8L 5AYQA 4LIQE 3H8NA 1FNSL 1GL4B 3I02B 4IMLB 4YFLI 4BSJA 4JFHD 1HDMB 3RPIA 3CK0H 5I1EH 3CFBA 4LASL 5I30H 4GAFB 1SJEB 1MCKA 3ZKMC 3S97C 4I18B 3UJJL 4LLUA 5ACLA 3O6ML 4MD4A 1ZT4B 4U31A 4GAJL 3V5KA 5L7XH 1JYNA 4L8BB 5DHYA 2HKFL 3D39E 1ND0A 3MROB 1NCNA 3VFPA 3D0VA 2A73A 2BP3A 2DOCA 1CICD 1G9NH 3FTGA 8CGTA 4H5SA 2OYPA 2IPKA 3WBDA 3ARFB 1KXQE 5EBLA 3I75A 1VA9A 4HIIB 1YYLH 2E9WA 1F4HA 3IDGA 3TNNA 2DI9A 4LNRA 1DLHB 4YGAB 5L7XL 5EO1A 1OQXA 1J9CT 1CLCA 3D69B 4OCXH 5ISZD 5KSVA 1NLBH 4QHMB 4W6WB 4WW2A 1ZLVK 5FCSH 3BXNB 2XYCA 4TUOA 1NCAL 1KTKE 1WFTA 2H2SC 3PWJB 1G9NL 1CDIA 1VFUA 2P5WA 4X98A 4XH2B 1LO5B 1W8NA 2VN7A 2FGWH 3IDUA 3G08A 5IOPA 1U8OB 3HPLA 4OCXL 4NWTL 3FQRB 4Y5VB 4DZ8B 2HH0L 3VXRA 5EUOF 4Q9BA 2NYYD 1UENA 5SWZA 3EDFA 1CD9B 3QUMB 3O6FD 2LE9A 3BYYA 4NQEE 4PP2B 4MNGE 5D2NA 4OFYA 4CADA 4F7PB 4LSPL 1IGCH 4HV8A 5FFLA 1LEIB 3QQ4B 2VABB 2NY0C 1RQ5A 2FJGA 4H0HB 4M61B 1I7TA 2DLGA 1QSED 4HGWA 4JM2F 4PRPD 4PR5A 3QDAA 3QDGB 1TENA 3DSNA 3T0AA 2HJKA 4LAQH 1A4JA 1ULVA 2G9HA 1QLRA 3EFFB 4LLDB 3MRBA 3A67H 4OCWL 5CILH 5D8JH 3D3VD 3DX8B 4XCNA 3IT8D 2R29H 4RRPG 1ZWIB 1CK0H 1RZJH 2VDNH 1N4XL 2J8HA 3GZKA 4QRQB 1NCCL 4I5BA 4AY0A 1LDSA 3QNYB 4QWWC 4M5ZL 4ZOCA 4PLJC 1ACYH 2LU7A 4PG9B 1H3TA 1D5XB 4RSVA 1RZFH 4M7ZB 2WIIB 3HI6L 5IROA 4IRSD 4PJCB 4WI5A 5CILL 4WCYL 3GBNL 4L8CA 2AJ3B 5HXMA 3EGSA 3LS5H 2R29L 4LCWE 5BVPL 1E0OB 3GMPB 3I6GA 3KLSA 4QOKD 2BVUA 3LKSA 1WWWX 5E70A 4PLKC 3BSZH 3VDCA 5HHQB 2XZZA 2R23B 4ODWB 3WEXB 3FFCB 5IB5A 3BWAB 2BX5A 3FQWB 2PXYD 4M8QB 2XNAA 1I3VA 9CGTA 1IT9H 4HK3N 3RWEA 1LNUA 3KAAA 2DI8A 1T83A 1CL7H 2F5BH 4UTAL 1RZFL 2ENYA 2PN5A 4OI9A 1EJOH 5HI3D 4BZYA 3VD3A 4IMLA 4XNQB 2EDHA 5D7IF 5E8DL 2HA1A 4KROD 1R3HB 3HCVB 1LK3L 4GBXD 4KVNL 2JJVA 3O4LE 1SJEA 1G0XA 1XR9A 5I1IL 2DKMA 3DECA 3RVWD 3TPUA 4I18A 3WE6B 2NY6B 4C4KO 5D1XA 5EU4A 2VL4A 5C1MB 4L8BA 1NAMB 1F4WL 3QDHA 1P2CA 4NQEA 1T04B 4MNGA 1TPXC 5EPMB 3KPRB 4AEFA 4I4WB 3GRWA 2H41A 2PYEE 3CFCH 2RFXB 3S3SA 3DMMD 2EEBA 2DLFH 2DM3A 1IGIL 4LSTL 4PD4J 1ZK9A 4MA8H 3ARQA 3GM8A 1QFUL 5H35A 4QRSA 4EDWH 4HS8H 3D69A 4HS3A 4F33B 1BQUA 3RZCA 4NCDA 2ICWJ 4NKOB 4HK0B 1DUZB 3HNSL 3T0EB 3FO0H 3BXNA 3QH3B 4NN5B 1WZLA 2WWKO 5GRXG 5DJDB 4PBWD 1EEZB 3CFCL 3V0VB 5D2LB 2BVQB 1JTOA 2X44D 1FFNB 3NPSC 4K3EH 3MBED 2OXGA 3PWUB 5DJ0B 4MA8L 2OQJB 3O3BB 1U8OA 1FL5B 5EUKB 1YDPB 3ULUC 3FQRA 4DZ8A 5DZLA 1FH5H 1MNUL 4R8WH 4HXAL 4LCWA 4WJ5A 5FKAA 1EMTL 4JQIL 5C0EB 4GW1B 3UYRH 4XXDA 4K3EL 4TSBL 4PP2A 5IB1B 1J10A 5TF0A 3CSGA 1NLDH 3SQBA 2VABA 3DV4B 3OKMB 4M7JL 4M61A 4W81A 3MGTA 1CDYA 2QSCH 1I9JH 1JNHB 1H3WM 3T3MF 4EN3C 2VR9A 3O4LA 2ZSVA 3UYRL 3EFFA 3E2HC 3ZKXB 1TMCB 4PTUA 1U3HA 1TIUA 1H3XA 2IEPA 1NLDL 3AS1A 1S9YB 3OHXA 4D3CL 5DUBA 5MEOB 1MCNA 2DMCA 3U1SH 2PF6A 1IBGH 3QNYA 3U30C 2UVFA 1OD7A 5B8CB 4BK5A 2DQFA 2J5LC 3UC0L 4PG9A 5TQ2L 1CXIA 4JO4L 2VDKH 1D5XA 3DSFL 3STZB 2WIIA 2NY3B 3CSPA 3PL6D 1YPZF 5DEFB 3LIZH 4AM0B 1KN2L 3LSOB 4RNRB 1AO7D 4CVXA 1V3JA 5C0GB 1H9VA 3U1SL 5L2KB 3ARBD 4ODWA 4QYOB 3WEXA 4I3SH 3BWAA 2RHEA 4M6OH 5D7LB 3VFVB 2BNRE 5EU6D 4Z78A 3PNWA 4TVPH 4JRXD 3VU2A 2CDFA 3RUGB 1UKQA 3A6OA 3G9VA 4NNPH 3SDDA 3QWQB 3HE7B 4XNQA 4F7EB 1R3HA 3HCVA 1MCWM 2GYSA 4DTGH 1XGYH 5C71A 5KAQF 2DLTA 3KPQB 3CC5B 3SGEH 1UWXK 2KL6A 3RTQB 3WE6A 3ULUF 1T22B 4I3SL 3AS2A 1TTGA 2AV1B 4ODSH 5FYKD 4AG4H 4YC2C 4X5LA 1PG7W 4TVPL 5C8JB 1T04A 4NNPL 5EPMA 2O5ZL 4AENB 4APQD 3T77A 3KPRA 3SGKA 3GSRB 2VOTA 4XP5L 1G7HA 3W0WD 2JELL 2RFXA 3U4BH 5IVNA 3IVKB 1I1RA 1GGIL 2QJDA 4JG0L 2B0SH 3U7YL 5CD3B 1FFPB 1HXMB 4YDLC 1IAIH 1U3YA 4F9PC 2ZUUA 3QPXH 5C7XH 4J7RA 4F33A 4F7MB 1YNKL 4HK0A 1DUZA 3GSUA 3T0EA 3MA7B 1R3JA 3GNML 1KB5B 4RMRA 3SDXF 3OJDB 4N0CC 5DMKB 3U4BL 1JRHH 5C0AD 4JFXB 5D2LA 1FDLH 1QHPA 1DN0B 3VFMA 4LGPB 2EYSB 3G6JB 4MHHI 1WITA 4PRHE 4JQXC 1BWWA 1TXKA 2FGZA 4RFNB 2DTMH 2EO1A 1OY3B 1A22B 4GO6B 4R7NA 5L6YH 2XOTA 1G7MA 4NO3B 1RZ7H 5C0CD 4I48B 1GVIA 5IMLA 5IVXF 2FX9L 4YO0B 4RBPK 3RA7H 3FN3A 2C1OB 1JRHL 5C0EA 4GW1A 5GZOD 1XH3B 4JO3L 3OKNB 5IB1A 1KTDA 1IC4H 1WV7T 2R2HA 1YUHB 3OKMA 1AJ7L 5GGSY 4NZTH 1KNOB 5CBEA 4YXLL 1RZ7L 2EEDA 1Q0YL 1QBBA 3MGOB 5A40E 1F6AB 4TYUA 4WO4C 3RA7L 5C2UB 1DN2A 1ZXQA 1I7ZB 2W92A 2CRYA 4MS8C 2D9CA 2BNUB 4K3HA 3O4OB 3QEQB 3FFDA 4XNMA 3GMNB 1I1YB 4DW2L 1IC4L 4AIZB 5IFAH 1EO5A 3HG1D 4I3RH 5H37H 4Z0BL 4LMQI 5J1AB 5E8OB 2EXYD 3TO2B 3EUUA 4HWNA 5B8CA 3TNMB 1X5HA 3OB8A 4TNWF 5JXAL 3MRDA 4FQXD 4YDJB 4TSCH 1M71B 4HFWA 2B1HL 3OKOB 3UYOD 1CF8L 1UKTA 3KYAA 1Q9WA 4S1DC 4TOYL 3LSOA 1DBMH 3IXTB 4H8WL 3TJHC 4UUJA 5LQBL 3D2UD 2VITA 3BKMH 3OQ3B 1QLEH 4LCUB 2DTSA 3P30L 1TJIL 4ZXBC 3V6OE 3L3IB 1LEGB 4PRHA 4ZO6A 2EH8L 4Y0GA 1AGBB 4QTHB 2AABL 1JPSH 5E08L 1PQZA 4KV5F 2J8UF 4GKNB 1VEMA 5F9AC 3RTQA 2QHRH 3MV7D 4JFFD 4NIKB 1JRHI 1T22A 3BKML 1RFDH 4MAYD 5CP7B 2AV1A 5K33A 3H9SE 2ARJB 2J8OA 5AG8A 2GFBB 5C8JA 1JL8A 4KK8C 4HS6B 4DAGH 3A0OA 3FO1B 4JFEB 4H26A 3CIQA 3DIFB 1FORH 3GSRA 5J12C 1HK6A 2QQLL 2IAND 3IVKA 2D7TH 4PJ7F 2W65A 5I9QB 4HPYL 4YUEH 2DMKA 4PGDB 4DEPC 2FJFB 1HXMA 1XGTA 3N1PC 1IC7H 1KXVC 4KI1A 1NFDF 4JVUA 1CDHA 1MHHB 3RWJB 3IJYA 3WN5C 2DQCH 3UXFA 2APTA 3UTTE 5BRZE 2OJZL 1FORL 1KB5A 2PUQT 4Y16A 5DMKA 3VXME 5ERWB 4QRPB 2EYSA 3TVMB 4F15C 5DJYA 3BZ4A 4D9RE 3T0WA 1KELH 3TT3H 3IKCB 4KPHL 1FO0A 1TITA 3BJ91 3ARFD 1ZANL 2ICWI 4HJJL 1K5NB 1V3MA 3I9GH 3OX8B 2ZUQB 4RFOL 1A7RH 3IDJB 4GSDH 2DQCL 3CXDH 3HMXA 4I48A 3U7AA 1G7JB 1A4KB 1R3IL 2L7JA 4P2CG 4YO0A 4AMKH 2C1OA 1ZHBB 2P8MA 2ZSWB 3TESA 1XH3A 1EHLL 3ULVC 4UQ3A 3OKNA 3VD4A 2OSLA 3I3BA 1KELL 3TT3L 1AQDB 3V6OA 3HAEG 3MRFA 1A7RL 3AB0B 1F6FB 3DVGB 3CXDL 2IFGA 4HG4J 1KV3A 3CH1B 1VCAA 4IS6B 3GSWA 4PREB 4J6RL 4KI5D 4AMKL 1BD2E 4OV5A 4JFHE 2RIKA 3FONA 3MLTB 2OS7A 1Q9LB 2QQNH 3QIWD 5ANME 4YR6A 3GMNA 2IMMA 1I1YA 1H5BC 3H9SA 1UXWA 1H3VA 4HAFA 4AIZA 1NEUA 5HYEA 5KVFH 1S78D 3QQ3B 4LDOB 1VESA 2NLJA 4DGIH 4O4YH 4P46C 3CAFA 1T89C 4KMTL 3BPNC 3QDGD 1F3RB 5ENWA 1P7QB 5C3TA 1A02N 3V6ZB 5IR1A 1M71A 3MFFA 3RWFB 3ZHDA 4TPRL 1CLOH 3OKOA 3FB6B 2QQNL 2JJTA 2ZJSL 3BUTA 1MI5E 3DTXB 4X7SH 1H15A 3DX7B 5JIIA 2AERT 3IDYC 3BPOB 1MLBB 2VLKB 3R1GH 3ROLA 4O4YL 2XZAL 4QTIH 1KACB 4NJAL 1EXUB 4LCUA 2PO6B 2CIIB 2XQYG 5C09B 3NGBC 3MMEA 1LEGA 3BJLA 1AGBA 1HSBA 1M6OB 1YMME 5KVGL 4HUVA 4XBGA 4NN7B 4ZPTA 2RR3A 5JUEH 3QDJE 4GKNA 4P3CL 3ECBA 2DBLH 2IPUG 5C07B 4BQ6A 2BFVH 2GUOA 2R69L 3BH9A 1TZGH 3BOVA 3GSNA 3P11L 1CE1H 4QTIL 4ELME 3GSXB 5I1DA 3AC0A 3FFCD 3F7VA 3K2UH 3BIKB 4OLWL 1X7QB 1UACL 1XMWA 3FO1A 3L9RB 4LQFH 4U1SA 3WFZA 2A74B 5CHNB 1BBJA 4YNYB 5EZOH 2H32H 4W4NA 3RDTA 4W4OC 5JUEL 4ERSL 3VW3H 5TH2A 1RZIB 2A83B 4K7FA 2Y72A 2APFA 3M8OH 2BFVL 5CP3A 1PG7H 1FZKA 1TZGL 3SE9L 2ZNWA 4HWEH 1CE1L 3KPMB 1QSEE 2FJFA 2K9UA 1BD2A 3FT4B 5ID0B 2EIEA 4QRUB 1NGWB 1LP9B 4GS7C 3RWJA 5ANMA 1HQRB 5HVWA 4EVNA 4PRNB 1BFTA 15C8L 3ZYIA 3FCTA 2NY2B 1XCQB 3MRCA 5ERWA 3VW3L 1BECA 4MQXD 1T3FB 3D3VE 3M8OL 5E1AB 5FA3B 3TVMA 4XCYA 1CR9L 2VISB 4MQ7A 5TFSH 4N90D 3O2DL 1EGJA 4HIEB 4JZNB 5B21A 1BHGA 4BSVB 1K5NA 2W0KA 4I0KA 1BZQK 4PJEF 5DSCB 3DGCR 4IIQB 2VMFA 3IDJA 3STLB 2HT2C 5T33H 4FFVC 1NEZB 2XA8L 1MI5A 1U8NB 4KQ4L 1Z3GH 5KZCD 1G7JA 1G6RL 4NM8L 2VXUH 3B2UD 3X12A 3T0ED 1A3LH 4LRIA 1NJ9B 3MRIA 4Z7OE 3AS0A 3QHTC 1M7XA 4OD2B 4QOKE 3SBWC 1IJ9A 4YAQA 4BFEA 3NFSH 2F8VA 2MKWA 1M05A 4LPCA 3NAAH 3DUSA 4LLQB 3SJVE 5J6HA 1YMMA 2PTVA 4MJ4A 1Z3GL 3CH1A 4IS6A 4XP1H 4LKCB 4F7TA 3QDJA 4L4TD 3P9MA 2NW3B 1U58A 4N8VA 1CQKA 4ELMA 3EOAB 2IWGA 3FO2B 4GH7B 4I2XB 1OQOA 2WMPA 1FZJB 5IV2A 3ZDXF 3IRZA 5EBMA 3SOBL 2ZOKB 4PGCB 4HGKC 5TDOB 1P7QA 1UM5L 4E5XB 4PIRF 3O2WH 4EOWH 1SY6H 3V6ZA 2VZSA 5J11B 1XGPB 1M4KA 5D5MB 5I0DA 1QR1A 4KY1H 1CFSA 4RX4D 3O11A 3DTXA 3GO1L 4F37F 3ZZ1A 2D4FA 4RGNB 4OBSA 1H3GA 5HDQH 4CVWA 2Z31D 4EIZC 5I76B 3LKNB 1MLBA 4KJWD 1TJHH 3KXFE 1ZHKB 1MAML 4KHTH 3G04B 2DF3A 1EXUA 3QQNA 4PV8A 4S0SD 3O2WL 4EOWL 5D70H 4ZS6D 3DHMA 4PP1C 2J88H 3EYQC 4JCLA 1D5MB 3QUYA 4HKJA 1CE6A 4M6AA 1S9WB 1D3CA 3WIFB 1M6OA 2EDDA 1KJ2A 2X41A 5EIIB 5AZ2H 3R06B 2NY3D 2V9QA 1B4RA 4WHYG 4S10A 1HKFA 4EUPH 5HDQL 2NZIA 3VRLF 1YN6B 1IAOB 3S35L 3MCKB 4G3YH 1MY7A 4KHTL 5GRJL 3QDMD 1VFBB 3GHBH 4ZTOH 5L2KD 2W91A 4OGAC 2XXCB 3UAJC 2VE6B 5DVLA 3OL2A 3TO4C 3NCJH 3O3DB 1M7IA 2R2BA 3BIKA 2OXHA 5D7LD 1JN6B 3T3PF 1A8JH 3EYOB 3L9RA 4X6CF 1MFEH 3DPBA 5AZ2L 4GG6B 3HE7D 4BKLB 1KPUB 4PJIF 4HCRH 1QRNE 4M8VA 4OFPA 4LEOB 3SJVA 5GS0C 2R9HD 3KPOB 4IRSC 3RWDB 3FO9A 3P4OB 5B3NA 5EH1A 5ITBL 4K94C 3RTQD 3KPMA 3IFOB 4O00A 5F89B 4HJ0D 5I71C 3FT4A 3UZQA 4KKAD 2EE3A 5FAAA 4QRUA 1NGWA 2QSTA 1T2XA 2CJUH 4PJ5B 1TETH 4Z7NF 1YEDB 4PRBA 5CJOL 3RVXC 3VGFA 3ARDB 5IBLC 1EFXA 1T3FA 5DFVD 5E1AA 5JW4N 5F3BA 1FP5A 5DC4B 3TN0B 1ITBB 5HHNB 2X9WA 1IM3B 2XPGB 5IEHB 4I0CC 4W68A 4BSVA 3C08H 2D0FA 1HHIA 3ARVA 3P77A 4C83B 1CLYL 5IG7A 4KHXH 4IIQA 2FHBA 5TQ0H 5CINL 3UBXI 1SJHA 5IM7A 1AR1C 4U6YA 1U8NA 2BOBB 1QA9B 1CD1B 4FNLL 4XP9L 1G1YA 5E2WH 2YD8A 1BJMA 5HHMB 1NJ9A 5DTFB 1EAPB 4HKZB 4PJFE 2NY4B 1YEHH 4KKLD 3KXFA 4YHYB 4HZAA 3LQMA 1FAIH 5DD3H 2W60B 4UZGA 4QGTA 1MUJB 4DCQB 3C08L 4Z76A 4I8DA 1LK2A 5KBNC 4X4MA 5GZNC 4OD3H 5EU6E 1FN4A 5F9JB 3V5DA 2P8PB 5IMKB 1AFVL 1EAJA 4HX1B 4LKCA 1IQWL 2NW3A 5T3XE 5AYUL 4BFIB 1BOGB 1EV2E 2LQRA 1UADC 2VYRE 4NQUA 3EOAA 3FO2A 3UDWA 5DD3L 4I2XA 1ED3B 5ETUB 3AM8A 3L5IA 5CD5D 3LEXB 3RGVB 1MHEA 3LN5B 4OD3L 4OQTH 1CZ8L 1W72H 4AH2A 1DANU 4O51A 2ZOKA 3PWVB 4IRJA 4E5XA 2FIKA 3QG6B 2N4IA 5T5NF 1JWUB 4NRXB 1MAKA 2JIXA 4MJ2A 5I8EB 2AS5M 1AE6L 5T1LA 4RMTA 1UYWL 3EJJX 3HS0A 1PYWB 1FE8L 2YRPA 3QEQD 5H8DA 5HGDB 5T5FL 1UA6L 4KWUA 3MRPA 5I76A 2MOVA 3S37H 3MREB 1W72L 4WHDA 3JUZA 1J5OL 1ZHKA 3OG6B 1E4WH 2YD2A 4KKBC 3G04A 2BZDA 2Z35A 1JMZA 1HINH 4LHUG 1IAKB 4LDLB 3VFRA 2D9QB 5C0AE 3VJ6B 4H1LG 3IFNH 4X9HA 3EZJB 5IUSA 3OR6B 4H25B 2Q7YA 1OGAB 5HYIA 3MXVH 1OM3L 1YN6A 2P7TA 4WY7H 3S37L 4OLUH 1IAOA 4P2QB 1Z6JT 3SDCA 5C0NC 1DANT 5KS9B 5C0FB 4PJFA 5C0CE 5JDJA 1JN6A 4WI4A 3RKPA 3EYOA 1MCSA 2AXFB 4J4PC 3IFNL 1NGYB 2GJ6B 4GG6A 3RVVD 3QJFA 5T3ZH 4Q9RH 1ONQB 1KPUA 4WTZG 4J2XA 1J1XH 3MXVL 1INQA 3ULUL 2HTLD 3JWOH 3KPOA 5CZKA 5GGTA 3RWDA 4JDTL 3GSOB 1GGTA 5CBAB 3AREA 2H6PB 4I0PA 3QHFH 4U3HA 3B9KC 2APXA 4Z7WA 5EZJB 3QRGL 2LFGA 5TE7L 1ZEAH 3MODH 1CFTA 5F7KC 3U2SB 1U95A 4LARH 2BVOA 1S7RB 4XAKD 2W07A 4JFED 2RQ8A 5T3ZL 4Q9RL 4UOW1 1J1XL 4MAUH 3ARDA 5FYLD 4WI3A 1U6AL 2HTKC 4OF7A 1LO2L 1NFKA 3TN0A 3HG1E 2ZCLH 3TCLA 1PZ5B 2XPGA 3L5XH 5IEHA 1K9TA 4BJLA 1N26A 3QHFL 4XBEH 3IDNA 2VDRL 2HP4A 3N1MC 4PRDB 2BOBA 4M6NL 4LARL 2IG2L 1VKXB 5DMIH 3BDXA 1JTTA 4MAUL 2WWMC 2AEQL 1OP3H 1QFPA 4MLSA 3THMH 1AGCB 3BEWA 4QRPD 2EYTA 1F3JA 2JJSA 2ZCLL 4L8SB 5KSUB 1OSPL 1MUJA 4DCQA 3MACL 2VZUA 3BKCL 3V4PH 1KLFA 2XZCH 2WLZA 3LDBB 5DYOB 1T03H 5F9JA 1WCBB 2OL3L 4U6TA 2G2RB 3VG9B 4HX1A 3G5VA 4K3JH 4ZUTB 3WFDH 5DMIL 5EWIL 3VXQB 4NQTA 4N8CH 1ADQH 3U0WH 1BOGA 2DN7A 4PJDE 3DOSA 3VFGL 1ED3A 2V7HA 4JFFE 3FQNB 5ETUA 3PGFL 1QQDB 5HVGB 3GUTA 3LEXA 4OZFG 3RGVA 1YN7B 3LN5A 5CEYA 1T03L 3QG7H 1DCLA 2GSGA 1U91B 4HD9A 4K3JL 5D9SA 3WFDL 3BISA 1M7DB 3EOTL 1A14H 1JCKA 1JWUA 4C56B 5I8EA 1ADQL 2IANE 4ETYA 5I75C 3O9WB 4WW2C 1PYWA 2ICWB 1U93B 1MQKH 5ACZB 2BVPA 3GMRB 1B0RA 3HRZA 4M7LH 2J4WH 4OFDA<