1ORIA

Structure of the predominant protein arginine methyltransferase prmt1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
316
structure length
316
Chain Sequence
SYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Predominant Protein Arginine Methyltransferase PRMT1 and Analysis of its Binding to Substrate Peptides
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 1
total genus 89
structure length 316
sequence length 316
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1oriA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1oriA01
3GO4A 4RVFA 3EVBA 3C3YA 4KW7A 2JG3A 3IHTA 2PGXA 5BXYA 4HTFB 4L7VA 5EMLA 1FPQA 2VZ9A 4RTJA 2EX4A 3HVJA 3QOXA 1KP9A 3KHKA 5K8VA 3KPVA 3UA3A 2BM8A 4P7FA 4GUAA 5GINE 2XVMA 3AY0A 3OPNA 3VC2A 3MAGA 1KIAA 3B3GA 5DWQA 1VBFA 2PSSA 1SVUA 5GM1A 1WG8A 1O9HA 4BP3A 1X1CA 3BWCA 3T7SA 3PFHA 5U4XA 3GU3A 5DM1A 4PIPA 3M6VA 2AS0A 3LX6A 2GLUA 3ME5A 4KIGA 5EIFA 5K0JA 4YUVA 5CCBA 5EMKA 5FWDA 3TLJA 2UYCA 5K05A 2Z6QA 3L8DA 4R6XA 3LL7A 5DLYA 3EGVA 1AV6A 4DF3A 3G5LA 5CVUA 2QE6A 1VIDA 2OBFA 3CC8A 3MGGA 3A4TA 3UJDA 5CM2Z 1EJ6A 4E2WA 4ER5A 3DMGA 3RODA 5LQNA 1G38A 1XDUA 4E32A 5IH3A 3EGIA 2FHPA 2I7CA 3EEOA 3OZSA 4CKCA 4X41A 4P7GA 4QTTB 1NW3A 3OZRA 3B3JA 2B2CA 4CKBA 1SQGA 2CWWA 5CCXA 2VP3A 1PRYA 1UIRA 4PONA 2UZ4A 1MJFA 1QAOA 1XTPA 3LCVB 1I1NA 1F3LA 2PBFA 4FSXA 4HC4A 2XYVA 4XUEA 5CUQA 1R8YA 4WVLA 5GIPE 2JH9A 2YX1A 2QYOA 2AOTB 3JWIA 2FRXA 1RI1A 5HOQA 5ICGA 3FTEA 9MHTA 4M37A 3Q7EA 3C3PA 4HSGA 1R00A 2AZTA 1L9KA 2ZFUA 3CKKA 5DTRA 3UBTA 3JWJA 3GXOA 1EIZA 3P8ZA 4RX1A 5C0OE 4F85A 5T64A 5GOZA 3FUXA 3VYWA 1G6Q1 3FTDA 3EVAA 1R8XA 1B42A 4GF5A 1R18A 3TKAA 5IKMA 5K03A 4E2XA 3B3FA 3K6RA 2HNKA 2P41A 3IYLW 3IEIA 3GIWA 4FT4A 5B1SA 5K0EA 2ZIFA 1DL5A 2QY6A 2FCAA 1M6YA 4GC5A 3SSOA 4PYQA 3DMFA 3A25A 1Q0SA 1M6EX 4WXHA 4PYMA 5HIIA 4E2YA 3EVEA 5EKXA 4M7RA 3FPHA 4BY9E 3LBFA 4HTFA 5FTWA 3GRYA 5LQRA 10MHA 2I9KA 3X0DA 4MWZA 5K0CA 1YB2A 3DULA 1L3IA 3AWIA 5GP1A 2PWYA 5GM2A 2GAFA 3I64A 1XJ5A 3R9XB 5FQNA 4GBED 2C7QA 3UJ8A 3DOUA 3MHTA 3NW9A 1KYZA 1KXZA 1NKVA 4IV8A 4PYNA 3DXZA 3QOWA 5DTMA 4YV2A 3ER8A 3HTXA 1JR4A 2ZZKA 1NV9A 4X61A 3OE4A 4PYJA 4YUXA 2WA2A 1JQEA 3OFJA 1F38A 1I4WA 4PGHA 3GGDA 3PFGA 4ER6A 5E2AA 1JSZA 2P8JA 2PLWA 3M33A 4E33A 2HMYB 2VDVE 5CVVA 2UYOA 2C7OA 3KR1A 3MTEA 3FUTA 3UA4A 4HGZA 1KPHA 4ER7A 2FPOA 4PWYA 5CIYA 3DP7A 1NW6A 1WY7A 3LKDA 4QVGA 5F2KA 2H1RA 2P35A 3BWYA 3RW9A 3THRA 3B89A 5DXAA 1NBIA 3C6MA 3HVKA 3NTVA 4LG1A 1O9GA 5EZQA 3NMUF 2O57A 2JH8A 4QQNA 3HA3A 3MERA 3PX3A 4RYLA 3V8VA 1NT2A 1P1CA 1H1DA 5F2OA 4RTMA 5GWXA 3NVKI 2R3SA 3GRUA 3HEMA 3P2KA 1QANA 4KDRA 2YTZA 3ANXA 5E9WA 3G2QA 4CXMA 2N47A 5HZMA 2VDUE 3MTIA 1VL5A 2BR3A 5FHQA 4R6WA 1P1BA 2OZVA 3PX2A 4P58A 5ERGB 3WSTA 2BZGA 3G7UA 3HCAA 4EVIA 4RTSA 5FULA 2IH2A 1VE3A 3FZGA 5MHTA 1TW2A 5LQKA 2K4MA 2O06A 2UYQA 5JUWA 3UJCA 2IIPA 1OR8A 3KQQA 5ICEA 3P9KA 4FS8A 5E2BA 4DKJA 1G8AA 3NDJA 4Y30A 3SMQA 1EG2A 2I6GA 1IXKA 3GNLA 4BLWA 3OU2A 3A27A 5E9QA 4YMHA 2NNWB 3EEYA 2BM9A 1L3CA 1NE2A 2O05A 1FP2A 3K0BA 4RSRA 4HRAA 3HVHA 4GOOD 2XBMA 5FUBA 3R3HA 1NW7A 1AQIA 3G2PA 3HCCA 5DM0A 1KYWA 3NVMB 3RIEA 2C7RA 1JSXA 3G5TA 3TMAA 3CJQA 5DTQA 1VQ1A 1QYRA 2EG5A 4OA5A 2WK1A 4JXJA 3P9IA 4DCMA 3KKZA 4RWZA 3CJTA 4OBXA 5LQAA 3BKXA 3FPEA 3SXJA 4DQ0A 3MCTA 2Y1XA 1SUSA 1RJDA 3LCCA 1EQAA 1NV8A 1T43A 2PKWA 2IPXA 2ZBRA 4R8RA 3V97A 5KQSA 1YZ3A 2PX4A 2YR0A 2ZTHA 3ELDA 3SR4A 1X1AA 2VS1A 3DMHA 3P2IA 3KPYA 4XCXA 4GEKA 2O0LA 1R74A 4ZTBA 5FA5A 1XCLA 2YXEA 5E1BA 1UWVA 4OBWA 5GIOE 4AZTA 4YUZA 1KPGA 2NYUA 3AXSA 2V7EA 1ORHA 3ELUA 3G8BA 3M6UA 4PIMA 1JTEA 3HP7A 2A14A 1JG3A 3E7PA 3R24A 4V0RA 3E8SA 5DX8A 2PT9A 5EEHA 2WA1A 1D2GA 4QPPA 2ESRA 1EJ0A 7MHTA 2B9EA 4KIFA 3CCFA 3NDIA 3G2OA 1FP1D 2AOWA 3LECA 3NJRA 4QDKA 5EC8A 1N2XA 4OA8A 1HMYA 5DSXA 4DMGA 4HH4A 4PYKA 2NXEA 5C9ZA 2HV9A 3G2MA 3HCDA 2G1PA 3BGDA 3LDGA 5FADA 3FPJA 4XUCA 4BLVA 4RTPA 1X1BA 1XDZA 2AOXA 1WXWA 3HVIA 3M6WA 5H02A 1KHHA 3TPZA 1XCJA 4PINA 3BZBA 3KQWA 5EG5A 2ORED 3A7DA 3SSNA 3EPPA 4GOND 4C08A 1JG2A 3P71T 1RI3A 4YUWA 4H0NA 3KR0A 3LGAA 3BGIA 3OCJA 2EJUA 3EVZA 3DUWA 4Z2YA 2XYQA 2PXCA 1RJEA 3G88A 2P3OA 4EQZA 5K0NA 2PX5A 3T7RA 5DPMA 4OQDA 1NW5A 2AN5A 2NXCA 2PXXA 5E1OA 3I53A 3HNRA 3NWBA 2R6ZA 5DXJA 4LWPA 2ZULA 2OB2A 3GRZA 4KDCA 3NWEA 4FT2A 5FHRA 2IGTA 5BW4A 4C07A 2P3LA 4ATNA 3KQPA 3KQTA 3GWZA 2PVCA 2PY6A 3KU1A 2AOUB 2OO3A 1I9GA 5E1MA 1WZNA 4OQEA 3E23A 4RTLA 3O7WA 5HEKA 4AZWA 1D2CA 1IM8A 2IBTA 1ZG3A 4EK9A 3OU7A 4EKIA 2Z6AA 2DPMA 1TPYA 2YVLA 2AOUA 2O07A 4RVHA 5FA8A 1HNNA 1ORIA 2GH1A 3TM4A 1FBNA 3P2EA 3E05A 4U7PB 2IDJA 2AR0A 3G8AA 1MHTA 3FRHA 3O4FA 3LKZA 3CVOA 3GDHA 3SGLA 2P7IA 4RTRA 2H11A 5E8JA 4BLUA 3KPWA 4DZRA 4E30A 2FK7A 5M5BA 5DRYA 5F2NA 2QRVB 3KR2A 3VC1A 2GA9A 2ONZA 2P1DA 3BKWA 1SG9A 2ZW9A 2C7PA 3ER9A 3FTFA 3I9FA 2QM3A 4V0QA 5FQOA 3P97A 5KYGA 2GS9A 2KW5A 4G56A 1VPTA 3CGGA 4QQKA 3DLCA 3DXXA 3ELWA 4X1OA 4LWOA 2BH2A 3Q87B 1D2HA 2HR1A 1TW3A 4C04A 2AOVA 3KR9A 5KVAA 1NW8A 3REOA 5BW5A 4ER3A 3UFBA 3BGVA 3OU6A 2NXNA 5HFJA 5EMMA 1QZZA 4QTUB 2Y1WA 5EHIA 1WXXA 3FRIA 4YV0A 3EVGA 1YF3A 4AUKA 3FUVA 5E1DA 3D2LA 3LBYA 5CVEA 5T6BA 5K0LA 3KQSA 1SUIA 4QDJA 2YQZA 1VP9A 2IFTA 3EGEA 3QV2A 1U2ZA 5D1NA 2B3TA 4C06A 5EPEA 5EHGA 3CJRA 1FJXA 2DULA 4MTLA 3HA7A 4B17A 3M6XA 3F4KA 4IWNA 4O29A 3ERCA 5FWAA 3HCEA 4RTQA 2H00A 1V39A 3GRVA 3KQMA 2FYTA 2V74B 1DUSA 1RJFA 3MQ2A 4MQ4A 4POOA 3P9CA 4BP1A 4X63A 3ELYA 2IBSA 3JWHA 3UZUA 1L3BA 3EMDA 5CD1A 5EKUA 4R05A 3THSA 2OXTA 3U81A 3HA5A 4XUDA 5DM2A 3G89A 3FUWA 1R6AA 4E70A 4A6EA 3T7TA 5K01A 5K0GA 4P7JA 2PT6A 2IP2A 5LR6A 2BR4A 1RJGA 1O54A 5E9JA 5DSTA 1BKYA 3HCFA 2ZVJA 3EVDA 3JWGA 1VLMA 2NP6A 4PCLA 5HILA 4C05A 1RI2A 4CWAA 1Y8CA 1SKMA 4PCAA 1DCTA 4K6MA 4QPNA 4ER0A 2NXJA 2AN4A 2ONYA 5DM4A 2LD4A 5LSAA 1X1DA 1ZQ9A 3AXTA 4RTNA 2G70A 3DXYA 5C1IA 1L1EA 2AN3A 4FP9A 4YMGA 5EEGA 4GOMD 4PNEA 1JQ3A 1YZHA 4HG2A 2YUIA 4RV9A 2BR5A 3LDUA 2JHPA 5LQUA 1BC5A 1N7JA 1XDSA 2P3QA 3R6TA 2PJDA 1SQFA 4PYLA 3GCZA 2JHCA 3FPGA 3KQOA 5D1HA 5HIJA 3CBGA 1IY9A 2P7HA 4FZVA 5ICCA 1KPIA 3OE5A 2CMHA 2IH5A 5EVJA 4GOLD 1AF7A 3MCZA 2ZCJA 4GC9A 2ADMA 1INLA 3S68A 3SM3A 4PYIA 3PT9A 1YFJA 4HGYA 4GQBA 1RI4A 3DTNA 2CMGA 3VSEA 3DH0A 5EIWA 2HTEA 1XVAA 2Z6UA 1P91A 4UOEA 1NBHA 2B78A 5KS2A 5E8RA 4FSDA 2I62A 4ISCA 2ZSUA 2OYRA 1KR5A 3A26A 4QVKA 2PXAA 3GRRA 1Q0TA 4FR0A 3P9NA 4C4AA 3BWMA 4M38A 3FUUA 4F84A 3UWPA 3UJBA 3BWBA 4YV1A 3TM5A 3SVZA 5K0FA 3KPJA 1YUBA 3B7PA 4KRGA 4OX9Y 5EOVA 2ZZMA 5JR3A 2YXDA 2YXLA 2EJTA 1X19A 2AOTA 4CTKA 1EAMA 5DX1A 1BOOA 1BHJA 1Z3CA 8MHTA 2Q41A 4E31A 1VP3A 3UJ9A 4NECA 3PVCA 3R0QA 2P40A 3C6KA 4IV0A 2VDWA 3BXOA 2ERCA 5T67A 4EMSA 3I5UA 3C0KA 2ZBQA 2QRVA 4RTOA 1ZGJA 3TKYA 4AZSA 2NP7A 3IV6A 3FTCA 2ZIGA 5CVJA 5EQJB 5HIKA 1UFKA 3UJ7A 3BT7A 3OFKA 3KQVA 2ZLBA 1JQDA 4YUYA 2EFJA 3LCUA 4R8SA 5EMJA 5HIMA 4A6DA 3DR5A 4FGZA 4CKEA 1YFLA 2ZZNA 5K0BA 3EMBA 4LECA 2B25A 3FYDA 4M36A 5EGSA 2JHAA 4U7TB 1RI5A 2ZWVA 4E2ZA 5DX0A 1JG4A 1JTFA 5LQJA 3KQYA 3LHDA 4F86A 2OPBA 4KVZA 4MIKA 4DM3A 2G72A 2OB1A 2PWPA 4AZVA 4AX8A 1ZKDA 2PX8A 3DLIA 5BP7A 4MHTA 3BUSA 1AQJA 3FPFA 2G8NA 2XVAA 3TR6A 3GJYA 3OZTA 3TFWA 5DT2A 3EVCA 2CL5A 2E5WA 2GPYA 2OY0A 1G60A 3ORHA 3A7EA 5ICFA 3UJAA 3PLAE 4PGGA 5DRTA 4RVGA 2PV0A 4KWCA 3M70A 5FCDA 3SSMA 2ZBPA 4RVDA 3ID6C 1G8SA 3PS9A 5P8WA 1ZGAA 4PYOA 4DCGA 3TRKA 1N7IA 1M0EA 2ZWAA 3B5IA 1WS6A 3LPMA 4CTJA 5G02A 3T0IA 2CKDA 2G71A 3MB5A 2GB4A 5LQCA 4X60A 3KPUA 3AJDA 2AVDA 3LDFA 5CVDA 4EKGA 3FYCA 2UYHA 4C03A 4P7KA 3TOSA 2FK8A 2OKCA 3PB3A 3UJ6A 3H2BA 2HWKA 3PTAA 3O31A 3SX0A 4RTKA 1QAMA 1P39A 3EVFA 3I58A 3LSTA 2IH4A 2XYRA 2JJQA 3HM2A 2ZIEA 1XXLA 4Y2HA 4DA4A 2IDKA 1G55A 3M4XA 5EZSA 3TQSA 4IKPA 1QAQA 1PJZA 2F8LA 2AVNA 1ZHFA 1JG1A 5KQRA 3HCBA 2PX2A 5K09A
chains in the Genus database with same CATH superfamily
2C04A 4L6CA 3DOOA 1RXIA 1Z4OA 3GCDA 3IB6A 3FNEA 1EWKA 3LZCA 5J1SB 1Z2CA 1TVKB 3FB4A 1FPQA 2NPFA 1QVWA 1R9MA 2Q1YA 4UVDA 4F8JA 3ADPA 4L4YA 3LOPA 5ERYA 1P44A 2EJVA 1IN6A 3OPVA 1OXMA 5DWQA 5DNCA 2VAXA 3PL5A 1DRWA 4WN9A 1HYHA 2G7MC 3A6KA 3PP8A 3VU0A 4AN4A 4C2UA 5DH9A 5DM1A 3NTLA 5CB6A 3WQHA 4Z4CA 1EWTA 4R8KA 1ZJ6A 4OU5A 4MO9A 4X8MA 5EIFA 3WO1A 1VJ1A 5FWDA 2VCHA 4G84A 4EBBA 1DINA 2WF8A 4TX1A 1UZNA 2O0MA 1ZMBA 1U2PA 1ZNZA 2KLBA 4P53A 2JFGA 3AV3A 3SHVA 5MN6A 3NT5A 1K9VF 3SC3A 2R2GA 4ROSA 4Z4GA 3UJDA 2VSNA 1NZFA 1K3FA 2OOKA 3KUXA 3L0CA 4JJ6A 4JLDA 2BHSA 2D2FA 5EWLA 3HDVA 1SU8A 2BTOA 2QNIA 3TD6A 2GTHA 3RAGA 2W4IA 1JPNA 3F2VA 5DHQA 9LDTA 2AK2A 2MINA 1W2WB 1NW3A 2IYZA 1KYVA 3KAJA 1EWQA 1BJKA 3N8HA 3PA6A 4NOLA 5FUMA 5F9HA 3NANA 4FDUA 4A36A 4AKIA 3JQEA 4GECA 1OFUA 4OGGA 5JJIA 3CLUD 4TRRA 3W9SA 4CIXA 1DO2A 3HC7A 4JGGA 1ZGGA 4I3GA 4J75A 4DG5A 1YVUA 3TXXA 1I7SB 4G5XA 3FCSB 3D3EA 1HH4A 1UUFA 2ZFUA 3UEOA 3OPQA 1Y3CE 4CIVA 1HV8A 5I8ZA 4ADSG 2FXVA 2ZAMA 2C0CA 1SELA 4PC2A 5T64A 4W5WA 1ORTA 2GRUA 4Q66C 3QEMA 4ZCLA 1NN5A 1RQLA 4PFSA 2P11A 5AJZA 4DE5A 4MKFA 4N5LA 5FNZA 2ZJ4A 4TMYA 2MDTA 2X42A 3L8GA 3IEIA 3KSRA 1DAKA 3WV4A 1Z7EA 1XNJA 2VL7A 2QN7A 4L3OA 3D54D 4KI7A 1E2KA 3DMFA 5J2UA 1JAHA 1K4KA 3G7NA 4LJ9A 2O0HA 4DLNA 4A2CA 3P0FA 1NSYA 1ZL2A 3AW8A 3DD1A 2J33A 2Y93A 4O8ZA 5DGCA 4MWZA 1YGYA 2OWDA 4LY6A 3TSWA 1A5AB 2PJZA 2R8YA 5F3RA 4B81A 2PWYA 3Q12A 3NLLA 2PUWA 4P4TA 3R9XB 1RM4A 2REXB 1M1UA 1NJ8A 3PR3A 4UD2A 2VF4X 5GV8A 4MWTA 4GBED 2VDMB 3OEHD 2C9OA 3EHEA 3QY0A 5C2JB 3RVSA 3OTOB 1IK6A 1FRZA 1T6NA 4UPEA 1Y6FA 3IFSA 1IOLA 3DFFA 1E20A 1DX6A 3G2JA 4HLDA 4BV3A 2ZRDA 3N39C 1BKSB 2HADA 4LE0A 4YCAA 1TNDA 4FX5A 5E2AA 1WSWA 4DT1B 2FQXA 3UK2A 4HLUC 3R3YA 3S1LA 2PUAA 1JEAA 3JVIA 1TZMA 1E79D 3U3DA 1JDJA 1GCIA 4HGZA 3WGZA 2CJPA 4TN5A 2XMGA 4QUAA 1MW9X 1SUBA 4UU7A 3DBOB 3NCHA 3WNCA 1ISSA 5AP9A 4DW8A 2ROQA 4JHXA 1VG8A 3RB8A 2WW8A 3USCS 1OPXA 2H1RA 3VO9A 1XNRB 1TO1E 3RW9A 1JXQA 4KQ2A 3TTUA 4UTNA 2PMFA 1YQEA 3GNTA 3X3HA 2C31A 1XQXA 2O57A 3MBOA 3ONWA 5HQJA 4BMSA 3I2YX 4A2PA 2XITA 5LCXA 2H4JA 2ZRLA 1P1CA 4OQNA 5F2OA 1W87A 2WMYA 4M7PA 1H2RS 4Q7EA 4LPKA 4BN4A 4EECA 3NVKI 1QANA 2E85A 4Z51A 1YQWA 4A6XA 3BM5A 3A2NA 5ALPA 1PZXA 1ECFA 3SP1A 4LEIA 4D45A 2NO0A 3D8UA 3Q15C 2JI7A 4R6WA 4EVIA 3QX8A 3NFYA 1JLSA 4BLQA 2VZ8A 5AUQA 4E1BA 3MOSA 3O2NA 2GHQA 5DVZA 4CMCA 5IT4A 3G9QA 1OR8A 2R7KA 4YAGA 1AZLA 1DV2A 2J4FA 1C9YA 1QR2A 2HJVA 4D9FA 4ARZA 2DUJA 3QHPA 3ZGZA 2WSSA 1PEYA 1RQGA 4NP6A 4PXYA 1RM0A 1PFVA 2VUIB 1SHJA 1T8PA 1KYTA 2AN1A 2C0QA 3M82A 4G8DA 4KZKA 3N70A 1L5ZA 3WK4A 2FJPA 3CPEA 4TWBA 2PMBA 1GM5A 5EIEA 2YIJA 3AUKA 3CG4A 1FP2A 3ND9A 3QKRB 1W93A 2J32A 3G85A 1RP1A 2OTCA 1N1MA 4RSRA 2FPLA 1QIKA 2ANCA 1BE0A 1G8FA 4UBOA 1F8GA 3B1WA 4RHCA 4MQBA 3ROGA 3BQ9A 1VIYA 1OGYA 2YOGA 1KYWA 3LLMA 1NVEA 4O33A 1NYTA 4BVEA 2OSVA 3G5TA 3SBEA 3ZWBA 1IH8A 1XQ9A 2IEIA 1N5IA 1VQ1A 2CJWA 3VNAA 3R9XA 4RPLA 1IQRA 5JE8A 4B4OA 2ZE6A 3PJFA 2VT7A 3PFWO 3ZGXA 3JX9A 4BGIA 1R4AA 1EBBA 1LSJA 3BXPA 7YASA 3GFFA 4JJIA 4L8WB 1NVDA 5ELLA 3ZY4A 3ACDA 4JUCA 1SG6A 2R84A 3CE6A 2JIZA 2ECOA 1RQ2A 2Q9UA 1YZ3A 4OGWA 3DBLB 3M34A 1EK0A 2ASVA 1MEOA 1Y5MA 3LHIA 4QICA 5THXA 1XJWA 1EXNA 1HTBA 2AK3A 2VHXA 3U13A 5JMTA 3LKVA 3K9CA 3QP9A 1GFZA 1HL7A 2RB4A 3OZ7A 4G86A 1I10A 2XHEA 5BN4B 4MQUA 2AFIE 2PR7A 4MHOA 2OLKA 1RZVA 2ATIA 4NVRA 4U7GA 4UTZA 4F6LA 3G8BA 4MV1A 4ZV7A 3S28A 3UWDA 2JLCA 2HJGA 5CLGA 4LC0A 4AZ3B 4V0RA 1A82A 1JQLB 4ZAYA 1R64A 4ZOEA 5FLYA 3GP5A 4NLLA 1P1RA 3TRHA 2D5IA 1HG0A 3ZDBA 1FA9A 3KZMA 2AOWA 4HDMA 4QDKA 2X9QA 4TYNA 3I61A 3BGOS 3IXQA 4MEAA 2JFPA 1QO0D 1GV0A 3ZW7A 1PR9A 3F3SA 5AVWA 4XUCA 2WVHA 1X1BA 1RWVA 3KSUA 1I32A 2UV8A 3DEZA 3PNPA 3VH4A 3BXFA 2B4TO 2YYZA 3DFZA 3EPPA 1F6DA 1L5FA 4JR0A 1X8JA 1P9LA 3BB4A 3LUHA 3PHJA 2VDJA 3LXMA 3N2EA 1M73E 3AR8A 4OFBA 3LLSA 3VSBA 4QOGA 3DM5A 3KXDA 3UGTA 1TF7A 1XXHA 2EHDA 3VR6H 4A4DA 2VTBB 4DR1B 1YDWA 4KYVA 1OZAA 2HIAA 3HNRA 4L5AA 1R9NA 1I36A 6AT1A 3T5PA 5FD8A 3VNRA 2JGMA 3Q3JB 2IYOA 2OB2A 4BCBA 4CQMA 5JU6A 1WMBA 1OYVA 1PEDA 2FN7A 3CT4A 4L0QA 1EK1A 4FS3A 1GAQA 3GW8A 3AF6A 2AV6A 2BC9A 1D2CA 4HNRA 2GYWA 4M8SA 4N0QA 4FCWA 1YS2X 3OHMA 1NVGA 2EL7A 1N4AA 1TPYA 2V5AA 2DBYA 3DKIA 1QE3A 2NN3C 4WOKA 3R9IA 4BNDA 1P5HA 4L0MA 4AK9A 1WB6A 3QEKA 4EEZA 2FR8C 5EINA 3KM0A 3O4FA 4Q05A 2NGRA 3MRVA 1KI6B 4GLBA 4RJJA 5TE9A 1MPXA 4Q4DA 4ZYZA 5EE3A 4E30A 3GC6A 4ZJPA 2O8EB 2ALJA 1XQ6A 2FVXA 1QUEA 1GUZA 3KR2A 5DN6A 2B5VA 1P1IA 2P1DA 5JBQA 4UATA 2NNLD 4GFDA 3WDSA 3V8PA 1QGZA 4OXRA 1C30A 3MOGA 4V0QA 2G9VA 2QSYA 4G56A 3FY4A 1FQOA 1EUQA 1A4IA 1I3CA 1L7NA 3Q87B 3TTVA 3CEHA 2EHJA 4TT3A 2I1WA 3OETA 1CJVC 3QMWA 2BMFA 2V0NA 4DC9A 4PM4A 1MX5A 3AUFA 5EXXA 1Z8DA 4E09A 5A3RA 3BRSA 3BK2A 1E58A 4OQMA 2QK4A 4ZEOA 4IP0A 2CLMB 1JBEA 3SD7A 1P6QA 1MB4A 4UOQA 5G0SA 2JK1A 2WSLA 4XYLA 5T4HA 4YXWD 6ADHA 5CMLA 2HCJB 3WNZA 2OECA 3R6LA 5CVEA 3ENQA 5GJBA 4WNAA 2ON6A 5COQA 4WOBA 1BH6A 3OT4A 3PTZA 2DBVO 1BX3A 3D7RA 1N6KA 1XZLA 1CW2B 3AUJB 2RJNA 3UGQA 3ED5A 3VGPA 1MFZA 1EBUA 2OCBA 2QROA 4INJA 3M6XA 3NZEA 3WDMA 1LSOA 3F1LA 2BKLA 1AX9A 3I04M 4ZO8A 1W6RA 2PRYA 2YHIA 3I1FA 1RJFA 3VHXA 2DECA 3QXCA 1UQUA 3AL3A 3TEMA 1KAMA 2XNJA 2NV2B 4JLBA 1SKUA 3OZGA 1EDZA 1ISHA 3OCXA 4NJMA 3VI3B 2QVLA 4D0LB 2FG5A 3DOCA 4H3KB 1BX1A 4PS0A 1HXHA 2OXCA 4K6KA 4OTZA 4H0FA 3RU3A 4MVJG 2XJ9A 2QRMA 1ORVA 1YI1A 2WI8A 2I67A 4G4SP 3ZZUA 3MYYA 1KYYA 3B1ZA 2O8CB 1RJGA 1O54A 2GERA 3PC8C 5KBYA 2RC5A 2ZVJA 2NZYA 4EI2A 1XD2B 1HYQA 2QYTA 1V6SA 1DCTA 1V7CA 2F9FA 2B8EA 1HNZB 4RVUA 2PT5A 4Y2UA 4TSFA 1DEAA 1XTUA 3VSDA 3ZKWA 1MRSA 3VKFA 2DHDA 2PZGA 1E3TA 3A6HA 1PYGA 3PTLA 5TT1A 3N2ZB 3WLNA 2JJ2D 4CODB 3WSWA 4BNGA 5AUNB 3EC2A 1A88A 5CDHA 3ZVNA 2HUNA 3NDRA 4QAJA 1XL1A 4WKGA 4UKDA 5J40A 2YUIA 2QZSA 5G1PA 4CF6A 2AMFA 1YJBA 4E07A 1UXKA 3UQZA 1Z7YA 1ULAA 3KXIA 3U4QB 1B0PA 4BNHA 1SH7A 1T8RA 2IP4A 4HUTA 3FJYA 4DCPA 2CV1A 4JIGA 2JIZD 3AJAA 3W4JA 1QTIA 3BMOA 2P75A 3BF8A 3E81A 3QLVA 1INLA 1J09A 3C4JA 2WIFA 4HAWA 2BMAA 3FDFA 3HZRA 2ZSKA 2XQIA 2Q7DA 1RLIA 5LFAA 3DH0A 1AC5A 3O84A 2PFKA 4EHHA 1SXJE 4HWKA 2OHXA 1KR5A 5KNCA 3DHVA 3JVDA 1DCMA 3KK0A 3UV7A 2YC4C 1NBMA 1PTJC 5BV1A 2HBQA 1KQFA 5BV2P 3NAGA 1IXYA 5ESRA 2K87A 1UWCA 3A6FA 4AMZA 4CUKA 4I1IA 2OMEA 2CYBA 2YXLA 1C2TA 1TF2A 2QMYA 2X4LA 1Z3CA 1ZJZA 4DVJA 4KR0A 2A9OA 2H2GA 3WK7A 1NFQA 2OBLA 3WFIA 1VE1A 4H15A 3FPAA 5FWYB 4NHEA 2D8AA 2P4EA 3BD6A 3QU9A 1B8UA 3PNQA 1P7YA 4CEHA 3LXRA 5CVJA 4C2AA 3OUZA 1JU9A 2NTJA 1YV9A 2BRUC 1AKEA 3HI4A 3KE9A 3QKIA 1QH8A 1RZUA 3KQVA 3D2BA 3P0HA 4R9SA 4DCVA 4FDTA 1Q14A 4Y7DA 4X91A 3NOVA 4JUAA 4N3NA 5EMJA 3H9BA 4OI2A 4OKNA 1ZU5A 2F1JA 2QLTA 3HCWA 5E6SA 4KQIA 2OCLA 5K0BA 2QW1A 2JHAA 2WFLA 1GGMA 3S0JA 2I71A 4B40A 1QH8B 1VSUA 1ZSYA 2FFRA 5HKKD 1JTFA 1DBVO 3MPOA 4S3MA 2DYKA 3SPXA 3W5JA 2OPBA 3TAXA 2LVBA 1Z2PX 2OB1A 4AX8A 4F5DA 2H7YA 5DW0A 1T5IA 1JGTA 3ZJUA 4C7MA 1BW9A 2XUZA 4U7JA 2EF0A 2J85A 4OU4A 2WTBA 3IIIA 1ZH6A 3IQXA 3LT4A 4KQ6A 3VR6A 2P79A 1FDOA 2M1XA 3JATB 1I3NA 1M34A 1TO2E 1W48A 3K09C 3OESA 1AV7A 5IVIA 1CE8B 1U7DA 2PKQO 3WK6A 4JWTA 2Z2JA 4B73A 1G8SA 3AVPA 1JE0A 2BM0A 3EIFA 1FFBA 1GUBA 3WIBA 5JECA 3QE9Y 2B5WA 1VMDA 1KFJB 3L4BC 3GLUA 5JXJA 5B1EA 4OLFA 4V03A 1VOTA 4XX0A 1I2CA 1Y3FE 3DV0B 1ZC4A 3EBPA 4NPAA 2D5BA 1GU0A 1WO8A 3AUUA 4M54A 5KNBD 2RGEA 2JFHA 4RAQA 5E6UB 3QWBA 3WGYA 5E3IA 3O31A 2AR7A 2Z4TA 3H1GA 4PZEA 4XX0B 3EFBA 3Q98A 4Y7CA 3W8RA 4HUQB 5LBIA 1J2TA 2QTHA 2VYNA 4RKWA 3WNVA 4Y3UA 4O4JA 1L7AA 4TS3A 4YJ2F 3LUFA 3TLCA 1S0UA 1ZD3A 1O5IA 3KELA 3U49A 3UWKA 4HP8A 2EERA 3EHDA 5I8WA 3C98A 3CTPA 4L50A 3JALB 5AVRA 1DMRA 4IYRA 3C3YA 3SEFA 1RYYA 4RZSA 4N5DA 2PGXA 3C7KA 3PKZA 3WGKA 2A0KA 5ESDA 4C0LA 4EF4A 1MXFA 5LBUA 3B6ZA 5BQXA 4FOLA 4IJUA 1XAJA 1OWNA 5B1HA 4D4LA 2JGAA 3ZOKA 2YV1A 4WLNA 4HT3B 3AY0A 1DS6A 1VLHA 2Y1KA 2ZRJA 5F35A 4GGPA 4ZVUA 5IYZB 4HWTA 3G59A 1O3YA 3DBRB 1Z25A 4JLWA 2XAAA 2ZYSA 3V42A 2FG6C 5HJ2A 1K7CA 4WBNB 1EVJA 5THKA 1WDTA 3CUEF 5CLQA 1J97A 5EMHA 5HS6A 2XTNA 4XD2A 4B5KA 2YZKA 5ESXA 5ALYA 5IYZA 4X7MA 1E60A 1JEJA 4C0SA 2NUAA 1KZ6A 1Y8AA 2H16A 2IY7A 5B2EA 4LZZA 2QE6A 1VIDA 2OBFA 5PGMA 3MGGA 5K6TA 4ARCA 4N4AA 3A1SA 4Q93A 1BEEA 1G2IA 1ZI9A 3SF8B 4RPCA 3SJCA 4DQKA 5IH3A 3EK2A 2OVFA 5JO9A 3CLSC 2CVZA 4G5RA 4IMJB 2FA9A 2HV8A 3A58B 4YDRA 1U8EA 4IXWA 3RIHA 3ZWAA 4M0FA 4IR7A 1J9GA 2V4ZA 1FUYB 2VP3A 2XZTA 3BMCA 4G85A 3UMFA 4B2IA 5BV8A 2R60A 3ILXA 4ZAFA 1ETUA 2CFRA 2QYOA 4GXQA 3SMVA 4DIMA 4CM6A 4HFMA 2R48A 3Q7EA 1R00A 3UBTA 1L9KA 3UWOA 2J08A 1E3QA 5IXSA 5JMOA 4DDMA 2O4CA 4WE3A 1CDOA 4HDQB 1AQYA 3DPSA 4KR6A 5EUQB 4Q9KA 2HA3A 2ZWOA 3RHTA 2R79A 5IUKC 1U3DA 1SZDA 3CRRA 3TKAA 1FW8A 1D0SA 1QCCA 1XZMA 4HDKB 4IDBA 4JYAB 2HHHB 2B83A 3LT0A 4DRXA 1Y7LA 1AGPA 3ZCPA 3SHOA 5B7QA 5K0EA 4ENPA 1EFPA 4DIDA 5LB2A 3LKBA 1ZP6A 4QAQA 3CIFA 3DBVO 3R1IA 3OCCA 1H66A 4M0PA 1E6WA 2RH4A 3EVEA 4BFSA 4NF2A 2VQFB 3T95A 2F1RA 3B9PA 3C5EA 1N5JA 3N87A 4I7EA 4YRTA 2GX6A 4YRAA 4XYBA 1II0A 2H08A 2XSZA 4N0PA 2GD0A 3IBSA 5GP1A 5EHZA 3LTNC 4FYHA 5AW3A 4O63O 3HXPA 1V11B 4I9HA 1OU4A 1SVIA 1XL0A 1S2MA 3D6FA 3DOUA 4M7OA 4GDFA 1YU9A 2RE8A 3FMFA 4XOIA 4BRUA 2I03A 2ZSJA 4KKVA 3TLZA 1X7DA 2M6RA 4DQVA 4MICA 1M0WA 4KRYA 4QQFA 1ACJA 4L3VA 4EIWA 1NX6A 3BPSA 4E22A 1WXHA 3OEWA 2FSUA 2A6PA 3B48A 3CO5A 4W8GA 1EP1B 1KU6A 1P19A 2DH5A 2G76A 4H4CA 3BFJA 4ER7A 4RVSA 4R3NA 3LPCA 5EIBD 4ALKA 4LXUA 5EJ9A 4BYMA 4WZZA 4RC9A 3UUFA 3FETA 4LJKA 3BWXA 3DE2X 4MS1B 5D6NA 2JZOA 3OTGA 1PCXA 3OZIA 4LG1A 3QVMA 1VE7A 2B1IA 4NK5A 3NMUF 1UMBA 1W0JD 3MBIA 4ZV4A 3ZYCA 1ZD9A 1U9IA 1EUYA 2PSDA 3H1BA 2HBYA 4K6CA 2Y67A 5KYUB 2EJBA 2OHHA 3A11A 5A04A 1MAWA 2WV9A 3PXAA 5AJWA 1NNEA 2BSQA 1VA5A 2WVJA 1K89A 5HZMA 3ETGA 1VYUA 2D2VA 5ERGB 4P58A 1U0SY 3H9UA 1A77A 1AG9A 1RKUA 2IYUA 4BB5A 5C7LO 5LLSA 5LZ2A 4RWEA 4KE7A 2NWQA 1RRFA 4XQ9A 3OEED 3GLGB 2IQIA 2UYQA 2V6BA 3UJCA 5ICEA 2JAUA 3ICCA 3VV2A 3ZVRA 3VMFA 1KJ9A 4Z9XA 1MC1A 4NULA 5DBFA 5AVOA 3PUKA 3HMKA 1DIBA 3EZ9A 1Z2OX 2A0YA 1RTKA 2G06A 1C9DB 3NP9A 4J0IA 3TLBA 4PGFA 3EG5A 1U9ZA 2EKQA 5JPCA 4CG1A 2Q27A 4RETA 1W52X 2QL9A 3K0BA 3AB3A 4KXVA 3PGJA 4MW7A 4OPMA 4UJ5A 2ZJ0A 5EE9A 3U3OA 4JLVA 4I8XA 3GVCA 4LA4A 1YS7A 5JDCA 2E7ZA 4AN1A 2NO6A 4OM8A 3C7AA 2WJZB 3IVMA 3OZFA 3RADC 4MCIA 3GCXA 1O5TA 4UDOA 1HE8B 5KNLA 1I4EB 3LMKA 2PAFA 2WK1A 4IQ0A 2YOHA 4BEJA 1EX6A 4NFLA 3A4NA 2ZIUB 1SD5A 2OCKA 1PQPA 1RD4A 3DE3X 5AM1A 3WSVA 4AQYB 1LJUA 2NO4A 3DV2A 2K6GA 1CEYA 4BVBA 3CLKA 1FOEB 3ML1A 3SQNA 2EFYA 2ZGVA 3ABIA 4S0XA 3RGGA 1W73A 1YZLA 4YLYA 5LXTB 3AEUB 1YD7A 2ZTHA 3DE7X 3QF4A 3HG7A 5G4LA 4B3BA 1RWXA 3UHAA 3PDIB 1FXUA 1H69A 3FR7A 4GEKA 2ACVA 3FSGD 2ID9A 1K8XB 2ZJZA 1YZGA 3KHTA 4K3UA 4BGUA 4Z2AA 1G3QA 4RMHA 5FA6A 4FR2A 1IM2A 3JZAA 1KPGA 3IRUA 3QF4B 1C1DA 4KQCA 2CE2X 1IYZA 3QI2A 1Q95A 2D2XA 4CGYA 3L8EA 3FG9A 1QRRA 3L79A 3PC3A 4XFJA 4BGEA 4ACBA 3PEUA 2PT9A 4MIYA 2P78A 1EJ0A 3UUWA 3ZU2A 3VH3A 3WLFA 1NZDA 3KTAB 4K6HA 3UH1A 4RLHA 1CZRA 2GN6A 3PC7A 4BNNA 1I4TD 3SIWA 1OAOC 3ANSA 4RK5A 1UEIA 4DM4A 1JJIA 3GFVA 3OMWA 4EQ6B 3KOXA 2ACKA 4YV0A 1U5CA 3PQ8A 4B84A 1KYIA 4BWVA 2EFEB 2ZI9A 3DA8A 2DBRA 3LGAA 4NH0A 4WMLA 1AK2A 3W5UA 3WZMA 3ITEA 4JCCA 3DO6A 3GZ4A 1HE5A 4CLRA 1HR0B 2FF7A 2PNFA 4OK3A 1P4JA 1N6OA 2Z5VA 4H0CA 1SQ5A 3JQ8B 3N75A 2FOXA 4LRQA 3GLHB 5HJEA 1A7JA 2I6TA 3VSCA 1AMOA 3MZ0A 4LXHA 1ANKA 5DXJA 1NJFA 1XDGA 2WTXA 5JG7A 4R5MA 2HA4A 3SC2A 3K5IA 5BW4A 4RORA 2P3LA 4NYJR 4RV4A 5CNJA 3KSMA 5D6OA 2WQ7A 3B6MA 4DR3B 5B37A 2XUPA 2WKRA 4YJFB 3SC2B 1K0UA 4QDTA 3AVOA 5IDWA 2GO1A 3O94A 4OHBA 4YJGA 4JODA 4YMIA 1V1JA 2Z95A 3BJRA 4RULA 1MO4A 3SG0A 2HWYA 1HQDA 1I4LD 4C3UA 2PGOA 5FA8A 5FV4A 4ZA2A 3SZOA 1EUCB 4KPUB 3VTZA 4U5QA 4GYKA 1VG9B 3KDSE 2P62A 1EFRD 1NBOA 3GJ7A 2I4TA 1TUGA 3LKZA 5C7YA 5LU9A 4UVEA 3KB6A 2FEKA 3U6BA 1EFRA 2ZYHA 1KEEA 2WFZA 2FK7A 4MK4A 4I36A 2QD3A 5F3WB 4TSRA 2HFKA 1NZJA 3N7TA 1RWMA 2G82A 2GEJA 2YCBA 4ZV9A 4GX1A 3KQLA 4B6EA 3FCXA 3GEIA 1NKSA 3AGQA 1PJ2A 1L2TA 3OVMA 4Q4JB 3AIKA 2FR8A 3IJPA 4WLVA 1AN0A 2XNSA 1WUTA 3EMKA 4U2CA 1KSJA 3ONDA 3PU6A 1PU2A 4ZZ3A 3BZUA 5AW1A 1OJLA 3IIMA 1S4QA 3R7WB 1QF9A 5BW5A 5FH9A 4L9SA 5E2IA 4YJ3B 1HZZA 1A8IA 4JWKA 3UPUA 3C6YA 2Q62A 2XRZA 3WRVA 2FPGA 4XVHA 3FRIA 5CDSA 2D1RA 4EQ6A 3M3HA 4JL5A 5EJ4A 2DQYA 1AD2A 2Y77A 4XWKA 4HAXA 4N7MA 4G5YA 1H05A 5KSZA 1VP9A 3BK1A 1R9JA 4FOOA 3O9MA 1F2UA 5IBRA 5G4KB 2C8KA 2ZUDA 3BJEA 3E3AA 3EQ9A 4JC5A 2HDWA 4IDDA 4B0OA 2IVZA 4MTLA 4PCVA 5IASA 3V4SA 5TIIA 4J0KA 4IWNA 3VHQA 1ZN7A 5KU1A 2JDID 3ERCA 5EUBA 3BFVA 1TYCA 1F8UA 2VK8A 6REQB 3PNKA 4UARA 1NXOA 2JANA 3EG9A 5IN5A 4ZTUB 3IV9A 1YQTA 1I8TA 2W6JA 4DSZA 3TBKA 1QVAA 4PLZA 3UVEA 2B1JA 3MC1A 2X9VA 2NAPA 2QTGA 521PA 1Y1KE 1D6JA 4H17A 3U31A 4MOWA 2GPNA 5BSTA 3AEZA 5D87A 4BASA 3FOZA 3FUWA 2L42A 3CX7A 1Z6GA 3EJWA 2RKBA 5E9JA 3GK3A 1XZCA 4ED9A 5MGNA 4LHWA 1ODIA 2DWOA 4ZEMA 3ZDAA 1LDEA 4RK7A 4KPYA 3K4HA 3BL8A 2WU3A 2CXNA 3BSSA 4DLLA 2G5PA 5K6AA 1SCUB 1QK5A 1Z74A 4L6IA 4K6MA 4WNIA 4G0VA 2G1AA 3GPLA 5H8WA 1T1SA 4CDMA 2OSBA 4UHJA 2O5VA 1NIPA 2H4ZA 3GLIA 3Q40A 2JFZA 4PZ0A 2ILTA 1D6MA 4N6OA 1WTAA 1J90A 4TWAA 4L5CA 5C5DA 3F0TA 1JQ3A 4KUEA 1L4LA 2A0UA 1NBEA 1J5EB 4JEMA 4BLWA 2P3QA 3K32A 3OEHA 1TCBA 2ID4A 2X9LA 3RUDA 1Q1AA 1K5HA 2P90A 3OD1A 2I3BA 4RE5A 5JNSA 2ZR8A 1G8YA 4H27A 4D9IA 1ID8A 4BO1A 1Y1QA 1YDGA 1IC6A 3LUKA 1W19A 4GC9A 4H7IA 1RAEA 4DJ5X 1U0JA 2CBZA 4K6GA 2ZTVA 1CUWA 2FPKA 2ONCA 4KIJA 1Y63A 2IJGX 2J6BA 1REQB 3DTNA 4QRDA 3HV2A 4YALA 2WYUA 3TL2A 1RYFA 5ENVA 4HNHA 3IMKA 1ZVKA 3THYA 1V2HE 2I62A 3OCVA 4CV0A 5FYQA 1M67A 5JWOA 5LA6B 3RBAA 1SVWA 3VVLA 2YJGA 4LAFA 1LTKA 3KQHA 3P45A 2XGJA 4ZK2A 3KPJA 2CNWD 3AU9A 3FWHA 4JH0A 4S1TA 2H85A 1GP2A 1IAVA 3F6PA 5EOVA 5AJHA 3X2SA 2ZPAA 1X19A 1CV2A 1TB4A 2QE7D 4Q6BA 3EASA 3I2IA 1YTUA 3IKJA 4YAIA 5LKAA 1MOSA 4WKNA 2WF9A 5DIFA 2PL5A 2VBIA 4IV0A 1L5MA 1PSWA 1MMFB 3IQWA 2ERCA 1YVDA 3D31A 2PZAA 2O2HA 4CFYA 5CYPA 1EDDA 2H4HA 2XOXA 3EAFA 4N6GA 1XB2A 3L6DA 3JPYA 3SR3A 5FJIA 3CTMA 1KDRA 1M83A 1WEHA 2QVCA 2ZDHA 3FD8A 1GQFA 1N5LA 4V2IA 4R8SA 1J2UA 1OXBB 3BFXA 1E1MA 2VZEA 2G4LA 4HQRA 3W8EA 3MNFA 1XROA 4RH3A 2HA6A 4WRRA 3UAXA 5AUPB 2GO7A 5FR2A 4E4RA 2IODA 2E4UA 4HB4A 1ID1A 4MIKA 4MS3A 1G42A 1VHDA 2P27A 2Q3DA 3ZWYA 5EIAA 1TYAE 1FJ2A 3C41J 3RO7A 3NETA 4MHSA 4MHTA 4ZAGA 5LP6A 2YWHA 4MW0A 1AQLA 4WDRA 5KTRA 4WCVA 3THXB 1RIIA 2YN4A 3ORHA 3UJAA 2NLOA 2GEFA 1MEJA 3OMLA 4AMUA 4AURA 4HXYA 4N3CA 2HSDA 1GHTA 3LDHA 4UEWA 1KJZA 2WWXA 3E0QA 5KTMA 4P5PA 3PZRA 5KX5A 4TN1A 5CJPA 1RCFA 1UJ2A 1NDUA 3NQ41 3HB7A 3EAGA 3UKJA 3C3JA 1I14A 1PZFA 1G9SA 2AVDA 1XPJA 2LE0A 2OCYC 3IHKA 2Q4DA 4ZDIA 4GQIA 1GILA 2J30A 2XI4A 4HFRA 2P91A 1SHTX 4CLXA 4O6VA 1KYXA 1D1QA 1HC7A 3LSTA 4OQFA 4LYHA 3SAJA 2C2HA 3RVNA 2AWOA 3L4BA 2VP6A 3OIWA 1G55A 4DA4A 2YZMA 4M6WB 2PZKA 1KK0A 1N1EA 2ZU0C 1YOVA 4DLSA 3TF5A 3GP8A 1DAIA 2C58A 1ZM3A 3TG8A 4O4LA 3NKFA 2I29A 4QHTA 3ZWOA 1HLGA 3ZDQA 4QPJC 3T3EA 5KWVA 3Q8MA 4G6ZA 1QDLB 5FAXA 1PSZA 2FLVA 2QQFA 3HWX1 3KO8A 3SOPA 2WJPA 5L3QB 4DDWA 3HA2A 2O2EA 3FBTA 3QBVA 3LLUA 4Q01A 3KPVA 1DWUA 2H9AA 4NYIQ 1YA8A 1OC4A 1RAIA 5MDHA 2ORYA 1UJ6A 4Q4HB 4RELA 1JEQB 3IC5A 3UH0A 1J70A 1N25A 4LQ4A 1ZUIA 3I37X 4AJKA 1KARA 4Y1RA 1WDMA 3QENA 3U3XA 1WSAA 2E9SA 2OENG 2AS0A 3LX6A 1DFGA 3G2KA 4JJEA 1LUAA 1BN7A 1RRGA 1GQYA 5DMHA 2B4YA 1XZIA 4W63A 4K87A 4M9SA 3LL7A 2P9YA 1IXSB 3U9TA 4D97A 4IS2A 2AFIA 3A4TA 2VKQA 4MI3A 3VNQA 1U31A 4E2WA 4ER5A 4TL9A 2FOIA 2WICA 4ZGWA 2PS3A 1CWUA 1GCUA 1Z39A 5F12A 3ZQUA 4C9BA 1Z63A 3ABQB 3TNJA 3P4YA 1E1QD 2AB0A 4WEOA 4F6CA 4HL6A 3MG9A 2P1ZA 3SI7A 1CBUA 1FUIA 5J1TB 1LBHA 2NU8A 3HDTA 3KSDO 3LBHA 3PF9A 3H8VA 4FM9A 4LFBB 4M37A 3OE1A 3L05A 1UWKA 4M9CA 2OVBA 5HBRA 3TZQA 3C4VA 1R5OA 2JIOA 3L4KA 2ZJOA 1ESCA 5TJ9A 4ZVSA 2ZJYA 3C45A 5KVQA 3QV1A 3TD2A 1BD3A 2UUAB 2FZEA 3TB6A 1O9BA 1U80A 4CMIA 1NN3A 2ZATA 4BUJA 1ZEMA 5KTSA 3OOYA 3OX1A 3S8EA 3QXGA 2ODBA 3S99A 3M1YA 1XHFA 4JP8A 3STXA 4WINA 3IR7A 2APJA 1E1NA 1I7LA 1T9KA 2IZ7A 4E2XA 5BWBA 1C8VB 2DPGA 3ED1A 3CLVA 3CKMA 3QVWA 4XYMA 2WJ3A 4GC5A 1PNRA 1R6XA 4NZ9A 5F52A 4GI5A 2HPHA 2GCIA 1XNGA 4UHCA 3HDGA 3FHTA 1CCWA 4NOJA 3KQKA 3WKAA 3DVAB 3EGCA 2PGLA 5IU6A 4TGLA 3CF4A 2II6A 4P6VF 3AWIA 5TQ0B 4PGAA 4EA6A 5KYXB 2WTMA 3L6BA 4R2LA 4AG5A 3GLHE 3K1JA 1G19A 3QE4A 3EQ6A 5FQNA 3N2KB 3NAZA 4X3PA 4WZBB 4FHDA 5CFQA 2FX2A 3OPXA 3AGPA 2W2QA 1Q74A 1XZQA 7MDHA 2BUCA 1E4EA 3OIGA 5CM9C 4Q21A 4PYNA 3WKDA 2WTAA 2H65A 4PFJA 3HO8A 2BEVB 2IIBA 1M2GA 3DM9B 3QSGA 5JNRA 1GZVA 2IHVA 2FJ0A 3M6LA 2JLXA 4MI9A 3EXIA 5IMBA 2NZ8A 4HEJA 3V2HA 4QIHA 4EB6B 2GT1A 3W2FA 5AVUA 1FNMA 2EW8A 2QU8A 2X41A 3F7OA 5CVVA 5IJAA 1QHNA 4HNAB 1MVOA 4P3YA 1ZOPA 2D0PB 3FOCA 3I9KA 5B64A 3HYLA 1QHHB 1SR8A 1YULA 3P0IA 4TXLA 5AXBA 3EZLA 1BMTA 1IL0A 2ZUEA 2P9TA 3ZHTA 1A98A 4PWYA 2MOKA 5LD2B 2DQ4A 1DJLA 2BFEB 3CLHA 3H7IA 4L5YA 5F9MA 3CNQS 4U2KA 4YRBA 3LCRA 2FWRA 4IJ5A 4OYYA 5T3UA 3K05A 4NAUA 4PRLA 1P2TA 4P0TA 4TWIA 4ICIA 5D51S 3Q9SA 1Z38A 1AE1A 2WG2A 2RH9B 1H6CA 4C7XA 3HEMA 2XQGA 2B99A 1HLPA 2IUEA 1SUAA 4MH0R 4MGZR 2BFCA 2YTZA 2ZJAA 4BO8A 2QGZA 4HS4A 1W9MA 3I8XA 1YA6A 3HVUA 1GSHA 4Z0HO 2ERXA 5B2FA 1CT9A 2IUFA 3G7UA 3HCRA 3HBAA 2J87A 1UWLA 2QX7A 1T8YA 1G21A 3ZW8A 4EHDA 5CX4A 3JQ7B 2YN2A 5E2BA 3K8ZA 3OT5A 3ZR4B 1T4CA 4JI6B 4Y30A 3BF7A 4R84A 3ILSA 3COSA 1MC5A 1F9EA 3QEOA 4MQLA 2AH5A 3NOQA 2BM9A 4GG1A 2XH8A 5AOAA 2J67A 2I2DA 2WYHA 2IXFA 5JAOA 3HHPA 5J5AA 3FF4A 5EIOA 2XBMA 2REOA 2HA0A 1YQ9A 2VPTA 3I9LA 3RBVA 4CDRA 5IEJA 5L3VA 5KDDA 2VSQA 3OHPA 3B6EA 5KNDA 2HNAA 4HS9A 2QNBA 2VBGA 1L7OA 4TRNA 1UJBA 1ZNXA 5EERA 2A1TR 4Q00A 1WMDA 1GKIA 3WB0A 5B6JA 2WD8A 3PWTA 3K9NA 4P4UA 3NI2A 2Z08A 4DUYB 1QIJA 2WOJA 3FE2A 3U7QB 3MLEA 1W85A 4RZ3A 1JFSA 4MJLA 3JZIA 1JLHA 4RMJA 3E82A 3HSYA 4UEOA 2EKZA 2YWCA 1N2OA 4JB3A 3ZUGA 5FORA 3IIJA 1LD3A 1WXQA 2VS1A 1FP6A 3ZCVA 2ZM5A 2HU7A 3TB4A 3OLYA 3EYAA 3WBJA 2B2NA 1LB1B 1XZAA 2R6CA 3LX8A 3PKJA 4GQAA 5DFAA 5ESWA 4X95A 2J3KA 1WLSA 2VJYA 4YPOA 1WPQA 2FU5C 3GLQA 2OM6A 3UICA 1P17A 1S2OA 2NYUA 3AXSA 1N2BA 3CG0A 3DP9A 1J0AA 1P60A 4FFSA 4JJ8A 4JJAA 3TLXA 4KG7A 3M3PA 5JSFA 4UAUA 1Z7BA 5EEHA 2BTQA 2GFQA 2VQ3A 3WQBA 1U5AA 2QV0A 1AQUA 4NPCA 4XWYA 1YC2A 3CCFA 4MV5A 4ETIA 4PR0A 2POCA 4W5HA 2VJQA 3IDQA 4M60A 2ZRBA 4ARBA 1E2QA 1VC2A 4LI3X 1O95A 2YQ5A 4TMFA 1CB0A 3HJAA 4UM9B 5BOVA 5KKNB 4X5OA 3ULKA 4FCCA 5IAAA 2Y9PB 3WWCA 3HB4X 4A0FA 1JKMA 5CRIA 4GOND 1XC7A 1CDEA 3HUEA 1S7CA 5FWXA 2BOVA 2POQX 4QM7A 1G21B 2ISQA 3EVZA 4BNIA 4WCFC 2HD4A 1T10A 1PEKE 3EZGA 3M4JA 4B34A 1MGPA 3OOEA 2EDCA 3CINA 5BVGB 3U7FB 2FMIA 1WMSA 1V7PC 1ONBA 4F97A 4FEGA 3A6JA 3ESRA 4W9RA 5KWEA 4LRXA 4LWPA 1T4GA 2MWMA 3PRYA 4TVBA 3LC7O 5CNMA 3ABSB 5FHRA 4ZDWA 4C0BA 4Z6KA 4C07A 2AKEA 1BE6A 2WVAA 1MO6A 4BMOB 3K6JA 2PVCA 2RJ3A 3LVBA 4F3NA 3U5TA 4E11A 5L6LB 3TQRA 1N3BA 4C7OA 3T9FA 1NVUQ 1UBFA 3B52X 1Y3AA 1I94B 1N0HA 5LNK1 2JLAA 4DR6B 2O8DB 5HEKA 3MSXA 1GAXA 1CIJA 4RXTA 3NXSA 2FPIA 4CF5A 1FJGB 5FNVB 2F8TA 3A10A 3ADKA 2A9JA 1FBNA 3SF0A 4M1WA 1SPBS 4DIOA 4ZYYA 3FRHA 2W6ID 1KHTA 3MWEA 1SZCA 2KLHA 1G7CA 5FTNA 2QRVB 5JZMA 5LN1A 2QRUA 4IKEA 3HWSA 1PLJA 1WULS 4FFDA 5J47A 3HYSA 2FR0A 4DSOA 3Q3EA 3U0VA 4WKPA 3BREA 2A35A 2W2OA 4BXOA 3FFAA 5TQ2A 4RABA 3PE3A 1DHRA 4IFBA 4Q02A 1G6OA 4ZWNA 2FI1A 1LS1A 2IZ1A 3I2KA 2F3RA 3K7EA 1BVUA 1UH5A 5AKEA 1DAFA 5TGZA 4YCSA 2V1UA 2JBAB 1OYYA 5JSQA 3ONFA 1K06A 1Q17A 1WZEA 1PWYE 4H1WA 4XVCA 1U1CA 5IWCA 4BJ1A 1EFDN 1QQ7A 2PA3A 3MWDB 4K81B 2CGEA 4QBFA 4AUKA 5LM3A 3TNYA 3JR7A 5JSYA 4DUZB 1ZRMA 2P4HX 3T7EA 2CHFA 1GR1A 4JCOA 4UE2A 3DUFA 4CHTA 1VFPA 4INAA 2YHBA 1GTVA 1Z37A 5DBEX 2BFFA 5D84A 1KQOA 5EIHA 3C14C 3DMTC 2VDLB 4YGYA 4DR5B 5C80A 4KBGA 3UG7A 3UFXA 4GMHA 4GP6A 1B8VA 1GZ4A 2B3DA 1R9GA 3F4KA 4K86A 4WY2A 1H8HD 4MV9A 4O29A 2QX4A 1FRNA 2V7QD 2ZQYA 3ANLA 3DCJA 3MILA 3P52A 1RADA 1ZM2A 2P9GA 2OOSA 4TMTA 4WACA 1N33B 2P9BA 3VZRA 1XR3A 2OC4A 3PI7A 3NNDA 4DRXB 3W8FA 5F33A 4EEXA 4F2DA 1QYVA 4PIVA 5KJ6A 3PNMA 3I4CA 2QAGA 3RVPA 4EO4A 1TLLA 4R05A 2R6AA 4R7TA 4E5YA 4XJTA 1MZVA 5AIAA 5EWMA 2VWGA 4GMDA 2AW3A 4M1EA 1THGA 2NVUB 4E70A 4XWTA 4LX8A 4Q9IA 3CH4B 2DFKB 4FVTA 4H3SA 3T12A 1MX9A 4G81A 2O14A 3BFKA 1T6XA 4MPRA 1PX0A 4AMGA 2GZSA 3C3DA 1Y8CA 3NVAA 2JBWA 4KXWA 5I9TA 3E9YA 3P26A 2FSHA 4OG2A 3HGMA 1SXJB 3C5VA 3P27A 4ER0A 2NXJA 1BRTA 2LD4A 3EW9A 2HBZA 3KJHA 4RSGA 5T4BA 4EM6A 1BAPA 1EFVA 2OG1A 4OL9A 3T7IA 1C1HA 4TYWA 2XZLA 3RVBA 1R0BA 4YMSA 2OD7A 4TRMA 4ID3A 2MSNA 2AEFA 3IE1A 1MN6A 3LGSA 5D1HA 1GZ7A 1RWKA 2A7QA 1U1EA 2XOEA 4FJ2A 2F3SA 4TROA 4WJZA 3LOQA 8LDHA 1M2OA 1HE2A 2P7HA 3VYTB 2W11A 3B85A 3TYXA 5AVVA 3HXKA 1YI0A 3OY7A 1KZ7B 3MCZA 3SM3A 3PIRA 3CM0A 3PD1A 3VO8A 1WR8A 2YWGA 3PCTA 3RPEA 4B4UA 5C18A 5DBOA 4OHMA 1W2GA 5DLQC 5FOUA 2PS1A 2B2XA 1ZX1A 3MWDA 2X8JA 2B78A 4UVIA 3COJA 3NOXA 4MW9A 3L7MA 3ZWQA 4TLCA 1ODKA 1S9HA 3FUUA 1GDHA 1UOQA 4LHXA 3ZHOA 4TQUS 1Z2DA 2B6HA 3SYRA 3UWPA 1KH3A 3NHSA 3UHJA 1G3RA 2ZRFA 2C2GA 3IESA 1D4FA 1MOZA 2VJLA 1O95D 3P0JA 4FE3A 2QAGC 2BCEA 1TC2A 4DDUA 421PA 1HFJA 5FOWA 3I9JA 3PCRB 4YV7A 2XT9A 1XFAA 2CJWB 2XPCA 3T99A 5B7PA 3NTUA 5WRFA 3R0QA 2ZUFA 2Z9BA 1NW9B 3GP3A 4OCZA 4X71A 3TLMA 5IJ9B 1Y6JA 3WGOA 1ZJ4A 1T3ZA 1YJCA 2AJLI 5CEJA 1ECLA 2OBNA 4IGKA 1H2AS 2ZBDA 5CDFA 2UUPA 3RSHA 4RPKA 5GV7A 1GPDG 4BX0A 2EGGA 3UMYA 1ZC3A 5FI1B 3N3AC 4H7PA 4DHEA 3DNMA 3TQTA 4JP1A 4LECA 3CZCA 3WNBA 3W1EA 2IVFA 4X9XA 1RMYA 2WHEA 2R1VB 5B3JA 4LZWA 5DX0A 3O8BA 3ELBA 2ZT7A 3H13A 2Z9DA 2GRAA 4H16A 4P2GA 1QRTA 1T9CA 3AW9A 2XWQA 2G72A 2PWPA 5JLAA 1K97A 3QA9A 3D6UA 2VK4A 1KZ4A 3H6KA 4YP0A 1MAUA 1R4NA 2X22A 4QG7A 2H2WA 4Q3EA 3SKVA 3UJHA 2XVAA 1XZKA 4JELA 5KNDD 1GG9A 2E5WA 4RLFA 4F7DA 1PUIA 3A7EA 1ZFNA 4TS9A 1KZHA 4IUCS 1JJFA 1RLOA 2Z30A 4BFVA 1QVVA 2PKRA 1O95C 3WBKA 1T24A 1U3CA 1RKXA 2IUTA 4O08A 4O02B 1VBKA 3PUYA 3U3MA 4B71A 4D3ZA 1W5TA 5C8YB 2WPDD 3MELA 1JFFB 3BB1A 1NAHA 1ZJ5A 2W58A 3B5IA 3GFBA 3RNOA 4CTJA 5L40A 1FIUA 4MQ5A 4YRSA 1AS2A 3AILA 3H04A 2FPPB 4R1LA 2PD6A 1P8AA 2DC1A 5I7UA 3EA5A 3KAPA 5AJUA 1SGWA 2DGDA 1NUSA 1ES9A 4UXJA 4JYCA 3DVLA 1PJLA 3F74A 4Q82A 3SX0A 1YK0A 1PD1A 4K0RA 3UB3A 3CNOA 4FQ7A 4DBLE 4F3KA 3K6SB 3TOZA 1TGYA 2ZB7A 4LYAA 2PUFA 5BNTA 4XGIA 4H1TA 8GPBA 5L6MB 1G3UA 3OC6A 1DKRA 3TQSA 3QXJA 1NDQA 5A9SB 2F8LA 1BWQA 3CXUA 1RWWA 1PAUA 3C3WA 3IRVA 1SXHA 5CFLA 4LF5B 3CF4G 2IOFA 4LISA 4B5LA 1CRPA 3WGVA 4B33A 1E3IA 5JQGA 2I54A 5BXYA 1H2WA 5TY0A 3R3ZA 4HTFB 3HM9A 1QNFA 4JT4A 4TMVA 3PQEA 2OT3B 4OLHA 4BV2A 2GARA 3GGPA 3WMEA 1HK7A 1QU3A 4J9UE 4UM7A 3PNVA 1GFWA 1G59A 3IUYA 1S2LA 5B1YA 4IVQA 3B3GA 4XW2A 3F6SA 2PSSA 3PVSA 1QP8A 5KREA 4PQYA 2ZUWA 3CURA 1B2LA 2XKBA 2VVTA 3G7SA 3ICVA 1FL9A 3I92A 4C0QC 4I81A 3TFOA 1P73A 2R1VA 3DL0A 2LV8A 4WXRA 5HRUA 1X3SA 2G0NA 3TLJA 1NI4A 3QWAA 5K05A 3N2LA 1KI9A 4V0LA 3QVUA 3WRYA 4D0GA 4F5YA 2WJ4A 4IS3A 4CPDA 3PDCA 3U62A 1AA6A 3URMA 5FPSA 2GI4A 1SHZA 5D3ZA 2E6UX 5ILOA 1QTQA 1T9GR 5TQJA 2HMAA 4KE9A 2PZFA 2RAUA 2B35A 5A5FA 3TRIA 3C8ZA 3KJFA 4NCIA 3OZRA 4BLSA 1L7PA 5JH7F 1YVRA 4BPBA 1SQGA 4IZ6A 3QELB 4L22A 5ECWA 1U6KA 2GCNA 1BD4A 3LCVB 3ESZA 4W5JA 5HXAA 4LHEA 1LSUA 4NIMA 2XMPA 4KITB 2FRXA 3FYHA 3V7YA 1B4DA 2VPIA 3VVBA 3EQZA 1B93A 5DTRA 3CKKA 5TEVA 5KSYA 4W5NA 5TRTA 4K9MA 1FYVA 2O2GA 2G9RA 5ICMA 5GVSA 2ACEA 3NYWA 3OT1B 4EKNB 5KUTA 1YXMA 1ULBA 1E2MA 2HK6A 2OYSA 4M1TA 4OFZA 3VGJA 4QBTA 5K03A 4D8UA 1U3UA 4GR9A 3ZPXA 1FW6A 2W0MA 3IAEA 2PL1A 5FL7D 2REQA 2WIAA 5B1SA 4KV9A 1DL5A 1LW7A 5BURA 3TNLA 1PNQA 3V4RA 2PUEA 1SK8A 1WUYA 1VMAA 3IAHA 2IHJA 3A25A 3STWA 3EOZA 3WLPA 2O5EA 1I6KA 4GYWA 4EF5A 4H7EA 2C2MA 4RE6A 3ZV3A 4HVCA 1LCIA 4JEUA 1RKBA 1W0KA 4MUKA 4V1CA 4DWVA 5CT8A 1U1FA 1YSCA 1KQ3A 2X15A 1GNLA 2C2ZA 3DULA 4TMZA 4UHKA 4DNPA 1Q20A 2R6GA 1W9HA 4EW1A 5C7IO 1BCRA 5A9RA 4PX9A 4XM1A 3I9NA 4KXYA 1KBQA 3GMSA 1V5WA 4BX9A 5IM4F 3OLZA 2ODPA 2HRDA 4ZVMA 1U0GA 2VJAA 4ECAA 1VJ0A 1Z08A 2EDAA 1XZNA 4IJKA 4NZNA 3WIEA 3ZV6A 3HTXA 2IYRA 1L9XA 1SXPA 3ROXA 1MIOB 4TV8B 2AZ4A 4H31A 5IH7A 4ZQBA 5MN4A 4BO2A 5CTJA 2O6LA 2PFGA 4MWGA 5BO5A 4DEYA 1L1QA 3EFHA 3OZBA 1YZFA 3G8CA 2PU5A 4B3XA 2OD9A 2XVYA 5KINB 1WUKS 1BFUA 4JSTA 4NENB 4X20A 1GRQA 4EPTA 2IKSA 3P9ZA 1U0HC 1FYEA 3IODA 4N0EA 4UMDA 1DBRA 5HP4A 1KOGA 3LRPA 4P35A 4X1KA 3LKDA 1Z22A 3DBHA 4I55F 3VR5A 3W1WA 4EZBA 1M2JA 3INYA 4WESB 3OQIB 4F4CA 5JFOA 4RIGA 3I83A 3TTSA 4ZTZB 4PSKA 2F3PA 3FUCA 1V9LA 4QU8A 3PVZA 1GPYA 3HA3A 3VR5H 2OR3A 3OZEA 4XUGB 4YRNA 4QDXA 3HXQA 1ZJWA 3JWEA 3GRUA 4WESA 1RQPA 1V96A 2N47A 2NUTA 2VDUE 2JKYA 4NZZA 2QAIA 3QPWA 1JHQA 1SBQA 5GAJA 4O1IA 5LOVF 1W44A 4PSUA 1YFZA 4LBZA 4ND5A 2W9XA 3KJZA 1X7WB 2AT1A 2QUKA 5LQKA 1CZUA 3ZCQA 2UAGA 2R6R1 4DL9A 3O9ZA 4A10A 5JANA 4II2A 4DKJA 3OCUA 3SMQA 2FV8A 2AA3A 2ZUUA 4MWSA 1N0WA 5I7AA 4EFKA 1NVWQ 1QGYA 4W7HA 3O95A 4AJJA 4C5BA 3OU2A 4YMHA 4M22A 1OT5A 1FSZA 4I3HA 3SX2A 1C8KA 1DJOA 4Q3CA 2R7NA 1SA0B 1UDCA 5JD4A 2J9FA 1LV7A 3BZWA 5CT9A 2XWBF 2R85A 3N1UA 1WF3A 4WK0B 4DPMA 4HWRA 2W2LD 3PFKA 1QFSA 4OHXA 3EF3A 1V37A 1L5NA 4CIBA 4I50A 1G2PA 1HFWA 2YV5A 3OTIA 3SR0A 3UW1A 5KC8A 3LGXA 4ZT2A 1SKQA 4O2LA 4CKZA 1SA0A 2VWQA 2C7RA 3CJQA 2P68A 2QW0X 1KK2A 3HCPA 4MR8A 3P9IA 3K9WA 4OX9B 3L7LA 4RWZA 1QXSA 4DVGA 3CCCA 4YX9A 4O2RA 3ETEA 1CQIA 3OKAA 4JEHA 2ZKLA 3SXJA 1U2GC 4RK1A 5FBWB 4M9ZA 1SUSA 1XEAA 4PLFA 2DWQA 3VJLA 3ZG6A 3WB1A 5DNVA 4OXNA 2XKJE 1DLIA 1GRNA 3WG9A 1P4AA 3QNWA 4A15A 2J0QA 1YB4A 3JATA 1KMHB 4IX9A 1PE0A 3Q3CA 3SFTA 2PIAA 5IVDA 4R1NA 2XZOA 5TC4A 2A0XA 1V1RB 1JMYA 1UDBA 1XRMA 3PFIA 3EIQA 5DCYA 3QTLA 4YUZA 2JPDA 2VA8A 5BV0A 1TYEB 1JKFA 3FHCB 1P3DA 2R9VA 5TEWA 2NG1A 3ITNA 3NJ8A 1P7ZA 2IYNA 4QOJA 3TK1A 2OHOA 1Q7BA 4EAQA 2W2LA 2RH5A 3AKYA 5EI5A 3SE0A 3KYIB 4RHTA 3GFOA 1Z0AA 5E6UA 2QMHA 2PUTA 2G67A 2Z8XA 1E6MA 3RHFA 2XKKA 4LHZA 2VUHB 1D8TA 4KXUA 4YFYA 2W6QA 4CEIA 4LDRA 1T6BY 1UMDB 3HVIA 4XJSA 2IWHA 2JIQA 4DMHA 3R77A 2D7DA 2HEGA 4OXIA 3D4LA 4AF8A 3KJQA 4HQLA 3VAAA 1UINA 2ZDQA 2QTAA 3Q2OA 4UTVA 2XEDA 5IFKA 2Y8EA 3CUYA 4Q39A 4MVJH 4B32A 4MA4A 1UMDA 2A1TS 3SHFA 2XYQA 3VU9A 5M7EA 3U61B 4HYTA 4XAQA 4CI9A 2KWIA 5C3MA 1BWPA 3IQGX 1U90A 3H1AA 3SEQA 4OGFA 4I4TF 2WHRA 1R2QA 1KMCA 2A9QA 2QPLA 1AK9A 2WHPB 4KMOA 5KPJA 3TXYA 3A37A 3AF1A 3K9BA 3LDAA 4FIDA 4FQ8A 1CTQA 2XUHA 3OPYA 2R6FA 4L9WA 4LWQA 1V5IA 3DVRX 3NUGA 5JC1A 4A0SA 2O59A 3OX4A 3FMPB 2FSSA 3WB2A 4EUSA 2Y0EA 4KL8S 5L3SB 2CLEB 3O7WA 4HMQA 2QZ4A 4JX8A 1BMQA 2XIJA 4LTDA 4RO0A 4ZO9A 3THOA 2ZRCA 4C4TA 5KDOA 4GI2A 1QG4A 4AO6A 3QBTA 5JNUA 5CNIA 4PFQA 3H4VA 1EK6A 2LIVA 3ZZTA 5FL3A 4BQNA 4IIEA 4C6HA 4CG0A 1EE2A 4ZKDA 5L3QA 2SKDA 1WDWB 4G0PA 4JBNA 3GEEA 4KKXB 6GPBA 4G1MB 3GUUA 1RKVA 4HQOA 3AIOA 3AHHA 4U7PB 4BMZA 1MHTA 3CVOA 2QF7A 2XF2A 3CEJA 3SGLA 4D9MA 1J8QA 1S02A 4KQFA 4OUDA 1MV8A 1Y7PA 1V6CA 2VDOB 3K9LA 1Q0LA 3VC1A 4LBVA 2X76A 5DK6A 3O8RA 1LPSA 1SCKA 2Q8QA 3PFBA 4HD8A 5EKSA 1JA0A 2C98A 1ZAYA 4PC7A 3A2MA 2X2OA 1EGHA 3M2PA 3RUPA 1ZR2A 2F8SA 2GBCA 3CF2A 4D6XA 1E5VA 3O47A 4OMDA 1UXHA 5FF9A 3E03A 3VJRA 3JARA 4JDUA 2AOVA 4HXFB 1ELOA 3NG1A 3DLBA 1KI1A 2P9CA 1AUVA 3MYRA 4CFSA 5EJGA 2IE0A 3UFBA 2FRDA 1L7QA 3M89A 4GP9A 3G3EA 2XNCA 4MGEA 5EHIA 4KQJA 4HEA1 4QNNA 2IDMA 3NS7A 4FFRA 8ADHA 1LNQA 1Q22A 2BCGY 3KYDA 3Q7RA 1ETHA 1P9NA 4DA0A 4R83A 3FSEA 1V5FA 3RIYA 4JX9A 4BP9A 3K0CA 2YFYA 4KREA 1J0EA 1KKUA 1TRKA 3R3UA 4N3AA 1EWRA 2C2XA 3PLRA 4Q16A 2Y1GA 2ICAA 2Q9CA 4FYJA 5GQSA 1LZKA 1XXHE 4YRKA 2AYYA 4YJKA 1NASA 1I5EA 3DAHA 3IUJA 2WJAA 1SO8A 3RV3A 1DQRA 3DT9A 3E7DA 3K15A 2NO7A 4OP3A 3QVSA 5TQVA 1QIDA 3HCEA 4QWWA 1XLUA 4H7FA 4JYPA 4ZT5A 3GRVA 2FZVA 4LI0A 2AEEA 2RARA 3B5EA 4OHFA 2AXPA 5KQGA 2RHTA 2X0DA 2IXGA 3ESXA 1KIMA 5AW5A 3GQBB 5TGDA 3ELYA 3DKVA 2WF7A 4TTTS 3ZU3A 3QKTA 4NYMR 4BO7A 1WOMA 1Q12A 1FBTA 1X1RA 2B98A 2QG4A 4IHJB 3DOFA 1IHUA 1M1ZA 3B51X 4RD1A 1EM8A 4JP2A 3RSGA 1ABFA 1RRPA 2F64A 2GMWA 4IOKA 4UHHA 3RJZA 4X0EA 4TZTA 4D9KA 1L7RA 4Y1EA 4GLOA 2Z98A 1HX7A 3BHIA 1UOEA 3VYRB 4Q12A 4LSZA 4TTJA 3C6BA 1P1FA 1JRLA 4PCAA 3CZRA 2WIBA 3FRJA 2HRRA 3N6VA 2HSEA 2CNNA 3OOWA 1CY0A 2P6MA 1QH1B 3L7NA 4O2BF 3EFEA 1C80A 1GGEA 2JGDB 4NE7A 4D44A 1CYEA 2BEVA 1X92A 4HN4B 3SC6A 3O74A 4FP9A 3G02A 1O58A 4RY8A 4BO5A 4R7ZA 3LDUA 4X66B 4NCJA 2NM0A 3ENNA 1U8TA 1HBJA 2JIMA 3FYUC 3UK1A 3SBDA 1NUTA 2VAWA 2V7QA 4FZVA 3TJRA 3FDZB 3NAQA 2P4SA 3CWZA 2HIGA 1Q6YA 1SUDA 3OTQA 4BDSA 3DWEX 2YZ7A 3OWHA 3TSZA 3LVFO 1KZ9A 4DC0A 1SCJA 3SNKA 5ALKA 4TKZA 3TS1A 2HA7A 4B09A 1P3JA 1T9GS 5ES4B 2Z6UA 1C3OB 2ISSD 4PG4A 2FWBA 1QCZA 2GJ9A 1URPA 5FPPA 3DLAA 2PXAA 4YCDA 1OGJA 2P2YA 3L06A 5LQSA 3WMWA 5J2TB 2Y0CA 2AZMA 3GEDA 4B6QA 4DXAA 2DR2A 3U4MA 4WLEA 2C03A 1HEUA 2Q0HA 4Y6PA 1HDGO 4TTPA 2R1TA 1KYQA 2PEZA 3CMCO 3PV0A 5JR3A 4IIJA 3HJBA 2HY7A 4J49A 1EAMA 5F1PA 4C0HA 2ECQA 3OSZA 5CIWA 4UAJA 2CF6A 1FFHA 3QU2A 4B3RB 3MVEA 5JHGB 4DQLA 5DHUA 4LK2A 4KN8A 5M29A 3KT3A 1LNZA 3BXOA 2FF5A 3E1KA 2YNMC 4JSYA 1OZFA 4Y2PA 1P8JA 1NP7A 4LJSA 2NT4A 2XV1A 2W8BB 4OXQA 2C88A 4PQEA 5AHRA 4D3FA 1V4NA 5J3JA 3QQPA 5I7FA 3KB1A 1Z0SA 2OG2A 3OCYA 3UJ7A 3ER6A 1JE1A 4YT2A 2HM7A 3AH8A 4ZARA 2P9EA 3WLSA 1FFWA 3S2EA 3O8OB 4GLFA 2JEZA 5IULC 4LF4B 3TMYA 1NVMB 3WJAA 2YW9A 1HRDA 1VG0B 4RGYA 2WLTA 4XQEA 8OHMA 3Q6NA 3UXYA 1JPUA 1LLUA 3QMPA 1G5RA 2XUOA 4YCJA 4MV3A 1FUEA 1W85B 1OMOA 1Y1LA 1FLDA 3U39A 3BD9A 4KIWA 3OZTA 1GUDA 3ES9A 1QG2A 2Q3BA 2CMFA 3EVCA 4K2HA 3RH0A 4FYYA 3WC4A 1JLRA 4PGGA 4RH1A 1B0ZA 4N01A 4RVGA 4XWWA 2K7ZA 4DNOA 4P0PB 3RU2A 5JAQA 2W6OA 1Q11A 1TO6A 3ID6C 4TYPA 1NMYA 3L7YA 3WMGA 5HFNA 1XT6A 3ZI4A 3HKEB 2PSFA 3CPSA 4I6GA 1ZD4A 2Y6VA 4LYGA 5CYOA 3WGJA 4EY7A 1JH9A 5EESA 1U98A 1JJ7A 3AJDA 2B1QA 4KAAA 3UTDA 1J25A 2RH8A 3FYCA 3G6WA 4OOEA 2OYCA 1H23A 2GDZA 3FJOA 5K7SA 2OKCA 5K8TA 2KBFA 2VTKA 1E9RA 1JUDA 4RTKA 1A9YA 1QAMA 1ZCFA 4RHUA 4CM9A 5TF0A 3FVWA 2CZQA 4Y2HA 4JVOA 3AUSA 1AKMA 2AXQA 1FMFA 1PR6A 2WSMA 2FX3A 1LH0A 1ZHFA 1T5DX 1PUJA 2GEVA 3HWRA 3I0NA 2PX2A 4R9VA 3ZW9A 1F4LA 4OMUA 1UAYA 2LCFA 5BXQC 3O38A 4L95C 3AG6A 1XNQB 5C4GB 1YIDA 4FC6A 3FCAA 4QFMA 1GZ3A 2C7GA 4L7VA 4M0CA 4X85A 3PNYA 5ITZA 5CU7A 3VZPA 3W2GA 1XPUA 2IGBA 5CA1F 3HVJA 2Q3FA 3CVWA 3KLNA 4V0ME 1EYZA 4GUAA 3W1VA 2Q3LA 4BB9A 3JYQA 1AVTA 1HDEA 1NOKA 3J80A 3W2TA 3L7JA 1WU7A 3ET4A 4A03A 2DFNA 1LQ2A 3RSFA 3O8OA 2OMKA 3GQVA 1C50A 4UNQA 3KEQA 3SJ7A 2EXXA 3PSAA 3NVDA 3SHQA 3ZBPA 2QX9A 1NUPA 4KIGA 2I2XB 1DXYA 1JDNA 1RHKA 2I1QA 3L01A 4YUVA 1ARZA 2O7QA 3AFOA 3U7JA 3WHPA 2PJUA 4N12A 5FPHA 3G5LA 2IYQA 4U7WA 2PNJA 4BB0A 4DIBA 3EUFA 5ICSA 3P9XA 1VI6A 1JILA 4WLFA 1WHSA 1G8JA 3QJ5A 2WU1A 4J1TA 2QRLA 2QU7A 3QWHA 2I7CA 3DGEC 4PX2A 5CDTA 3DTVB 3Q85A 3B1YA 4NH4A 2I91A 1DWPA 2Z2YA 4IHQA 3ZJ5A 1P4SA 4HLCA 3RWOA 3VVMA 3AWDA 1H9BA 2VRBA 3I4FA 4QG3A 4BV8A 5GIPE 3CRW1 2PCLA 1C30B 3E27A 5FBZA 3JWIA 5HOQA 1RI1A 1XZHA 1WZ2A 5TQ2B 1A50B 2MSDB 4YLEA 2AFHB 2AZTA 4C2BA 4DIFA 1Y1SA 1F2UB 1HTTA 4UC0A 5JAMA 2FPRA 1E5XA 4BNYA 1VG1A 1W94A 3ANTA 4D4HA 2WQ6A 3FUXA 4M8LA 1ZKMA 2Z1MA 4BVLA 4LXXA 1ECJA 3VYWA 1K0FA 3A9UA 4E5UA 1Z4MA 2G80A 1R8XA 4ROTA 5A2QA 3KE8A 4WFQA 1MJNA 1YUMA 4MZXA 3ZQKA 2JLVA 4CHGA 1R0LA 4O8CA 2WR8A 1P9OA 1TTQB 2FW8A 2GGSA 1T6YA 3FPBA 4MUBA 1FFXA 3T34A 5EN4A 5L8VA 1A76A 5BUCA 4D3DA 4PYQA 2BGLA 3E9EA 1VECA 2IZZA 4OY3A 5FOXA 4H6XA 2CMDA 3WBFA 4WLUA 5EQFA 2TMDA 3LBFA 4JP3A 3MTDA 2FUKA 1W1UA 3NTQA 4P84A 4X45A 5EA2A 1QB8A 4AU1A 4E5SA 4EH1A 4AKHA 2BZ0A 2JCYA 2Z57A 4LF6B 2XE6A 3BERA 5E0KB 4ZI2A 5IXYA 4LOIA 1TAQA 4MKZA 4QOHA 3T4PA 5DI9A 2Q0XA 1M2EA 2OA0A 3C8HA 1BMDA 2ZAIA 1ZUHA 2PTHA 4YIKA 2M6LA 1XKLA 1KYZA 5IC6A 4YQEA 2ZYUX 1AHPA 1NV9A 4K9RA 2BGNA 1K63A 2EATA 1QOPB 1A9OA 1JVNA 1PJQA 2QIPA 4M2LA 1C0EA 4FFNA 5DU2A 1GVHA 4WOPA 5E95A 1QV7A 2VDVE 1U9IC 1YJXA 1XA0A 2CXPA 3DFUA 3AI7A 2O7NA 3MRXA 4M55A 4REQA 4Y6RA 5MF6A 2PQ0A 1EFAA 1KU0A 1B6GA 2PD4A 4TTSA 5HGXA 2O3TA 3JZFA 3K2BA 2EARA 5ADHA 1JR3E 1M6VA 2B7CA 1EE9A 4BNDB 3PFNA 4G5QA 2G4CA 2G8LA 4P54A 2H06A 1E3EA 5EZQA 1S9DA 5TPZA 4LSGA 1ZWKA 2IHKA 3H2JA 4B9EA 1OV4A 3CS3A 1WOYA 2GZRA 4D2IA 3BL6A 3DFKA 4DB4A 2FG7C 4IIVA 3U4QA 1QIGA 4UUQA 2J09A 1VPVA 4BAUA 4QZVA 3HYCA 1K7EB 3D64A 4MW5A 3BILA 1QGUA 3DE4X 5A05A 1FXWF 2QJWA 1FP7A 3PX2A 2W0SA 5BWMA 2YYYA 3AFGA 1QHXA 4O2AF 5AKLA 4ESEA 1M1YA 1I30A 2GXSA 3B13B 1DT3A 3LIPA 2QR5A 4F11A 2WOOA 2X9NA 1E2JA 2Q46A 3CT6A 2NQTA 4OFXA 1GDDA 1E7WA 2ZUSA 4KFCA 4X6LA 3WA7A 1F4PA 4E46A 3ABZA 4GZLA 3GUYA 1KI8A 2O05A 3ROQA 2NYVA 4UUMA 3EIEA 3HVHA 2CV2A 2HO4A 1C7RA 1L8OA 1YRWA 1C7ZA 2RK4A 3PHBE 5ALHA 3RRFA 5KVCA 4HCJA 3NO4A 4OF4A 2QMUA 3BVPA 3KFVA 4CW7A 2VBCA 2O2YA 5H5JA 2WIDA 3LX5A 1JKJA 1OT3A 1T8UA 4QVIA 3O1JC 3PXXA 4GNKA 4TVOA 4DCMA 5J2UF 5GADl 1H9CA 3PC2A 5C5IA 4OJKA 1TCAA 4ZT6A 1QQ6A 1OTXA 2ZTLA 2Y1XA 3DLPX 1RJDA 1HT3A 1LX7A 1V16B 3CPJB 3L7KA 4JJZA 2CVHA 5E7MA 3MJDA 4F1KA 5CFPA 4HDNA 3S3TA 3KCQA 3E3OA 5DNWA 1Y7IA 1T9ZA 2JEYA 3LFHA 1RWNA 4PSAA 3DMHA 3MA0A 3C6QA 3WYDA 2WWYA 3TMKA 2P6PA 3TCNA 1CUUA 2C9ZA 4QODA 4FLFA 4TV9B 3ENZA 5EPUA 2UVQA 3RJMA 4K40A 2VAMA 4XDGA 1U2DA 1V5GA 5I4KA 2V7EA 4B3GA 2WUWE 5JPDA 1IY8A 4DM7A 3AM1A 2WZDA 3OX3A 1JG3A 2O8CA 2VPQA 3T3NA 3RFVA 2WA1A 1EMDA 1TT7A 2IZ0A 2PL9A 3ZD9A 3D4BA 3G2NA 2AC7A 4EFLA 1PFQA 3NJRA 3D8NA 3SY8A 2IHTA 4PYKA 2X14A 1NUQA 1WPRA 1E4VA 3JVUA 5C9ZA 3MD0A 4NWIA 4MYUA 2ENUA 4UUPA 1EVIA 2PGDA 4LSMA 2JGFA 3VU1A 1WVGA 2FZWA 2WYIA 4AKSA 4BN0A 4NG4A 5JFGA 1NX9A 2ODTX 1XMXA 4GI7A 2ODAA 1YHNA 5FKJA 1V1MB 3FDXA 3FA2A 1IMOA 4F60A 2J59A 5CBKA 4X64B 2NTEA 5DCWA 1ACLA 1E5DA 5JYEA 2JGKA