1ORMA

Nmr fold of the outer membrane protein ompx in dhpc micelles
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TRANSVERSE RELAXATION-OPTIMIZED NMR SPECTROSCOPY WITH THE OUTER MEMBRANE PROTEIN OMPX IN DIHEXANOYL PHOSPHATIDYLCHOLINE MICELLES
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein X
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1ormA00
2GE4A 2MNHA 1G90A 3C5OA 1QJPA 2JMMA 2X27X 3GP6A 1Q9GA 2LHFA 1QJ8A 1THQA 1QJ9A 3QRAA 1ORMA 2N2LA 1MM5A 3G7GA 4RLCA 1Q9FA 2M06A 2F1VA 1MM4A 2F1TA 2N2MA 2ERVA 2MHLA 1P4TA 2K0LA 4PUXA 1BXWA 2M07A 3QRCA
chains in the Genus database with same CATH superfamily
2KZ7B 3POQA 3AAAB 3T24A 1GFQA 3TZGA 3SYBA 4LSEA 3VE1A 4D64A 2GE4A 5D5DA 4FMSA 3K19A 2JMMA 3LK3A 1GFPA 1Q9GA 2LHFA 4PJ0O 1ZHZA 3VZWX 3LK3B 2OMFA 4D5UA 5ADXK 3A0BO 1T16A 3AAEA 3LK2A 4BUMX 4C4VA 2Y0LA 3PGUA 2Y7SA 3VE2A 5EE2A 2FGRA 1MM5A 5G38A 2XE2A 3V8UA 3G7GA 5DL5A 2XMXA 2WJQA 8PRNA 2WVPA 1GFNA 2Y2XA 4U9CA 3A0HO 1MM4A 3BRZA 3DA4A 3KVDD 2N2MA 2Y0HA 1HXUA 3SZDA 1P4TA 2K0LA 3HW9A 3LK42 4AKRA 5GTHO 4AKMA 5PRNA 3WU2O 3A2SX 2LFUA 5G39A 5ADXL 1IZNA 1IZNB 4KRAA 5G3AA 4FESA 4AYID 3AA0A 4N58A 3GP6A 3T0SA 2W80C 3AA1A 1QJ8A 2R88A 1THQA 1QJ9A 2O4VA 3JCUO 3NSGA 4G76A 4GF4A 4N75A 3PF1A 5DL7A 2R8AA 1ZHTA 3AA7B 4UB8O 5IYUA 1HXTA 1ORMA 3WI4A 1BH3A 4AFKA 3EMNX 4AYMC 4F4BA 3DZMA 4GCPA 4AZLA 4B61A 1OPFA 4LSHA 2KDYA 2XE1A 4XNLA 5B5EO 4IL6O 5DL8A 3AA0B 3POUA 3UPGA 5JDPA 3SYSA 4N74A 1Q9FA 4AYNA 1S5LO 4RJWA 4FSOA 2M06A 3UU2A 5B66O 3RBHA 3VY8X 2F1TA 5E79O 4JFBA 2ERVA 4KR4A 3PORA 4O4UA 4O3XB 4FSPA 4O3YA 2M07A 2FGQX 1OSMA 5KAFO 1MPFA 2K4TA 2XTQA 4N59A 2R4NA 1HXXA 5TISO 2MNHA 4E1TA 1ZHWA 3C5OA 3DA3A 2X27X 4O3WA 4GCSA 4E1SA 1ZHYA 2KXPB 2W81C 3AA1B 4O4XA 3HWBA 3FYXA 1YS5A 4KR8A 5DL6A 4AYEC 4FT6A 2XG6A 3QRAA 2PORA 3LK2B 3JTYA 4FOZA 4FRTA 4PR7A 4C4VB 2IWWA 2N2LA 3PRNA 5FVNA 3NJTA 1GFMA 4C69X 3SZVA 2R4OA 3LK41 4RLCA 2ZFGA 3AAAA 3SY7A 4D65A 2PRNA 4FQEA 3BRYA 2F1VA 2XE3A 3PGSA 4JCHA 4K3CA 2XE5A 5GV0A 3DWNA 4K3BA 2F1CX 3HOEA 3POXA 4FRXA 2MHLA 2IWVA 2R4PA 4C00A 3DWOX 4FZNA 1PRNA 6PRNA 3HOLA 4O49A 5KAIO 3WI5A 4XNKA 3AA6A 4RJXA 3PGRA 7PRNA 3KZIO 2YNKA 4LSIA 2Y0KA 4QQ1A 4LSFA 5GTIO 4AUIA 2AXTO 1G90A 4FZLA 1QJPA 3O0EA 4AYDC 1BT9A 5H2FO 5G26A 5AFUL 1ZHXA 4GCQA 3BS0A 2QTKA 3UAQA 4AKRB 2J4UP 4GHBA 1PHOA 1T1LA 2WJRA 4UB6O 3T20A 2KZ7A 5T5FA 4RLBA 1GFOA 1E54A 2R89A 3VZUX 4FZMA 2YPVA 3PQUA 2J1NA 2X9KA 4RL9A 5AFUK 3AA6B 3VY9X 2KC0A 2ZLDA 3VZTX 3PQSA 4O3ZA 3SY9A 4Z3TA 2KXPA 3AAEB 3AA7A 4G75A 2XTRA 1H6S1 2ODJA 2JQYA 4PUXA 2R4LA 1BXWA 4CTDA 4FUVA 3QRCA
chains in the Genus database with same CATH topology
2KZ7B 3POQA 3AAAB 3T24A 1GFQA 3TZGA 3SYBA 4LSEA 3VE1A 4D64A 2GE4A 5D5DA 4FMSA 3K19A 2JMMA 3LK3A 1GFPA 1Q9GA 2LHFA 1ZHZA 3VZWX 3LK3B 2OMFA 4D5UA 5ADXK 3AAEA 3LK2A 4BUMX 2Y0LA 2Y7SA 3VE2A 5EE2A 2FGRA 1MM5A 3V8UA 2XE2A 3G7GA 5DL5A 2XMXA 8PRNA 1GFNA 2Y2XA 4U9CA 1MM4A 3KVDD 3DA4A 2N2MA 2Y0HA 1HXUA 3SZDA 1P4TA 2K0LA 3HW9A 3LK42 4AKRA 4AKMA 5PRNA 3A2SX 2LFUA 5ADXL 1IZNA 1IZNB 4KRAA 4FESA 4AYID 3AA0A 4N58A 3GP6A 3T0SA 2W80C 3AA1A 1QJ8A 4G76A 1THQA 1QJ9A 2O4VA 3NSGA 4GF4A 4AFKA 5DL7A 1ZHTA 3AA7B 5IYUA 1HXTA 1ORMA 3WI4A 1BH3A 3EMNX 4AYMC 4F4BA 4B61A 4GCPA 4AZLA 1OPFA 4LSHA 2KDYA 2XE1A 4XNLA 5DL8A 3UPGA 3AA0B 3POUA 5JDPA 3SYSA 1Q9FA 4AYNA 4RJWA 4FSOA 2M06A 3UU2A 3RBHA 3VY8X 2F1TA 4JFBA 2ERVA 4KR4A 3PORA 4O4UA 4O3XB 4FSPA 4O3YA 2M07A 2FGQX 1OSMA 1MPFA 2K4TA 2XTQA 4N59A 4E1TA 1HXXA 2MNHA 1ZHWA 3C5OA 3DA3A 2X27X 4O3WA 4GCSA 4E1SA 1ZHYA 2KXPB 2W81C 3AA1B 4O4XA 3HWBA 3FYXA 1YS5A 4KR8A 5DL6A 4AYEC 4FT6A 2XG6A 3QRAA 2PORA 3LK2B 3JTYA 4FOZA 4FRTA 2N2LA 3PRNA 5FVNA 1GFMA 4C69X 3SZVA 3LK41 4RLCA 2ZFGA 3AAAA 3SY7A 4D65A 2PRNA 5GV0A 2F1VA 2XE3A 4JCHA 2XE5A 3HOEA 3POXA 4FRXA 2MHLA 6PRNA 4FZNA 1PRNA 3HOLA 4O49A 3WI5A 4XNKA 3AA6A 4RJXA 7PRNA 2YNKA 4LSIA 2Y0KA 4QQ1A 4LSFA 4AUIA 1G90A 4FZLA 1QJPA 3O0EA 4AYDC 1BT9A 5G26A 5AFUL 1ZHXA 4GCQA 3UAQA 2QTKA 4AKRB 2J4UP 4GHBA 1PHOA 3T20A 2KZ7A 5T5FA 4RLBA 1GFOA 1E54A 3VZUX 4FZMA 2YPVA 3PQUA 2J1NA 4RL9A 5AFUK 3AA6B 3VY9X 2KC0A 2ZLDA 3VZTX 3PQSA 4O3ZA 3SY9A 4Z3TA 2KXPA 3AAEB 3AA7A 4G75A 2XTRA 1H6S1 2ODJA 4PUXA 1BXWA 4FUVA 3QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  2MNH A;  1G90 A;  3C5O A;  1QJP A;  2JMM A;  2X27 X;  3GP6 A;  1Q9G A;  2LHF A;  1QJ8 A;  1THQ A;  1QJ9 A;  3QRA A;  1ORM A;  2N2L A;  1MM5 A;  3G7G A;  4RLC A;  1Q9F A;  2M06 A;  2F1V A;  1MM4 A;  2F1T A;  2N2M A;  2ERV A;  2MHL A;  1P4T A;  2K0L A;  4PUX A;  1BXW A;  2M07 A;  3QRC A; 
#chains in the Genus database with same CATH topology
 2KZ7 B;  3POQ A;  3AAA B;  3T24 A;  1GFQ A;  3TZG A;  3SYB A;  4LSE A;  3VE1 A;  4D64 A;  2GE4 A;  5D5D A;  4FMS A;  3K19 A;  2JMM A;  3LK3 A;  1GFP A;  1Q9G A;  2LHF A;  4PJ0 O;  1ZHZ A;  3VZW X;  3LK3 B;  2OMF A;  4D5U A;  5ADX K;  3A0B O;  1T16 A;  3AAE A;  3LK2 A;  4BUM X;  4C4V A;  2Y0L A;  3PGU A;  2Y7S A;  3VE2 A;  5EE2 A;  2FGR A;  1MM5 A;  5G38 A;  2XE2 A;  3V8U A;  3G7G A;  5DL5 A;  2XMX A;  2WJQ A;  8PRN A;  2WVP A;  1GFN A;  2Y2X A;  4U9C A;  3A0H O;  1MM4 A;  3BRZ A;  3DA4 A;  3KVD D;  2N2M A;  2Y0H A;  1HXU A;  3SZD A;  1P4T A;  2K0L A;  3HW9 A;  3LK4 2;  4AKR A;  5GTH O;  4AKM A;  5PRN A;  3WU2 O;  3A2S X;  2LFU A;  5G39 A;  5ADX L;  1IZN A;  1IZN B;  4KRA A;  5G3A A;  4FES A;  4AYI D;  3AA0 A;  4N58 A;  3GP6 A;  3T0S A;  2W80 C;  3AA1 A;  1QJ8 A;  2R88 A;  1THQ A;  1QJ9 A;  2O4V A;  3JCU O;  3NSG A;  4G76 A;  4GF4 A;  4N75 A;  3PF1 A;  5DL7 A;  2R8A A;  1ZHT A;  3AA7 B;  4UB8 O;  5IYU A;  1HXT A;  1ORM A;  3WI4 A;  1BH3 A;  4AFK A;  3EMN X;  4AYM C;  4F4B A;  3DZM A;  4GCP A;  4AZL A;  4B61 A;  1OPF A;  4LSH A;  2KDY A;  2XE1 A;  4XNL A;  5B5E O;  4IL6 O;  5DL8 A;  3AA0 B;  3POU A;  3UPG A;  5JDP A;  3SYS A;  4N74 A;  1Q9F A;  4AYN A;  1S5L O;  4RJW A;  4FSO A;  2M06 A;  3UU2 A;  5B66 O;  3RBH A;  3VY8 X;  2F1T A;  5E79 O;  4JFB A;  2ERV A;  4KR4 A;  3POR A;  4O4U A;  4O3X B;  4FSP A;  4O3Y A;  2M07 A;  2FGQ X;  1OSM A;  5KAF O;  1MPF A;  2K4T A;  2XTQ A;  4N59 A;  2R4N A;  1HXX A;  5TIS O;  2MNH A;  4E1T A;  1ZHW A;  3C5O A;  3DA3 A;  2X27 X;  4O3W A;  4GCS A;  4E1S A;  1ZHY A;  2KXP B;  2W81 C;  3AA1 B;  4O4X A;  3HWB A;  3FYX A;  1YS5 A;  4KR8 A;  5DL6 A;  4AYE C;  4FT6 A;  2XG6 A;  3QRA A;  2POR A;  3LK2 B;  3JTY A;  4FOZ A;  4FRT A;  4PR7 A;  4C4V B;  2IWW A;  2N2L A;  3PRN A;  5FVN A;  3NJT A;  1GFM A;  4C69 X;  3SZV A;  2R4O A;  3LK4 1;  4RLC A;  2ZFG A;  3AAA A;  3SY7 A;  4D65 A;  2PRN A;  4FQE A;  3BRY A;  2F1V A;  2XE3 A;  3PGS A;  4JCH A;  4K3C A;  2XE5 A;  5GV0 A;  3DWN A;  4K3B A;  2F1C X;  3HOE A;  3POX A;  4FRX A;  2MHL A;  2IWV A;  2R4P A;  4C00 A;  3DWO X;  4FZN A;  1PRN A;  6PRN A;  3HOL A;  4O49 A;  5KAI O;  3WI5 A;  4XNK A;  3AA6 A;  4RJX A;  3PGR A;  7PRN A;  3KZI O;  2YNK A;  4LSI A;  2Y0K A;  4QQ1 A;  4LSF A;  5GTI O;  4AUI A;  2AXT O;  1G90 A;  4FZL A;  1QJP A;  3O0E A;  4AYD C;  1BT9 A;  5H2F O;  5G26 A;  5AFU L;  1ZHX A;  4GCQ A;  3BS0 A;  2QTK A;  3UAQ A;  4AKR B;  2J4U P;  4GHB A;  1PHO A;  1T1L A;  2WJR A;  4UB6 O;  3T20 A;  2KZ7 A;  5T5F A;  4RLB A;  1GFO A;  1E54 A;  2R89 A;  3VZU X;  4FZM A;  2YPV A;  3PQU A;  2J1N A;  2X9K A;  4RL9 A;  5AFU K;  3AA6 B;  3VY9 X;  2KC0 A;  2ZLD A;  3VZT X;  3PQS A;  4O3Z A;  3SY9 A;  4Z3T A;  2KXP A;  3AAE B;  3AA7 A;  4G75 A;  2XTR A;  1H6S 1;  2ODJ A;  2JQY A;  4PUX A;  2R4L A;  1BXW A;  4CTD A;  4FUV A;  3QRC A; 
#chains in the Genus database with same CATH homology
 2KZ7 B;  3POQ A;  3AAA B;  3T24 A;  1GFQ A;  3TZG A;  3SYB A;  4LSE A;  3VE1 A;  4D64 A;  2GE4 A;  5D5D A;  4FMS A;  3K19 A;  2JMM A;  3LK3 A;  1GFP A;  1Q9G A;  2LHF A;  1ZHZ A;  3VZW X;  3LK3 B;  2OMF A;  4D5U A;  5ADX K;  3AAE A;  3LK2 A;  4BUM X;  2Y0L A;  2Y7S A;  3VE2 A;  5EE2 A;  2FGR A;  1MM5 A;  3V8U A;  2XE2 A;  3G7G A;  5DL5 A;  2XMX A;  8PRN A;  1GFN A;  2Y2X A;  4U9C A;  1MM4 A;  3KVD D;  3DA4 A;  2N2M A;  2Y0H A;  1HXU A;  3SZD A;  1P4T A;  2K0L A;  3HW9 A;  3LK4 2;  4AKR A;  4AKM A;  5PRN A;  3A2S X;  2LFU A;  5ADX L;  1IZN A;  1IZN B;  4KRA A;  4FES A;  4AYI D;  3AA0 A;  4N58 A;  3GP6 A;  3T0S A;  2W80 C;  3AA1 A;  1QJ8 A;  4G76 A;  1THQ A;  1QJ9 A;  2O4V A;  3NSG A;  4GF4 A;  4AFK A;  5DL7 A;  1ZHT A;  3AA7 B;  5IYU A;  1HXT A;  1ORM A;  3WI4 A;  1BH3 A;  3EMN X;  4AYM C;  4F4B A;  4B61 A;  4GCP A;  4AZL A;  1OPF A;  4LSH A;  2KDY A;  2XE1 A;  4XNL A;  5DL8 A;  3UPG A;  3AA0 B;  3POU A;  5JDP A;  3SYS A;  1Q9F A;  4AYN A;  4RJW A;  4FSO A;  2M06 A;  3UU2 A;  3RBH A;  3VY8 X;  2F1T A;  4JFB A;  2ERV A;  4KR4 A;  3POR A;  4O4U A;  4O3X B;  4FSP A;  4O3Y A;  2M07 A;  2FGQ X;  1OSM A;  1MPF A;  2K4T A;  2XTQ A;  4N59 A;  4E1T A;  1HXX A;  2MNH A;  1ZHW A;  3C5O A;  3DA3 A;  2X27 X;  4O3W A;  4GCS A;  4E1S A;  1ZHY A;  2KXP B;  2W81 C;  3AA1 B;  4O4X A;  3HWB A;  3FYX A;  1YS5 A;  4KR8 A;  5DL6 A;  4AYE C;  4FT6 A;  2XG6 A;  3QRA A;  2POR A;  3LK2 B;  3JTY A;  4FOZ A;  4FRT A;  2N2L A;  3PRN A;  5FVN A;  1GFM A;  4C69 X;  3SZV A;  3LK4 1;  4RLC A;  2ZFG A;  3AAA A;  3SY7 A;  4D65 A;  2PRN A;  5GV0 A;  2F1V A;  2XE3 A;  4JCH A;  2XE5 A;  3HOE A;  3POX A;  4FRX A;  2MHL A;  6PRN A;  4FZN A;  1PRN A;  3HOL A;  4O49 A;  3WI5 A;  4XNK A;  3AA6 A;  4RJX A;  7PRN A;  2YNK A;  4LSI A;  2Y0K A;  4QQ1 A;  4LSF A;  4AUI A;  1G90 A;  4FZL A;  1QJP A;  3O0E A;  4AYD C;  1BT9 A;  5G26 A;  5AFU L;  1ZHX A;  4GCQ A;  3UAQ A;  2QTK A;  4AKR B;  2J4U P;  4GHB A;  1PHO A;  3T20 A;  2KZ7 A;  5T5F A;  4RLB A;  1GFO A;  1E54 A;  3VZU X;  4FZM A;  2YPV A;  3PQU A;  2J1N A;  4RL9 A;  5AFU K;  3AA6 B;  3VY9 X;  2KC0 A;  2ZLD A;  3VZT X;  3PQS A;  4O3Z A;  3SY9 A;  4Z3T A;  2KXP A;  3AAE B;  3AA7 A;  4G75 A;  2XTR A;  1H6S 1;  2ODJ A;  4PUX A;  1BXW A;  4FUV A;  3QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...