1ORMA

Nmr fold of the outer membrane protein ompx in dhpc micelles
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TRANSVERSE RELAXATION-OPTIMIZED NMR SPECTROSCOPY WITH THE OUTER MEMBRANE PROTEIN OMPX IN DIHEXANOYL PHOSPHATIDYLCHOLINE MICELLES
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein X
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1ormA00
3GP6A 2GE4A 2JMMA 2X27X 1MM5A 2M07A 2M06A 2MNHA 3C5OA 2LHFA 1QJ8A 4PUXA 2K0LA 3QRCA 3G7GA 2ERVA 1Q9FA 1QJ9A 3QRAA 2MHLA 1Q9GA 1QJPA 2N2LA 2F1VA 1P4TA 1BXWA 1MM4A 4RLCA 2F1TA 1G90A 2N2MA 1ORMA 1THQA
chains in the Genus database with same CATH superfamily
1E54A 3A0HO 3GP6A 4D5UA 4C4VB 1IZNB 2WVPA 3PORA 2GE4A 4GHBA 1HXTA 2X27X 3PGUA 2R8AA 4B61A 2KXPA 1MM5A 4C00A 2M07A 2M06A 4RJXA 4O4XA 2PRNA 1QJ8A 3VE1A 2XE2A 4O4UA 1T1LA 3VZTX 3EMNX 1PHOA 5G39A 4C69X 4RL9A 4PJ0O 3JCUO 5GV0A 4FZLA 4O3ZA 4FRTA 3UPGA 2MHLA 2JQYA 3AAAB 2XTRA 3PGRA 1IZNA 2OMFA 4GCPA 4JCHA 2X9KA 4UB8O 2R4NA 1P4TA 5TISO 3AA0B 1ZHXA 4N59A 4AZLA 1HXXA 1GFQA 1HXUA 4RLCA 3T0SA 3WI5A 2F1TA 3VZWX 3DA4A 3T24A 5AFUK 4E1SA 1G90A 5G26A 1THQA 1ZHYA 4RJWA 4FSPA 3SYSA 2LFUA 2Y0HA 2J1NA 4KR8A 4AYDC 4AYNA 5G3AA 1PRNA 2XMXA 2YPVA 1GFNA 5KAFO 5AFUL 2R4LA 2ZFGA 3AAAA 3C5OA 2LHFA 5DL7A 3BS0A 4PUXA 3SZVA 2K0LA 2Y2XA 3A0BO 3HW9A 3LK2B 5B66O 3LK3A 2J4UP 2ERVA 1BT9A 4FESA 4O3YA 4XNLA 3VZUX 4AUIA 4KR4A 2R4OA 4FT6A 4GCQA 1OPFA 1Q9GA 1ZHZA 3LK41 1GFOA 3PRNA 3PQSA 4D65A 2KZ7A 2F1VA 2XG6A 4IL6O 2QTKA 4FRXA 3VY8X 3AA7B 3AA1A 4O3XB 4E1TA 2IWWA 3PQUA 3SY9A 5ADXL 4D64A 3AA6B 4BUMX 3DZMA 3RBHA 3K19A 5ADXK 4N74A 2KZ7B 4LSFA 3AAEB 4AFKA 2PORA 3AA7A 5H2FO 3VY9X 2JMMA 3BRYA 4K3CA 2KC0A 2XE1A 3WU2O 1OSMA 2MNHA 5DL6A 3DWOX 5E79O 3T20A 1T16A 4AKMA 3DWNA 3UAQA 4K3BA 3QRCA 4XNKA 5EE2A 2Y0KA 4AKRA 4N58A 4QQ1A 3UU2A 5G38A 2XE3A 1QJ9A 3LK42 4FQEA 4O3WA 5GTIO 4Z3TA 3AA6A 3LK2A 5FVNA 4FSOA 1BH3A 3NJTA 1QJPA 3NSGA 4RLBA 3AAEA 3BRZA 3QRAA 5KAIO 3SZDA 4LSEA 5B5EO 3PGSA 4G75A 5JDPA 3JTYA 1BXWA 2FGQX 4O49A 2AXTO 2F1CX 4FMSA 4JFBA 2W81C 1ORMA 1H6S1 3AA0A 3PF1A 4FOZA 4LSHA 2KDYA 2XE5A 3O0EA 4FZNA 1S5LO 4FZMA 4PR7A 5DL5A 5T5FA 3VE2A 3POXA 4AKRB 6PRNA 3KZIO 4AYID 3A2SX 1GFPA 4G76A 2WJQA 4LSIA 4U9CA 2KXPB 4GCSA 4AYMC 1ZHWA 5DL8A 4CTDA 5GTHO 3DA3A 4FUVA 2W80C 5PRNA 3G7GA 3SYBA 3WI4A 4C4VA 2R4PA 2YNKA 3HOLA 3HWBA 2ODJA 2Y0LA 3KVDD 3LK3B 1YS5A 3POQA 4GF4A 3FYXA 3SY7A 1MPFA 2Y7SA 3TZGA 4F4BA 3POUA 3AA1B 2R89A 2N2LA 2R88A 2XTQA 3V8UA 5IYUA 2IWVA 3HOEA 2ZLDA 1MM4A 4N75A 4AYEC 7PRNA 8PRNA 5D5DA 2WJRA 1GFMA 1ZHTA 2K4TA 2O4VA 1Q9FA 2N2MA 4UB6O 4KRAA 2FGRA
chains in the Genus database with same CATH topology
1E54A 4D5UA 3GP6A 1IZNB 3PORA 2GE4A 4GHBA 1HXTA 2X27X 4B61A 2KXPA 1MM5A 2M07A 2M06A 4RJXA 4O4XA 2PRNA 1QJ8A 3VE1A 2XE2A 4O4UA 3VZTX 3EMNX 1PHOA 4C69X 4RL9A 5GV0A 4FZLA 4O3ZA 4FRTA 3UPGA 2MHLA 3AAAB 2XTRA 4GCPA 1IZNA 2OMFA 4JCHA 1P4TA 3AA0B 1ZHXA 4N59A 4AZLA 1HXXA 1GFQA 1HXUA 4RLCA 3T0SA 3WI5A 2F1TA 3VZWX 3DA4A 3T24A 5AFUK 1G90A 5G26A 1THQA 1ZHYA 4RJWA 4FSPA 3SYSA 2LFUA 2Y0HA 2J1NA 4KR8A 4AYDC 4AYNA 5AFUL 1PRNA 2YPVA 2XMXA 1GFNA 2ZFGA 3AAAA 3C5OA 2LHFA 5DL7A 3SZVA 4PUXA 2K0LA 2Y2XA 3HW9A 3LK2B 3LK3A 2J4UP 2ERVA 1BT9A 4FESA 4O3YA 4XNLA 4AUIA 4KR4A 4GCQA 4FT6A 1OPFA 1Q9GA 1ZHZA 3LK41 1GFOA 3PRNA 3PQSA 4D65A 2KZ7A 2F1VA 2XG6A 2QTKA 4FRXA 3VY8X 3AA7B 3AA1A 4O3XB 4E1TA 3PQUA 3SY9A 5ADXL 4D64A 3AA6B 4BUMX 3RBHA 3K19A 5ADXK 2KZ7B 4LSFA 3AAEB 4AFKA 2PORA 3AA7A 3VY9X 2JMMA 2KC0A 2XE1A 1OSMA 2MNHA 5DL6A 3T20A 4AKMA 3UAQA 4XNKA 3QRCA 5EE2A 2Y0KA 4AKRA 4N58A 4QQ1A 3UU2A 2XE3A 1QJ9A 3LK42 4O3WA 4Z3TA 3AA6A 3LK2A 5FVNA 4FSOA 1BH3A 4E1SA 1QJPA 3NSGA 4RLBA 3AAEA 3SZDA 5JDPA 4LSEA 4G75A 3JTYA 1BXWA 2FGQX 4O49A 4FMSA 4JFBA 2W81C 1ORMA 1H6S1 3AA0A 4FOZA 4LSHA 2KDYA 2XE5A 3O0EA 4FZNA 4FZMA 5DL5A 5T5FA 3VE2A 3VZUX 4AKRB 3POXA 6PRNA 4AYID 3A2SX 1GFPA 4G76A 4LSIA 4U9CA 2KXPB 4GCSA 4AYMC 1ZHWA 5DL8A 3DA3A 4FUVA 2W80C 5PRNA 3G7GA 3SYBA 3WI4A 2YNKA 3HOLA 3QRAA 3HWBA 2ODJA 2Y0LA 3KVDD 3LK3B 1YS5A 3POQA 4GF4A 3FYXA 3SY7A 1MPFA 2Y7SA 3TZGA 4F4BA 3POUA 3AA1B 2XTQA 2N2LA 3V8UA 5IYUA 3HOEA 2ZLDA 1MM4A 4AYEC 7PRNA 8PRNA 5D5DA 1GFMA 1ZHTA 2K4TA 2O4VA 1Q9FA 2N2MA 4KRAA 2FGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP6 A;  2GE4 A;  2JMM A;  2X27 X;  1MM5 A;  2M07 A;  2M06 A;  2MNH A;  3C5O A;  2LHF A;  1QJ8 A;  4PUX A;  2K0L A;  3QRC A;  3G7G A;  2ERV A;  1Q9F A;  1QJ9 A;  3QRA A;  2MHL A;  1Q9G A;  1QJP A;  2N2L A;  2F1V A;  1P4T A;  1BXW A;  1MM4 A;  4RLC A;  2F1T A;  1G90 A;  2N2M A;  1ORM A;  1THQ A; 
#chains in the Genus database with same CATH topology
 1E54 A;  3A0H O;  3GP6 A;  4D5U A;  4C4V B;  1IZN B;  2WVP A;  3POR A;  2GE4 A;  4GHB A;  1HXT A;  2X27 X;  3PGU A;  2R8A A;  4B61 A;  2KXP A;  1MM5 A;  4C00 A;  2M07 A;  2M06 A;  4RJX A;  4O4X A;  2PRN A;  1QJ8 A;  3VE1 A;  2XE2 A;  4O4U A;  1T1L A;  3VZT X;  3EMN X;  1PHO A;  5G39 A;  4C69 X;  4RL9 A;  4PJ0 O;  3JCU O;  5GV0 A;  4FZL A;  4O3Z A;  4FRT A;  3UPG A;  2MHL A;  2JQY A;  3AAA B;  2XTR A;  3PGR A;  1IZN A;  2OMF A;  4GCP A;  4JCH A;  2X9K A;  4UB8 O;  2R4N A;  1P4T A;  5TIS O;  3AA0 B;  1ZHX A;  4N59 A;  4AZL A;  1HXX A;  1GFQ A;  1HXU A;  4RLC A;  3T0S A;  3WI5 A;  2F1T A;  3VZW X;  3DA4 A;  3T24 A;  5AFU K;  4E1S A;  1G90 A;  5G26 A;  1THQ A;  1ZHY A;  4RJW A;  4FSP A;  3SYS A;  2LFU A;  2Y0H A;  2J1N A;  4KR8 A;  4AYD C;  4AYN A;  5G3A A;  1PRN A;  2XMX A;  2YPV A;  1GFN A;  5KAF O;  5AFU L;  2R4L A;  2ZFG A;  3AAA A;  3C5O A;  2LHF A;  5DL7 A;  3BS0 A;  4PUX A;  3SZV A;  2K0L A;  2Y2X A;  3A0B O;  3HW9 A;  3LK2 B;  5B66 O;  3LK3 A;  2J4U P;  2ERV A;  1BT9 A;  4FES A;  4O3Y A;  4XNL A;  3VZU X;  4AUI A;  4KR4 A;  2R4O A;  4FT6 A;  4GCQ A;  1OPF A;  1Q9G A;  1ZHZ A;  3LK4 1;  1GFO A;  3PRN A;  3PQS A;  4D65 A;  2KZ7 A;  2F1V A;  2XG6 A;  4IL6 O;  2QTK A;  4FRX A;  3VY8 X;  3AA7 B;  3AA1 A;  4O3X B;  4E1T A;  2IWW A;  3PQU A;  3SY9 A;  5ADX L;  4D64 A;  3AA6 B;  4BUM X;  3DZM A;  3RBH A;  3K19 A;  5ADX K;  4N74 A;  2KZ7 B;  4LSF A;  3AAE B;  4AFK A;  2POR A;  3AA7 A;  5H2F O;  3VY9 X;  2JMM A;  3BRY A;  4K3C A;  2KC0 A;  2XE1 A;  3WU2 O;  1OSM A;  2MNH A;  5DL6 A;  3DWO X;  5E79 O;  3T20 A;  1T16 A;  4AKM A;  3DWN A;  3UAQ A;  4K3B A;  3QRC A;  4XNK A;  5EE2 A;  2Y0K A;  4AKR A;  4N58 A;  4QQ1 A;  3UU2 A;  5G38 A;  2XE3 A;  1QJ9 A;  3LK4 2;  4FQE A;  4O3W A;  5GTI O;  4Z3T A;  3AA6 A;  3LK2 A;  5FVN A;  4FSO A;  1BH3 A;  3NJT A;  1QJP A;  3NSG A;  4RLB A;  3AAE A;  3BRZ A;  3QRA A;  5KAI O;  3SZD A;  4LSE A;  5B5E O;  3PGS A;  4G75 A;  5JDP A;  3JTY A;  1BXW A;  2FGQ X;  4O49 A;  2AXT O;  2F1C X;  4FMS A;  4JFB A;  2W81 C;  1ORM A;  1H6S 1;  3AA0 A;  3PF1 A;  4FOZ A;  4LSH A;  2KDY A;  2XE5 A;  3O0E A;  4FZN A;  1S5L O;  4FZM A;  4PR7 A;  5DL5 A;  5T5F A;  3VE2 A;  3POX A;  4AKR B;  6PRN A;  3KZI O;  4AYI D;  3A2S X;  1GFP A;  4G76 A;  2WJQ A;  4LSI A;  4U9C A;  2KXP B;  4GCS A;  4AYM C;  1ZHW A;  5DL8 A;  4CTD A;  5GTH O;  3DA3 A;  4FUV A;  2W80 C;  5PRN A;  3G7G A;  3SYB A;  3WI4 A;  4C4V A;  2R4P A;  2YNK A;  3HOL A;  3HWB A;  2ODJ A;  2Y0L A;  3KVD D;  3LK3 B;  1YS5 A;  3POQ A;  4GF4 A;  3FYX A;  3SY7 A;  1MPF A;  2Y7S A;  3TZG A;  4F4B A;  3POU A;  3AA1 B;  2R89 A;  2N2L A;  2R88 A;  2XTQ A;  3V8U A;  5IYU A;  2IWV A;  3HOE A;  2ZLD A;  1MM4 A;  4N75 A;  4AYE C;  7PRN A;  8PRN A;  5D5D A;  2WJR A;  1GFM A;  1ZHT A;  2K4T A;  2O4V A;  1Q9F A;  2N2M A;  4UB6 O;  4KRA A;  2FGR A; 
#chains in the Genus database with same CATH homology
 1E54 A;  4D5U A;  3GP6 A;  1IZN B;  3POR A;  2GE4 A;  4GHB A;  1HXT A;  2X27 X;  4B61 A;  2KXP A;  1MM5 A;  2M07 A;  2M06 A;  4RJX A;  4O4X A;  2PRN A;  1QJ8 A;  3VE1 A;  2XE2 A;  4O4U A;  3VZT X;  3EMN X;  1PHO A;  4C69 X;  4RL9 A;  5GV0 A;  4FZL A;  4O3Z A;  4FRT A;  3UPG A;  2MHL A;  3AAA B;  2XTR A;  4GCP A;  1IZN A;  2OMF A;  4JCH A;  1P4T A;  3AA0 B;  1ZHX A;  4N59 A;  4AZL A;  1HXX A;  1GFQ A;  1HXU A;  4RLC A;  3T0S A;  3WI5 A;  2F1T A;  3VZW X;  3DA4 A;  3T24 A;  5AFU K;  1G90 A;  5G26 A;  1THQ A;  1ZHY A;  4RJW A;  4FSP A;  3SYS A;  2LFU A;  2Y0H A;  2J1N A;  4KR8 A;  4AYD C;  4AYN A;  5AFU L;  1PRN A;  2YPV A;  2XMX A;  1GFN A;  2ZFG A;  3AAA A;  3C5O A;  2LHF A;  5DL7 A;  3SZV A;  4PUX A;  2K0L A;  2Y2X A;  3HW9 A;  3LK2 B;  3LK3 A;  2J4U P;  2ERV A;  1BT9 A;  4FES A;  4O3Y A;  4XNL A;  4AUI A;  4KR4 A;  4GCQ A;  4FT6 A;  1OPF A;  1Q9G A;  1ZHZ A;  3LK4 1;  1GFO A;  3PRN A;  3PQS A;  4D65 A;  2KZ7 A;  2F1V A;  2XG6 A;  2QTK A;  4FRX A;  3VY8 X;  3AA7 B;  3AA1 A;  4O3X B;  4E1T A;  3PQU A;  3SY9 A;  5ADX L;  4D64 A;  3AA6 B;  4BUM X;  3RBH A;  3K19 A;  5ADX K;  2KZ7 B;  4LSF A;  3AAE B;  4AFK A;  2POR A;  3AA7 A;  3VY9 X;  2JMM A;  2KC0 A;  2XE1 A;  1OSM A;  2MNH A;  5DL6 A;  3T20 A;  4AKM A;  3UAQ A;  4XNK A;  3QRC A;  5EE2 A;  2Y0K A;  4AKR A;  4N58 A;  4QQ1 A;  3UU2 A;  2XE3 A;  1QJ9 A;  3LK4 2;  4O3W A;  4Z3T A;  3AA6 A;  3LK2 A;  5FVN A;  4FSO A;  1BH3 A;  4E1S A;  1QJP A;  3NSG A;  4RLB A;  3AAE A;  3SZD A;  5JDP A;  4LSE A;  4G75 A;  3JTY A;  1BXW A;  2FGQ X;  4O49 A;  4FMS A;  4JFB A;  2W81 C;  1ORM A;  1H6S 1;  3AA0 A;  4FOZ A;  4LSH A;  2KDY A;  2XE5 A;  3O0E A;  4FZN A;  4FZM A;  5DL5 A;  5T5F A;  3VE2 A;  3VZU X;  4AKR B;  3POX A;  6PRN A;  4AYI D;  3A2S X;  1GFP A;  4G76 A;  4LSI A;  4U9C A;  2KXP B;  4GCS A;  4AYM C;  1ZHW A;  5DL8 A;  3DA3 A;  4FUV A;  2W80 C;  5PRN A;  3G7G A;  3SYB A;  3WI4 A;  2YNK A;  3HOL A;  3QRA A;  3HWB A;  2ODJ A;  2Y0L A;  3KVD D;  3LK3 B;  1YS5 A;  3POQ A;  4GF4 A;  3FYX A;  3SY7 A;  1MPF A;  2Y7S A;  3TZG A;  4F4B A;  3POU A;  3AA1 B;  2XTQ A;  2N2L A;  3V8U A;  5IYU A;  3HOE A;  2ZLD A;  1MM4 A;  4AYE C;  7PRN A;  8PRN A;  5D5D A;  1GFM A;  1ZHT A;  2K4T A;  2O4V A;  1Q9F A;  2N2M A;  4KRA A;  2FGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...