1ORMA

Nmr fold of the outer membrane protein ompx in dhpc micelles
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title TRANSVERSE RELAXATION-OPTIMIZED NMR SPECTROSCOPY WITH THE OUTER MEMBRANE PROTEIN OMPX IN DIHEXANOYL PHOSPHATIDYLCHOLINE MICELLES
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1ormA00
1THQA 1MM4A 4PUXA 2M07A 1QJ9A 2K0LA 2M06A 1MM5A 2JMMA 2X27X 3QRAA 2LHFA 3QRCA 3G7GA 1QJPA 1BXWA 2MHLA 2GE4A 2N2LA 3C5OA 2F1VA 2ERVA 3GP6A 1G90A 1Q9FA 1ORMA 1Q9GA 2N2MA 1QJ8A 4RLCA 1P4TA 2MNHA 2F1TA
chains in the Genus database with same CATH superfamily
3SZVA 3LK2A 1PRNA 3SY7A 3LK41 1YS5A 4QQ1A 1T16A 3VZTX 4C00A 1QJ9A 2XE3A 2KZ7A 4AYMC 2M06A 4AKRA 3WU2O 2XTRA 4U9CA 2PRNA 4GCQA 4KR4A 2X27X 5GV0A 2AXTO 2Y0LA 4RL9A 3K19A 2ZFGA 2Y2XA 3G7GA 3HOLA 4AZLA 4O4XA 1ZHYA 3UU2A 2LFUA 4AUIA 4CTDA 4XNLA 3DA3A 5KAFO 3C5OA 2KXPB 1PHOA 4FSPA 3PGSA 3A0HO 4AYDC 3AA0A 3SYSA 2R4OA 2O4VA 5DL8A 3AA1A 4FRXA 3T20A 3PF1A 4D65A 5EE2A 4N75A 2KDYA 2Y0HA 1MPFA 1HXTA 4O49A 4FZNA 5KAIO 4C4VB 3AA6B 1H6S1 3KZIO 2PORA 4RJXA 5G3AA 5D5DA 3NJTA 1ZHXA 2XE1A 5DL5A 1HXUA 2K0LA 4C69X 5AFUL 3LK3B 4FRTA 3HWBA 4BUMX 4C4VA 3A0BO 4N58A 7PRNA 2IWVA 1GFNA 4F4BA 1IZNB 4N74A 3PQUA 4GCPA 3PRNA 4XNKA 4FQEA 3DWOX 5G39A 1QJPA 4UB8O 2KC0A 2MHLA 5AFUK 3UPGA 1IZNA 2GE4A 3T0SA 4D5UA 4FSOA 4E1SA 5G26A 3GP6A 3V8UA 4AKMA 4E1TA 3PGUA 2XE2A 2XE5A 1Q9GA 3AAEB 4LSEA 2K4TA 1S5LO 3PGRA 4GF4A 1GFQA 4RLCA 3POQA 4PUXA 3KVDD 2R88A 4JCHA 2MNHA 2KXPA 4O3XB 3RBHA 2FGRA 1THQA 3BS0A 1MM4A 3AAEA 1GFMA 2FGQX 4FESA 3VE1A 2XTQA 3SY9A 3PORA 3LK42 4FMSA 1HXXA 4G76A 3SYBA 4AFKA 3PQSA 3POUA 2ZLDA 5E79O 2R89A 5IYUA 4LSFA 2JQYA 3O0EA 5ADXL 1OSMA 1GFOA 1ZHZA 1MM5A 3BRYA 4PR7A 2YNKA 1ZHWA 4FUVA 3AA6A 3JTYA 5T5FA 5PRNA 3WI5A 3BRZA 4G75A 4AYID 1BT9A 4GHBA 2W80C 2WJRA 2J1NA 2W81C 3AA7B 3DZMA 4GCSA 2X9KA 3LK3A 5B66O 5JDPA 1GFPA 2F1CX 3EMNX 5DL7A 5G38A 2F1VA 5GTHO 2ERVA 2QTKA 4KRAA 3LK2B 3TZGA 3NSGA 4UB6O 1Q9FA 3FYXA 4RJWA 5FVNA 2OMFA 2R4LA 2N2MA 4O3YA 2R4PA 5GTIO 2Y7SA 3VE2A 5DL6A 3VZUX 4AYNA 2IWWA 1T1LA 2F1TA 3HOEA 4KR8A 4AKRB 4AYEC 4K3CA 2ODJA 4O3ZA 5B5EO 3DA4A 6PRNA 2M07A 2J4UP 1ZHTA 4B61A 2WJQA 3WI4A 3VY9X 4LSIA 3T24A 2Y0KA 2JMMA 5H2FO 4PJ0O 3QRAA 2LHFA 4N59A 4LSHA 3QRCA 5ADXK 4O3WA 4RLBA 1E54A 3AA0B 3POXA 3AAAB 3VZWX 4FT6A 4IL6O 1BXWA 3JCUO 3AA1B 2WVPA 3A2SX 8PRNA 4O4UA 2R4NA 4FZLA 4JFBA 2N2LA 3UAQA 2YPVA 3VY8X 2XG6A 3DWNA 3AAAA 5TISO 1G90A 3AA7A 4Z3TA 3HW9A 1ORMA 4FZMA 1QJ8A 4FOZA 4K3BA 1BH3A 2XMXA 1P4TA 3SZDA 2R8AA 4D64A 2KZ7B 1OPFA
chains in the Genus database with same CATH topology
3SZVA 3LK2A 1PRNA 3SY7A 3LK41 1YS5A 4QQ1A 3VZTX 1QJ9A 2XE3A 2KZ7A 4AYMC 2M06A 4AKRA 2XTRA 4U9CA 2PRNA 4GCQA 4KR4A 2X27X 5GV0A 2Y0LA 4RL9A 3K19A 2ZFGA 2Y2XA 3G7GA 3HOLA 4AZLA 4O4XA 1ZHYA 3UU2A 2LFUA 4AUIA 4XNLA 3DA3A 3C5OA 2KXPB 1PHOA 4FSPA 4AYDC 3AA0A 3SYSA 2O4VA 5DL8A 3AA1A 4FRXA 3T20A 4D65A 5EE2A 2KDYA 2Y0HA 1MPFA 1HXTA 4O49A 4FZNA 3AA6B 1H6S1 2PORA 4RJXA 5D5DA 1ZHXA 2XE1A 5DL5A 1HXUA 2K0LA 4C69X 5AFUL 3LK3B 4FRTA 3HWBA 4BUMX 7PRNA 4N58A 1GFNA 4F4BA 1IZNB 3PQUA 4GCPA 3PRNA 4XNKA 1QJPA 2KC0A 2MHLA 5AFUK 3UPGA 1IZNA 2GE4A 3T0SA 4D5UA 4FSOA 4E1SA 5G26A 3GP6A 3V8UA 4AKMA 4E1TA 2XE2A 2XE5A 1Q9GA 3AAEB 4LSEA 2K4TA 4GF4A 1GFQA 4RLCA 3POQA 4PUXA 3KVDD 4JCHA 4O3XB 2MNHA 2KXPA 3RBHA 2FGRA 1THQA 1MM4A 3AAEA 1GFMA 2FGQX 4FESA 3VE1A 2XTQA 3SY9A 3PORA 3LK42 4FMSA 1HXXA 4G76A 3SYBA 4AFKA 3PQSA 3POUA 2ZLDA 5IYUA 4LSFA 3O0EA 5ADXL 1OSMA 1GFOA 1ZHZA 1MM5A 2YNKA 1ZHWA 4FUVA 3AA6A 3JTYA 5T5FA 5PRNA 3WI5A 4G75A 4AYID 1BT9A 4GHBA 2W80C 2J1NA 2W81C 3AA7B 4GCSA 3LK3A 5JDPA 1GFPA 3EMNX 5DL7A 2F1VA 2ERVA 2QTKA 4KRAA 3LK2B 3TZGA 3NSGA 1Q9FA 3FYXA 4RJWA 5FVNA 2OMFA 4O3YA 2N2MA 3VZUX 2Y7SA 3VE2A 5DL6A 4AYNA 2F1TA 4AKRB 3HOEA 4KR8A 4AYEC 2ODJA 4O3ZA 3DA4A 6PRNA 2M07A 2J4UP 1ZHTA 4B61A 3WI4A 3VY9X 4LSIA 3T24A 2Y0KA 2JMMA 3QRAA 2LHFA 4N59A 4LSHA 3QRCA 5ADXK 4O3WA 4RLBA 1E54A 3AA0B 3POXA 3AAAB 3VZWX 4FT6A 1BXWA 3AA1B 8PRNA 3A2SX 4O4UA 4FZLA 4JFBA 2N2LA 3UAQA 2YPVA 3VY8X 2XG6A 3AAAA 1G90A 3AA7A 4Z3TA 3HW9A 1ORMA 4FZMA 1QJ8A 4FOZA 1BH3A 2XMXA 1P4TA 3SZDA 4D64A 2KZ7B 1OPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1THQ A;  1MM4 A;  4PUX A;  2M07 A;  1QJ9 A;  2K0L A;  2M06 A;  1MM5 A;  2JMM A;  2X27 X;  3QRA A;  2LHF A;  3QRC A;  3G7G A;  1QJP A;  1BXW A;  2MHL A;  2GE4 A;  2N2L A;  3C5O A;  2F1V A;  2ERV A;  3GP6 A;  1G90 A;  1Q9F A;  1ORM A;  1Q9G A;  2N2M A;  1QJ8 A;  4RLC A;  1P4T A;  2MNH A;  2F1T A; 
#chains in the Genus database with same CATH topology
 3SZV A;  3LK2 A;  1PRN A;  3SY7 A;  3LK4 1;  1YS5 A;  4QQ1 A;  1T16 A;  3VZT X;  4C00 A;  1QJ9 A;  2XE3 A;  2KZ7 A;  4AYM C;  2M06 A;  4AKR A;  3WU2 O;  2XTR A;  4U9C A;  2PRN A;  4GCQ A;  4KR4 A;  2X27 X;  5GV0 A;  2AXT O;  2Y0L A;  4RL9 A;  3K19 A;  2ZFG A;  2Y2X A;  3G7G A;  3HOL A;  4AZL A;  4O4X A;  1ZHY A;  3UU2 A;  2LFU A;  4AUI A;  4CTD A;  4XNL A;  3DA3 A;  5KAF O;  3C5O A;  2KXP B;  1PHO A;  4FSP A;  3PGS A;  3A0H O;  4AYD C;  3AA0 A;  3SYS A;  2R4O A;  2O4V A;  5DL8 A;  3AA1 A;  4FRX A;  3T20 A;  3PF1 A;  4D65 A;  5EE2 A;  4N75 A;  2KDY A;  2Y0H A;  1MPF A;  1HXT A;  4O49 A;  4FZN A;  5KAI O;  4C4V B;  3AA6 B;  1H6S 1;  3KZI O;  2POR A;  4RJX A;  5G3A A;  5D5D A;  3NJT A;  1ZHX A;  2XE1 A;  5DL5 A;  1HXU A;  2K0L A;  4C69 X;  5AFU L;  3LK3 B;  4FRT A;  3HWB A;  4BUM X;  4C4V A;  3A0B O;  4N58 A;  7PRN A;  2IWV A;  1GFN A;  4F4B A;  1IZN B;  4N74 A;  3PQU A;  4GCP A;  3PRN A;  4XNK A;  4FQE A;  3DWO X;  5G39 A;  1QJP A;  4UB8 O;  2KC0 A;  2MHL A;  5AFU K;  3UPG A;  1IZN A;  2GE4 A;  3T0S A;  4D5U A;  4FSO A;  4E1S A;  5G26 A;  3GP6 A;  3V8U A;  4AKM A;  4E1T A;  3PGU A;  2XE2 A;  2XE5 A;  1Q9G A;  3AAE B;  4LSE A;  2K4T A;  1S5L O;  3PGR A;  4GF4 A;  1GFQ A;  4RLC A;  3POQ A;  4PUX A;  3KVD D;  2R88 A;  4JCH A;  2MNH A;  2KXP A;  4O3X B;  3RBH A;  2FGR A;  1THQ A;  3BS0 A;  1MM4 A;  3AAE A;  1GFM A;  2FGQ X;  4FES A;  3VE1 A;  2XTQ A;  3SY9 A;  3POR A;  3LK4 2;  4FMS A;  1HXX A;  4G76 A;  3SYB A;  4AFK A;  3PQS A;  3POU A;  2ZLD A;  5E79 O;  2R89 A;  5IYU A;  4LSF A;  2JQY A;  3O0E A;  5ADX L;  1OSM A;  1GFO A;  1ZHZ A;  1MM5 A;  3BRY A;  4PR7 A;  2YNK A;  1ZHW A;  4FUV A;  3AA6 A;  3JTY A;  5T5F A;  5PRN A;  3WI5 A;  3BRZ A;  4G75 A;  4AYI D;  1BT9 A;  4GHB A;  2W80 C;  2WJR A;  2J1N A;  2W81 C;  3AA7 B;  3DZM A;  4GCS A;  2X9K A;  3LK3 A;  5B66 O;  5JDP A;  1GFP A;  2F1C X;  3EMN X;  5DL7 A;  5G38 A;  2F1V A;  5GTH O;  2ERV A;  2QTK A;  4KRA A;  3LK2 B;  3TZG A;  3NSG A;  4UB6 O;  1Q9F A;  3FYX A;  4RJW A;  5FVN A;  2OMF A;  2R4L A;  2N2M A;  4O3Y A;  2R4P A;  5GTI O;  2Y7S A;  3VE2 A;  5DL6 A;  3VZU X;  4AYN A;  2IWW A;  1T1L A;  2F1T A;  3HOE A;  4KR8 A;  4AKR B;  4AYE C;  4K3C A;  2ODJ A;  4O3Z A;  5B5E O;  3DA4 A;  6PRN A;  2M07 A;  2J4U P;  1ZHT A;  4B61 A;  2WJQ A;  3WI4 A;  3VY9 X;  4LSI A;  3T24 A;  2Y0K A;  2JMM A;  5H2F O;  4PJ0 O;  3QRA A;  2LHF A;  4N59 A;  4LSH A;  3QRC A;  5ADX K;  4O3W A;  4RLB A;  1E54 A;  3AA0 B;  3POX A;  3AAA B;  3VZW X;  4FT6 A;  4IL6 O;  1BXW A;  3JCU O;  3AA1 B;  2WVP A;  3A2S X;  8PRN A;  4O4U A;  2R4N A;  4FZL A;  4JFB A;  2N2L A;  3UAQ A;  2YPV A;  3VY8 X;  2XG6 A;  3DWN A;  3AAA A;  5TIS O;  1G90 A;  3AA7 A;  4Z3T A;  3HW9 A;  1ORM A;  4FZM A;  1QJ8 A;  4FOZ A;  4K3B A;  1BH3 A;  2XMX A;  1P4T A;  3SZD A;  2R8A A;  4D64 A;  2KZ7 B;  1OPF A; 
#chains in the Genus database with same CATH homology
 3SZV A;  3LK2 A;  1PRN A;  3SY7 A;  3LK4 1;  1YS5 A;  4QQ1 A;  3VZT X;  1QJ9 A;  2XE3 A;  2KZ7 A;  4AYM C;  2M06 A;  4AKR A;  2XTR A;  4U9C A;  2PRN A;  4GCQ A;  4KR4 A;  2X27 X;  5GV0 A;  2Y0L A;  4RL9 A;  3K19 A;  2ZFG A;  2Y2X A;  3G7G A;  3HOL A;  4AZL A;  4O4X A;  1ZHY A;  3UU2 A;  2LFU A;  4AUI A;  4XNL A;  3DA3 A;  3C5O A;  2KXP B;  1PHO A;  4FSP A;  4AYD C;  3AA0 A;  3SYS A;  2O4V A;  5DL8 A;  3AA1 A;  4FRX A;  3T20 A;  4D65 A;  5EE2 A;  2KDY A;  2Y0H A;  1MPF A;  1HXT A;  4O49 A;  4FZN A;  3AA6 B;  1H6S 1;  2POR A;  4RJX A;  5D5D A;  1ZHX A;  2XE1 A;  5DL5 A;  1HXU A;  2K0L A;  4C69 X;  5AFU L;  3LK3 B;  4FRT A;  3HWB A;  4BUM X;  7PRN A;  4N58 A;  1GFN A;  4F4B A;  1IZN B;  3PQU A;  4GCP A;  3PRN A;  4XNK A;  1QJP A;  2KC0 A;  2MHL A;  5AFU K;  3UPG A;  1IZN A;  2GE4 A;  3T0S A;  4D5U A;  4FSO A;  4E1S A;  5G26 A;  3GP6 A;  3V8U A;  4AKM A;  4E1T A;  2XE2 A;  2XE5 A;  1Q9G A;  3AAE B;  4LSE A;  2K4T A;  4GF4 A;  1GFQ A;  4RLC A;  3POQ A;  4PUX A;  3KVD D;  4JCH A;  4O3X B;  2MNH A;  2KXP A;  3RBH A;  2FGR A;  1THQ A;  1MM4 A;  3AAE A;  1GFM A;  2FGQ X;  4FES A;  3VE1 A;  2XTQ A;  3SY9 A;  3POR A;  3LK4 2;  4FMS A;  1HXX A;  4G76 A;  3SYB A;  4AFK A;  3PQS A;  3POU A;  2ZLD A;  5IYU A;  4LSF A;  3O0E A;  5ADX L;  1OSM A;  1GFO A;  1ZHZ A;  1MM5 A;  2YNK A;  1ZHW A;  4FUV A;  3AA6 A;  3JTY A;  5T5F A;  5PRN A;  3WI5 A;  4G75 A;  4AYI D;  1BT9 A;  4GHB A;  2W80 C;  2J1N A;  2W81 C;  3AA7 B;  4GCS A;  3LK3 A;  5JDP A;  1GFP A;  3EMN X;  5DL7 A;  2F1V A;  2ERV A;  2QTK A;  4KRA A;  3LK2 B;  3TZG A;  3NSG A;  1Q9F A;  3FYX A;  4RJW A;  5FVN A;  2OMF A;  4O3Y A;  2N2M A;  3VZU X;  2Y7S A;  3VE2 A;  5DL6 A;  4AYN A;  2F1T A;  4AKR B;  3HOE A;  4KR8 A;  4AYE C;  2ODJ A;  4O3Z A;  3DA4 A;  6PRN A;  2M07 A;  2J4U P;  1ZHT A;  4B61 A;  3WI4 A;  3VY9 X;  4LSI A;  3T24 A;  2Y0K A;  2JMM A;  3QRA A;  2LHF A;  4N59 A;  4LSH A;  3QRC A;  5ADX K;  4O3W A;  4RLB A;  1E54 A;  3AA0 B;  3POX A;  3AAA B;  3VZW X;  4FT6 A;  1BXW A;  3AA1 B;  8PRN A;  3A2S X;  4O4U A;  4FZL A;  4JFB A;  2N2L A;  3UAQ A;  2YPV A;  3VY8 X;  2XG6 A;  3AAA A;  1G90 A;  3AA7 A;  4Z3T A;  3HW9 A;  1ORM A;  4FZM A;  1QJ8 A;  4FOZ A;  1BH3 A;  2XMX A;  1P4T A;  3SZD A;  4D64 A;  2KZ7 B;  1OPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...