1ORQA

X-ray structure of a voltage-dependent potassium channel in complex with an fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
215
structure length
215
Chain Sequence
ENVLTQSPAIMSPSPGEKVTMTCRARSSVSSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDTATYYCQQYSGNPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
molecule keywords 6E1 Fab light chain
total genus 48
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orqA01
5EZLA 1MRDH 1VDGA 2X1PA 4KPHH 2ITCA 1VFBA 4U6HB 4XPAL 3TA3D 3RIFK 4Q6IB 1LO4L 3U2SB 4HFUL 4YWGH 5IHZB 5IIEA 3U0PA 1CDYA 2AEPL 1ZGLM 2O5XH 4XCCH 5CZVH 2PCPA 1MVUA 4XHQA 8FABA 3IF1B 1CDJA 2R0WH 3PABB 4QO1A 3MA7A 2ATPA 3T8XB 4XXDA 2X10A 2BHUA 4WDIB 2WINA 4BSJA 3Q5YA 4FQQB 4G6FD 4YO0A 3FO1A 3F65A 4WDIA 4WUUA 1R3IH 2RIKA 3BKJH 2D2OA 5F7MC 5DVLA 1E6JH 2P8LA 1F97A 1OARL 3O9WB 3PP3K 4F58H 3QDAA 3V6OC 4YEEA 4OD2B 4HC1H 2WWKO 5I1AB 1OM3L 3FT4B 3OF6A 1CG9A 2GITB 4JFFB 5D2LF 3KNBA 1IFHH 1A3QA 1G9MH 3BIKA 1A6AB 5E8EA 5T1DH 1Y18B 3W11C 3BUTA 5DJYA 5C0GA 5CCKH 3FL7A 1MPAL 3ABZA 4FNLH 4W4NA 3R1GH 4X7SH 5IMLB 2YUVA 3DSFH 2ED9A 1QBAA 3KXFE 4YBLC 1H15B 3FTGA 2K3TA 4ZS7H 4GRLA 4IS6A 1ZV5A 4HT1H 5E6ZA 2F54A 4YDLC 3IS1X 2ADJB 3RVXC 2JELH 3HC4L 2QR0B 5E2JA 3VWKB 4PG2A 4YHMH 3OL2A 4JRYB 5C0BB 2PXYB 4NUGH 2QQNL 5I1KH 1MIMH 2QKIA 2QHLA 2J8UF 2FHBA 1KCSL 3HZVA 1H3PH 3ARXA 1K8IB 5I8KL 3IETB 4O2CA 1F6FB 4RGNC 4EN3B 2BOCA 3ZDZE 5IMLA 4ELMA 3RKDC 5J9PB 2E9IA 4PTUB 2W07A 2H6PB 4QXWA 4HFWA 3OV6A 3FCTB 1U93A 1ZA6A 4QHMA 4XMKH 5E2WL 3AS0A 5E4EB 4Q9RH 2O61A 2GITA 5DJ6B 1IZKA 3O2VH 1S9WB 1A9BA 3MMEA 3G6JA 2X1QA 1MCEA 1T4KB 3F5WA 3C6SA 3RGVD 1R3HB 3ARDD 2R4RH 5IVXB 4BFBD 1BD2A 4QRRA 1XGRA 4PUBL 3HE6A 3QPXH 3OKEB 5EOQL 2EDYA 5I1HH 1UFUA 1JGUL 3BE1L 2P8PA 3QQ4B 4J1UB 1KJVA 5KJRH 4ZUTA 1U6AH 3FFCE 3ROOB 1FPTH 1V5JA 2VZ3A 5HGBA 3S8WA 1TVBB 5IT2H 1F4XL 3QISA 4L4TE 3A6BH 5ADOL 4HGKC 4OF6A 4YDVB 5KOVC 3KPQB 5DK3A 4Y4HD 5AG9A 4M7LL 1PLGH 3IDIA 4KHXH 2F9BT 4FG6D 3KAAA 5IMKB 2EYTB 5F1NA 3ARDC 4KUZL 4UINL 3FB5A 1VADA 3TIDB 2OJEA 1MWAH 3MRKB 1RIHH 5GISL 3GSNL 1SYSA 3VWJA 3X3GH 2RFXA 3EDKA 4BYHA 5ANMA 4JHAH 3PWUA 4LARL 1HHIB 5SX4H 1CGYA 1JRHL 4F37K 5EU7C 3LOWA 3RVWC 2FGWH 3KXFA 3FB6B 5CSZA 3D69B 1JHTB 1DP0A 1TQBB 1RZ7H 5IROC 3ZKQD 1FVCB 1SEQL 3OKNA 3GMQA 4HUXA 5E6YA 3QFJE 4I1NB 1AFVH 2NZIA 3F7VA 1A7NL 2ZCHH 4LKXB 3W82A 3RX5A 4XAKD 4X6DE 4XCYA 1NCUA 2Y25A 4HJGA 3H9SE 4PJFB 1AR2A 1LE5A 3F12A 3FQTA 2Z4QB 3UXFA 1MCPL 1CLZL 1CE6B 2K7PA 1RJLA 3L7EB 3ZZ1A 1FLRL 3MNZA 2NNAA 3L1OL 4V1DE 3DX7B 1IM3B 1P4BL 4HJJL 5I2IB 1WT5A 1QG3A 1S7VB 3VWKC 3BKYH 1CLCA 3JVGA 1PKOA 1AO7D 1TVHB 3D39B 4P3DA 4QY8A 5IJKC 4YHOL 5EH1A 3U7WH 3MRJB 5TE7L 5A3IC 1AP2A 5C0FA 4KK9D 5DK2A 3QIBD 5IQ9B 4DN4L 3KPOA 1KACB 1HXMA 4NKMA 3VXUD 4WENB 5I1EL 2EKJA 1D5BB 4FFZL 3QUMH 4GAGH 3EOAB 5C09B 1HHHA 1VSCA 2D7TH 5EU5B 1EH9A 1CFQA 1CR9H 5IMMB 2QSCH 4UUJB 3M1BA 1BIHA 3OX8B 5E1AA 2IH1B 4AEIH 3H42L 1F6LL 5HPOA 4G6FB 2FBJH 5HI3D 1J0KA 1UWGL 1G9NL 2I5YL 4Z7OF 1T1YB 1IAIL 4CN6A 1KG0A 3STBA 2Y7QA 1DSFH 4FQHB 5T5NF 1QZ1A 4HKZB 1I7RA 1T2QH 3QRGH 3H9YA 2VXQL 4PREB 2DBLH 4X98B 4JLRA 4U1LA 1MCKA 3JUZA 4LOUD 4EI5B 1BQSA 1EAJA 4ZMAT 5ANME 5GGRY 3P0GB 4I2XB 2DQUL 3PL6C 3C5JA 5INCB 4C83B 3DGGB 2VDPL 4DK6A 2JCCE 3O2DL 3L3IA 4X7DC 3K3QA 1EJOH 4U31A 1GZQA 2XQYK 4NO5B 1HYSD 3EOTH 4OFIA 4GG6E 4JM2F 1W0VB 2HFEB 1EEYA 4U1GB 1NMCC 3DUSB 4DK3A 1XF3B 1BD2E 5CILH 5M94B 1E4XL 3CIQA 4J3WA 3GI9H 4QYOA 2D3VA 2GEEA 3KR3H 4QRPA 3DBXA 4Y4KA 1M05A 4NWUH 2AS5M 1KPRB 4ZTPH 1AKJB 3LS4L 3VGAC 1J7VR 1FFPB 5B4MC 3WLWD 3FFCA 5TQ0H 2PYEE 4PJFE 3LKSB 3PWNB 1RMFL 4Q0XL 1S9KC 4OZ4B 3O45B 2X1OA 3VFNB 2X6MA 3SHSA 4HS6A 2R8SH 4F7MB 3S4SB 5JLZA 5B4MD 4K23H 3X13A 2VL5B 1YEHH 1ZA3B 3CXDL 5GXBB 4ZOAA 2VLKD 2E27H 4LVOB 3OKKB 2I24N 2EC9T 2BRRL 4V2CB 2HWZH 4JCLA 4UTBH 5D7LE 1AIFB 4XBEL 4AT6A 5DJ2B 3IDXH 2DJSA 2P24A 4HIXH 3V5KA 1LE9B 4TNWK 1FDLH 4I0PA 1EAPA 4PLKC 5GS0L 3W0WE 1RJYA 4BZ2H 3HC3L 4W70A 1UA6L 3MCG1 5C07A 4H8WH 5DD5H 3TJHD 1KPVB 5KVEL 2PO6B 2XZQH 1CFNB 3D18B 4F7EA 2EYSA 5C0RL 4WTZG 3B3IA 1NFIB 2W59A 3IAQA 3U36A 4OCXH 2A1WH 2W65A 2A2QT 4WVRA 3PF2A 2IBZX 3NFPB 1NCCL 4R26L 4XP9H 1JPSL 3NZ8A 4JR9L 3VMOA 4ZO8A 1G0DA 4R3SB 4QHKI 4JG1L 3VH8G 3VFGH 4TSCH 3X3FL 4ZUSA 3GMRB 1ZHNB 2WAHA 2NY7H 4TSAL 5H2BA 1N2RB 1YYML 3ZHDA 4HULB 4EXPX 4MWFA 3O4LE 1I7ZA 2DJ4A 1F8TL 4JFDA 4F2MA 3L5HA 1NCBH 4OFPA 4BSWA 3DMMC 4PJ5B 4NHCL 1ZTXH 4KQ4L 3AUVA 5GIRB 2XKSA 5FO8A 1WWCA 4GRWF 5HGDA 2BNRB 1LE9A 3BAEH 2V2XB 3DPBA 5DEGB 1JGEA 4HS3A 3BISA 4WW1B 4JKPH 5GSVA 5ALBH 1HXMB 3TVMA 3AB0B 3L3GA 3NACH 4XC3L 3SKMA 5C8JB 4P2RD 2AKRB 2W0KA 3FQRB 3N9GH 4Q2ZB 5E24E 3QQ3B 4ISVA 3CFEB 4P9HC 3QIWB 1QLRB 3CSGA 1C08A 3PV7A 1IEAA 4ZFOB 3Q6FB 2V5YA 4IJ3C 4ACPA 1U8LA 3AAZB 3LKRA 4UBDC 4BQCA 2PF6A 1D5XB 1KGCE 1YY8A 1ZVHA 4JJ5A 4WI3A 1WCBB 1XF2B 2F53E 5IVZB 5TH2B 2VLJE 1CE6A 2BDNL 3TO4B 4CNIB 3MLWL 3HRZB 3KPNA 3V6FA 2HT2C 3FQTB 4TRPH 4ZPTB 3VA6A 4EUPG 4M1CD 1JUFB 1KXVC 1L9NA 4LVHB 4ZXBD 4JKWA 2O93L 5KG9A 2F58L 5J4MA 4RZCB 1OAZH 1MQ8A 1T5WB 4MCYA 5DT1H 5I1DB 3Q48A 3BJ91 4HBCH 3RU8H 4OQTL 3LQZB 3D0VB 5INCA 5ESVB 1KBGL 4QRQB 3UCRA 1FGVH 2NY2B 4G42A 5HYSA 2NPLX 1G7HA 4ZAKB 3G5ZB 5IHUL 5TGBA 4M43L 3G04A 1Y0LA 4XZUA 4G8GD 1LDSA 1VKXA 1PZ5A 1FH5L 4L4TD 2MPAH 1Y0LB 2QTEA 3HKFA 3P11L 2C7UA 3W2DL 3U0WL 3DXAB 3O8XA 4RAVB 2HKFH 1VACB 1F6AB 1NCTA 3D48R 1IRAY 4YUEL 4NT6A 3N0PB 2P45B 4KC3B 4WWID 3MRCA 3QDGE 3S5LB 4OZHA 4OD3H 4KMQA 1EEZB 2AEQH 4U1JA 4JM4H 3VXMD 4A2MA 1T1WB 2MWCA 3EJZC 2BSSB 3ARGB 3QBTB 3FO9A 4RISL 3UMTA 2J1KA 3S37H 4Z5RB 5SWSE 1B88A 2ATKA 1L0YA 4XWGH 2V9QA 4IHOB 3WKML 4Z0XA 5L7XL 2D03L 2ORBH 5I0DA 1U3ZA 4LVOC 4UIMB 1XMWA 4ZS6C 1ED3B 4K94C 3FQUB 4S1DC 3ZT6A 3OG6B 2R1WA 4XPGL 2E9BA 1CZ8H 4LSVH 1MY7A 4K3JL 2FJFB 1DVFA 1MRCL 3IFOB 3TF7C 1A8JH 2Y36H 4OCNC 5A2JH 4XP1H 2C3GA 2CRMA 3T1FB 3I6KA 5ID1B 3RKDD 2ICWI 2A6JA 2HP4A 3VG0H 2F53A 1QBLL 1A7QL 1OTTD 1U3HD 1OOAA 2B1HL 4LKXA 4F9PA 1F58H 4PRIA 5DWUH 4ZFOL 1MY5A 1SYVB 3ARFC 3CC5A 3FHAA 1CFSB 4CN1A 4KDVA 3GIVB 4MMZC 4HW6A 1NUFA 4HPOH 1WJ3A 3AFLA 3QDGD 2AK4B 1AO7E 2J8UE 3LD8B 3PWPD 4JRXA 3LH2H 4PRAB 1UKQA 3T4AB 1CIDA 3OKOB 3F7RA 3IDUA 2V7NA 3TT3L 3T2NL 4AIZB 2VXVH 1KENH 4BZ1L 4L3EB 4WJ5A 3MREA 4NGHH 4ZOCA 3QNZA 2CDGA 5TJWK 4N0CC 2DD8H 1FO0L 2UY6A 5I16A 1CLOH 5C0AB 4HWBL 4HC1A 1JIBA 4ZTOH 3OAYH 4KKBD 4OI7A 3QQNA 3HI5L 4X6CE 5ITBH 5CHNA 2Z91A 4PGEB 1CL7I 2DI7A 4FQCL 3BDYH 1HINH 3PHQB 4ZUVA 3EFFA 2GSIA 2BVOB 1TITA 4AM0B 3MRQB 4L1DA 3RX7A 5IR1A 1MFBL 3NFPA 1UEYA 4ONHB 2Y72A 5JQ6H 2W65B 5J89A 1J1OH 1U8OB 1ZHBB 1TVBA 3D25A 1U8QA 4KAQH 1XCTA 5I9QC 3TCXA 4IMKC 1FO0A 1U36A 3WIHL 1CICC 4Y19E 1H3VA 2PYED 2ATPB 2MJWA 4NN5B 2A6DB 2HG5A 4MAYD 1P9MA 5GSRB 5HVGB 4JQVA 3SY0B 3TBSA 1J8HE 5FYLL 1XGRB 4R0LC 1R5WA 1S9YB 4FABH 2X05A 1XCQB 3O6LH 3ZL4H 2FB4H 3KYMA 3TBVA 2ZNWA 4N8VA 4KVCH 1IGCH 3GFUA 5DJ2A 3PQYD 1AIFA 1A9BB 3MMEB 5CWSB 4EUPA 4WU7B 3OBAA 3QHZL 3AMKA 4PJBB 4JM2C 1GC1H 2H3NA 3ARSA 3BN9C 5KAQF 4XP4H 3G6AB 1T03L 4LSQH 1W0WB 5F7DB 4BKLA 2DM4A 1P7KB 1F4HA 5C0AA 2DIBA 2BK8A 2BOCB 2HT4C 1UM5H 3JBG7 2QQKH 3HPLA 3QEHB 2IG2H 1KIQB 5JHDD 3GJFB 4U3XA 5DJ0B 4Y5XB 1KCVH 5JXEC 2D31B 3ARBD 1H5BA 1E27A 5C0BA 2AJ3B 4X80H 2ZCLH 5JW4Q 4R6UA 1J5OH 5CD5D 5LKNA 5IG7B 1ONQB 4K3DL 4BFEA 1A14H 1DZBA 2OJZH 1N6QL 4Y4FC 3VXNB 3MLPA 5J6HA 5DHYB 3TNMA 2MKWA 4DGIH 2DRUA 1OLLA 5HI5C 3U6RA 1M6OA 3PDDA 2CKNA 4X0KB 1U0QA 4TUKH 1KN4L 5LGJB 5FKPA 4LVHC 5BZDB 2GW5A 3QUYD 2BVQB 3PHOB 5GZOD 3VGBA 1T1ZA 2JF1A 5I1GL 1B6DA 4I2XA 3U30B 4UV4L 2ED7A 1CG9B 1RUQH 2FGZA 4LU5H 3S97C 5IW6A 5MHSE 4AQOA 5T1LD 2HJFB 5CBAA 1T0PB 4XP6L 3TWCH 3V6BR 1N59B 5EIIB 3BD5A 4XX1E 4X4XA 3TVMD 3MYZA 1R5IB 4UIMA 2D7MA 3ARGC 4F3FA 3VD5A 4UDTB 2YD7A 2JJTC 3DGCR 1OB1A 4Z8FH 1C5DA 1QFWH 4MDJB 3WL9B 2BVOA 1P1ZA 4EDWL 5DMIH 1TZGH 3QXDB 5HYJE 2DKSA 2P4AB 4DVBA 1NSNL 1FRGL 5I16B 5H37H 1CLYH 5D7LD 1VGEL 1P7HL 2CKBA 1JCKA 2AV7A 3VFOA 3G5YA 1FN4A 5HGAB 1FVDA 3BJLA 4PJ5E 4WTZA 1OB1B 4FQXC 2YD3A 2WBJD 3DARA 3CMOH 3SO3B 4U7KA 3P4MA 2N7BA 4GRWE 4X4MA 4X5WA 3WHXA 4FFVC 4IRSD 1HQ4A 3BP4A 3RTQC 4C4KO 4YNYB 4CADB 5FB8A 2UWEB 1IAIM 2OR9H 1MQKL 4OAWB 3T2OA 3QUXD 4U7MA 4QHNB 1DQML 3GJFK 2AXHA 1KIRB 3SQOH 1QFUL 1MREL 3RNKA 5K9JH 3QWOB 5FKPB 1A6ZB 4D9QD 5EBWB 2PXYC 3IKCA 5DC9B 3MGAA 2CR3A 1FNEB 3Q6GH 4K71C 1IKFH 4GRLC 1I9EA 2YEZB 1NC4A 1DQDH 1UM4L 5LQBL 4NQDA 2I9TA 4MNQE 3E0GA 1OHQA 1AHWB 2P8MB 4M3JA 3PE9A 4NM8L 4JY6A 4YBQD 2BRQA 3JV5A 3NAAH 4HWNA 1I1FA 3KPMB 2CO7B 2C1PA 2NX5B 1VFMA 1G7PB 1SYSB 4KTEL 1JWMB 2E7HA 1J18A 3R06B 1GIGL 1V7NH 1XAUA 3HCVA 3JWDH 2IPTL 2Z92B 1ITCA 2ENSA 3LN4B 4RFNC 3TIEB 4DVBB 5ID0B 3CDYA 4DAGH 4DN3L 3RI5K 3CLEH 5C08E 4RAVA 4G7YL 1N64L 3KPQA 3O4OB 5H8DA 3RAJH 1NFDB 3FFDA 4NRZA 5ISZA 3T77B 4O00A 3MNWA 5FYJE 4KI5D 1A0QL 3BFOA 2C9AA 2BVUA 4NKDB 4X6FA 5J11B 2ICEB 1C5CL 3OKMA 3FN0L 4HKXB 4P23D 3BZ4B 3S96A 1YNTB 3GSOB 3VGHA 5KW9L 2J6EL 5HYJB 5CEXB 3B5GA 3NZHH 1HOCA 1WBZB 2QADD 2AP2A 4YDLB 2XRAL 4PJ7B 3KG5A 3OXRB 5F9JA 4Y16B 5KVDL 1QSEA 3TYGL 3DO7A 4LLYB 1ZHNA 4FXKA 4NJAL 5AG8A 4JZJC 1R3HA 4YHIB 4QOKA 3CX5J 4LP4A 2UZXB 3L3OB 1I1AB 2A83B 2W91A 5FKAA 3P4LA 1PG7W 3O41B 5CJXC 4AIXA 2VLMD 3K8LA 2EO9A 1KEGL 4QXTB 5I66B 4JRYE 4BQ6A 1N6UA 2LABA 2WMPA 3AMLA 1FL3A 4FS0A 1Q94A 4I2XE 3P9MB 4RQQA 3G5VA 1D6EA 1KLGB 3T4YA 3V6FB 3TBYB 1A7OH 1ZEAL 4O2CB 3CU1A 4LSSL 5GJSL 3TT1H 3B6SB 1M1SA 3GI8L 2Q1EA 1N8ZA 3C5ZC 1ETZA 1OP3K 3SO3C 1R5VA 5IB5A 4NZTH 3MFFB 3QNXA 3LB6C 3WFBH 4PJEF 1QLFB 1UVQA 4KK8D 1EA9C 3PWJB 43C9A 2EIDA 1JGDB 5B39G 1KTLB 2JB6A 3IXTA 3RY5A 3LKOB 4OLVL 5D1XA 5J1SC 5CBEA 4Z95H 5F7WC 3UYOD 5C0JB 2BNRD 4HG4J 2CO6B 4WHYG 2XICA 3EYOA 4R90L 1TTFA 1W8OA 4YDKL 5DJYB 3EDJA 4M8QA 5DEGA 4KU1A 1XEDA 1MJJA 1H0DB 4P2RB 3PWJA 1F3DH 3ZYJA 4MB5A 4OLEA 4PJ5A 5IW3A 3OXSA 3U9UB 3TH3T 5CEZD 4F2MB 4JFDB 1IBGL 3O11A 1BF8A 4GRMA 4PR5A 2H1PH 1MUJB 3D2UD 2XZCL 1TLKA 4JM2A 4PD4J 1A6UH 4R7NA 4Z0XB 1SJEA 2R1YB 1ZHBA 4HK3N 3D25B 4Z7NF 5DRZB 1I8IB 1NLBL 4IRJD 2FIRT 3C5SA 4MJ5A 3TO4D 4K7PX 2EC8A 3SCMD 2YPVH 4IOIB 1B0RB 1HH6A 3V0WH 5D7LB 2OL3A 1ACZA 3CDGA 4Y1AE 5DS8A 2RQ8A 4Y4KD 4ZG1A 4R9HA 3PJSA 3SE4A 4XGZA 4Z6AT 2PTTA 3IRZA 2Z93B 2IQAA 2NY4D 4FTVE 2X7LB 4PG9A 3QUZD 4O02H 2VSDA 4P23C 2X4SA 5INDA 4P5TC 5I0ZA 1ROWA 3O4OC 3CFKB 1WAAA 3IDJA 3QH3A 1KJ3L 1CYGA 4X8XA 5EUKB 4J7RA 4WO4C 5F6IC 1WUNT 3MLTA 1ZLUH 5BXFB 4KRNA 1MI5B 2H32H 4JVUA 3EO9L 3MNWB 4MJIA 4MZ3A 4JFDE 1XGTA 3RPKA 1EFXB 4HH9B 5DQ9A 3IJSA 1AI1H 2X4SB 5INDB 4JFED 4WW2F 2VDKH 2DQJH 4QRQA 1FORL 2HTKD 5JPNA 3LN4A 4JPWH 5I30L 1HKFA 4P46D 1IM9B 4LSUL 4TULL 1OSPL 3EDEA 4OZHF 5FUZL 3MV8B 4RFEB 2H2SD 3EKCA 3H3KA 2VXUL 3CZFA 5IVOA 3RDTA 1I9JL 1BBJB 1A4JA 3C60B 3RL2B 4G80A 1NLDH 2QQLH 1CF8H 2VMFA 5CP7B 1EHLH 3R0NA 1CDCA 2PXYD 3HMWH 5MEOB 3ET9F 1NC4B 4WW2C 1MAJA 1E4WL 2NW2B 1JGLH 2DLIA 4JO2H 1HHKB 1YY9C 3UYRH 3O0RH 1SBBA 4ODUB 2ZUQC 1NGXB 3P73B 1NCAL 5H35A 5E2VL 1G6RA 3F12B 1KB5B 4LL9A 2VLRB 4OLZL 2A9ML 1MJJB 4PRHD 4NKOB 4QOKE 5GRYA 2WP3O 1P6AB 2CPCA 4M7KH 3I6GA 4KFZC 2PW2A 1DE4A 3VXME 3I3BA 4YXHL 4X5LA 4S1SH 3CCHB 4I18A 2W1NA 2VTFA 4MQ7A 3SOBH 3NFNB 3WDJA 4MNGA 1K4DA 4PREA 3HS0A 3KXFB 2VDLH 2YK1H 2A77L 3QDGB 4MXQC 2CUIA 4K3EL 1F00I 1QSFD 1ETZB 2Q8BH 1K2DA 4L29A 4CMHC 4KGJA 3V4VL 3MLUH 2AV7B 3VFOB 4LSPH 2C3XA 2VQ1B 4OZFA 1BJ1H 5C7XH 2C3VA 1I3RA 5KS9A 1A3RL 5I6XC 1KCUL 4UILH 2APTA 3D0VA 2XIDA 4HWUA 2BSRA 4RWYL 1S7RA 3ZE0E 3FAXA 4M5YL 4MD5B 4ZD3H 3GK8L 1MCWM 3OB8A 4IOFD 4WI2A 2NTFB 5KS9F 1HH6B 5F6HJ 1YEFL 5B39B 4JFOB 1KNOB 1CK0L 4OZHE 3VD7A 3GSXA 5E2UH 3WN5C 4OB5H 5DYOA 3UTTA 2FO1A 3BPCB 1JPST 2DQEL 3QB7C 2J88L 3OJDA 2DQGH 4OBRA 5ALCH 1T83A 1MUJA 3QQ9C 3MRHB 5SWSA 2ZPKH 2HVJB 4MLIA 5BVJB 3L7EA 4LSRH 3JWNC 2Q76A 4JHBA 1LE5B 5CZXD 4FQIL 2B0SL 2O26U 3NTCH 2EIZB 3UBXI 2B4CL 2H26A 3O6KL 4D9RD 1MCNA 3QQ3A 4HJ0D 4ISVB 4XNYL 1LO2L 1AGBB 2BY3A 1KCRL 1OAUH 4PBVC 2GFBB 5DJ6A 2J7LA 5D4QA 3BEVB 5CBEB 3KVQA 4Y2DC 5IG7A 4L4TB 1I8LA 1PJ9A 2BNRA 3RRQA 3VFNA 5TQ2L 2HT4D 1C8PA 3BP7B 3ZKND 3BP5B 4H88L 2NYYD 1ZT4B 1I7UA 3L5WA 5HHOA 3KPMA 2CXGA 1JHKH 5JZ7C 5CEZH 2NCMA 4YIQA 3NABL 4Y4KB 5H2BB 1AO7B 2J8UB 4IRZL 2OSLA 4IDLA 3VFRB 3TLRA 3ARBB 1JP5A 2GJJA 1IQDA 3E8UH 3TIDA 5L6YL 1Q94B 3BKML 5HHNB 5B21A 1H15A 3FTGB 4ZSOA 3V79C 1HHGA 3ZKMD 2H3NB 4G9FD 2AK1H 3IDIB 3P0YL 1NDGB 5BO1H 3CH1B 2A74A 4N0UE 5C0GB 2BVTA 5K59E 1KELL 1SY6L 3QEQA 4PFEA 4KKLD 3U36B 3SGJC 5E9DD 5KS9E 7FABL 1CICD 1GGIL 3IFPA 3IDGB 4RMSA 4M9OA 1CFNA 3D18A 2VN4A 1JF6A 4PJ9C 4PJDA 3AGVA 3O3BA 5I6XB 4X7FC 1EFXD 2YUWA 3LN5A 5D1XD 3GHEH 4NNPH 5EOCL 5DJDA 1U8PA 2Z8RA 1QNZH 4PJDF 5TFSH 3FT3A 3JWDC 4KZDL 4FQHA 5ISZB 3MA7B 3TNNB 1Q0YH 1FVDB 3QO1B 4NWTL 4U1HA 1VERA 4HHAB 4WWKC 1JL8A 2HKHL 4P57B 5IGXL 2HFGH 1ZT1A 4XI5D 4HFUH 1WWWX 3S36L 2ICWB 1U93B 5CZVL 1AXTH 1UCTA 1YPZB 4OUUB 4M48H 1J0JA 4JDTL 1FBIH 4OFKA 2HN7B 3OB0K 1C16B 1WIOA 1BREA 3MJ7A 5D7IF 1OT1A 3CFBA 4YR6A 3FOLB 4XWOC 1UJ3C 3GMOB 5MHSD 3FMGH 4EOWH 1JWUA 4F3FB 4RGOH 1NBVL 4APQB 2W0LA 5T33L 4F58L 4XCFH 4QYOB 3C08H 3WN5A 4K8RL 43CAB 4L4VE 2AV1B 1T3FB 1XGPA 2ZJSL 4L5FH 5C0BE 3MOAL 5I9QB 3IKCB 1BLNB 4L3CA 2VDQH 5KSAC 1SYVA 2FCBA 5FCSH 3GZKA 4ERSL 3L5IA 4UT6H 3KLHD 3T3PE 4XCYB 1P84K 3QWQB 3NFSL 3PP4L 3S7GA 2EH8L 3BZEB 4X0KA 3MGTB 2R56L 1HIML 4R7DA 4GW5A 1N3NA 5T5FL 5EPMB 2H8PB 4MAYB 3HB3C 3LQAH 2XWTB 2R2HB 1NEZA 9CGTA 1XGPB 1CU4L 3N1QC 1WWAX 1ZAGA 4X7CC 2AJUH 3WXWH 1RZFH 3QIUB 1F2QA 4HPYL 4Q9QH 3BP4B 3MXWH 4PJCB 1I7RB 2GY7B 1HHJB 2VRAA 3QEQE 3U4AA 3A6CL 3K7UA 3P4OA 4G6KL 4EVNB 2CLVB 1BX2A 1T2JA 1OAXL 4PGDA 3S9DB 4PRPE 5AZ2L 4PJDE 1GJIA 4DGYH 3MNVB 5FOBB 3E2HB 1FL5B 4XMKL 5GGSB 2E6PA 5DLML 3OX8A 1F2XK 5E1AB 4Q9RL 4PJAB 4DZ8B 4UAOC 3HZYB 5IMMA 1S3KL 4NN5C 1UG9A 1T7XA 5D7JB 4L4JA 1MEXL 3CUPB 1Q9OB 3QCTH 5FO7A 3U7AA 1QSFE 1CXKA 5F1IB 1CDBA 4L8SC 32C2A 3ISWA 3ESVF 4NZUL 1FAIL 2JJVA 5CEYA 4K9EC 2EICA 2OZ4L 3DETD 3DX6A 4GKZB 1TZIA 4WFEE 5KZCD 2H9GB 2ILLA 1FL5A 3QPQC 5GGSA 5I1HL 1DLFL 1R5IA 3PNWB 4MDIB 4J12A 4LCWB 4XNXL 3NCEB 3Q1SL 3BE1H 2V2TA 5KVGH 5HHXL 1T66C 1U6AL 5IBUB 1QQDB 5IBTL 1HHJA 4R4NC 2X4UA 1V7ML 1B4JL 4PRHE 2ZOLB 3BP6B 3PGFL 4R8WH 4RA3A 4ZDHB 2EH7L 4I13B 5C9JB 3T0EE 4P4KC 4IRJC 4J8RB 1N3NB 1GXEA 4P2QE 4R7DB 5J6HB 4ZUVB 4HQQH 4GW4A 5JA8B 5TPWL 3VRJA 1YC8A 2HLAA 1CTOA 3NBNA 1QEWB 3MACL 3SE3C 2YWZA 1IGYB 4HX1A 3HAEA 1UT9A 4GSDL 4F9PC 4UT7H 3HE7A 4ONFL 4U1GC 4MVBC 3F58L 1MWAB 5DD1H 2YD5A 5KSAD 5K9KA 4WEUD 4RIRB 4HIEA 2QHRH 1KC5H 1N4XH 1T6VN 3FO2B 4NQCA 1A7NH 3ULUC 4NP4L 5FXCH 1VADB 3CFEA 2BFVL 3GNMH 2GY5A 1JZ5A 4OFVA 2HMIC 3TBWB 4HUWA 2BSTA 3H3PL 1KJ2A 1G7QB 5T3ZL 3HC0B 1WIPA 3KYNA 2VLME 4PRPA 5DUBA 3C5ZD 4JO4L 2Y07H 1MCPH 2LU3A 1LO5A 1LD9A 3L1OH 4LAQH 4DOHE 1UYWH 3V6ZA 3QUXA 4JQIH 1P4BH 1SEBA 4H0HB 3UBXB 3BKYL 4ZAKD 3WO4C 3DIFA 4MWFB 1FG2A 2Y5EA 3FO1B 3DX9A 3BMWA 1KXQE 1MNUH 1QRND 3D2UB 1MHPL 1D6VL 1QKZH 2DL9A 1OP5H 3GMNA 1BBDH 2LFGA 1RZKC 1OGAB 2IEPA 5GHWL 3X12A 4YH6A 2ERJC 3AROA 1D9KD 1RK0B 3LSOB 3HPJB 3RWJA 4PRID 4JRXE 4XNQB 2XZZA 5CLTA 2X9WA 5E08L 1DBJL 1JFQL 3H42H 5IWLA 1X4YA 2HTLC 4MX7A 3U1SH 5HVFB 4H20H 1OW0C 1MVFA 2QADC 2OL3H 3GMPA 5EN2A 3FCTA 1D5IH 2NY0C 1NKRA 5HGHB 2EDLA 2OLDA 1A6TA 1MCHA 2HFFA 3IU4L 3STLA 1BPVA 1KPUB 4YHNB 4PJGB 3ESUF 4PYGA 3WS6A 3TO2B 3CFDB 4ZQKB 5HHNA 3QRGL 3HNSH 4AIZA 1R3JA 3D0LB 4BJLA 4I0PD 4P5MB 4Y2OA 1RJYB 4G43A 4H25B 2GK0A 3VWKA 4PJ8D 4I8DA 3HA0A 4BFIB 2OI9B 1G84A 3QR2A 5EC1A 2AJSL 3W81A 4OIBA 3GIVA 4NC0B 1MI5D 1F3JA 1IC5H 3W9EB 4C4KT 5I17B 1CICA 5D72H 3J7HA 4ZUWA 4LHUB 1PY9A 2W9DH 1HH9B 2XXMB 1FV1B 3O2DH 3UTQB 1YEJH 5ESQB 1EJOL 4KRPB 3LQZA 5MEQB 4GXUN 1A1OB 3PWNA 3FT4A 2VDRH 4TVPL 5I1AA 4XCEA 5CZKA 2KZWA 4Y4FA 5I1CH 4LGSB 2FJFA 5DF0A 5IQ7H 4RFNB 4KTYA 2G9HA 4XBGB 3LS4H 1CWVA 3SGEH 4K07A 4J4PD 3QWRA 1RHHB 3DRTA 5L9DH 1UENA 3UX9B 5IB2B 1A4JB 5SWSB 5L2KD 1QYGL 1WWBX 5D7KD 2B4CC 3ARGA 5TDPB 3L3KB 4QF1A 3VCLB 2ENYA 3S35H 5HYQA 5IHZA 4CRPA 2CD0A 3S34H 4MSWB 1U8IB 4E42B 1U8JA 1JMZA 4P2QA 2VZTA 4XBEH 2MQ3A 4FFVD 2OS7A 4LCWD 4HIHB 1TCRB 4HIXL 1BOGB 1X4XA 4BQ8A 4EI5A 2QV2A 1Q8MA 3SKUD 3WDIA 5CINL 3QXVA 5A2KH 2VZUA 4L4VD 4NJ9H 4WWKB 1IGTA 3F7YB 3ZHLA 1FNSH 4NKIH 4EI6A 2NY6B 4PD4K 1T7WA 1G1CA 2VDOH 3D9AL 2WZPD 4M93C 3RY6A 1N7ML 1OSZB 1ZSDB 4POUB 1ZWIB 1OTSC 4XP9L 1QA9B 2P43B 2EXYC 3JXAA 3A6OA 5A3ID 2X4QB 3P40A 4K7PL 4KVNL 4WI4A 3GIZL 2ZZUT 2VABA 1SBSL 1TJGL 3BW9B 5IQ9A 5E03A 4OFDA 3JV6B 4JPKH 5H94A 5D9SB 4BFGA 2B1AH 1VEMA 3HR5A 3PQYE 4YHZH 4LK4A 3SJVB 4IRJB 5KSAB 2V5RA 5HHVH 4QWWC 4AENB 2JJSA 3BYTA 3DX7A 3VA2C 1RVFL 1DBAL 4M6ML 5EA0H 3LKQB 2A73A 4AEHL 4CL7A 4OLWL 5IB2A 4GBXA 1HDMB 3QAZB 3G5XB 1DQJB 3T3PF 4MA8H 3JUYA 3RUGE 4HJGB 4WNQB 1HQRB 1EHAA 2P24B 3MV8E 1H3GA 3KYAA 3PV6A 3SJVA 5DK0A 3BQUC 4I9WE 1DCLA 4G6JL 3FT2B 3HNTH 3FRUA 3ZKSD 2DKMA 4U49A 4ELKA 3HZKB 4IMKA 3SDAB 1JBJA 4KTDH 5ESAB 2AQ3A 5GSVB 3LB6D 5JXED 2FHFA 2AW2A 3LCYA 1FVCA 2VLJD 4BH8B 4XPHL 4Z7WE 3WFDL 3A0OA 3QDJA 3VXMA 1NGPL 2ESVA 3EO1A 1QRNB 2GI7A 3RZCD 5F1SA 1YEKH 2BDNH 4EXKA 4BK5A 3MFGB 4O5LH 4MNGE 4YX2L 4K8RC 2AABH 2YD9A 4BFIA 3V5HA 3ZTNL 4D2NA 4WO4A 4U2ZA 4U6YA 4QRPB 3MRPA 5I19H 3NN8A 4CVZA 3WUWA 3HZMB 4HXAL 4M1GH 5HVHC 1TFHA 5K59F 4H0GA 3NPSB 3EOYG 4HIHA 3U4BH 1UWEH 5HJ3B 2J3SA 1M7XA 4O2EA 4MNQA 3KYKH 3FB7A 5F9OH 1S7TA 5HHQB 3C5JB 2CDFA 4KJWC 1U95A 4RMUA 4R4BB 3GBMH 1NC4D 5HGBB 4C56A 4P5TA 1IARB 1RK0A 3OXRA 5IHUH 1CIUA 1QFHA 3MCLH 1KPVA 1OCWH 4KI5C 1TENA 5DFVD 3WUWB 2VLRD 2M8XA 1Q72L 4O51B 3SPVA 3UZQA 4JM2B 4GAYA 4W6XB 1RFDH 4X99A 3DMMA 3OHXA 2FLBT 3O11B 1GOGA 1T1YA 1OP9A 1JYXA 1SM3L 4CU8A 2N56A 5C2BL 5ISZE 35C8H 2WQRA 5ENWA 2AJXL 3QUXB 3FQWB 4MNHA 2FLRT 1LD9B 3ZKXB 3FB8B 1YUHB 3DNKA 4PB9L 2Q8AH 3FO0L 1P7QB 3TZVD 4OF7A 4Y5XC 1D5BA 5C09A 4MJ6A 1CQYA 3P3YA 1T2XA 4KJYB 3W9EA 4G7VL 4I3RL 3GUTB 2J4WL 1D5ZA 2QSQA 1AGEB 2AGJH 1CL7H 3MRJA 3PDOB 2NW3A 2JB6B 3IXTB 5D1ZC 1TTGA 5E2TL 3WV0A 4AEEA 1IAOB 2ZUQB 2CKBH 5F88B 5D5MA 3DROA 4N0UB 1KCKA 3N85H 3AY4A 4XCNB 1MWAA 1WBXB 3DURB 5HHOE 3IFNL 5CKGA 2XG5A 1EXUB 5FYJH 3MLYH 3O6ML 1LO0H 1P2CB 3MRRA 4QXUL 4AENA 1I8MB 1YEEH 2FEEI 4MHHG 2JJWA 4L3EE 2R69L 4F7PA 3H7BA 1T0MA 3QQ9D 1J8HD 1RURL 1Q1JH 3VE0B 4FFYH 3FN9A 4OQTA 4YDIH 3IGAA 4QWWD 1IT9L 3WJLA 4XNQA 3MRGA 3I84A 4ZS6D 1AXSA 4HPOL 5F7HA 1X5KA 5IB3B 1KN2L 4K9EL 5EG6C 3ILQC 1CDIA 4YHPB 3LAFA 3CX2A 3OR7B 3E6FB 1WBYB 4K94L 4WUUB 3ME0A 3GKZA 1KENL 1YDPB 1JWSA 4Y5VC 5FUOH 2GJZA 1TXKA 1GAFL 1AE6L 1BIIA 1EV2E 1KG0B 3H9HB 5EZOH 2QADB 1MJ7L 2G2RA 1HHIA 4PV9A 1FNGA 3PWUB 4LLVA 1MRDL 4LF3B 3GSOA 4GRWB 4AY0A 4XPAH 2ARJQ 2XA8H 3DJ9A 1LO4H 1MCIA 3FOMA 3BH8A 2W0PA 1PW3A 2APBA 4XNMA 1AY1L 5FYLE 5BS0E 2DLTA 4XCCL 3QCVH 1IC7L 2YOCA 1FZMB 1EO8L 1HILB 3LRSA 3DVNB 5FUCE 4MQXC 3ALPA 3WFZA 4AH2B 2JK5A 1F4YH 5HHMD 1R24A 1A2YA 1J1OL 5DVMA 1X5FA 4HV8B 4NN6C 3LZFL 3VW3H 2A6IB 2JJTA 3NIGE 3M45A 3HCVB 4PJEE 3QDJE 3V52L 3BKJL 3GJEA 4HH8A 3BVNA 2V5MA 5FYKH 1JWMA 3L95B 3V4UH 1WZLA 4G8EB 4BH7B 5KANG 5TDPA 3DSNA 4ZFGL 2CDEB 1OM3H 1YMHB 1L7IH 3PUCA 1I1FB 2AI0H 5HVHB 1SVCP 2DQFA 4QHLA 4HBQA 3V5DA 1ZT7B 4X7EC 5E9DA 5TE4L 1RJLB 3IXAA 1RHHA 4I77H 4LKCB 4HXBL 3Q5OA 4FTVA 5LCVL 3SDAD 3H2WA 3L5JA 2ADFL 4JFZH 2X4OB 2G9HB 1WBYA 1TZHA 2E7LA 2NXZD 4X7SL 3IVKB 4XH2A 4F33B 4J3TA 5CD5C 2A9NL 1WC7B 2VB5A 4LSQL 4XX1G 4EBQL 2ZWLT 3RY6C 3WSQH 3V8CA 4Z7UB 1URLA 3ARBC 2YD4A 15C8L 4OZGB 4F15B 1ONQA 4MJIE 4UOW0 2H32A 5J9PA 3GDBA 2LU4A 3IETA 3VGFA 3L3JB 3HI6L 4Y5XA 1T22B 4GLRH 43CAA 3VMNA 1RIVH 1CFVH 4C54A 1HNGA 1HQ4B 2GHWB 4Z7VA 1GHFL 2P5EA 2UUDK 1PEZA 4X5WB 3MRBA 3RBSA 2OJZL 3DROB 5F88A 1DFBL 2WP3T 1ZLSH 4YR6B 4YE4L 4GW1A 1ZVYA 1L9MA 4WO4D 4PRNB 4XC1H 1FZOA 1MCBA 4UTAH 5I1GH 2Q7YA 3SDXA 3VXSA 2AJYL 5ABDE 4DTGH 2EZ0C 4FQ2H 5EN2B 4PUBH 1F13A 5CS7A 2GYSA 4LGRB 1FFRA 3QUZC 3ROOA 2XQBH 2ADIB 4PG2C 3S3JA 3M17B 3TWCL 3O6FD 4URTB 2DLHA 1UWXH 1I9RL 1EZVX 3P4OB 1FPTL 1L7TL 5D5ME 2XOTA 3HTLX 4CMMA 3KHOA 4UOW1 1MLCB 3K0WA 4NPYB 3JV4B 1DDHA 4JN2A 5ADOH 5J57B 5A16A 5GGUA 5D1QC 5DRNB 4M7LH 5CEZE 4L9DA 3T8XA 5CUSL 5DMIL 2IWGA 2R0LH 2OQJA 4WGWB 4B7IA 1HKLL 4APQC 4F57H 1WAAF 4H1LG 3P0VH 4OSUH 1EPFA 2VQTA 4HLZG 4UQ2A 7CGTA 1GL4B 3QAZC 4HKBA 1FSKC 5MENE 2NR6C 3ARED 4ELMB 1CGSH 1BGXH 2VZ1A 3ORJA 4OV5B 5GZOC 4YXLL 4OGYH 2AV1A 1MHCB 3GO1H 1BEYH 3K8KA 1RUKL 4ALAL 3B9KD 5HI5D 5C92A 3MLVH 3MRBB 3MODH 4PV8A 1MQKH 4X5XB 2GJ6D 5C71A 2HMID 3MRIA 2F54B 1OQOA 2E7BA 3MGOB 4KI5E 2OXHA 5F44A 2Z8VC 4WEBH 5D2NB 1D5ZB 4HK0B 4CU7A 3W39B 4ZNEA 4MXWH 4YAQA 3ZYOA 5DMGD 4OV5A 2YZ1A 4KKNA 3ULSA 2ICWJ 3BRDA 5K9JL 2O5ZH 5DQJB 5L88H 5BS0A 3DV4B 1NFKA 4OGXH 5EZIL 1UJTA 1OL0A 2E6QA 4BKLB 1MCSA 4Z7VE 2CR6A 4KZEH 1S7XA 3VGEA 2P5EE 5E94A 5EO1A 1HSAA 5ILTL 1IKFL 1FZKB 3RJQB 1PKQE 1S7WA 4Q6YA 4OCSH 4PJFF 4EKXA 2OQJB 4V1DD 5GGSY 1RPQA 3DMMB 5IF0B 4ZYKA 4YHOH 4XPTL 3TYFB 5BRZB 3CFCH 2C1OA 4JQXC 3WIFA 1U8PB 4A6YB 5ICZB 3KXFD 1JNNL 4CMMB 5B8CA 4LQFL 4L8CB 3TBSB 5BQ7A 2HG5B 3VI3E 2DQIL 3CXHJ 1MFAH 5GRWA 4FFZH 1FFNB 4I0KA 3SO5A 4R4ND 3OMZA 2DM3A 4MAYC 4RRPA 4AEIL 4TNVK 1T66D 3MBXH 5E99L 4NNYB 4L8DA 3EOBA 4MNQB 2PTUA 3H0TB 2I5YH 3ARUA 2VE6B 3I02B 1CS6A 1C5CH 4QOKD 2DWEB 2MTPA 1VB9A 2VXQH 1QA9A 4ODWA 1REIA 5CKAA 1VFUA 3QZWB 4L8BB 5KSVB 3OR6B 3UJIH 5ECJE 5SX5H 2XRAH 2D7QA 1AQKL 3GRWA 4X8JA 5MP6L 3VXQA 2CJUH 3HLAB 3GSNA 2R0ZH 4U7SA 4AEFA 5K93A 2VDPH 2Q87A 3WNLA 2B5IB 3UC0H 2OP4L 1F42A 4JANB 4FQ1L 4YHPA 3BEWA 2R2HA 1IGFH 1S5HB 3EOTL 1KLUA 5LXGL 2EECA 5DHVB 3L3HA 4GQ9L 3MA9L 2WUBH 2WIMA 4GRLD 2DQTL 4IIQB 2HVKB 1A7OL 4HKJB 3S3SA 3OWEA 4ZTPL 1HQRA 5LWYH 5IB1B 2OTWA 1LO3H 3ULVD 1BLNA 4W4OA 4FZEH 4UV7H 4E41B 3F7QA 3EYQD 3V5DB 4LHUG 1NJ9B 4PJHB 1HHKA 3RUGF 3VDCA 4YFDB 1RULH 3KLHC 3OG4B 3TBTB 1EMTL 2E9JA 3UDWC 2ZUWA 4OCLC 2J2ZA 3OQ3B 1UWXK 1YEHL 5JUEH 3PDOA 5ACZA 5D70L 3T0XA 5KVMC 1ULVA 4IRSC 4NQVB 4U33A 3OF6D 1OLZA 2WBWB 4NYLB 1FL6A 3SCMA 2I27N 2JIXA 5MENA 2X09A 1IL1B 1H8NA 4NT6B 5EC2A 3WS6C 1X4ZA 3FB8A 3KPSE 1BQLL 1G6RL 5AWNL 5T3XL 3I6LE 1X5XA 5KVEH 1YEGH 5C0RH 3HN3A 5JHDE 3RZCB 4X6DB 3VFPA 4OCXL 1UXWB 2HH0L 3OGCB 3DOSA 2Q6WB 1UB6B 2DQHL 1Z3GL 4MJ4A 3D0LA 3BD3A 4I18B 3IDJB 1Z9SA 4NO2A 2VAJA 1M71B 1XF5B 5GGQL 5D7SH 2N1KA 4JG1H 3T65B 3FQXB 4PY8J 5D7IE 3Q0HA 3VFGL 1IAII 2HJLB 4TQEH 4QTHB 2J5LC 4YHKH 3X3FH 4LEXH 5C3LD 2NY7L 1P5VA 3GMPB 4O02L 3TJHC 4ESKA 1T0MB 2YR3A 5IBLD 1K6QH 3MTRA 1EK3A 3IJYA 4JFEA 3L3KA 4QF1B 1FIEA 1FIGH 3QSKB 5JXAH 4OZIB 1EGJH 4P2CG 1OWRM 1T04A 4ZSOB 3QUYC 3C09C 1CT8A 5EU6A 3RWFA 1I8IA 2IGFL 3ZT7A 3W9DA 4ODVL 3MRPB 3PWLA 3Q3GA 1NFDF 4XMLH 1G7IA 1KB9K 1MI5E 4B7LA 2CMRH 4NNXB 1RZIB 3OJ2C 3PGCB 3TESA 4G80B 3TJEH 3UTSD 4RMWA 2E8YA 4EZMA 1U8MB 3GUTA 4YZFE 3VFMB 4DUXA 5JOFB 2X4RB 2DL2A 4QRTA 5HDBF 4JPWL 5CMAB 4D3CL 5I30H 2UYLB 4NN7C 1IEAB 2B5IC 3V7AG 2FZ3B 3VXTB 1LO5B 1KTKE 4LCCB 2AJVL 2I60L 1CVSC 1S9VB 3VFWB 3D3VD 3INUH 2Q86A 1MIEH 4UBDD 5AZEL 2NY6D 4D8PB 2D0GA 4OZ4A 1ACYL 3U9PL 3QXTA 1JK8B 2BNQE 3HG1E 2FIKA 1KJ2L 4W81A 3BH9B 5HY9B 1DEDA 3VFTA 2FWOA 5T3ZD 3ROLB 3RVXD 1U8MA 3MLWH 4LDOB 1BM3H 5F7EH 3CSBA 3E6HB 4EDXA 3BD4A 3FJTA 1S8DB 1RV6X 4GAYB 43C9B 3H6JA 4R0LB 3GHBH 4D0DA 5DD3H 2VDMH 3SGDH 4PJXE 4BSWB 3WNPA 3WYRA 3W11D 2FX7L 5ERWA 3BPOC 5DT1L 3RVTD 4OZIA 4MXVF 1MH5B 4NRXB 2B8OT 1N2RA 1MCOH 4P5TB 1UB5B 4P59H 4QXGH 3F6LA 4JFPA 4JFXB 4W6WB 1PG7X 5EBMA 2ED8A 4XGZB 2YXMA 3CFJB 2I9LA 3V2AR 2UWEE 3NA9L 4IMLA 5FF6B 1CVRA 1LDPL 4LPXA 1O5DT 2BSRB 4NQCE 5D5MF 4Z7UF 2JJSC 3BSZH 1CE1H 2PUQT 5L8JB 3SKJH 1A7BA 1OF2A 4NPYA 3W2DH 1WCQA 4NRXA 3MLUL 4Y4HB 2JKXA 3MJ6A 4MA7L 2R29L 5C9KA 2EIBA 3OXSB 4YUEH 2VUOA 4GAJL 3EO1B 2ADIA 3REVB 1A3LH 4GUPB 4X6FB 2IH1A 5KBNC 3DLQR 4YXKL 3GK8H 4RBPK 4MQ7B 3LV3A 4Z77B 1N5AB 4MXQD 1NAKH 1NC2B 4PLKD 12E8H 2V17L 2XQYG 5DHXB 2OMBA 1NGQH 3X13B 1QACA 1TJIH 3GSWA 3VI4E 3KPSA 3WS3B 3NCMA 4PJAA 4DZ8A 4AG4H 5DMJB 1PG7L 4LPTA 2HLFD 4GS7C 1KB5A 1M7DA 4HIIB 2P5EB 4G8GE 4XAKE 1CFTB 3NIFF 1A6WH 4MAUH 5FHBL 2A73B 5ICYA 3N06B 4PS4L 4LQ1A 3MCKB 3T1WA 4YC2B 3SDCC 25C8L 4JY4B 3C6LC 4E9LA 1FP5A 2XTJD 1MHHB 2FECL 3SE3A 1CDUA 4S1DD 5ADPH 3QIUC 2XWTA 3EDFA 4ZOBA 1JNJA 4YJZL 5DHVA 1WGOA 1EVUA 5EPMA 3RDTB 4FQJL 4LFHG 5EBWA 3SDAC 5KANI 1S9XA 1A6ZA 3MLZH 3BDBA 5MEQA 1ZHLB 3JZ7A 4DZBB 1J86A 4C83A 5ESQA 5T1MB 5GS1A 1DBBL 3D39D 4HSQA 5JOPD 3EJZD 1K9TA 3BPOB 3BP6A 3T2NH 2CH8A 4HEME 2CUHA 3GSNB 4L3CB 2BY1A 4LPVA 3S37X 5IBLC 5CEZL 2DQFB 3GBNL 4G9FE 1ZMYA 1FO0H 4IRZH 5EC1B 1XGYL 4LCIH 4DQOH 5C09D 2UVEA 1MI5A 3E8UL 4HKXA 1JGVL 5ITBL 2YPLA 4APQA 3LEYL 4R4FL 4WWKA 5E00B 4FQCH 3NCCB 1IGIH 4JZNB 2AK1L 1C7TA 2E9WA 2QLVB 2CRZA 4GKSB 4M6OH 3JWOH 3TO2A 4HV8A 5BJTA 3MRNA 32C2B 1C16A 4LPWA 4XAWH 3QFJA 4DUVA 1KELH 1ODAA 5JQ6L 1MFCL 1KFAL 1NGZB 4H1LB 4OLUL 3CVIH 4OTXL 4KAQL 4E42A 2EDHA 2X1XR 1I4FA 5E6ID 2OBGA 1RU9L 1YN6A 4OKVB 3TH2T 3NGBB 3F6IA 3BKCH 3EFDL 3K2UL 1NGWB 3SE9H 4B5EA 2E7MA 4DFIA 2K1MA 2WBJA 4FQXB 5EOCH 3H9HA 4S2SA 1QBMH 1RZKL 5FGBA 5TFSL 2IFGA 5L2KA 1NCDL 4PJCA 4A6YA 4TPRL 2APVA 3IT8D 2C1OB 2QEJA 4M3KB 4WFHE 4N9GA 1VEPA 4Y2DB 5CBAB 2HJFA 1KYOK 2R9HD 3G6JB 1F90H 3S36H 5BV7H 1NMAH 1A7PL 3KPPB 3IFPB 3VWJC 2B2XH 3MV01 3BN3B 4OLXH 3WUWG 3BZEA 2I07B 1WT5C 4P2RA 3TPUA 2H45A 4P9HL 1ZA6B 2QQKL 4M62H 3EYQC 1CXLA 4F7PB 3LKPA 3UYPA 3VXOB 4OF3A 3VD9A 3O4LB 4RAUB 2CLRA 4XP5H 4LNRA 1RZJL 3N1FC 5CFHA 3C6LB 4N0FA 4HCRA 4HK0A 5JW3H 3H9SD 4X80L 3ZLQC 1S7UA 2AK4E 4XCFL 2EIEA 4RIRA 4ODXB 1UVQB 5FO9A 1EBPA 1CGWA 1OT2A 5J0BA 4L5FL 5I8CA 1G9EA 3MRLB 1MHCA 3O9WD 3QUYA 1RUPL 5I18H 4TUKL 4F7TA 4QTIL 4BZYA 1P4IH 4RFOH 1GGTA 3PQYA 4KJYA 1N0XL 3SGDI 1QRKA 3NFSH 4PTTB 3MV7B 4JZOA 1QR1A 1WEJH 4J3VA 1A7RH 2GKIA 4OM1L 3MV11 1J0IA 5B22A 1N5YL 5F7NC 3K81A 3VJ6B 2JCCA 5IMKA 3VFSB 3FQNB 2AJUL 3G08B 4CN4A 2ADGA 3RVVD 4JY5H 3JV0A 4G6AC 3MXWL 4J2XA 5IOPB 1Z9MA 3QDMD 1MAML 4WFFD 4NQED 4GBXD 4L9LA 4G8GA 1IVLA 5L8LB 2YRLA 5B38G 4Z8FL 1IEBA 5AYUL 1YQVL 5C0BD 5E70A 2P8PB 3BGFB 4NN6B 1NKOA 3MRHA 4P4RA 2PCPB 4M7JH 3PNWA 5ICZA 5E8NB 1JZ3A 4QRRB 5GS0C 5HI4C 3WFCL 1ES0A 3C8DA 3QA3A 2IF7A 4O58L 3QCTL 3VGAB 2A38A 1VGEH 3RKPA 3PHOA 5D7KE 4P2OC 3WFHA 3OAUL 2BC4A 4PJAF 3LIZL 4O2EB 2WLZA 1DL7L 3LHPL 5CGYC 1DUYB 2P5ED 4PJIB 2Y1VA 2PN5A 3G6DL 4KHTL 1Z5LA 3H8NA 2OX5A 3RGVB 1AGFA 3RL1A 3FO2A 5C0EA 1NBYB 4I48A 4WFGE 3BI9X 4P2RE 3CGTA 1DTUA 4JPIA 4LLDA 3LDBB 1BVKA 4G6ML 5FGBC 3ELAT 3C60C 2GJ6E 4RWHA 2X40A 3MRLA 1Q9KA 4KXZI 4X5XA 2R2BA 2ESVB 2OI9C 3MUGA 1IZJA 1ORQA 4WW2B 3QULB 4Z7WF 2IBBA 2DQDH 2IADB 1QFWI 3IDYC 2YWYA 3Q6GL 1CFSA 2PR4H 3C6LA 3O6FB 3B2UC 1PSKH 5IJVA 3FONB 4QRUA 3UZEA 4JG0H 3WD5L 3ZYZA 1YJDC 1BAFL 3W0WB 4OCWH 4C58B 4DKAA 1AC6A 1A5FL 5IROA 4NBZB 1HYSC 5GGRA 5B8CC 1HN1A 2VLRA 3KHQA 4FTVB 2ZOLA 1DQJA 1X5YA 1K3IA 3I6KB 4KK6D 5FV1L 4JQXA 2HLFC 4OBSA 1S7QB 3EHBD 3JWDL 4NP4H 4XB7A 1RUML 3L95A 4JHWH 4FMKA 1QHPA 3DVIA 4IRJA 2WINB 2IAMB 1JWUB 1TZIB 4JO1L 4QT5A 1DVFD 4GAFB 4JFOA 2C4FU 4ODHH 3PHSA 1A2YB 2NY2D 4P49A 1G9NC 3RAJL 1BVLB 3G08A 4NCDA 1Q9OA 4YWGL 4LASH 4XRCB 2NY1D 4FQXD 4TNWF 1LK3H 1RIUL 3U2SA 1QFPA 4Z7NE 2AEPH 5EWIL 2HRPH 5C86A 1MFNA 5A43C 3K1KC 3UTPE 5ITFA 1KEML 3BHBB 4AL8L 2FO4A 1F6AA 3LRGA 1YYLH 3QNZB 1XGQB 4U1HB 3H9ZA 4ONOA 2VDNL 5HDQH 3X14A 5J7CC 5E00A 3NCBB 5DDHA 5D71L 2GJZB 5FO9B 4J4PA 4ODXA 1E6JL 4TOYL 1BBDL 1FG9C 4LLAA 5IFAH 4HC1L 2LQRA 4LRIC 4CBPA 1DVFC 2VC2L 2WBKA 3LN5B 3ARGD 4N0FB 1IFHL 1G9ML 1JFQH 5I8OH 1ZLVK 3VWKD 4JRYD 3RBGA 1FNLA 4Z76B 5BRZD 5C0IA 3ZMRA 5DJXA 3KJ6H 1J1XL 1EX0A 2V5TA 2NZ9D 3CDGB 5DHYA 4I3SL 3RJDA 1YJDH 3NIDE 4RZCA 4HZLA 4IDJH 3SN6N 4M8VA 2XFXA 4WY7L 1D5MA 3ARBA 1I3GL 4N9GB 3UO1H 4R7NB 4DGVL 1KCSH 3QXAB 4CNIA 2D9QB 1IAOA 1Z2KA 4RCAA 5GZND 2EYRB 2VLRE 3CFBB 4R90H 3PG2A 3VD3A 3VRIA 2Y06H 4TTDD 4X6EB 1DANT 5E2WH 4M7ZB 3B83A 4UT9L 5A2LH 3RIFF 1OAKH 3X11A 1Q9LB 3BQUB 3BXNB 4WTWA 4Q2ZA 3IRPX 2L7JA 3MJ8B 4LSTL 3C2AL 1ZANL 2X89D 3KDMA 4OF5A 1NGZA 4H1LA 2ZG3A 3EYUH 1IBGH 1NBZA 4YFLI 5EO9B 4KROD 2R4RL 4X6CF 5JR1H 1SMAA 5I1LB 5DJ8B 3WNKA 1T21B 5DFVC 5D2NC 3QPXL 5EOQH 1VCAA 3FT3B 5C0AD 1ES0B 1K4CB 1LEKB 4D0CA 1ZGLP 4XZUB 3QNXB 5ACLA 2YD6A 1K5NB 4R97C 3ZHKA 5JHDA 3LEVH 4LLQB 3O2WL 1JE6A 3LD8C 4NQEA 1KPUA 4YHNA 1VHPA 2XKNB 1MELA 1LNUB 5FA4B 1D9KC 3VFUA 4MCZB 4KHXL 4TYUA 2W9EL 3D3VE 3E3QC 4E41D 1IGJA 5DVOA 2VZVA 2NTFA 5D2LE 4MD0B 4F7CA 2IFFH 2GTZB 5EOTA 5FKAB 3SQBA 2O5YH 4NSKB 4PP2B 4KH2A 3QJHB 3HZMA 1KB5L 2J12B 4OF0A 3H7BB 3UTTD 3TN0A 1MOEA 4JHAL 3D2UA 3S35X 1AO7A 2J8UA 2ESVD 1WFUA 4W6YB 4GMTH 3PQYB 1XF2A 1AI1L 5E1HB 1WBZA 2VDKL 3KS0J 1MFEH 1I7UB 2A6KA 1WBXA 1ZT4A 1GGYA 2ARJA 3CVHA 1ORSB 4JHZA 3FRPA 4TULH 4K7PH 5SWQB 1PYWA 4JRXB 3WS3A 4OLYH 2MCG1 3TV3L 1OPGL 4OT1H 5MERA 3ULUD 2E6JA 2GFBA 1CTNA 1NBZB 3NH7H 4RAUA 3QI9B 4PRDA 1CF8L 4XVTH 4DKEH 4HEPG 4PY7B 2YN3A 1NCWH 2Q86B 4Z77A 3NIFE 3OKDA 4FQPA 3PV6B 3DRQA 8CGTA 5EFIA 4HIEB 4NQCB 1F11A 4X9IA 2Q3AA 1QLEH 4FZ8H 4AEHH 3IB4A 4OLWH 5TDOA 3UYRL 3QUMB 2VXSL 1NCAH 1DVFB 4M5ZL 5F96H 1GOFA 4OLZH 3NCYS 2XNAB 1PGRB 1RK1B 3KPRA 4HX1B 4UI2A 4G6JH 4O51A 3SPVB 4PJXA 3P9MA 4RQQB 1AGCB 3T0BA 1CT8B 3HR5B 4ZUUB 4IBLT 2ZKHH 5DQDH 3FZUD 3FO9B 4KTDL 1A4KA 4YXHH 1P84J 4N0RA 1JZ8A 5I76A 4KQ3L 1TNMA 4Y5VB 5HPMA 5C07E 4RFEA 1K8DB 3HE6D 3RDTD 1F45A 3MBEA 3S5LA 5IEKA 3UTSA 3QIWD 3U7YL 4YGVA 3QHFH 5I15H 4K3EH 1UWGH 1DN0A 5T1KD 2OR8A 3VXRE 1A47A 4O5LL 5E6IC 2P5WD 3TM6A 3DXAA 5JQHC 2AABL 4J23A 3GSUA 1JI1A 3RP1A 1DN2A 1HOCB 1T2QL 4ODTL 3QUKA 1RUAH 2DBLL 4YNYA 4L8SA 4FXGB 4I3GA 4MDIA 1UB6A 3LS5L 1T5XA 1KV3A 4FXGA 4YQXL 2X9YA 4HWEH 4EDXB 1UWEL 1G7HB 1CD1A 3QO0A 5E5UB 2FSEB 3TCLA 1BFVL 1R0AL 3BPLC 4HUUA 3VH8A 5F1IA 3UEZA 1S5IH 5DD6B 3I6GB 3MXVH 3CH8A 3V6OA 5ID0A 2IQAB 2DQEH 5GRVL 4MSWA 4IRSB 5ALCL 3RZCC 2IBGA 3O45A 1QPPA 3VXTA 5I8EB 5H35B 4NKMB 4TVPD 4FFWD 5CILL 1E4XH 1A4KB 4DOHB 3VXUA 3QG7H 3BGAA 5K9QG 4UIKL 3KPRB 4QEGA 4O4YH 3QIUA 3BQUD 1KCRH 3MCKA 4LSDA 4Q0XH 4C57C 4JFFD 1U8LB 2HT2D 4XB8A 5AD0A 5JORA 4FN0A 1A1NB 1B2WL 1CD0A 1OGAE 4L9LC 1TQCC 5TQ2H 4K7FA 1T20A 2IANB 2MHAB 4U1MB 4UB0H 5DD0H 4H88H 1XR8A 3L3HB 2J4WH 2VR4A 1HE7A 3MZTA 5I73C 1E6OL 5DC4B 2FD6L 4JGMA 4BUGA 5FHAH 2FSEA 2KQMA 3GMQB 4HUXB 4N8CH 3TFKD 2IADA 4LP5A 4N8PA 4MLSA 5DEFA 1UA6H 2E8ZA 4LLWB 3HUJE 1TETH 4H0IA 4GO6B 4L8SB 5JHLL 4N5EC 5IB5B 2A6KB 4Z7QE 1T6WA 5BO1L 1JZ2A 3P2TA 4UOJA 3O3AB 1RURH 3KLDA 2VXTH 3OKLB 4YDIL 3NCYP 1F4WL 3BT2H 3QRFM 2IQ9H 1D3CA 2F54E 5I75C 7FABH 2H2PD 1GGIH 4E5XB 5D7JC 1G7JB 5K9OB 1YEDB 4JR9H 4XRCA 1KN2H 1FVEA 3RWHB 2G5BA 4JEGB 3QJFA 5LG1A 5CJQL 2CLZB 4QOKB 3HAEG 4CVWA 5JW4R 3QG6B 4OGZA 4YHIA 3LMJL 5DRZA 4RRPG 2XTJB 4HK3J 3V95A 4KPHL 4JFQA 1UB5A 3GJFH 2RJMA 4NWTH 3D6GA 2PO6A 1GGBH 4NQEB 3MC0A 4X9BA 5KSBF 4WI5A 1T0NA 1U58B 5ICXA 4HS8L 4L3ED 2HFGL 2O5XL 3KPRE 3MJ9A 1IEBB 1XCTB 1VA9A 3AS2A 4U6VL 2Y23A 2AXFB 2NY5H 3AXLB 2EDOA 3EYVA 5ALBL 4ZYKB 5IF0A 5IVXA 4XNZB 5DUBB 1T21A 1I9IH 1UJ3A 1C5BH 4JDTH 3GKWH 2EDDA 3CH1A 1NDGA 2FWOB 4P9ML 5CJ5A 4KDWA 1DBKH 3SDDB 3TNMB 3FMGL 4HUWB 1EBAA 3TBWA 1S5HA 2BMKA 5T33H 3WXVL 4QHMB 3P30L 1GYAA 2NX5E 4HFWB 3C08L 4HCRH 4ZFGH 4RX4D 3VXRA 4ZUWB 3T0VA 1P4LB 3WE6B 3ARFB 3LKSA 1MPAH 3T3MF 4YAQB 1HEZA 4FNLL 4U0RC 3WLBB 3ZT5A 1FJ1B 4TRPL 3B6SA 3DSFL 3BPNC 5SX4I 3DX8A 3RWIB 1DLHA 3K1DA 3D85D 4OCRH 3MJ9H 1FE8H 1QSEE 1YNKL 5E6IB 4MJID 2F58H 1UM6H 3BIAX 1CGXA 2JJUA 5T5FH 1AR1C 3LQAL 2QQNH 4UDUB 1KUMA 4CW1A 3RU8L 4NFDA 1SHMA 1TIUA 3IJYB 4HPYH 3B4NA 4RBPH 2NY5C 5GS1C 2CRIA 1N26A 1AJ7L 5C0IB 2EIZA 1WZ1H 4Z76A 2GT9A 1I1AC 1YMMD 5J1TC 3IU3B 3IDNA 4M43H 3SKNB 1OAXH 1MJ8H 1MCDA 1U58A 5ICXB 5IKCB 5JHDB 4LCYA 1U41A 3O2VL 4XBPA 1B6UA 2E7CA 3K8MA 3UAJC 3NCJL 3LVEA 5DRWB 2ICEA 5D6DA 1GPOH 4BM7A 5DUML 4X6DA 2Y7QB 3H9SA 5HYFA 2AERT 3EJYC 4NZUH 3PWPE 4Y19A 4DTGL 2RB8A 4FQ2L 3FQNA 4NQUA 3BUYB 4OD3L 4LPCA 5CP3H 1QPXA 5IESL 5EO1B 3MLXL 3BXNA 3Q1SH 5HI3C 2VLLB 2HYMA 3SDXB 3B2VL 1G7LA 3VXSB 2NY1B 1C1EL 3RTQA 3KPRD 3S37L 1KJ2B 1IC4L 5EUOE 4KRMB 1V7MH 4GKSA 4LMQI 2W0FB 4WFHD 3ILQD 5FECA 3BWAB 3MV7D 1NMBL 1K4DB 2RGSA 1IM9D 4PRAA 1N59A 5EIIA 1DEEA 1GGCL 1VEOA 4G5ZL 4H5SB 2DMCA 4LCYB 5SWZB 3UTZB 3ULUE 3RVUD 4F57L 3JTTA 4RGMB 3KLAB 1BZ7A 2EE3A 4IM8A 4WV1C 3RWEB 4QHKJ 3B9KA 5T1KA 3STZA 3IDNB 2PO6C 3VG0L 1U8KA 5D8JL 2CLRB 5BVPL 3BGMA 1IGYA 4WHYH 1FQ9C 3NIDF 2F53B 1A6AA 3MOBL 3C8HA 4MHHI 4UU9A 5KAQG 4KWUA 3EZ8A 4PP1C 2VH5H 4ZODA 1UH3A 3OJMB 3GO1L 4J3OC 5AD0B 2C4XA 5JORB 1CCZA 4S1RL 1AFVL 5GGVL 5HHOD 3JTTB 4AMKL 2ZUSA 4WI6A 2QHRL 2R1XB 4HGWA 1MCRA 4PRHB 2IMNA 4WEBL 2ZUVA 4P4KD 2D31A 4C59B 3P4MB 1Q9KB 4PLJD 3H3PH 4OV6F 4S0TD 4XNZC 5EOCJ 4JFHD 2BP3A 1ND0A 3MJ7B 3BPNB 1MVUB 4ZTOL 1G0YR 3M17A 2RFXB 4M1DH 1W72A 4JO4H 3ULVL 4CUCA 3SGEI 5ILTH 3VRLE 4KI1A 3V4PL 4PIRF 1UYWL 5B38B 1H8SA 3GSWB 4M00A 2CK0H 2Q7YB 5BW7A 1MFBH 1R24B 1QSFB 2EYTA 1IGML 4AH2A 5TE7H 2MKLC 3CUPA 3IJSB 4LIQE 5IFJA 5D7JA 3WFHB 4RGNE 3EOBB 3I85A 5DQ9B 2VITB 4WFED 4JZNA 4OM0L 5AUMB 4YHLH 3ARRA 1QKZL 4GAGL 5FO8B 3BZDA 1W72L 4WTXA 5DJDB 5E8NA 1MFAL 1MF2L 2NY3D 3I9GL 1LEGB 2CGRL 1FHGA 1G9NH 1CXHA 3IU3A 5B8CB 4KVCL 3SDDD 2OL3L 3WJJC 4LLMB 2ZUXA 1U8OA 1RD6A 1BJ1J 4G9FA 5IEHB 5I1DA 1TPXB 3QJFB 5HSFA 2LE9A 1QSZA 4EN3C 5I76B 1WC7A 2EDNA 5JIKA 5T1LA 1LK2B 4K8RD 1MFDH 5IM7B 3UJIL 4LEOA 3HB3D 4WHTB 2X4OA 2H6PA 3ZDYE 2AJSH 5F3BA 1F3RB 3D85B 5LJYH 1I8LC 5KTEH 4D9QE 1BVZA 3C8KB 4PR5B 3LRHA 3QUYB 4U2YA 2R0ZL 1T3FA 2VQUA 3OZ9L 1AD9B 2KZ1B 3MGOA 1D5XA 1J5OL 1RAMA 2OP4H 3MRIB 1CFTA 2EDJA 3K4ZA 5CIPH 5DA0B 3V8OA 4Y16D 2VYRE 3MV9B 5DMGC 4XVSH 3V7AE 1IQWL 5EFIB 1P7KA 1IGFL 3KR3L 5LXGH 3IDYB 2FL5B 4GQ9H 3TVMB 5CZXC 2FX9H 5GRUL 2FJGA 2F74B 4MJ6B 2WANA 3WNOA 3ULUH 5TQ0L 1BQUA 2ICWA 5LBSH 2Z31D 4LCCA 3HUJF 4GUPA 3EYSH 2XWJB 3A67H 3AREC 4J6RH 3UTTE 2X4RA 3ARZA 5F21B 5BVJA 4XP6H 3FFCB 3CDFA 1R3LB 1EMTH 4Z7QF 1XF4B 3VFVA 1WV7T 2NLJA 3IFLH 2R1WB 4LRIA 2HWZL 2C3HA 2FEEL 3FQUA 4UTBL 1T83C 5DRNA 5FGCB 3SDYH 1G7IB 3IDXL 5FCUL 4CVXA 1MCFA 4YK4C 4M6NL 3ZKXC 1QFWL 1PLGL 1CBVL 2BZDA 3DUSA 3GSXB 5JW4N 1MSPA 4S2SB 1FL3B 4GOSA 2WBJB 4NSKA 2PW1B 2WW8A 4NQSA 4IMLB 4WCYL 1O7VA 1EEZA 4OGAD 1DANU 3L3IB 1RIHL 5HGGS 3D3VA 2BCKA 1FNSL 3GSNH 3X3GL 3GSQA 2ZSVB 1DBML 4D0BB 2VDOL 2X4TB 4FXKB 4POYA 2BNRE 2A1WL 3OKLA 3FQXA 3WO3B 5KSBE 3CMOL 4JO3H 2UV3A 5DI8A 1JPSH 2FGWL 1UXSB 4U1LB 4JFDD 4LLQA 1K5NA 1IQDB 3T2PA 5I8CB 3OKOA 2EO1A 5H37G 3BYYA 5D5MB 4LLWA 2YUZA 1INEL 3VFPB 1A22B 4MD4B 1S7UB 4IIQC 1KTDA 1DQLH 5C1MB 3RWDB 2ZCHL 3T2QA 5GJTH 4LEXL 5L2JB 2R4SH 1I8KB 1F8TH 1FLTX 2VL5A 3HMXH 1DN0B 5IW1B 4KQ4H 1P7QA 2NX5D 2YN5A 5EU5A 5J8OA 2VN7A 3THML 4MA1C 5FDWA 4LMQE 4MCYB 4EEEA 5JO5B 1AP2B 4ZUUA 4Y2DA 4PJGF 1MHHA 2KBGA 5JDJA 4EIZC 3S98A 4NQDB 3MYJB 1SMOA 4U3CA 4I4WB 1ZT7A 2H2SC 4AK1A 2F8XC 2ZSWA 5CD3A 3C60A 4LGPB 4WHDA 4D3CH 4LVEA 2IPKA 5T3ZE 1L0QA 1XGUA 3HMXA 3QUML 2UZYB 3HI1B 2AJVH 1NGWA 2I60H 3E2HC 3INUL 4JFEB 3R0MA 4ZFOA 2XKUA 5DYOB 3UTTB 4IRSA 1ACYH 3U9PH 3N50A 2R23A 1KJ2H 3OKDB 5K9QI 2FBJL 4X6CB 2MSPA 5FA3B 3NGBC 4G7YH 5I74C 1ZVSB 1IAIH 1TCMA 3M8OH 3PWPB 1IE5A 3UTSE 3BZFA 5IMOA 4HH9A 3FN0H 4ETQA 4CVZB 4LCUB 1FNHA 4G8IB 2C3VB 3W5NA 4HIJA 1S7SA 4WU5A 5D7JD 4FRWA 5DEZA 2H2PC 5KVDH 3VXQB 1JNLL 3HAEH 4X8JB 2NY4C 1XGQA 2NY1C 3KYKL 1D9KA 5ITFB 4C56D 1YN7A 5KZCB 3M1BB 3P77A 3GSVB 3CK0H 3QJHA 2EE9A 3PIQB 1BHGA 1JZ6A 1GZPB 1K8DA 1KSRA 3MCLL 5ESAA 1JPGA 1S9XB 3ES6A 1JHLH 5KVFL 5TDNA 3CFJA 2HKFL 1ADQL 4NNYA 3SKJL 4PRPD 4ZAKC 2WIIB 1QVOA 3RWGA 1LNUA 5FA4A 4MA7H 4NM4L 4QRPE 1WFTA 2DQCL 1SM3H 1NGXA 3TO4A 5HVWA 2IALB 3C87A 4ODUA 2AJXH 1WFOA 2Z31C 3IYLW 1CDHA 5TDOB 3OKEA 5FUCC 1LMKA 2QL1A 4RISH 4NZRL 5DHVH 3CD4A 1BFOA 5D6CA 2D03H 2ORBL 5D9SA 2X5PA 4I3RH 4XCEB 5EBLA 4LSVL 4ORZC 2FIKB 4ODSH 1C12A 4O9HL 4AG4L 1UACH 1FDLL 4D8PA 4OIIH 4XPFH 1S7XB 3RNQB 3T3ME 4QHUA 5IW1A 4PTUA 4WUKL 5DQJA 2APWA 4RAHA 3REVA 1MJUL 5DFTA 1DQQA 2F5BL 1ZLUK 5I17A 4UNTA 5A2IH 5TE6H 5DC0A 4RMRA 2FX8H 3ILPB 1NAMH 3I75B 2Y5TA 4QNPF 1F5WA 4DVRH 2R69H 5LGKA 2QQQA 4S1QH 4X99B 4N0YH 3T4YB 3QUZB 1Q1JL 3F7YA 3TEUA 4LHJB 3G5VB 1YZZA 4Y1AB 4PB0H 3RGVA 1HSBA 3WIIH 4CMHB 5GRZA 1FSKB 4GMSH 4GG6A 4WEMB 3FRPG 4KKCC 1TNNA 4F7CB 5LGHL 3GGWB 1DUYA 2X44D 4K3HA 1DBBH 4IOSD 1OW0A 4UQ3A 4ZO7A 4LDLB 2Z93A 1YYMH 2DD8L 1E4KA 4GXVH 2LAGB 4UQ2B 2PTTB 4PJ7E 4ELMF 3KYMB 3TBVB 4PJIF 4JFFA 3BPLB 4NCC2 5EZOL 2LTQC 2FH6A 5F9WC 2PYEA 4GBXC 1ZTXL 5ERWB 5DO2C 5E8PB 1HSBB 2IAND 5F1OB 1GCFA 1Z0NA 2R0WL 4HUNB 3JV4A 4RMTA 3QCVL 3FZUC 1EO8H 4Q7DA 3EIFA 5JA9A 3DIFB 2DMBA 1U8NB 4XVUD 3DVFA 3NACL 4LIQH 5DVKA 3WIHH 4AT6B 2OCFD 1AKJD 1R3IL 3MRQA 1JN6A 5M95B 3N9GL 1OARH 4GH7B 2XWJA 3L9RB 3KDMB 1RU9H 1OSPH 1IL1A 5EU3B 3D1MC 3FKUS 4OCYL 4QHUB 3ZDYF 1HZHH 4YC2C 2FB4L 3W5MA 1U92B 3WDHA 1CICB 2AI0L 1HCFX 4F7TB 4YBHA 4LLUB 4I77L 4K2UH 3QHZH 4M61B 2GCYB 2C1PB 2NX5A 4HXBH 5D1XB 1GSMA 4ENEC 4WNQA 2PXYA 4OF8A 1T03H 1GGUA 5KOMC 1E4WH 1FYTA 4HT1L 2J6EA 2IAMC 1ZLWK 3VDAA 3HC4H 1EEYB 2BJML 5IFHL 4N8VG 5HHPA 2R15A 4AZ8A 2IALA 2PETA 1MIML 4E41A 4OQTH 4Y16C 1BJ8A 4M62L 1JNHB 5F7KC 2PO6D 3LPWA 4ZXBA 1QEWA 2HLAB 4IIQA 4XP5L 1MCQA 4YEFA 1TTUA 3EUUA 4MA3B 4QXTA 5I66A 4R2GC 5JW3L 1A14L 1CFVL 4OAWA 5FAAA 1XR9B 1LGVA 4FQLH 5I75B 3S36X 4LFHD 2WBJC 2VDLL 2YK1L 3P77B 1EERB 2A77H 3BX7C 2MPAL 1DFBH 1NH6A 1YN7B 3D69A 3P11H 3ARDA 3UPRB 4EN3D 3I50L 3DO7B 4XXCA 2JB5L 4KMLB 3LEXB 4GG8A 2FR4B 5I1IH 1WISA 4G9DA 4QHLB 1QQDA 4LSPL 3O3UN 4U1SB 4XC1L 2XG4A 1FN4B 5HGAA 1INDL 5C7XL 5CP3A 5CSBA 3ARVA 4RNRA 3S96B 1WEJL 4U1JB 4XI5C 4HIJB 2PYFB 3MRKA 3RL1B 4G8FB 4L4VB 3ZO0A 5KJRL 4PRPB 4EIGB 2AEQL 1FL6B 4NQDE 4NYLA 5IT2L 3VI3F 3ZTJG 4PRNA 3JWOC 3IKKA 3VG9C 3LRSB 1MAMH 4O2FB 4OB5L 4JN1H 5DFWH 2VR5A 1TZGL 2DI8A 4UDTA 3R06A 1T89A 1VKXB 1CZ8L 3RUGB 3GRWH 1MRCH 1I3UA 1T7ZA 3AM8C 4RNRB 3HI1A 2VLKE 3H7LA 1MWAL 4LSRL 4M7JL 1S7QA 4NRYA 4JJHA 4PJHA 1JYVA 4OSUL 4GLRI 1NJ9A 3WFCH 1CXIA 4FQIH 3TP4A 5IW6B 1QBLH 1A7QH 3JTSA 2VISA 1LO2H 3WIFB 1JRHH 1YC7A 4PGCB 5DWUL 1FCGA 4KY1H 3M07A 1NGYB 5E8OA 4NBXB 5BZDA 5F93C 4YBQC 2VL4A 5IJKA 1OGTA 4YXLH 1V3JA 1I1RA 1VFAB 4CW1B 5FDWB 1OGTB 2FH8A 4UU9B 3LKNB 3MLVL 3TA3B 3QULA 1DQMH 2VXVL 2NZ9C 3QT2A 2VISB 2G5RA 3HNVH 4NGHL 2FNBA 4MXWL 5IVZA 5TH2A 1P2CA 3MRRB 1F3JB 2FBOJ 4PPTA 1INQB 5E5MB 1XIWC 4H5SA 3FHQA 1CLOL 2V2TB 5L88L 1UZ6F 4NZJA 5EZIH 5F6IB 3Q6FA 3HI5H 2MNUA 4WIQA 3BVNB 1U8HB 2ADJA 3I3EA 1HINL 3V9FA 3KPTA 5CEYB 3G6AA 1VFOA 3QIBA 4LNRB 2FJHB 1HILA 1NC2A 4MYWB 4HKBB 3ZE0F 5ISZD 3LY6A 4MX7B 4XNMB 4U6TA 5I1EH 4QRPD 4LQFH 1XCQA 3EGSA 2XN9B 5FOBA 1R5WB 1S9YA 5F9DC 2DQIH 4F80A 3QCUH 2YRZA 4LLVB 1JV5A 1OGAA 1FNGB 1VPOL 1RUMH 2P8LB 1BF2A 4N1EA 3FFCD 3OHXB 5L8KB 2EDQA 5IK3A 5D6DC 3MBXL 1WK0A 1MLCA 4PRIE 4LBEA 2VO5A 5IGXH 1X44A 1RI8A 4AM0A 3V7MA 2VLKA 5AYQA 4M02A 4N0CD 3EGSB 4KUCD 3EHBC 3WJLC 4DEPB 5IUSA 5K9OA 3G6JF 3RVTC 4M48L 4Q6IA 4BQBA 1J05B 1QR1B 4P4KB 4KK6C 1CGUA 5J11C 5E4EC 4NJAH 1G7QA 2NQCA 2VDNH 3F62A 3AS1A 1KJMA 2EXWD 4JREB 1KCVL 1TJHH 1JTOA 1S78C 2Y6SC 1KT2A 4JVPA 4U1KB 4R96A 3NN8B 4PBWD 4Y1AA 1KEGH 5CJBA 4Y5YB 3BO8B 2OSLB 4FQ1H 3VFRA 3T4AA 4R0LA 1JPTH 1S8DA 3QI9C 2P46B 3GI9L 3V5KB 3MOAH 4CAGA 2VUYA 4DGIL 4WV1B 1AGEA 3E3QE 3DO3A 2HN7A 4RDQG 1UH4A 4PRIB 1P4LA 3WE6A 5BW7C 3VG9B 2XXCB 5DMKB 4UV4H 4KK5C 2JTDA 4EJ1C 1RMFH 4HS6B 5IM7A 1T20B 2IANA 1LK2A 3V0VA 3WMSA 5EZJB 1HK6A 3SDDA 3T1FA 1RZFL 4K23L 5J56B 3WCYA 1I3GH 3P4NA 3UO1L 4TTGA 4OJFH 3U83A 3O3DB 4XMPL 2E27L 3PXJA 1XF1A 3LPFA 1AKJA 3OAZH 1FGNH 3A6CH 5JUEL 3F7PC 2D7NA 3T0ED 4OD1H 4PJ8B 3DUUB 2ATKB 2XWBB 2C26A 2V2WB 4EDWH 2A6DA 2IJ0C 1X5LA 3QHTC 2PYEB 2KH2B 1UQSA 2BVPB 4NO3B 2DLFL 4V2BA 5I1JH 1NSNH 5F9WB 1FRGH 5C0AE 4JFQB 5IP4A 1YN6B 1BQLH 4NO0B 5C6TH 1CLYL 3KPSB 1EUUA 1RQ5A 1C7SA 1A6UL 2JE8A 3KLSA 2NY3C 3MRMA 1SQ2N 5F7YC 4N1HB 4MXVE 4MD5A 3O8XB 2HH0H 2DKUA 1S7RB 1VENA 3IAGC 4A6YH 3ARYA 4QLRA 4X98A 2DQHH 3GSVA 1I1YB 1SJHA 5HHXH 5KSBA 2DM2A 3O81A 5IBTH 1B0GB 2BVYA 5GGQH 3NIGF 3U0TA 1V3MA 1K2DB 1U9KA 3ILPA 2GUOB 4H26B 3RDTC 1BZ9A 1JMXA 4TSBL 1RZ8B 1S7SB 2W9EH 4WU5B 4Y4KC 1NCBL 5J1AA 4JREC 5MI0B 2F5AL 5T1MA 4DJMA 3K2MC 2AEWA 4P46A 1N6VA 3RNQA 3SCMC 1Z9OA 3EOAA 2CIIA 1BJMA 4JVWA 4Z7WB 1DQDL 4JKPL 1AD0B 1GRWA 1AGBA 1QFWM 3TFKC 4GMTL 4JFXA 4PGCA 4XC3H 1BFOB 4NM8H 3T09A 2Q7NA 2OK0L 4GXUM 1TVHA 3MUHL 3ARFD 1QD0A 1L6XA 5DGQA 4HF5L 5ID1A 1U8KB 1R6VA 2IANE 3MPCA 4KTEH 4XNUL 3C5ZB 3GEWB 1SVZA 3MNZB 1GIGH 4X4ZA 2P5WE 2ICES 1NLDL 4PRBA 1UZ8B 5T3XE 4Q74A 2APFA 4Z0BL 3RVUC 5AEAA 2P47B 5C8JA 2PNDA 3SKMB 5F7UA 3QI9A 4PRDB 2XN9D 1T1WA 2YBRA 3GMLB 4KK8C 2Y07L 3HUJB 1G7LB 3O0RL 1Y6MR 2G60H 2X4QA 4FXLA 5DXWA 3GHBL 3LV3B 5JDSA 2V2XA 4D9LH 5F6HI 3BH8B 2A9MH 5J1AB 1BMGA 1D9KB 2Q3ZA 2YC1B 3TCLB 2WQ8A 1QO3A 1MCOL 3HR6A 1XGTB 2HT3D 1EGJA 2FR4A 5BXFA 1YDPA 3QZWA 5KSVA 4P5MA 5GHWH 4HWBA 3I3DA 4RMQA 2OZ4A 2BY2A 4X4YA 5C6PB 3QH3B 4FP8L 3RI5F 1FH5H 5JMRA 5FF6A 1FC2D 2EDRA 3I2CL 5B3JF 5CAYB 2Z0BA 4ELME 5EIVA 4WFFE 4DCQB 1AXSB 3ZTJH 3U1SL 4YHYC 3U7YH 3U0WH 1NL0L 5I15L 2XZAH 4R4BA 3RA7H 5JNYB 4YDVA 4YGVB 4ETYA 5EBMB 2VLJB 5ETUA 2BOBB 1LVEA 4PJ9D 5JNYA 6FABL 2DJUA 1KCUH 4P0DA 4UILL 3B3IB 5HJ3A 2FECI 3GGWA 4KXZH 5BMFL 3QDHA 3HNSL 1NUGA 4HLJA 3T0EC 4RWYH