1ORQA

X-ray structure of a voltage-dependent potassium channel in complex with an fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
215
structure length
215
Chain Sequence
ENVLTQSPAIMSPSPGEKVTMTCRARSSVSSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDTATYYCQQYSGNPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
molecule keywords 6E1 Fab light chain
total genus 48
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orqA01
4PJ7B 5HYJE 3RY6C 2YPKB 1EFXD 4LSPL 4Z9KB 1DTUA 3BPLB 4QHKJ 4JQXA 1T20B 2DYPA 5C0JB 5D71L 4Q9RL 4G8EB 1W8OA 5A2LH 2BNQB 3QUKA 1ZLVH 4TNWK 1BQHB 3B5HA 4OF5A 2C5DC 3DMMA 4PBXA 3MV8E 1JHTB 4X4XB 2BXZA 2WLYA 1X5AA 4JQVC 4JKPL 1NPUA 5SWSE 4ALAL 1FQ9C 3AUVA 3ZHDA 4U05A 5DD6B 3NIDE 4MA7H 1XAUA 3FO2A 4LBEA 4X98B 2MPAH 2B4CL 1S7RB 4V1DE 3U1SL 1X5JA 3ZMRA 3HNTL 3I50H 1YJDL 5DJ6A 3GI9L 5GGVY 5IMKA 1JRHH 3D39B 4XPBL 1J0ZA 1UM5L 1NGXA 4OLXH 1H3WM 5TDOB 1PBYA 1RK1A 5DQ9A 5LG1A 3IDJA 4XMPH 5IFHL 4ODWB 3NAAL 2RQ8A 1NCWL 5K59F 2DDQH 1J8KA 2Q3ZA 3JUZA 1UM6H 3EOAA 5LBSL 4NN5B 3BT2H 5F1NB 3ILPA 2QLVB 4PJFE 1XR8B 2DQTH 3FHAA 1KNOA 3HS0A 3MYJB 3LKOA 3VRJA 2I9TA 4HZLB 3RWJA 3FQNA 2Y5TB 1SJHB 4XP6H 1S7SA 2VDRH 2J88L 3CXHK 3OJMB 4DUVA 4GRWE 4U6TA 5DJ0B 4KJYB 2Q7NA 2IH3A 5IR1A 3KYKL 5IVXB 4BUHA 1NMCC 4LOUD 5JXAL 5E9DE 5D93B 3UDWC 1INEL 5EC1B 4U1SB 3TT3H 3MZGB 1SEBB 4MZ2A 4PYGA 5D1XD 1U92B 4FFZH 4Y7MA 3DROA 2Q1EA 1P1ZA 4PJIE 4GMTH 2R1WA 3FTGA 4FFVD 1U3ZA 3BZFA 4WHTB 4S2SA 1BAFL 5SX4I 3RZWA 3O6FA 2PKDA 3BEWB 5JXAH 1RIUH 3GO1L 4NPYB 2YA0A 2HLFC 4JLRA 5I2IA 1LEGA 1CL7L 4QTIL 2CLZA 1IARB 5BRZA 5CJ8A 4AIXA 2LVEA 3TV3H 3V6OE 3PJSB 3NCJH 4WUUA 2CO7B 5CZKA 1IC4L 5DJCB 5E8PA 2R15A 3ULSB 1CE1L 3VDCA 1CF8H 2VDOH 4B7IA 3CH8A 3O3AB 3NPZB 3IFLH 3U79A 4MJ5B 3I75A 3WFBL 1WIOA 5HVHB 4P3CH 3QIUC 1U8LB 1U8OB 2R2EB 6FABH 1UJ3C 4Y4FD 4ODVH 4NQSA 4ZPVA 1KC5H 4NQDD 4MYWB 1G0YR 2VLME 3HE6B 2JJUA 2VXUL 5C3LD 3SKNA 4Z7QE 1T1XB 4QKXB 2NY3C 3RZCD 1J05A 4OQTH 1XF4B 4TVSa 4ZYKA 4PY7B 1H8NA 2J8UE 1HK6A 3MOAH 3RNKA 1UENA 5CKAA 5DRNB 4V2CB 2ESVE 3CC5A 4ZDHA 4CADB 3PWLA 5J9PB 3P9MB 3DUSB 5DD0H 4M02A 4FXGB 1ZLSH 4QO1A 1F2XK 5KTEH 1HI6A 1Q9WA 1X5HA 1H0DA 3QNYA 3LRGA 1CGVA 3WXVL 2E7LC 2YS4A 4CDHA 1G6RB 4M6NH 1KCKA 1XR8A 1LE9A 2YZ8A 5IMMB 5IB2B 4GW4A 1JMXA 3FQTB 4U0RC 1ETZB 2KZ1B 1YPZA 4Y16B 5KANG 3TZVD 4G6MH 3WL9A 4YO0B 3QDGD 5IFJB 4PLOB 1CLCA 3VA2C 1N6UA 1FO0B 3EYOB 4ZAKC 3RX5A 2BCKB 3QUYA 4QOKB 2CLRA 1F4XL 1AE6L 4KJQC 3VGHA 5ELIA 3RY5A 3QDAA 1LO5B 1IGTB 2NXYB 1BJ8A 1A02N 5IW6B 3T0BA 4XC1H 4M4PA 2G2RA 4AT6B 4JQIL 4G8FB 2JK5B 4XPHH 4OLYL 1FLTX 1QTYT 1KBGH 2EDDA 4ENEC 3IDXL 1YNKH 4OLWH 3KJ4C 1XGUA 4JLRB 5I2IB 3SDDB 1LEGB 2BY0A 4UIKH 4EKXA 3P0VL 5EO0B 1G7QB 1UYWH 5FOJA 4PY8J 5LGHL 2Q86B 3ZKMD 3MJGX 2DOCA 1AO7D 2ZKHH 1VA9A 5ITFA 4MNQA 5DQJB 3BKML 4WRLA 2A0LC 2BVEA 3BEVB 5DMKB 5I8CA 4R0LC 3WIHL 5IMLB 4LRIC 3VD9A 1ORQB 3PGFL 4PPTA 3WFZA 1BGXL 5BQ7A 5DA0B 3C5ZB 5GJSL 4PJXA 2NY0B 5F7EH 4M5YL 4FZ8H 3QYCA 3NFSL 4O02L 4IMKC 3BWUC 5I1IL 5BRZE 5E2VH 3VXOA 4U1GB 2NTSP 5AYUH 4KMTH 1IM9A 3KPRE 1W72A 4JPWH 3FRPG 5IUSA 5FYKE 1YMHB 5KVGH 2AXGB 3NABL 2UYLB 4TVPD 2DLFH 4YX2L 4GSDH 1J86A 4QTHA 2D7QA 3X3FH 1CLYL 4OZIF 5F6IB 1YEKH 1NUFA 1YEFL 4YIQB 5ICYA 3MLSH 5C0BB 3TC9A 5ESAB 1MCKA 1JL8A 4JANB 3V5HB 4FXGA 4CVZA 1R3LA 3DYMA 4IHOA 5C0AD 5E8EA 3O9WB 2G75A 4S1SH 3LQAL 4JDVA 4Z7WB 4JPVH 4WJ5A 2ENSA 4MA7L 4QXUL 3B4NA 5AG9A 2N1KA 2Z8RA 3ARUA 2PXYD 1ERNA 5A16B 1ZOXA 1AJ7H 3LEXA 3I3BA 5DFVD 5I71B 1BP3B 3G04B 1HHJA 4ZSOA 3T0EB 5GGSY 5IQ7H 1N5AA 3VFNB 1YPZB 5INDB 4P2QE 1CLOH 3O81A 5L8KB 5EO1B 2Y6SD 4F33B 4F7MA 4IIQB 4NZDA 4LEXL 1EAJA 4HV8B 1PKQE 4CMMB 2HKHH 3HZVA 1MHEA 4NOFA 2ATPB 3IJHA 1VB9A 3MOBH 1N0XH 4W81A 4OLYH 4CU6A 1UACL 5L7XL 3KPPB 3GSXB 2DIBA 2WWKT 3GIVB 4KKCD 4MA1C 2UWEF 4KDTC 4L3CB 5GZOD 4KQ3H 1SBSH 4ZOBA 3P0YL 3CFBB 5IB4A 1Q1JL 5HI3C 3EBAA 3MOQA 3WLWD 4TVPH 2QBWA 2W9EL 3HE7D 2H6PB 2I24N 1NJ9B 3EDJA 4D0DB 5FHBL 3QUMH 2ADGA 5HI5D 3UTTE 1J0HA 5JR1H 1UXSB 1BM3L 1ZHBA 2YD4A 2LVCA 1CFNA 1FPTH 3OXRA 5A2IH 3ALWA 2AEIT 3TT1L 4YZFE 4KVNH 3UPRA 4DVRH 3G5VA 2FX9L 1HXMB 3FRPA 3GKWL 5FV2A 4K3EL 3QJHB 3HB3D 4LPWA 2WQ8A 5B8CA 1QBAA 4QXGL 3D3VA 3QEUB 5HDBE 5T1DL 2AJYH 5BS0D 4Q0XH 4HKZA 1ZLUH 1W72B 4MA3A 4HH9A 3KJ6L 1JTTA 2OTUB 3S36X 5KAQF 3RWHB 4X7DC 4X6EA 4P3WA 1WLHA 1FVDA 1G9MH 1MAMH 1G7LA 3JWOC 1OPGL 2BSSA 2IG2H 4FQCH 4Z7UF 2C3GA 4O58L 1MRFL 1X7QA 5KVGL 4RMRA 4K9EH 1KTLA 1G7MA 2JJSA 2NY3B 4R6UA 3CU1A 4L9LB 4O4YL 1ZWIA 2G75B 3ETBF 3OAYK 3V0VA 5I76A 1ACYH 2W9DH 4M7LT 3QNXB 5KSBB 1RJYB 2DKSA 4J3TA 1N8ZB 3SDCC 5IEHA 1MUJA 3LEXB 4K3EH 5E2UH 1DFBL 3ZKXC 1ORSB 2MCPH 3N06B 3PWPA 5DUML 3WIHH 3L3HA 5C6WH 1FNSL 3BH9B 4UQ3A 4YHPA 5E5UB 5DFTA 4RBPK 2YRLA 1VESA 4IRZH 1A3LH 1BBDL 4ODXB 2HJLB 3KYAA 2HH0L 4QHNB 5E2WH 4CJ0A 4U1KA 3TP4A 3FFDB 3PWJB 4LQFH 5K9QG 1MHEB 1QRNB 3U7YH 4PJ9D 4F57H 4FTVE 3IU4H 3W39B 4KJPD 4UOJA 1WBXA 1KIRB 5D1XC 4RAUB 3NCFB 4R2GD 5FGBC 2I5YL 2XN9A 2DTSA 5E0QA 1JNJA 1F2QA 1GSMA 4PS4L 5B4MC 3LRSB 1GCFA 3BQUB 3VFPA 4OGYL 5C0RH 3QFDA 3QIBC 1FNEA 2XQBH 4Q6IB 3P4OB 3QEGL 4FQXB 4MDIA 4NNXA 1NJ9A 3REWA 3SY0A 3MRJB 3KPLB 1V3MA 1CFNB 3KPSD 5HGDA 1YMMA 3IF1A 1OAXH 1N4XH 4YUEL 4EOWL 1GAFH 5DDHB 4HIXH 5IT2L 5CZVL 3QWRA 2XZAL 4Y88A 1JNLL 2WW8A 3D3VB 3QEUA 5ID0A 3ECBB 3ARDA 2PNDA 3SO3C 2J8UA 1KENH 4OV6F 4MNGE 4BQCA 1DBML 1F6AB 3UJTL 1MJUL 3CLEL 3L3DA 4S1QL 1DQQA 1F4YH 3L3OB 3H9SD 1FFOB 1T1YB 4ZTOL 3MLWL 4KDWA 2AJZA 1DVFC 1EHNA 3FRUB 3QISA 4WFEE 5FA3A 2CKBH 3MUGB 5JHLL 1D5MA 5FDWB 4MHHI 4MXQC 4M3JA 3SDAD 3VFOA 4KRMB 4Q9BA 1LWRA 3WE6A 1A2YA 4QRQA 4N9OB 3QR2A 1BVLA 1E4XI 1F58L 3WFBH 3NABH 2FL5B 1A5FL 1ZVHA 1A8JH 3HKFA 4Y1AE 3RVWC 1YEIL 2HJFB 1MPAH 2VAAA 4WW2A 5MEQB 1RHHA 4JGJA 4U6YB 3PWVB 4FQQB 2A9NL 1GAFL 4O02H 3NCYS 4NJ9H 3LV3B 4M1CD 1OTSC 1UFUA 3UZEA 1BECA 2DQHH 3HB3C 3HC0B 1BZ9B 3O8XA 3N1GC 3GO1H 3DETD 1A4JB 1U8MB 3GUTB 3DRQB 1RQ5A 3CGTA 1L7TL 2BC4B 4JFQA 5DVMA 2YD8A 2ZUQC 2NPLX 2H32B 1JZ8A 1GGTA 4QCIB 2X4NA 3OKOA 1BEYL 1S3KH 3NIGF 3QG7H 5C0BD 2AJVL 4JQIH 5JMRA 3VXSE 5ID1B 4Y5XC 3RPKA 1OQXA 5HHMB 2VZSA 1H3PL 3QPQD 3RZCC 1XEDA 1AE6H 2R4RL 3I3DA 4XCFH 1E4WL 2RCSH 1N64L 2O5YL 5HYJD 3V0WH 3P4OA 3UAJC 4MDIB 1UH3A 2V2XA 4M9OA 3VWKC 5CEYB 5HHPA 1LMKA 4YDJA 3FT4A 1IE5A 4XPTL 1OVZA 5T33H 3VXPA 4WEUD 1L0XA 4ZG1A 3CFEB 4QGYA 4P2RA 1QLEL 4Y2DC 5DUMH 2FATL 3C87A 3KDMA 3EGSA 2A2QT 3ULVH 3DLQR 1U9KA 4IRZL 1MRDH 3ARDB 2R9HC 4L8CB 1QSFE 5EWIL 1IEAB 4FXKA 4MX7B 1MIML 3CX5J 2Z8SA 3L6FA 4KHXL 5I8KH 4MXWL 4YC2B 4I3GA 3UTQA 2O61B 5L2KB 5KTEL 1S5HA 3DXAB 5F9DC 3WUWG 2FEDC 1NLDL 1Q9KB 1GPOL 2QSVA 1CCZA 3O6KL 4UINL 4Y2DA 5TJWK 2E9JA 4LK4A 2OZ4A 1R6VA 4Y1AA 3G5ZB 1S9XA 3WE6B 3VGEA 1YEHL 5DUPH 1F42A 4ZD3L 4X6CE 5LGJB 1HZHH 2JCCA 1RUMH 4QRRE 3OGCB 1PZ5B 2E9BA 4PJCE 4G3YH 4X83A 3PABA 1W2KT 2FD6L 5FYJL 5CFHA 1M1SA 1IGFL 1EAPA 1FG9C 2GT9A 1OM3L 4DVRL 2BNRA 3MUY1 4YFEA 1JFQL 3VD4A 2DMCA 4GBXB 4UI2A 4XNYL 4PR5A 5BVPL 2IQAA 3L9RA 4NNYA 3GK8H 1P5VA 2BMKA 4EI5B 9CGTA 4OGXL 2QSCL 4NUGH 2FJGA 3RDTB 1U8MA 3GUTA 4LAJH 4QRSA 1LK2B 2XYCA 1YEGH 2CJUL 1FPTL 1KLUA 1EGJL 2E5EA 1JBJA 3GJEB 4WHYH 2HFGH 3L5HA 3UTSD 4UZGA 4M7ZC 1MJ7L 3ZYIA 1Q0YL 1CQKA 2EIDA 3KS0J 4WCYH 4Y4HA 2Q7YA 2VITB 2V7HB 3MRLA 1GZQA 3F8UB 3L7EA 4JO4L 4WNQB 2ICCA 1TNNA 5F9OH 4UT9H 1NCTA 3RWEB 4X0KB 3AS2A 5E5MA 5F21B 5IHUL 1XGQB 2Z31A 3HCVA 4RZCB 3U36B 5DUBA 3HE6C 1FNHA 4OZIE 2QQKH 5MENE 5KVDH 2XWJA 1EHAA 2VLJB 4MCYB 4ZXBD 2UZIH 4PJ7E 5CIPB 1UACH 2Q76A 4XNMB 3SJVD 2J5LC 2WINA 3BP6A 4LEOA 4XGZA 1I9EA 3D2UA 4LSRH 4JO4H 1FIGH 1EZVX 3B83A 2F54B 1TETL 5J6GA 3GMPA 4PJ5E 3CFCL 1ZA3B 5ICZB 5C70A 1DE4B 2Y1VA 4P9HL 3KDMB 3ZHLA 1QQDA 4LHUA 3QCTL 2NLJA 3KLHC 3BGMA 1TENA 1X44A 3BDXA 4U33A 2SEBA 4XP9H 1KCVH 2AI0H 4UTAL 2CMRH 5ITBH 1INQA 2MWCA 4LVEA 3SO5A 4EN3A 3JSSA 3P2TA 3RUGB 5ENWB 4PJBA 3VA6A 3DGGA 4S1SL 3HUJA 1DANU 2EDHA 1F13A 3EO0A 4KQ4L 5CZXD 4FFVC 3G6JA 1DEEA 4I2XB 2NYYD 4OT1L 1QYGL 3QCUL 4OKVA 2F53A 1GHFL 4CRPA 2ZSWB 4HJGB 3FQUA 2R0ZL 3MCKA 1J87A 1J0YA 4X5WA 5C0IA 5GHWH 2N7BA 2B5IB 3IFNL 4KROC 3DSFH 1QFWL 3MRIA 1BLNB 2EIZB 2OP4L 3DX6A 4PJ5D 4KMLB 5J8OA 2YD9A 1C7TA 3QEQB 4RSVA 3TA3C 3QCUH 4HIIA 3OF6A 1RZJC 5SWSD 5L2JA 2QSQA 3BWAB 3AXLA 4F2MA 2EEAA 4MD4B 5EU6A 3QIBA 2VZUA 1LEKB 2H2PC 1XGYH 2D4FA 2OZ4H 4GQ9L 4GBXC 3C6LD 4L29A 2UVEA 1FFQA 5IVNA 4XNXL 5F7EL 4PRBB 4Y19B 1TETH 4P9MH 4QF1A 4EI5A 2EYTB 5AUMB 4JFFD 2FJGB 2PTTA 3DO3A 5FK9B 3RDTA 4WENB 3PDDA 5LGHH 1HHIB 4FS0A 3V6BR 1M7DA 5HDQL 1H8OA 3RL1A 4ZTPL 3MZTA 5J13B 3ZLQC 5EBMA 2V7HA 3W0WD 1GZQB 1KEML 5E8DH 5C92A 5F6HJ 5F89B 4X0KA 1HINH 1P84J 2CRZA 3O41A 4PBWD 3G9AB 2FWOA 2ZUTA 2YKLL 4NO3B 3D69B 1KF9B 1XF3A 2UZXB 2CIKB 3PP3H 4S1DD 2F19L 2GY7B 2FB4L 2DQUH 5GGVH 3WIIL 4O2CA 5D5MA 4O5LL 5SX4H 3LCYA 2Q76B 4XNMA 4UT9L 5DK2B 2HLFD 2X70A 4BQ9A 5K9OA 3GHEH 4YHYC 4MAUH 4CMHB 4ZUWA 4ELMF 1CGUA 1JGEB 5EA0H 3TN0D 5HHME 1U58A 4Y5XA 1FV1A 4G43B 4G6ML 4S0TD 5D7LD 1H5BB 4JVWA 4UBDD 3RL2A 3S4SB 1FNAA 2WV3A 3AREB 5KSBF 2MCPL 5MENA 3TFKC 3DX8A 5E99L 1ED3A 1AR2A 3GSWA 4P9ML 1KN4L 2R2BB 1TQCC 2QHRH 4ORZC 4DJMA 1QZ1A 5FHAL 3LMJH 1X5KA 4YDKL 5E8OB 1PVHA 3DX7B 4ZQKB 5I8EA 4UV4H 2XFXB 2CUIA 1AQKH 4XBEL 4NO0A 3ZYOA 1NBYB 4YDIH 4ONOA 1G7JA 2XA8H 1TCRA 3GSVA 3W2DL 3K4DA 4JN1H 4V1DB 3CCHA 3HR6A 4NKDB 4UOW1 4FTVA 4ISVB 4YGVA 4JGUA 3SCMD 1VFAB 2YMXH 2CDFB 3G6DL 2JKXA 4YHNA 2K7PA 5D5MF 1OD9A 3VXRD 5L2JB 1JYXA 4WU7A 4PD4K 5HVGB 3VG9C 1T83C 4P4KC 3QIWA 3RVWD 5CBEB 1OAQH 5GRYA 1T4KB 3DTXA 3G08B 1P69B 4FN0A 4OF8A 2LABA 5D8JH 2WANA 4H25B 4KDTA 4XRCB 4Y19A 3IRZA 3BP5B 5FK9A 1KJMB 4GKZB 5E56A 3M45A 3IDIB 4OI9A 1KIQB 4LMQE 1M7DB 1JNLH 2HT2D 2AABL 2HG5A 4AG4H 2H1PH 2APBA 2ARWA 2BY2A 3NCJL 3HLAA 3MV7B 4NP4H 5E1HB 3WD5H 4NQDE 3MACH 5IOPB 1N3NA 5IVXE 2D31A 3FN0H 3QAZC 4GW5A 1W72L 5A2JH 3S35X 3T1WA 4M6MH 3CK0H 3QJFA 4DW2H 2UWEE 1E4KC 4KHTH 2XXCB 4NN6B 1M05A 3ZTNL 2CRMA 3DV4A 5F7HA 1LP9F 4X9FA 2BJML 5IF0B 5FOBA 4J3UA 1U3JA 4PG9A 3TCLB 4GAGH 2QL1A 4HAGA 1GH7A 3E0GA 4NDMB 3JTTA 2MHAA 5EZOL 3IETA 2H3NB 1ZHLB 3C60A 4M6ML 4H88L 3C6LB 4XZUB 2AKRB 3PQYB 5IGXH 1IBGL 5EC2A 5T1LD 1U3HA 3U30B 1PGRB 1AY1H 3DX8B 3G6JF 5GIRB 4PRPA 3QNZB 1AGCB 4JHBA 1QFOA 3GSWB 3BZ4B 5IVOA 3KHOA 4HS8L 5F7DA 3WBDA 1FAKT 1T04B 1EVUA 4QY8B 1MPAL 1K8DA 5D2NE 2A6JB 2G60L 2NW2B 1A7RL 1MI5A 4PJHF 1U0QA 4U1SA 5IKCA 4L4TE 5BV7C 1MY7A 3K4ZA 4J4PD 3NTCL 5HHXL 5C08E 4CW1B 2WLZA 4X4YA 3ARFA 4G6KL 1R5VB 3EJYD 3U1SH 4P2OA 3BZFB 3HHRB 2J1KA 3MRPA 3X13B 5C8JB 5E08H 2BVTA 4HUKB 3O6FB 1HDMB 3VRLE 2ARJB 3NPSB 3WLBA 1QPPA 2CUHA 4I13B 1P6AB 1A7RH 1KTDB 4I2XE 1KCSH 2FR4B 1OAZH 1U93B 4POZC 4ALAH 1CXFA 2BOBA 1V05A 3TH2T 5EU7C 1T2QL 2GJZB 5E4EB 1VFMA 3I6KB 3OWEA 1JWUB 4K3JL 1J7VR 3FFCB 3DTXB 3GSNA 1LD9A 5HI5C 4YDKH 4H25A 3QUXA 4KHXH 1T22A 1P7KA 4XCNB 5DTFB 2A73A 2OCFD 3LKPA 4H88H 3DMMB 2COQA 3V8CA 1IEBB 4MDJA 4W6YB 2J6EH 4WDIA 5FGRA 3CDYA 2G5BB 4LSPH 1N6QL 1UB6A 4L4VA 3RHWF 3L1OL 5DD6A 3FOMA 5I74C 3VDAA 3K2MC 4EUPA 3QIUD 2EO9A 1JZ2A 4RRPG 2LAGB 1T3FB 3OKLA 4ZFFA 2W0LA 4ZYKB 3ZTNH 4MQ7A 3KLAA 4J3WA 5IB5A 1JV5B 3LKRA 4WIQA 1JZ5A 4K8RH 2GJ6A 5ILTL 1ZE3C 4JM2D 2DBLH 5EPMA 4U2ZA 3JV0A 4XCFL 3BIAX 3FN0L 4M9PA 3ZDYF 5I1HL 5EU7E 1WBZA 4EXKA 5I16B 5IBLD 1RZKH 1LO3H 3AB0C 3V79C 1KPUA 4PFEA 3HNSH 2E7HA 3KPQA 1MCQA 3UTTD 4L4VE 4YEFA 4YEEA 3WS3A 3RPIA 2BSTA 4MJ6A 5DEFA 3OB0H 5D1XA 3PQYA 1I9JH 2AKRA 3CIQA 1K2DB 2E8YA 2X4TB 3IXAA 3MRDB 4NJAL 2DAVA 1PW3A 4Z7QF 5HI3D 1AGCA 4LEXH 1E28A 4MXVE 1SEQH 1BBDH 4DQOL 2CRIA 1S7XA 5SWZB 3GSRA 1YYLH 1A14L 3VFTA 5GSRA 4L1HA 5CILL 2R23A 2VQ1B 3W0WB 3C9NB 1FO0A 3QHFL 3BKJL 5JW4N 1YEHH 2VXTH 5H37H 2VLMD 5FCUH 3V5KB 1LP9B 4R96A 1DUZA 1IC5L 3G5XB 4L8DB 1JNHA 3K7UA 3S4SG 4NKMB 1I3RA 1DZBA 1OPGH 4CN4A 5ERWB 2FHCA 3WMSA 3MXWH 3T3MF 4NGHL 3UXFA 3EFDL 4P3DA 5DS8A 5JQ6L 1FNGA 4YXLL 4R97B 2QQLH 1OOAA 5HPMB 1NCCL 1SY6A 1U8JA 2QJDA 5TQ0H 3T0DA 3LZFL 2KKQA 4LARL 5DK0B 3QQ3B 5F6IC 5ADPL 4E42B 1JWUA 1C1EH 4HK3N 5IB3A 3CXDL 1KCRH 1QYGH 3GKWH 4I0KA 3ULUC 4QWWD 3R0NA 3VE0A 1QLEH 4QXGH 5DTFA 1A3QA 4D8PA 3NZ8B 1AY1L 1MFBL 5D7IA 3S8WA 4EDXB 4ORGA 3RGHA 1JP5A 4HFWA 4OIIL 3BPOB 3KPTA 5FUZH 3WJLC 3BVNB 3M1BB 3HE6A 2W65A 3ARPA 3BISA 3BN9C 5JPMB 1YMHA 1R3JB 4Z76B 5FCSH 1FIGL 2DBLL 4XPFH 3TA3B 1K85A 2V5SA 4OM1L 4G6FD 4KJQD 4ZFGH 1U8QA 5J4MA 1I9IL 1NUNB 5HYQA 5DD1H 1I1RA 1XGTA 4FQXC 4LGSB 4PJHA 3U82B 1BD2D 3IAPA 5HYSB 4N0UB 1OL0A 1WJ3A 4TUOB 5IHZB 1R3HB 2AJUH 3BJ91 3EO1B 1NBQA 4N8VG 4Z5RA 1GC1H 1KT2B 2QHLA 4NQEE 5IWLC 3WS3B 1MIEL 4WWKD 3BPNB 4GRMB 5D6CB 4DKEH 2V5MA 4NC1C 4DKFL 3MV8A 3OKDA 4NKQB 5IK3A 3W11D 3HFML 3TVMA 3IXAB 2G9HA 2P8PA 3MJ9A 1O5DT 2ZOLA 4WEMB 1MFDH 4U1HA 4ZPTA 5CJ5A 1U91B 5FUZL 3AS1A 1S7XB 3WN5A 3PE9A 2Q8AH 4N0CD 4PLNC 2KL6A 3SDXA 3RTQB 4GW1A 4IIQA 4KY1L 5T3XD 1AO7A 4Q6YA 4U3HA 4JAMA 4YNYA 1LP9A 4Y8DC 5JXEC 1IGIH 4R96B 4U6XB 2E9WA 1R5WB 2OQJA 2QADB 4R7DA 5GXBB 5CJOL 2ATPA 3IJHB 1D6VH 1OARL 5HDOA 2ADJA 1DQLL 5FDYA 2Y23A 5JOFA 4RMTA 3R1GL 3ZL4H 1EEYB 1A3RL 2MSPA 1J8HB 4LSDA 3QXDB 5HPMA 3VFRA 2I60H 4OCRL 5IW3A 3B5TA 1Q38A 3TLRA 3ZKNC 1KJ3L 1VGEH 3KWWB 1UWXK 4M7JL 2V6HA 4E42A 2BVOB 1U8IA 2OX5A 5DMIL 3RTQD 5KSVA 1JPTH 5DZLA 2ATKB 3SGEI 4OUUA 1UXSA 3BEVA 3H3PL 3ULUD 3TNMB 2AK4D 4KVCL 3VFSB 2DM3A 4X99B 1N4XL 5CEXA 2Y06H 5ALCL 2GUOA 1WK0A 3HMXA 3WKMH 4CU7A 4EVNA 3CLFH 3MRBA 3S3JA 4NRYB 1FIEA 3WIFA 3WDJA 2CKBB 4MLSA 3IFLL 2GK0A 3QEGH 3VI4F 3QCVL 4MA3B 5M95B 5JPMA 1TPXB 3U9UB 2JB6B 4X6EB 2Y4SA 4YDVB 4HIHA 4JFDE 1MWAH 3T0EC 1FVDB 1CDIA 1SJVA 4AEFA 3MO1A 2F19H 5JO5B 2IGFL 2BVPB 1QSEE 3BYYA 2W0FB 4RMWA 1AGFA 4PLJC 3KYOA 1JZ4A 2P24B 3MACL 3HMWH 1YYMH 3V6ZA 4KU1A 3P4NB 3B9KC 3W9EA 2ENYA 3MRFA 4LF3A 4XNUH 5GSVA 1N8ZA 5IEHB 3B5GA 4YHOL 3MV8B 3OKDB 5IK3B 2VLJD 3TVMB 3CH1B 2X4PA 5BV7B 5DJ8A 3O4LB 4E5XB 5I1DA 5DQDH 5ISZE 1CU4H 3F7RA 3LKNA 1DN2A 1NMAH 4UQ3B 1BOGB 3H9SB 3DVGB 1YEEL 4MMZC 1LEIB 2GFBB 2Y7QB 5ALBH 1BFVL 3HC3L 4U31A 3CLFL 3LN5B 4LPCA 3BIKB 4NOBA 1ZMYA 4I48B 4I8DA 1NFIA 1T66D 2VDNH 1BHGA 2C3WA 4HV8A 4PJDE 4HUUA 4P9HC 1RV6X 1EH9A 2EC8A 3VRLF 3SO3B 1U3YA 3ZE1E 2X05A 1CZ8L 2PXYB 2APFA 2IFFL 1IC1A 2AXFB 1A6ZA 4E41A 1A9BA 3GSXA 5ACZB 4XMPL 4PRAB 4K7PX 4QRPA 3EJYC 5DO2D 5EBGA 5IB1B 1EJ6A 3LEYL 4M7JH 1IKFH 2F8OA 3KWWA 1FBIL 3QFDB 1IGCH 3CFBA 2Z0BA 4HFUH 3WEXA 5IHLB 3IFNH 3R1GH 3ZL4L 5EN2B 4DGYL 1GGBH 35C8L 1MCCA 3GMOB 2MPAL 1FVEA 1XCQA 2ADGB 2VXUH 1QOKA 4G8IA 3U4BH 2D7OA 3KPNB 3LEVL 4FNLL 4YHIB 3GMLB 4UTAH 3L3IB 3BZDA 1IGIL 4K7FA 3UJTH 3A0OA 4QRPE 3BP4B 5AYUL 4EVNB 3T77A 5TE6H 2VE6A 4N9GB 3ILPB 3LS4L 1KCVL 3MYZA 1KNOB 5ID0B 2YC1B 5GRJL 3HFMH 4PJFF 2NZ9C 2FHFA 4WFFD 4DKEL 1UH2A 1ZEAH 3TJHC 4JO3L 1OGAB 4KJYA 5IR1B 4J1UA 5TDPB 1FFOA 3SOBL 4ETQA 1SEBA 4K94C 2DKMA 4KI5E 4IRJA 2O93L 3O2VH 3KYOB 1PJ9A 5E8DL 2P24A 3HUJF 5DVOA 4OLUL 1DLFH 4YHKL 4PS4H 2APXA 3X12A 3UAJD 1RVFH 2F15A 5DXWA 1T5WA 1BVLB 1FFNA 1AGEA 3GHBL 4NO5A 5TPWH 2GW5A 4XBPA 3LN4B 2VLKE 5DHVB 4GAYA 4NQVA 3O0RH 4MSWB 3TYFB 2OR8A 4LDOB 3V5DA 3NMEA 2A77H 2XN9D 3BH9A 3HC4L 4GQ9H 4LIQE 4PJDA 4PP1D 1D5XB 2IADA 1FH5H 1FJ1A 3GJFK 2P7TA 4GRLC 4OCMC 8CGTA 4PV8B 1YMMD 5C07E 3BSZL 3JWDC 2DQEL 3FONA 2X4NB 3OKOB 5C08A 3IGAB 3WFDL 2XG5A 2DL2A 3MX0A 4JZOA 1ES0A 1NSNL 2JIXB 5C09B 5MEPA 1LE5A 3EFDH 4D9QD 5ID1A 4KDVA 2A6DA 1LO4L 2A83B 4HFUL 3WHXA 3ARDD 1NCCH 1S7WA 1PKQB 2B1HL 1G1CA 1QFPA 3BPOC 2IAMB 1C08A 4M7LH 2OI9C 2VXTL 3QSKB 2FYYB 2H8PB 2NY0D 2YD6A 4M3KB 5HHPB 3DO7B 1C8PA 1OSPH 4MS8C 1YYLL 3ARYA 4L8BB 1Q9LA 5A2KH 5D72L 4Y19E 4NSKB 4RRPA 1HIML 5TDNA 1D5BB 4K94H 5F9JA 2VE6B 2OR7A 1P6FA 3DVNB 5EWIH 4BZ1L 4NQEA 3MRNA 5IMMA 4RNRB 1AGDA 12E8H 5IB2A 4KV5E 5I1JH 3MFGB 4P59L 5JMOC 4LLDB 4Y16A 1NMAL 1AO7E 4ELKB 4BZYA 2BHUA 4P4KA 5IFJA 1YNKL 1E4WH 2RCSL 2VL5B 4X8JB 2VC2L 1OTTD 2BCKA 3QUYB 3IU3B 2K1MA 5CUSH 3BKYH 4Z6AT 3C08L 1NLBH 1OCWH 4DGIH 3MROB 5EUKA 2DLHA 4XVTH 1RVFL 4CAGA 4O5LH 3VXNA 3OXSA 1RUPH 4JO1L 1S9XB 2E6QA 1QNZH 4UTBL 4FABL 2M2DA 5FYJD 4DVBA 1X4YA 3QDME 1UT9A 1YY8B 2XA3A 1N6QH 2QSCH 4OGAD 4FQ2L 2VLKD 5IIEA 5JXEA 1W0WA 5FUOL 4LLUA 5DRWA 3V0AC 4HMDA 4KKBD 12E8L 4FP8L 3LS5L 2GYSA 3QEQD 2WZPD 4QEGA 4YZFF 2IMMA 3W82A 1BZ7B 4PR5B 3VWKA 4Y4FA 3VI4E 5HYJA 5J1AB 3M17A 5CGTA 2X40A 2OL3H 2P7TB 4YWGL 2ZSVA 1IMHC 4PRID 2LV4A 4PGCA 5FGSA 3WHE1 3O8XB 5INCB 3GJEA 1YN7B 1G9EA 3UJIL 5JDJA 3CFIC 3RX7A 2R1XB 2DWDA 4Y4HB 3MR9B 1BFSA 3RWFB 4WNQA 4K2UH 4JFHD 2VJXA 3F58H 1T89C 1UG9A 4L3AA 3OKNA 1A7QH 3IT8D 4UT6L 1NCNA 2R29H 4JEGB 4LOUC 5DUBB 4ZUSA 5JPNA 3BW9A 2JE8A 3FCTA 4H26A 3HZKA 5CJXC 5C0AB 3MV9A 1CXLA 3DV6B 4JFPA 4L5FL 4F7PB 3RBSA 3SDDD 3FO0L 1YA5A 4WI3A 1NAML 5FEBA 4IHOB 4OQ1A 3PP3K 5E8EB 4EUPH 1S8DB 1GGCL 1RZFL 1CTOA 4OBSA 3LKQA 2C4FU 4JRXB 1BX2A 3GSQA 4QHUB 4WW2F 5F9JB 5E4IA 1HEZA 1S5IL 4MJIB 4RAHA 4CVXB 5TGBB 3PL6D 1TQBB 1F8TH 3T0EA 3OBAA 2JIXD 3BN9D 5C09D 5GRUH 5T3XH 3SE8L 5C9KA 2Z35A 3MJ8A 3FB6A 2XZAH 4MX7A 4ELKA 3O11A 4OF3A 4PJBB 4QTIH 4ZAKB 4APQD 2QADD 4O9HH 3FFCD 5L2KA 3H9HB 3G6AB 1FZMB 1V7NL 4BKLB 3LQZB 5C6TL 4WFFE 3O45A 5KSUB 1U36A 1B0WA 5HTSA 4HIEA 2Q8BH 2JLLA 2C7UB 1JI2A 1RZ7L 3ZDZF 4FQ1L 4PB0L 2YD7A 2HJKA 2MMXA 5JW3L 3QUYC 3RRQA 5GGQL 1FNFA 2ED7A 5I1CL 3O3BB 1NCBL 1B6UA 1CICC 4IM8A 5EBWB 5GGSA 1QA9A 3FHQA 2BY3A 3OG4B 2YWYA 5LGJA 2PYEA 1ZEAL 3GMRA 2MKLC 2HFGL 4X5LA 3OGCA 2IGFH 1CLZL 5DVLA 4H0GA 2J88H 2D7PA 3P11L 1DANT 4I18B 4S11A 3S35L 5FA4B 4MD4A 2J6EA 4AH2B 2DWEA 4IRSA 3TN0B 3UTPD 2YSSB 3PIQA 1CGWA 4NQXA 4U7MA 5J1AA 5D8JL 3EJJX 2YUVA 3KLDA 4X7TB 1CICB 4QF1B 1P7HL 3DHMA 2XOTA 1OY3B 4LGRB 3Q1SL 5TFSH 5BXFA 1EUUA 2P5EB 3D2UD 4ZOCA 1RU9H 4POUB 5DD3L 1JFQH 4F3FA 5EBMB 3MNWA 4LLQA 5CD5C 5EZIH 1HHKA 4HG4K 3MTRA 1JUFA 2UY7A 4JREB 1YECL 4UNTA 4N90E 1DQMH 5J0BA 4HQQL 1G7IB 4ZOEA 5JPNB 1CWVA 3MLXL 4RZCA 1LQSR 1G0DA 1NGQH 3HG1D 5C0AA 1BIHA 4LCYA 4NZTL 5D5MB 5T1KB 5HGAB 4APQB 5ABDE 3CDGA 4DUWA 3OJDA 1OAKH 2VR4A 4LEOB 3QDJE 5EUOE 4KK9D 4U1MA 4XVUD 5DHYA 4KI5F 3DMMC 4WW1B 1L9NA 1Z9SA 2AW2A 4UOW0 2X1OA 2ZCKH 3MLYH 1DE4A 1AR1C 5EOTA 4LRNH 2P5WB 4F8QA 1GGUA 1RIVH 2BOCA 5ANMA 1QSED 4JDTL 1TITA 2W92A 2AERT 1T21A 1K8IB 4ELMB 1I7ZB 5FUOH 2C3VA 2FSEB 4ZUUA 2YPVL 1A7NH 2APWA 1T66C 2EC9T 3MRKA 3BD3A 4XBGA 2DMKA 4HS6A 3TBTA 2DQCH 4H5SB 2WIIB 1OAUH 2ZSWA 3TJEL 1BWMA 3CFDA 1CDYA 3PP4H 4FQHA 4MAUL 3O2DH 5MHSE 4X6DA 3MA9H 1F3RB 3SDYH 4JFFA 3HAEG 4XP5L 4YQXH 1UZ6E 1UA6L 1BLNA 2EIZA 1F4XH 2EE2A 5DMJB 5EBWA 1JPSH 3SJVB 4P5TB 3ZKQD 1KEMH 1Q72L 3ARFC 3U7YL 3DWTA 5D1ZC 4PJIA 4PY8I 1FGNL 3DBXA 5CSZB 5EFIB 3MRCA 4WU7B 3VFPB 4LQFL 5I75B 4KKAC 4JM2C 4Z7VF 4MNGB 1KUMA 1IFHL 1P5UA 5I8OH 2X4QB 4NNXB 2OSLA 2VABA 4GLRH 4GG6F 2NTFB 3KGRA 2IBGA 4X9BA 3SE9H 3KPLA 1F4WL 4RA0C 4XX1E 2Y06L 4JY4A 4LHJB 3RWIA 3JWOL 5DI8A 1VACB 4ZAKD 4KPHH 5BXFB 1RMFL 1OSPL 3Q0HA 4YHYB 4ODUA 1SVZA 2VLLB 4JPKH 2JF1A 3SDXF 2WK2A 3MNWB 5BZWB 2B0SL 2J8UB 3ILQD 4NC0B 4GRWB 1MCEA 5D7LA 4LCIL 3QJFB 1KEGH 1DQQB 1KCRL 3D18B 4I0PA 2B7DT 2CIKA 4KRPC 2Q6WB 5IMKB 3U6RA 3R06A 1KIUA 2DQDH 4WVRA 4OT1H 2Z93A 3E6HB 4OFVA 1NGXB 4S1QH 4JGMA 3KPSE 2BK8A 5A1AA 4HK3J 4AIZA 2IPKB 4IBLT 2WWMD 1KEGL 3S5LB 1BVKB 2V7NA 5LWYH 1FV1B 1XGPB 4HPYL 1T2JA 1RMFH 3PNWB 2CR3A 5C0AE 1PYWA 5CD3A 3AREA 3DIFA 5MENB 2VAAB 4WW2B 3LKOB 5TH2B 5MEQA 3U0TA 32C2A 3V6FA 3PGFH 3PDGA 4WO4B 1I7ZA 1GC1C 3C8DA 5E2TH 5F7DB 2EYRB 4GG8A 1YN6B 1S78D 1FDLL 1KELH 4U1JA 3OL2A 5FAAA 3TPUB 1IGYB 3RVTD 1FSKB 4TUJA 1IGMH 3QIWD 4MNHB 3SHSA 4R3SA 1A4JA 4I4WB 1FVCA 1MLBB 4NM8L 4GAGL 4KROD 4JFOA 4M7ZB 1TMCB 1FNLA 3W5NA 4P5TC 4LCCB 2XPGB 3SGKA 2NXZD 1DBJL 3MRPB 1FGNH 4C4KT 1JF1B 4KJWC 5AAWA 3R8QA 5C0CB 2AK1L 2VMFA 3VCLA 2ZUQB 1ADQA 2CSPA 3ARGD 4U1LA 3IXTA 4K8RL 3O2DA 4AQ1B 3WFCL 5IMOA 3IRPX 1L4IA 3H3BC 5DJCA 1FORH 2OR9L 4GXUN 4JG1L 2EE6A 3QWOA 4HUNB 5DI8B 2Y36L 5EIIB 1I1YB 1DQTA 3GK8L 3EYQC 3BDYH 2CH8A 4YHMH 4UIMA 1U8OA 2VDMH 4JDTH 1HQRA 1MCRA 4W4OA 2BERA 2HAZA 2PTVA 4N8VA 4PJ5B 1KLFA 1IAOB 4G80B 1BIIB 4LRNL 4Y4KD 3QQ4A 3TEUA 1IGFH 5DJYA 5F9WB 2KPNA 3H3KA 3G6DH 4FZEH 2DJSA 3CDFA 2R0LH 2VXSL 5I17B 1FN4A 2VKXA 2YR3A 3KLAB 1LK3L 2R29L 2QR0A 2XWBA 2GAZB 1ULVA 3IAQA 3HI1A 1FRGH 4FQCL 2IG2L 3DV4B 1GOGA 3GSUB 2WUCH 1KJ3H 1KPUB 4WFHD 2XZCL 4MWFB 3OB0K 4DEPC 2MHAB 2EE3A 1I1FB 2AJYL 4UV4L 3UTSB 1AD0B 1K2DA 1KN4H 3HC3H 4U6HB 4DQOH 5CD3B 5MP6L 5D71H 3PABB 5FHAH 5DGRA 2WBJB 4WO4A 4NJAH 5DMYA 5D7JB 1RU9L 4HLZH 1OD7A 2EYRA 3K1DA 1MAKA 1BBJB 3O4LD 4HGWA 4XPGL 4JZNA 3L3KB 1FORL 2NY4D 3M8OH 1IVLA 2B2XH 2NY7H 2R8SL 5KSAA 2R23B 2VQ1A 5CEZL 1K8DB 1HYSD 3EYUH 2DLGA 3F7YA 1MLBA 4QRSB 1MCPH 3G5XA 1KLUB 4MB5A 1TLKA 1ZVSA 3PF2A 4OFYA 4RMUA 1FO0L 4LPTA 3KPRB 3GRWA 1EO8H 5F44A 4K3HA 1IT9H 3S97C 2VDLH 3QXAB 3L7EB 3QUMB 1EHXA 2JK5A 1P9MA 4TPRH 3CMGA 4RFNC 2XRAH 4LKCA 3MREB 1NFKA 2V5RA 4U0QB 1JRHI 4ZXBB 2D9QB 3U36A 5C0BE 5E8NA 3T4AB 4MXQD 3FQXB 3QIUA 3ZE1F 4LCUB 5ESQA 2OK0H 4JKLA 4S1DC 3HNVL 3QULB 3GSNB 2VZTA 3D2UB 1W72H 3VXME 4D9RE 1P7KB 1NDGA 1NGPH 5BQ7B 3T3PF 4D94A 4PRHA 5FM5O 4K23H 2H1PL 1MWAB 2OTPA 1QO3B 5DFVC 3C5ZA 3EYSH 3EJZC 1HQRB 2NY2D 1X5ZA 5ETUA 1QRNE 1FG2A 4KXZI 1IQDB 4PGEA 4NRXA 1S7UB 2WMPA 4XPAL 2GQHA 5DJYB 5J11B 2PO6D 3EO9H 1YEJH 4HJ0D 1FC1A 5CJXA 2ZNXA 3RKPA 4N68A 3DRTB 4JHZA 1YEIH 1ZK9A 4PJAB 4C55A 1HSAB 5LWYL 1ZT4B 1L0YA 2OJZL 2YPLE 3NVQA 3ZSSA 4MQ7B 1U8QB 5F9AC 2J3SA 3LKRB 5BV7H 4LMQI 4X8XA 4BA8A 5B38A 5EPMB 4S1RL 4OQTL 4OCYL 4YXKL 1YEFH 4X5WB 3P4MA 2P45B 1TVBA 3G5YB 5D96B 2D0FA 2QQLL 3MBED 4P4RA 5I18H 15C8L 3ZDYE 2AQ1A 1HN1A 3U4EB 4QRRA 4G9DB 2VO5A 3C09C 5DHXB 3KR3L 3HRPA 1VKXB 2EH7H 4X7SH 1ZGLB 4KY1H 1KIPB 2BNRD 3T1FB 1BPVA 3TM6A 4DEPB 1CD9B 4I9WD 5FF6B 3LPFA 2C1OB 2ZOLB 4NN6C 4TUKH 4XP9L 4XBEH 1DBMH 4ZPTB 5F1SA 2PXYC 4KTDH 1HHJB 2EDBA 2R0KH 4UV7H 4E0RB 1LEKA 1WSST 2X6MA 3ULVE 5FM8A 2L7UA 2QHRL 3BYTA 5GRXG 4GW1B 2N7AA 2GCYA 4P46A 3CFKB 3DURB 2D7MA 5GPRA 4HIJB 4K23L 3PHSA 4RGMC 3DSNA 4Y4HD 3HAEH 1JHTA 4X4XA 3DX9A 1ZVSB 2AGJH 2CR6A 4XTRC 4P2YA 1T7ZA 4HH8A 1BAFH 4I1NB 4NKMA 4EBQH 3UYRL 4ENED 5DWUL 3REVB 5GS0H 3VH8B 1UZ8A 4H20L 3CFJA 3O41B 3QFJA 3A6OA 1TVHA 2D7TL 3MJ7B 4ZXBA 4RISL 1JHLH 4NO3A 1XF1A 2EH8L 3ZTJG 1U2CA 1QSEB 3IFPA 4Z7VB 3BAEL 3FT2A 5DMGC 1Z3GH 1QFUH 2W07A 1QEWA 3RI5F 3QQNA 1D5IL 3GRWH 1BOYA 3U0PA 4F7EA 2Z91A 5HI4C 1NAMA 2H6PA 2CDEB 4D0DA 2ADIB 1Z9LA 2APVA 2FZ3B 4LHUD 5AAMA 4AJ0A 4D8PB 4CGTA 3NCMA 3NCCB 1I3VA 4UU9A 4H1LB 3OKKB 4BZ1H 2AAVA 4ORGB 5F3BA 1ZTXL 3EYFB 3SKMB 2AK4E 1WC7B 1DR9A 3M1BA 5GZNC 1D9KB 4UT7L 2H9GB 3BGFB 1UM5H 2NY1B 3MBXL 2PR4L 4G3YL 3SGKC 3N85L 5FYKH 1CXKA 5IVXA 1T89A 5C0NC 1DN0B 3MCG1 3H9ZA 2ICWJ 3MO1B 4J3XA 4ODSL 2Z92B 3TWCL 1DL7H 2BVPA 1Y18A 4U1IB 4G9FA 3LPWA 1NBYA 1DQDL 4NM4L 4C56D 1A6WL 3F58L 4KI1A 3STLB 1U92A 2B1HH 4YBLC 2I60L 4OCRH 3P4NA 4RA3A 2P47B 4G9DA 1PG7H 2EDRA 4FA8A 3BH8B 1RI8A 1PG7X 3R8BB 2I9LB 2DQJH 4G6KH 2X4PB 1KLGA 2NQCA 5F7LB 3INUL 3EJZD 2C1OA 5GS0D 4PLJD 2AJ3B 2DQGH 1ORSA 1UKTA 3AMKA 3GB7A 4X6FA 4YHML 3V9FA 1WZ1L 1CFVH 2X9YA 1T4KA 2H32H 3B2VH 1F6LL 4DN4L 5JTWA 3SDCD 1OP9A 4XRCA 1FAIH 3FFDA 3RTQA 4OLVH 2HLAA 4TOYH 4XNZB 2HT4C 4PLKC 3VFWB 3VFUB 2Y6SC 4L8SC 4HUWB 5L2KE 2V9RA 4UQ2A 1VEPA 1W0VA 4I0PC 4YBHA 2A77L 1YMME 4HGKC 4HEME 3REVA 3OKMA 5CBAA 2HKFL 1WT5C 3D0LB 4RISH 4DKFH 1EEYA 1B4JL 3QXWA 4LASL 4LBEB 1UWXH 1QFUL 4MNQE 3WIIH 3UPCA 5HPOA 2QQKL 4RMQA 3MNVB 2P42B 1FNEB 2DL9A 3VGGA 4J8RB 4IRSC 3BUYA 3D1MC 3ET9F 4QHLA 3UTPE 4W6WB 1YNTB 4FQXA 4TVPE 1I9IH 1PQZA 2YPLD 1GGIL 1MF2H 1UJTA 2HA1A 1RK1B 5DQ9B 3NIGE 1FYTE 5LQBL 3UTZA 4GKNA 2WBJD 5C6TH 4I3SH 4K7FB 1NFDF 3FMGL 1HI6B 4IDLA 2OM5A 3QNYB 1JPFB 5CEXB 3UC0H 1RZJH 5DJXA 4EUPG 2D3VA 3DOSA 3OAZK 4ZFOB 3MGOB 4X4ME 3HPJA 1LE9B 5TE4L 3SE8H 3SKMA 3RWGB 4HZLA 1D9KA 1CFSA 2GK0B 3RWJB 3KYMA 2VOTA 3A67L 4JFHE 2R0KL 3GEWB 2ZOKA 4G9FE 4TQEL 3KS0H 3WL9B 1JJUA 4J4PC 4G8GA 3X3GH 1J1PH 1RZFH 4MMXC 1KV3A 1R5IB 1U8PB 2YRZA 3LQAH 4F9PC 2C3HA 4OZIB 1HHGA 2FJHA 5FA3B 1QG3A 4OKDA 4X4YB 1IGTA 3DI3B 4GKSB 4XB7A 1R5VA 3C2SA 1XH3A 4OZHF 1U8KA 4C4KO 3X12B 2IFFH 4A2LA 3RNQB 3MLSL 3IJYB 1HDMA 1UWGH 3RAJH 2I9LA 4JRYD 4JRXE 5D7JD 4XNQA 1IC7H 2YD1A 1TQBC 4Q2ZA 1V5JA 3H7BA 3CDCA 1DVFD 4WUUE 2E6JA 5HSFA 2AJ3A 2OJZH 3QH3A 2HJFA 1SJXA 3LKNB 3RP1A 1MVUA 4YWGH 4BQ8A 5CZVH 3N85H 2ZG3A 3E2HC 2W9LA 2Y7QA 2CMRL 5DMKA 5I8CB 5IMLA 1PX3A 2HLAB 1VGKA 4XCNA 3B9AA 5GJTL 5IT2H 1BFVH 1MCOH 1WITA 1J0KA 3MQIA 4IOIA 4NN7B 4OD3L 3BHBA 4R90H 2PETA 4NT6A 1EEZB 1JGUH 4RWHA 3RIAF 1IQWH 2IPUG 1A6ZB 4E41B 2F58H 5K9JL 2CK2A 1C7SA 1T1XA 1OTTC 4HMCA 3WHXB 1S9KC 2KBGA 4FFWC 2IALA 1XF4A 3GHEL 4OBRA 1X4ZA 3ZE2F 1IKNC 3B6SA 1S7WB 1F90H 3QP3A 3TBYA 3MNVA 3DVFA 5I1LA 5B4MD 2AEQH 1NBZA 5JZ7D 3T0XA 4NP4L 2IAMA 4Y5VB 4YQXL 5I1AB 3IVKA 4JANA 3V8OA 5J9PA 1XCTA 2EYSA 4LLYB 2HTLC 4CVZB 5DVNA 4X6BA 3VWJD 1CT8B 3C6LC 2FHBA 4KRPB 3VI3F 4IRJD 5DLML 5F1IB 3GMLA 2BSTB 2B2XL 4MJ6B 5DEFB 1NL0L 5HGBB 3MODH 2FJFB 3DVNA 3E3QC 4MA1B 1A1MA 1X6LA 4NQEB 5E2WL 4KVCH 3MV9E 4EQ3A 1Q94B 4L8CA 3VFNA 2V17L 1MI5D 4XMLL 1C1EL 2EO1A 4GO6B 1AXTL 3GSRB 2WP3T 5HHQB 1WZ1H 2EXWC 2O61A 1K4CA 3C9NA 5KN5B 5C07D 3KPOB 4HKXA 4CMMA 3ZE2E 2XICA 3DXAA 1R5IA 2NY6D 2GI7A 1QBLH 1SM3H 1GPOH 1T7XA 3MRGA 4WI2A 1C12A 2HFTA 3O6MH 2L7JA 4EIGB 1G9ML 4JKMA 5I18L 1NLDH 1I3GL 3KXFB 4BSJA 5T3ZE 2VR5A 4PJXE 4O58H 4XMKH 2KDGA 1SYSB 4DFIA 1AGEB 2CXGA 4KV5F 5EU5A 4Q0XL 4GAYB 1WWBX 4MSWA 3RWCB 4ODVL 1K3ZA 5CP3A 43C9A 2ZJSH 5D2LB 4JRXD 3Q1SH 4JRYE 5TFSL 1MIMH 5J57B 1FH5L 1CDBA 4JZJA 4MJ4A 3VE0B 1TTUA 1MRDL 3WFEH 5EU3A 2IQAB 2VDML 2CLVB 1BM3H 2BRRH 2VSDA 2X44D 2HN7A 3PHQB 4PLKD 3G5VB 1HKLH 3KXFD 1M6OB 4JHAH 4PGDA 5EU4B 4P48A 3HC4H 4QHKI 1YNLH 1Q1JH 1CS6A 2OR9H 3VXOB 5E7BA 4QT5B 1CFTB 3B9VA 4AEIL 3RWFA 5BOZG 5FO7B 2I07A 2EXYD 5FYJU 1KTKE 1MHHB 5T3ZH 3S3PA 2BSRB 3GHBH 1T6WA 4Z7UE 1GZPA 3CUPA 2NXZB 1IAMA 5C0EA 3S98A 1E27B 3HZMB 1L7IH 3BW9B 3FCTB 2WWMC 5JHDD 2AJVH 4BYHA 1Z3GL 1H3GA 5D70L 3VFVA 3O6FD 5ICYB 1NBZB 5IJVA 4PJHB 4TNWF 3V7MA 4AY0A 1X7QB 1YPZE 3LN9A 5E7FA 1G7MB 3FT3A 3B9KD 3X11A 4FQ1H 4PB0H 1J18A 4L9LA 2H8PA 2HYMA 4OZHA 1QLRB 1KT2A 2B20A 4ZFGL 1FHGA 5HDBF 4GRMA 5D6CA 3GSQB 1Q9LB 4QHUA 3NN8A 1B6DA 2FJFA 4HBQA 3KYKH 5CMAA 4TTDC 4NJ9L 2G9HB 1UB5B 4MJ2A 4XVSL 2ZUUA 3PWUB 4RNRA 2N56A 4U4BA 3MRHA 4F7TA 1OT1A 4OGXH 4XC3L 3VJ6A 4ZO9A 3EHBD 4IRJC 3WN5B 5HHNA 2FH8A 1ZLVK 2BRRL 3C8HA 1P4IL 1DEDA 2VLKA 3LSOB 4XNYH 4PJEF 5FKAA 3HUJB 1IC7L 3MLVL 4OTXH 3IKCB 3D39D 3NACL 4Z7OF 2F53B 2NYYC 2FD6H 5E00A 3MJ9H 5HHVH 5JORB 4LHUG 3GI9H 25C8L 4HC1A 2EKJA 2E27L 3MROA 3VXNB 3LH2H 3KPPA 1XMWA 1INDH 1X5LA 4YDLB 1JZ3A 3R4DA 1JWMA 4L3CA 3WNPA 1MJUH 3CLEH 4LSQH 3BN3B 1FE8H 5D7KE 4X7EC 4I18A 1FYTD 1W0WB 1U8IB 2GEEA 5E9DD 1B2WL 4BM7A 4DCQA 5DRWB 5CILH 3C5JA 5TF1L 5C0GB 4LLMB 2GJJA 4JZJB 1MJJB 4GRWH 4KK6C 4ZO6A 4JFDB 1T1ZA 4XVJL 2PO6C 5ALBL 3MBXH 2ZZUT 3VFSA 3SGDH 3B9EA 4QRUB 3MV7E 2NY2C 5IEKA 2A9MH 5CEZD 1DCLA 2BX5A 1OLZA 4OZGA 4RGMB 1IGJA 3ECBA 1MCHA 5IHBA 4LLQB 3QUYD 3Q2CA 1J1XH 1CU4L 5M7QA 4XCEA 3JWNC 3GBLA 4KTYA 5B39A 1P4LA 1MHHA 3MMEA 4YBQC 2JB6A 5DVKA 1KBGL 3SGDI 3T0ED 1KXVC 3L3OA 1XF2A 3HZMA 1SQ2N 4HXAL 5AYQA 4LCYB 2DIAA 4O2CB 5HGAA 4APQA 4V1DD 2P1YA 2VC2H 3BOVA 3FB5B 3VXQB 1KTLB 1J0IA 1RZIA 3MA9L 1AHWB 2VQUA 5CKGA 4JM2B 3TVMD 1FYHB 4E41E 3W9EB 1JGEA 3EYUL 4Z0XB 3O3DB 5D1QB 4F9PA 1HKLL 1OAYL 4QRQB 1QSFA 2F58L 3DYPA 5K9JH 4R8WH 1MFBH 2J8OA 4U7SA 1K4DB 3U46A 5DJ8B 1MCWW 3UPAA 1NC4B 3C5ZC 1EUTA 3QCVH 2ZG2A 4WGVB 1A7NL 3MUJA 3N1QC 1MH5B 2OJEB 1NBVH 1Y6MR 2PYED 5C7XL 1YEDA 1S9YA 2OYPA 4UAOB 5E5RB 4UUJB 2UY6A 3NFPB 1SBBA 4LLAA 4XBGB 5ALCH 4U1KB 5JOPD 5DO2C 4NWTL 4KAQH 3NCBB 3LQZA 3O45B 3EYQD 5K9QI 1OTUC 5FYJE 3RGVD 2C7UA 5I30L 1RHFA 3BFOA 3QXUA 4HQQH 4O51A 2BXYA 5C9JB 1GIGL 3GNMH 4JE4B 4M6AA 3ULVD 1MFCH 4JM4H 2VL4A 3BZEB 4D9QE 5EFIA 1KJ2A 1NEZG 2NNAA 4L3EE 4JVPA 5DGQA 4DAGL 4AH2A 3LD8B 4DKAA 3QIWB 2VABB 3X3FL 3X3GL 4RGND 2BVQA 3AY4C 3FT4B 4U3XA 4P2QA 4ZS6D 4N1HB 5H35A 2Z4QA 2IAND 4JFFE 3EO9L 3BP5A 1JGVL 1NANH 4PJ8D 2F5AH 1Q0XL 1Z2KA 1KJVA 3ES6B 4LSTH 4N9GA 1WEJH 2AJXL 3F7VB 3X14B 4HBCL 2C26A 1L6ZA 3WFCH 3TZVB 4J3SA 4B5EA 4XCEB 1UQSB 5B39B 4FXKB 4O2EA 3RA7L 5CINL 4NO2A 5D2NB 3WO4C 1KXQE 2QSTA 4KJPC 1XF2B 4MB3A 4K3DH 1QFHA 3VGAB 4Z0BL 4YGAB 5T1KA 2IWGA 4PG9B 4KJWD 5F7YC 4G8GE 1Q72H 1EHLH 1L7TH 4Y5YB 4W68A 1A6AB 5GS2H 3D25B 2Z31C 3NIDF 4NDMA 2I5YH 3IDNA 5DD1L 3TVMC 3VXMD 4D9RD 4D0CB 1FZJB 4XP5H 5HDQH 3RIFF 3VMPA 5FIEA 1MCSA 3EYVA 2AXHA 3PGDA 1R3KA 4XZUA 4XBPB 1JN6B 4RAVA 4YBLB 5ACLA 1PY9A 4O9HL 1UWEH 3BRDA 1E4XL 4XVJH 5I6XB 4A6YB 4U6YA 5T1LB 1TDQA 1MEXH 3C5SB 1S78C 3QEHB 4U1JB 4YBQD 5A43C 3JTSB 4KUZH 4QOKE 5DSCA 1NDMB 3ARRA 4U1GC 3MRKB 5E1AA 5KG9B 3MXVH 4M03A 4QY8A 2XKUA 1KGCD 3TCXA 5EBLA 4OAWA 3HC0A 4OZFA 1UJ3A 2PYFA 4RFOL 2YA1A 3VMOA 4NQCA 4FFYL 3HTLX 4LCCA 3X17A 2DJ4A 2OBGA 5C08B 2VITA 2Q7YB 4S10A 3GSNH 4QCIA 3MRLB 2FO1A 4GRLB 4P2OB 1ES0B 4P2RE 3NA4A 3GDBA 3W5MA 3I2CL 1LE5B 4P5TA 5DD0L 4XMKL 5C0CA 2AV7B 4PJIB 5JQ6H 5MHSD 1PKQA 4LVOC 3IXTB 1A6WH 1C16A 5FO8B 4ODBD 4MNGA 1NC2A 3O6FC 4HS8H 1WFUA 2FYYA 4XHJC 2V2XB 5GISL 4FZ8L 5JUEL 1QR1A 5JDSA 1ZAGA 1PLGH 1YECH 3W11C 4JKKA 4L8BA 2O5XL 1JGDA 3E6FA 4HKJA 3GMPB 2XZQH 1I1YA 2X89D 3NOIA 1F4WH 2JJVA 3F6IA 4Y0GA 2JCCF 1LDSA 6FABL 1E6JH 4MD5B 3UCRA 1X9QA 3MRNB 3X14A 5JIHA 3UZQA 5K59E 3WUZA 5BOPA 5BZWA 3N9GL 1UB6B 2UZIL 3QO1A 1INQB 2D9CA 3OG6B 5C0RL 3CSGA 5D7LB 1NANI 4NO2B 5D2NA 3L6FB 5I15L 1OF2A 5D2NC 4R8WL 2EKSA 4NQTA 1Q9OB 2RGSA 3T08A 5IBUB 5T3ZD 1BJ1J 4Z7WE 1WBZB 1I4FB 2QKIA 4DZ8B 4XAKD 1MLCA 3DMMD 3RUGF 2A1WH 4ZS7H 5F7FA 1KSRA 4BFIA 1WTGT 1CG9A 2ICEB 5KBNC 5CUSL 4HD9A 1HINL 1RZGB 4NUGL 4MGXA 4IMLB 1WTLA 4LDLB 4C54A 4LLWA 2X4TA 1EMTL 1HHHB 4PP2B 5I1JL 4XCYB 3HPLA 1N5YH 1JHKH 1BJMA 3L7FA 4G6JL 1H3UA 2PW1B 2AK4B 1P53A 4OCSH 1TJHH 3LDBB 4B50A 5DK3A 4RWYL 1DBBH 4R4NC 4WV1A 4XP4L 4PRBA 4OD1H 3VFTB 4MNHA 2ZSVB 4PGCB 1UJ3B 5LAXA 4ZNCD 5FYLH 5C08D 3SKJL 2OXHA 2VLJE 5I73B 1LK2A 3BXNA 3RL1B 2XZCH 4YFLI 4M48H 3AMLA 1KGCE 2EDYA 4M61B 3VFGH 2P5EE 5JNYB 1DQDH 3S34H 1JF1A 4PV9A 3IB4A 1JNNH 2YWZA 1XF3B 3E1F1 4H1LH 2VLRB 1KCLA 4MXWH 4N0UE 4HHAB 4WTZA 5KVFL 1NC2B 4F37F 4S1RH 4F7PA 3CZFA 3QXVA 4WU5B 4BQ6A 3IAGC 3UO1H 1QR1B 3QPQC 5GS1A 1S8DA 5EZIL 4HWBA 1P4IH 4NQED 5DD5L 4FG6D 3MJ6A 3PGCB 2XTJB 4OTXL 1FGVL 1ZA3A 3PG2A 4MJIA 4ZSOE 4CVXA 4HWZA 4JG1H 5ICZA 2HMIC 4UIMB 3TPKA 1S7TA 2FX8H 4N8VB 3BGMB 2ZCHL 3O8XD 3N1MC 1KACB 3QWQB 1G9NC 5IESH 3O3EB 2HWZH 1PD6A 1F97A 3ISWA 2JB5L 1XIWB 2FO4B 4QNPE 1T5XB 4ZUVB 4Z76A 4WUUD 2CDGA 5ECJE 4M1GH 2EKSB 3AREC 5KVMC 4ERSH 4ELME 2ZNWA 1VDGA 3HZYA 2XNAB 4OKVB 4JFED 1RD6A 4XWOC 3GSUA 5I1KH 4G6FB 4MZ3A 2NY5H 4PGBA 3GI8L 4TUOA 1PZUB 3K8MA 1OB1B 1U3HC 3HI5H 3GSOB 4K55A 5D1ZB 1FYTB 4OFYD 3FB7A 43CAB 1CI5A 5AG8A 5GGRY 4ERSL 3QEQA 4RX4D 3TBWA 3QG6B 5SWQB 1HHHA 3CVHH 2XV6B 1FDLH 4M93C 2EECA 4QGTA 1BMGA 1YDPB 2FX8L 2X42A 4U1HB 4M62H 3RKDC 1Q0XH 3O6LH 2AEPL 5I0DA 1KB5B 4LSVH 2YSSA 2J7LA 2LAAA 4H8WL 4GFTB 5CEZH 4OIIH 3O2WL 1FZKB 4HC1L 5C0JA 2GCYB 2YPVH 4P46B 1E4KA 1A6PA 2DM4A 3TF7C 4JQVA 4QXUH 1FAIL 4TOYL 1UC6A 2UVFA 4MXVF 3WKNA 4BSVA 1BQHA 1KJMA 4GKZA 1QLFA 1CR9H 1S7QA 2DKUA 4QHMA 2N4IA 2XT1B 4ZUTA 1R5WA 2OQJB 4R7DB 3ARBC 3L5XL 3NFNA 1J88A 5DUPL 4LPVA 2VZ3A 2FEEL 3DSFL 1BQLH 1N3NB 4EEEA 4KZEH 2ID5A 1JUFB 2W91A 4XWOD 4GG6A 3QFJB 3QUZC 5F89A 3WNKA 1OWRM 5I66A 5L9DH 2ZG1A 3MLWH 4LKCB 1QBML 3C2AL 3FOLA 5IBTL 1T2XA 4K07A 4M5ZL 2IANE 1OLLA 4RFEA 3TO2B 4X9GA 3RU8L 3QDGA 3K80A 1MRFH 5I0ZA 4HS3B 4PJIF 4NM4H 5FYKD 4WTWA 2XACC 4JPKL 1N6VA 1CZ8H 4UDTB 5DEGB 5JQHC 4KZEL 3E2HB 3N50A 4ODWA 3BGAA 2NY5C 4LVNB 5FYKL 1Y0LB 4AK1A 3BSZH 3BESR 4NN7C 3UC0L 3KPSB 1H5BA 5LXGH 1MCNA 5HGGS 3VW3H 1S7UA 4Q58C 2IPTL 4OCSL 5T33L 4N8PA 1ZTXH 1TPXC 1ED3B 3OZ9H 1M7IA 4G6JH 4F37K 2YN3A 1I7TA 1HSAA 3IDMA 2OLDA 1EMTH 4JB9H 1FSKC 4HXBL 3CX5K 4NZUL 2WM0A 4KGJA 4FQHB 5F71A 2DM7A 5CP3H 1TVBB 1N64H 2O5YH 2X9XA 2IC2A 3DGCR 2VDQL 2NY0C 1TCRB 3GSVB 3V6ZB 2NY6B 4LHQB 1P1ZB 3X13A 1DLHA 5GS0L 4YHKH 4AM0A 4HUVB 4JJ5A 3SJVA 3FB7B 3TBSA 5GSVB 4ZXBC 5C0DA 4PRHE 4ISVA 4YGVB 1IM9D 4OB5L 1ZHNA 1KLGB 4IRSD 2Q8BL 1VCAA 2BOBB 3GB7B 2DQHL 2YD5A 1I9RL 4DN4H 1V7NH 1BOGA 4GOSA 1INEH 4JY6A 5CBEA 2C1PB 2NTFA 1P7QD 2GFBA 1PKOA 2F5BH 2QQNH 1CFVL 3BP7B 4P59H 3NH7H 2VIRB 4K94L 2YK1H 3MLYL 3RWIB 5HHOB 3QT2A 4EN3D 3WKML 1PLGL 4MJ5A 4GRLD 3G6JE 4NKOA 4UQ2B 5TF1H 2X4UA 3U0WL 5IJKC 1U8LA 1IAIH 4ODUB 1YUHA 4P23D 5J6HA 1ODAA 2F53D 2PXYA 5F7WC 1QUNA 3FOMB 2AXFA 4PUBL 5CGYD 1MSPA 3HG1A 1UZ8B 4LCWE 3SKNB 2VKWA 4JR9H 3UBXI 1WFTA 4ZFFB 4QOKD 1TTFA 1M7XA 3AY4A 3FT2B 5TE7L 5B39G 3QDGB 1M05B 4KTEL 3WEXB 1QEWB 4J8RA 3Q3GA 5IW1B 1D6VL 1OARH 4YPGB 4F9LA 3PWLB 5ADOL 4AL8L 1IAKB 3ARBA 2YHGA 3L3GA 1CFBA 3GSNL 4UT6H 2CDEA 5E9DB 2ADIA 4OF6A 1EX0A 3PWNA 2AXJA 3JTTB 5EU6D 5C6PB 1D6EB 1FFRA 1KB9K 5DJAA 2V7NB 5E6YA 1N59A 3T0WA 2FNBA 4UU9B 4RMVA 3C6LA 3SQBA 4PRPE 1V7MH 1UEYA 2EDKA 4EI6A 1CVSC 2A6KB 2VN7A 1UWEL 2L0DA 5TH2A 1I8IA 1KPRB 1URLA 4IMKA 2P48B 5TE4H 2OL3L 1NMBH 1A4KA 1IKNA 2PCPA 4K9EC 2NXZC 3TPUA 4YHZH 2O5ZH 3NH7L 4Z7UB 1RIUL 1NGWB 3W0WA 4YAQB 3QRGH 1OGAE 2AK1H 3V5KA 2AJUL 2B1AL 2GITA 5BO1H 1JGLH 3HI6H 4OZIA 2DQFA 3MLZH 1JNHB 1GGIH 2HT3D 5FGCB 5HGHA 3ZE0F 2I26N 4UIKL 1S3KL 4HUXB 2BHYA 5C09E 4X6CB 5CZXC 3RNQA 4HUVA 3IJYA 4G8FA 4P3DB 3E3QE 1RUPL 2XXMB 3WXWH 4WCYL 4JFEE 4KHTL 2ARJA 3WD5L 4MQSB 3H7BB 5KAQG 3VWJC 4UAOC 4M43H 2VAJA 2HTLD 3O2DL 1PX4A 3ZKSD 5L8LB 1UH4A 3LQMA 4OV5B 1EA9C 3I6KA 4BH8B 4XX1G 4TTDD 1T20A 2DYPB 1MAJA 5ITFB 2AEWA 4X80H 4FQLL 1C5DA 5B21A 5HD8C 4M7KH 1T22B 5HHOA 1WEJL 2AJXH 2GTWB 3S36H 2MOVA 4YK4C 2A73B 3P9LB 1PSKH 2Y9RT 3KYNB 5E94B 2IPTH 2V9TA 5GS1C 1JZ7A 2DQGL 4HCRH 1CXEA 2DD8H 3UBXB 4WDIB 2F74B 1AI1L 2G5BA 3SCMB 2ZJSL 4HMEA 3ESVF 3OKMB 4NQCE 1RPQA 3IGAA 1HCFX 1IM9B 4L4VB 4DOHE 1U41A 4JZOB 4EUPB 5E24E 1SJEA 5TE7H 2A6DB 3L95A 2XTLA 4YDIL 3TBYB 5I1LB 5D9SA 3Q3GB 2MQCA 3EUUA 4JZJC 1QBLL 1SM3L 2JJWA 5CWSB 3THML 1IAKA 3BUYB 1F4HA 4KMTL 5TDOA 3ZSTA 2YXFA 3EO1A 1B88A 4I5BA 4MJIE 4NWTH 3SKUD 5D7JC 3NFSH 2NY2B 3BQUD 1NKOA 8FABA 4M00A 4WJ5B 1I1FA 1N59B 5FCUL 1A22B 1HCVA 4FFYH 3EOAB 1AP2B 3RX8A 2X1XR 4RGNB 5I74B 4RDQF 2F8XC 2YZ1A 2D4DA 4ONFL 4W4OC 2Y72A 5D7JA 1L6XA 3KNBA 4LVNC 3TBVB 3MRQA 2PCPB 4JZNB 3HNVH 4WWID 2IQ9L 4OZ4B 1NGWA 5CJQL 1N5YL 5EC1A 4K8RC 4HKXB 2A74A 1DBKH 1Z9MA 3ULVC 3I02A 1YYML 5BS0B 1VHPA 4J3VA 1DUZB 5CCKH 2FJHB 1AD9B 3KPRA 2XWTB 2J8HA 4GKSA 4PJAF 3SDYL 4BZ2L 3GIZL 2HRLA 1XH3B 3ARGA 4JFXB 1CDGA 1OAUL 3TJEH 1ZLUK 1JTPA 3LPGA 3QXDA 3FZUD 4NPYA 3JV6B 4KK8C 2V5YA 5EOQH 1HILB 3W0WE 3QH3B 2M8XA 3QG7L 3FQRB 2H41A 4M6OL 4CN6A 1IGML 1IQWL 1MVUB 4I3RL 1EXUB 3QULA 5FYLE 4XP1H 4YPJA 4J6RH 1BZ7A 3VWKB 4Y4FB 4HK0A 1MCOL 2FX7H 1CGYA 5H8DA 1LDPH 1QHPA 3SDAA 4NCC2 4Y4KA 3VRIB 3STZB 4HDIA 3VWJA 1L9MA 1P84K 3MRBB 4IOIB 1H8SA 5EU4A 5ETUB 3VDBA 3KHQA 4ZPVB 3MLRL 4I9WE 2C4XA 2FEEI 2DWDB 4DTGL 5KJRH 4P5MA 1SMOA 3RAJL 2CK0L 2YUWA 3B9DA 3O8XC 1R3JA 3ARFD 4LAQH 3RNKB 4P2OD 5JHLH 3QI9B 1A7OH 3VFVB 1QKZH 3FO0H 3D85B 5DR5H 1GOFA 2J4WH 4QLRA 1LGVA 2W0FA 2DQDL 5E08L 2ITDA 3VGDA 3IJSB 2DQEH 2K3TA 3DUSA 2YN5A 3WIHA 3LB6D 4GUPB 5CJOH 1GVIA 3ARGC 5C07A 1BREA 4NN5C 1QLRA 2R2HB 1ZWIB 1JI1A 3T2NL 2GHWB 1YEJL 3MRFB 4LF3B 5HHXH 1VKXA 1X5XA 2CGRL 3BDYL 2G5RA 3A6CL 3QUXD 3O4LA 4E5XA 3PWUA 1K5NA 1KPVA 2GKIA 3QCTH 1CE1H 4KK6D 3MRHB 4F7TB 3IFOB 2AEPH 3SDXE 3U0WH 4X9IA 3WO4B 1I8MA 3KNBB 3P30L 3FB6B 1TZHB 5BVJB 4XP4H 2YA2A 1LDPL 4KPHL 4XP1L 2ZP0T 2DLTA 4OZ4A 4Z7VE 1WV7T 5FECA 1NFIB 3BKCL 1WT5A 4YLQT 4BKLA 2NZIA 3BKMH 3C6SA 1MCJA 4U6XA 4FP8H 4ONGL 4TTGA 2BY1A 4NRZA 3SJVE 2XWTA 2A6IB 3JUYA 2NX5A 2HJKB 2GJ6D 1DBJH 1GC1L 1MFAL 4DW2L 3RTQC 1KIRA 3KXFA 2VDPH 4XPFL 4IJ3B 3WLWC 2XN9B 4O2FA 4A6YL 1RZKL 4JFYB 2PYEB 4Q9QH 5EO0A 1QSVA 3EZ8A 3P77A 5FA4A 3BO8B 3RIAK 4LLMA 2DWEB 4IRSB 5DQJA 5JHDA 1MJJA 1QBBA 3CPLA 5GRVK 3C5ZD 2FIRT 5E6ZA 1XT5A 4AG4L 1A64A 1YEGL 1J0JA 4K7PL 1J10A 3AU1A 1YJDC 1HE7A 3OPZL 4K7PY 3ARZA 4GJTB 4R4BB 4IOFD 3JV4B 2HN7B 4FNLH 4TSAL 2F5AL 1IM3B 2DDQL 4P5KB 5GZND 3CVIH 2YC1A 4DAGH 4F3FB 4QT5A 3UYOD 4OCXL 2XI9A 3H7LA 4FFWD 2R4SH 1ZHKB 4U49A 2NX5E 3RVUD 4HWBH 1NUDA 2VR9A 5HYEA 1OGAA 2QEJA 3LHPL 1GZPB 5BRZD 3L3DB 4ONHB 4PJ7F 1CDCA 4IS6A 4L4TA 4JN1L 3D48R 4Z95L 5GISH 5C0EB 5JLZA 3QI9A 1WWCA 5ISZB 4LL9A 5ESVB 5IJVB 4G9FB 3NPSC 3J8F7 1DQJA 4R97C 4PJ9C 3IJSA 4JG0L 3UBXG 4HJJL 3STLA 1YQVL 4PJGB 4Q97A 5HJ3B 4PJGF 3O9WA 1T0NB 1FRGL 3UP1A 3EOTH 4CUCA 1DL7L 1X5FA 2VDNL 4BK5A 4WW2C 2UZYB 1V8HA 1NKRA 2V17H 4RWYH 4GAFB 3JWOH 1ZV5A 1N2RB 4NQVB 1V3JA 1UB5A 1SEQL 4NUJB 3OAYH 3S36L 2JJSC 1UXWA 3P9WB 5E95B 5JW4M 1M4KA 4HX1A 4C57C 3DVGA 4MLIA 1K8IA 3PWVA 4FQQA 1J1OL 2FBJH 4WY7L 4OSUH 3QUXC 3DNKA 2VLKB 3LSOA 4I3RH 4TSAH 5EO1A 5IROA 5D7LE 4C83B 2DF3A 3BIKA 3V7AE 3OHXB 3HZVB 4OB5H 4X80L 4XVSH 4OLWL 3LIZH 2EDQA 5E00B 4XHQA 5DZOA 2A6IA 3O0RL 1NFDB 3ZDXE 4GXVL 3WSQL 4Z78B 2H32A 4GMTL 1D5ZA 4TYUA 3VGFA 5ACZA 5C9JA 4QRPB 2W60B 5IB1A 3WXWL 1ZXQA 2D03L 1BEYH 3BZEA 2ESVA 5AZ2L 3MOBL 1RJLA 2GJ6E 5I1CH 2NY5L 5CJQH 5L7XH 3BO8A 5EN2A 4C59B 4FMKA 5JHDB 1PQZB 4NZRL 3T09A 4URTB 4L1DA 4MS8D 2IH1A 3ALXA 2BVQB 1NMBL 1E6JL 3WHE0 2YXMA 1RIVL 3ARTA 4OFPA 4CVWA 4R4BA 2ERJC 5J1TC 1JPFA 4NSKA 1VACA 2LU7A 3FB8B 3BP4A 3K1KC 3UPRB 3TO4B 3BT2L 3MGOA 3P73A 1BFOA 1ZANL 2HTKD 3EFFB 4ZNEE 3P30H 4DZBA 3A6CH 3RWGA 4PJEA 1CD1A 1EIBA 2HVKB 4HH9B 1ZHKA 4JRYB 3OF6D 4M7LL 4FOMA 5SWSA 3T2NH 3MMEB 4L8SA 4G9FD 2CGRH 5C0ND 3OV6A 1F58H 3MLUH 3GMMA 1J11A 3QQ9D 3T2PA 4JPVL 4WI5A 5IVZA 2FRGP 3EOYG 4WFGE 3IU3A 5C3TA 5ESVA 3I50L 5F1OB 4OCYH 1U8PA 3C8KB 2DICA 2OP4H 3HMXL 3TESA 4XTRD 5ADOH 3RDTD 2NMSA 3OKEB 1GHFH 2WWKO 4DK6A 1MRCH 4YXLH 5IWLA 1AHWA 4Y2DB 4MQXD 3HNTH 3WS6A 3QNXA 5DC0A 1ZLWK 4XNQB 4XPAH 3QA3A 1YY8A 4NO5B 2VERN 3H8NA 2JCCB 3TIDA 1PYWB 1MEXL 3V5DB 2H45A 1HSBA 2B0SH 5EO9A 3SDCA 1A6VH 1MNUH 2IEPA 4YHPB 4DKDC 4P9HH 3G9VA 3VXSB 5FYLL 4PJEE 1WGOA 1BD2E 1YN6A 4JDZA 2HJLA 4OCNC 4QHNA 1NDMA 1AXTH 3V7AG 3NFPA 4C83A 4JRWA 1DBBL 4BK4A 4Q74A 3TYGL 4OAWB 1DDHB 3QIWC 5T5FL 4NHUA 3TNNA 4J6RL 1E6OL 5LCVH 4JHWL 3S37X 2VZVA 1EHLL 2VTFA 5CAYB 1WAAE 4OLUH 2XPGA 5EA0L 1KULA 3UDWA 1K6QL 5MEND 4XH2A 2AV7A 3SOBH 1VENA 3VCLB 5GGRB 4LRIA 3ESUF 3HZKB 1UA6H 3MV9B 3DI2B 4U1LB 5I1HH 4JO3H 3SDDC 2QV2A 2VLJA 1HXYA 4BZ2H 1I1AA 1C08B 1MFEL 1FCCA 2IH1B 4NO0D 1CT8A 1XFPA 1AFVH 3W9DB 3IF1B 4OLVL 4XPGH 1BX2B 5C2BH 5EIIA 4WI4A 5D6DC 3V6OC 4CBPA 1HEZB 2PYEE 5TDNB 2R8SH 1YY9C 3Q6FB 5DURB 1VFOA 1ZSDB 1QQDB 2GSGA 5CHNA 3EHBC 5FO9A 1A3LL 3U4BL 1OWWA 4OSUL 1CD1B 3NAAH 3VXRA 3U9PL 1S7VB 2FIKB 4YE4H 3UMTA 4IEFB 2QADC 1T03H 4XXCA 1F6AA 2JTDA 5FB8A 3RUGA 1NCDL 2VZOA 4LCWA 3P40A 4LPYA 1GL4B 1NGYA 4P4KB 4E41D 3H9HA 4XXCC 3EZJB 5I1GL 2IJ0C 3HE7A 1JZ6A 1RUKL 2AJZB 3CVHB 3F12B 3W2DH 1FFPB 4LQ1A 3C8KA 5IQ9B 4PJBE 5IBTH 1I4FA 1OHQA 1I8LC 1IAII 4PBVC 1ZGLM 5HY9B 5EUKB 4OGAC 4MWFA 1NSNH 5EOCH 3Q48A 1B0GB 4HKBB 4P23B 2VISB 2VXSH 4F58H 4OZHE 3I2CH 3BX7C 1DQML 5DD3H 3S88H 2FL5A 4OIBA 2PF6A 3HAEB 5E4EC 2WBJC 4NIKB 1MI5E 5EU6B 2F5BL 2QQNL 4A6YA 1AIFA 3LV3A 4H8WH 4LNRB 3JTSA 5E99H 1NL0H 3IDGA 4X7TA 3M17B 1DDHA 5SWZE 2PW2B 2PTTB 1A7PH 4N90D 2P5EA 2DTMH 4TULL 1MHCB 1RURL 3AGVA 2DB8A 4MAYB 4XPTH 1D3CA 2UUDK 1BWWA 4CU8A 2F54E 4HWNA 4I77H 1U3HD 5D93C 4MHHG 5I1EL 2D2OA 2I07B 2YBRB 5BCAA 3O3UN 1HYSC 2X7LA 4X4ZA 3V4PL 1HWGB 3U48A 5GGRA 3PWPD 3R0MA 2ILLA 3B9KB 3SCMC 2EDTA 1J8HD 4KI5D 2YKLH 4LCUA 5ESQB 3DV6A 1HXYB 3OX8A 3CDGB 2ORBH 5I1KL 2Y5EA 1WAAF 3FT3B 5GS1B 5F7MC 2BNRE 3TYGH 4DWHA 1G9MC 3BGFC 4PJDF 4KUCF 5LXGL 1MVFA 4PJ9A 4KUCD 3WS6C 3QB7C 1PAMA 3BKCH 1QO3A 1I7RA 3NN8B 1ONQB 1EJOL 1EFXA 2VXQL 2DTML 1RZ8A 4TULH 4MD5A 4OFIA 2GSGB 5CHNB 5TGBA 1EBPA 1KELL 5AD0A 2DYPD 5EDXA 4JFZL 3MFFA 1S7VA 2FIKA 5F3HA 2EDLA 3QO1B 4ODHL 4PTTA 4U7KA 2FO4A 2R2BA 3WFEL 2H2PD 4LCWB 3O11B 3TO4C 1V3KA 4M1DH 3MNZA 5KZCD 3G6AA 2WUBH 1A6TB 2V2TA 2XFXA 1PDKA 3UO1L 1I1CA 5DR5L 15C8H 1MLCB 1TNMA 4HT1L 3RQ3A 3V95A 4LARH 5A2FA 4P4RB 1EK3A 3QWRD 2HP4A 3NACH 3H0TB 1CG9B 2ICEA 1OSZA 3B2UD 2PO6B 4UMGA 3T1FA 4LLWB 3QG6A 1PZ5A 1YY9D 1D7FA 3RDTC 4DCQB 2ADFL 5IV2A 4HCRA 3C5JB 1Y6KR 3O2WH 4HC1H 4Q7DA 3NGBB 2X4QA 1F4AA 3JV5A 3MGTB 2KH2B 4GBXA 3BKJH 1BF8A 3CNKA 5GS0C 4GH7B 1CGTA 3PIQB 1YC8A 4NQXB 4JY4B 1LHZA 2VXVH 3HE7C 3VG0H 2OTWB 4OQTA 2BMKB 1OTSD 4TSBH 1VERA 1F3DJ 2R69H 3LS5H 1TZIA 4ZUTB 4I18C 4OZGB 4MAYA 4JO2L 1HOCB 2VLLA 5T1MB 4YFLF 2EXWD 4BELD 2HTKC 4KKCC 1R0AH 1OP3K 4YXHH 5I8OL 2BJMH 5IOPA 2ZUSA 4ZFZA 3OJ2C 1T6VN 2D31B 2X7LB 3BI9X 4GW5B 4G7YL 1ACZA 1KN2L 3D6GA 2MTPA 5F70A 5KS9B 1NLBL 2R2CA 5D1QC 2MCG1 5LJYH 3B9KA 3V0WL 3T04D 4KK9C 5AZEH 3RA7H 1KB5L 3I84A 4MCYA 3BAEH 3VXUA 5FOBB 4AMKL 1H3PH 5FYLD 1RZIB 1A0QH 3PXHA 2B39A 4HXAH 1LVEA 1MQ8A 4JFEA 4PTUB 4YK4B 5GRJH 5DHYB 3SBWC 5J6GB 2AS5M 3B8SA 2D0GA 3QBTB 1FP5A 3S5LA 1NGZB 1EGJH 1ONQA 1JGUL 2IQ9H 5EC2B 4WV1C 5JW5A 1JIBA 2K7QA 1RK0A 5GIRA 1FL5B 2BOCB 5ANMB 4UILH 4TSBL 4RX4A 1CD8A 1XR9B 2ED9A 2C3VB 1IGYA 5HD8D 4B53A 3EOTL 3G6JB 1F00I 5BJTA 3GKZA 3O4OB 1MFCL 4HS6B 3TBTB 2EDOA 4I4WA 5FYKU 3MCKB 4HJGA 2X09A 1AGBB 3CFDB 3RZCA 2P5WE