1ORSB

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
221
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCTVTGYSITNNYAWNWIRQFPGNKLEWMGYINYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYFCVRGYDYFAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 33H1 Fab light chain
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
total genus 42
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsB01
2NXYC 3MRRA 3QXTA 1G9NH 1V05A 3PWVA 5DYOA 4Z7UA 5EO0B 2XPGA 4BK4A 1KB5H 1CL7I 1O5DT 1I1AC 2VLJB 1DVFC 3LS5L 2FO1A 2GCYA 3FOLB 3QUZC 2BOCB 5E8DH 4DCQA 4PG9B 1NANI 5L2KA 4PR5A 4JREC 3S37X 4RMTA 4ODWA 4YWGL 2X4OB 2PYEA 2YK1H 4ZDHA 1FNFA 1I4FA 3GSUB 3BJ91 1T22A 5CUSH 4X8JB 3PDGA 4JFZH 4POYA 2P8LB 3B3IA 3D69B 4OLZL 4ZXBC 3MLXH 4QRTB 3ULUL 3L3GB 3TJHC 1ORSA 1Z0MA 4OJFL 1S7TB 1F4XH 2I07B 3KPSB 2AK1L 2FEEL 3GM0A 4FP8H 5MERB 3O2VH 1I9RH 3CVHH 3IFLH 1WBYA 1JUFA 2R8SL 4PLOB 5C0EB 2X05A 5DUBA 4YR6A 1EFXA 2C1OB 9CGTA 4MD0A 1HHHA 1T7YA 3GMNB 5GS1C 4L4VA 1GAFL 1RUML 2B5IC 5F93C 2G5BB 3PJSA 4XNUH 3UBXI 5D7IB 3FB6B 5I1GL 5F3HA 4HS6B 4AY0A 1AXIB 5EH1A 5FDWA 3HZVA 1S7SA 1RJLA 3O0RH 4OZ4B 4QRRA 4H0HB 4V2CB 1U3HC 3CDGB 4JO3H 3UTZB 1AO7D 5JUEL 4OLVH 5FA4A 4K9EL 1J87A 3V52H 1AH1A 2AJYL 3GSRA 2CK2A 3WFEH 2CH8A 1XH3A 3TFKD 1CF8H 2YUZA 2HTLD 3ARGB 3GSVA 4FMKA 4I2XE 4J4PA 5IMOB 1AXSA 4XVSH 2NXZB 1BJ8A 2PYFB 3BWAB 1PEZA 3PQYE 1QBBA 3MOAL 2DQJH 5MENB 5I15L 1EEYA 3WLBA 1WISA 1DTUA 2DLEA 1A9BA 5E08L 2XTJB 3VXMA 2APTA 4TNVF 4C57C 1UKSA 5ITBL 1QNZL 1V7ML 3FO2A 1E6JH 4MSWB 1U8NA 4JB9H 1IBGH 4LHQB 4FQXB 1DUZA 3ULSA 4J3TA 3SDDA 3FN0H 1KBGH 3MODH 3MJ7B 1FJ1A 1MJ8H 1N4XL 1TZGH 3MREA 2ARWA 4D0DB 4MD4A 3T8XA 3NFSH 2G5RA 2YD7A 3CK0L 1DUYA 2VXVH 5KW9L 3HB3C 4KK8C 2Y9RT 4BH8A 5EBWA 1CBVL 3QUKB 1XIWD 2F53A 3KGRA 4WFHD 3S4SB 1FL6A 1OCWH 5JW4Q 5ESQB 2W60B 5GISH 3S96A 4KUCD 4QHUB 3KPNA 2LU7A 2ADJB 3DVIA 3GSNL 4RWYH 3N1FC 3EDKA 4DGIH 5DMGD 4ODSL 1RMFH 1IAKB 3MRLA 4UILL 1ZVSA 4WFFD 1YZZA 5F7YC 3FQRB 5HHMD 4LSSH 1HEZA 2AK4B 2Y4SA 2ZPKL 3NTCL 5IF0B 4NN6B 1NBVL 4BFIB 2EIDA 4M4RA 3ES6B 4DVBA 5EO9B 4OZIF 3QB7C 5EC1B 1NSNL 4HMDA 4KZDL 5HGDA 4N1EA 2Q7NA 3V6FB 4TVPD 1JNHA 1ED3A 3O2WL 4P2QE 3QEHA 5FYJE 1IAOA 2BZDA 3O3AA 4LSQH 4Z0BL 2Q76A 3C6LD 4JRYD 3EYOA 4WO4A 2HKFH 1FL5A 3W5MA 5J1AB 2V2XA 4X9HA 1OP5H 1DQJB 1DQML 4XCNB 5DO2D 3HFML 1NAMB 2B8OT 4R8WL 4X7EC 3MRJA 5K93A 4C56B 3QA3A 3BI9X 2ATPB 2HRPH 3F12B 1OLZA 4X98A 4JQVC 5TF1H 4IDLA 3OR7A 5CEXA 4PGEA 4PLJC 3EUUA 4NNXB 1Q0XL 3BZ4A 5DMYA 1R5WB 1NCCH 3BIBX 1QFWL 2DJUA 5D96C 1I9JL 1M7IA 1U3ZA 2VABA 1H3UA 5ISZA 3TN0C 3MRPB 3IETA 4FQIH 5CJ8A 5E6YA 2C3GA 4R0LB 1HXYA 3W9DA 4HWBL 4PJBA 1RU9L 2PW1B 3T1FB 3C8KB 4XPAL 1P7KA 2X4PB 4XNXH 4HG4K 3CZFA 4ZFOB 3EDJA 3QO1B 4XP1L 5I8OH 2FCBA 1ZTXH 3CFEA 4PJDF 3S3PA 2BNRD 1FVEA 2WLYA 3MV9B 4KTYA 3NH7H 2RBLA 1OAZL 1TZHB 4KI5D 5EOTA 1HCVA 4Z5RA 1GYAA 1NMBL 4U6VL 5EZLB 3LIZH 5HDOA 5HHPB 1HIMH 2X40A 4WW2F 3JZ7A 3TVMC 3QI9A 4O5LL 5I18L 1MLCB 2HJLA 4TPRL 3U0WL 3IGAB 2EH8L 3PWPD 5JDSA 4G6KL 1IGYA 3DUSB 5IBLC 3CFKA 3JV5A 3WLWD 1JMXA 1PG7W 2DJSA 5HI4D 2NY6B 3B6SA 5DUML 5F89B 3VGGA 3RUGB 4GSDL 2F5BH 3VJ6A 3FZUD 2H1PH 3WL9A 3MRCB 5IBUB 4MZ3A 4Z7QF 1DEDA 1AO7E 5I1LB 5IWLC 4QTHA 5F6IC 5D70H 1MCOH 3EYUL 4I48A 3QAZB 3GB7A 2CUHA 1SVCP 1B0RA 3BGMB 5E8OA 1BQLL 3UBXG 4N5EC 2R0KL 3HI1B 3QPXH 2D7MA 3P4MA 5HY9A 3RWJB 4K3DL 4I18B 1HHKA 4TULL 4P46D 3QIBB 5I1EH 4HUWA 3GI8L 2XZQL 1VGKA 4JDTH 3D39A 1KELL 2K7PA 3MO1B 4PV8A 2VZTA 2OI9C 5EBMA 1MHCA 5K33A 2D0HA 2XFXA 5JIHA 2AKRA 4HWNA 3EJJX 1WQVT 1LE5B 1HN1A 3HR5B 1FV1A 4LSTH 5F8RC 3VXSB 4KDTC 4L9LA 5IHUH 4Z77B 4C83B 3VD4A 4HZAA 3M17B 4EDWL 2VSDA 5I2IA 1T20B 1T7XA 3U4EA 3UTTD 4XP6H 3O3DB 5HYSA 1QFUL 5KBNC 1PG7L 1I7UA 4PYHA 3K8MA 2KQMA 3U0PB 3FN9A 3KXFB 3QWOA 5DEFA 3CVIH 3K1KC 4U49A 5D7IF 5E2JA 2UZYB 1DQDL 1C5DB 3P4NA 1D9KD 3HS0B 1QKZH 3SBWA 1WWCA 2VDQL 2GFBB 1MRCL 1QPXA 4M6NL 3RWCA 4S2SB 4WFHE 3A6CL 4GW1A 5KAQF 1EO7A 5BW7C 4U6HB 1GPOH 4YZFF 3UJTL 2H2PC 1I1AA 3LKRA 1DVFA 4IRSD 3EYVA 4E0RB 5TE4L 3GBMH 2J7LA 3Q1SH 3QUZA 1FPTH 3OF6D 2Z31A 3IDMB 4P2CG 1TNMA 1DN0A 5CS7A 4XPGH 4WFFE 4K3EL 4F37F 3S88H 1YEEH 5HHME 2GSIB 1P5VA 3MRIA 5ITFB 1ZSDA 5GS0D 4OIIL 2I60L 2V17H 2W9DH 4MXVE 4NN5C 1OB1B 4OSUH 1R24B 4ZXBA 2XA8L 4W68A 1MY7A 5D93C 2FX8L 1S8DA 4TVPE 2FLRT 3BWUC 5EZOL 2R2CA 4WNQB 4YE4L 3S36X 1YECL 5JXED 4Y19B 4G9FA 4JRYE 3GIVA 4WHDA 1A14L 2RR3A 4JN1L 3PGFH 4PD4J 3TH3T 3HCVB 2A9NH 3NCJL 3NZ8B 3V4PH 3F7QA 1JZ8A 2F54B 4ZSOE 1EGJH 1HHJB 5FFLA 4HFWA 2XT1B 4G80A 5GS1A 3AUVA 1NCUA 4P9HL 2HT4D 1MCSA 2R56H 2APVA 2YD6A 4GXUN 4HHAA 1T1XB 2FECI 1F3RB 3MRNA 3OPZH 4MA7L 4Q9BA 2VXQL 2BRRL 5LCVL 3BGFC 4M9PA 4NQXA 4IS6B 5F7DA 2E9WA 2XXMB 3L5JA 1MAJA 4NNYA 4L4VD 3DRQB 4ONGH 1T04A 1CDUA 2DQEL 3LKQA 4PGDA 3SOBL 3CFBA 3IJHB 3NA9H 4QRRD 3DETD 2F5AL 3EW3B 5BJTB 5EZIL 2BNRE 2QQNH 2YS4A 4H5SA 4O2FA 3WUWA 1I8MA 2DBJA 5F7MC 3GSOA 1EJOL 1UM6L 1MREH 4HAGA 4YHYB 5AYUL 2Y7QB 4PJEB 3G9AB 4PJCB 4I4WA 3BXNA 1NFIB 5C0RH 4P9ML 2BY2A 1T4KB 1S9XB 4NSKA 3BKJH 2VTFA 3KPLA 3ROLA 5T33H 4YHKH 2FEDD 2OTPA 1FDLL 1LEKA 4ERSL 5J13C 3PWPE 2UY6A 5ACZA 1MFEH 1II4E 1F90H 4NQCB 4U1IB 1JE6A 1OTTD 2XOTA 4WENB 5C0AB 2WP3T 1L6XA 3C5JB 1IM3B 4XMKH 2NZ9C 1YEFL 5IFAL 3KYNA 4W6WB 2UVEA 5D5MA 4M8QB 4FXGA 4IMLA 3GSXB 4HIXH 5EIIA 1FNAA 3MACH 2GK2A 3O2DL 1I1RA 4ZS7H 4F9LC 1ZLVH 5F7HA 2VSCA 4JE4B 4U7KA 4AL8H 1YMMB 1RZJH 1U8IB 2AXGA 3JWDC 1XZ0A 2H32B 3FB7B 4PRPB 5DWUL 1IGML 4DUXA 5I1KL 5F71A 2FHFA 4UTAH 1A4JB 2GYSA 4Y5XB 2DQGL 1Q94A 2N56A 4MJID 1JPTH 1ORQB 4QHKJ 5L9DH 5EBGA 4Q97A 3VMPA 2EYSB 4Z7NF 2PXYB 5GZND 4JANB 2F53D 2EDRA 1KTDA 4GJTB 3INUL 4K7FB 1YJDH 4J3SA 3CFCH 3HRPA 3MROB 4NUGH 3ZHLA 2B1HH 3VRJA 1MCWW 2P8MA 4JVPA 2FIKA 1PKQB 2JJWA 4BH7A 3UTTE 4QRSB 5CWSA 5T1LD 3BAEH 2BXZA 2N1KA 3MRGA 4X7FC 5C07B 3WNMA 5ETUA 5FM4A 1ZHNB 2OXHA 2DM4A 4LBEB 3RPIA 4GFTB 3I3EA 1I8IB 4WW2C 1RULH 3T0WA 5KG9B 3LQAH 3TF7C 3RUGF 1G6RL 1P7QB 3ARDC 3O6FB 3T0AA 1BEYL 4UIKL 3V4VH 4JQVA 4CNIB 3QIWD 1MCBA 2AABH 3V5HB 3SKJL 1TNNA 3LH2L 1QLEH 5SWSB 1CGVA 1TENA 3WXVH 3OBAA 5GSVB 5GXBB 1NDMB 1Q9WB 4WTXA 2VXUL 4NKDA 4GXUM 4XCEB 4DQOH 3B5TA 4RIRB 4P5TB 5KOMC 2YWZA 3V7MA 3DURA 2J8HA 4OBRA 4M6ML 2NW2A 1BZ9A 2OX5A 2DM2A 5T3ZL 1FORL 5CZXD 3ARBB 1K2DB 1RUPL 3X3GH 4L3EB 1BOGA 4H26A 2GQHA 2R23A 1NH6A 2W1NA 1YEJL 2HVJA 2NYYD 2X1XR 4U1HB 4QXTA 1XCTA 1MI5B 3LEVH 4D2NA 1S9YB 5FHAH 1T7VA 3T2NH 5ISZD 1B6UA 4U0RB 4ZPVA 1Z0NA 5D2NB 4OGXL 2DIJA 5EIQA 4ZTOH 1N8ZB 3PXHA 5I19L 1YPZB 3OB0H 3P30L 5DEZA 2WUBH 2Q8BH 4AT6A 3AY4C 1W0WB 4UBDC 1CICB 3C60B 4UV4L 3TVMA 3L9RA 3L3IA 1EEZB 3EDFA 4NJ9H 1YY8B 2AJSL 4QHKI 1HILA 1RSFA 3QUXD 1A3LL 3EO0B 1HOCA 3C87A 1ZHBB 5T1KB 1QR4A 4R7DA 4MA8L 1RIUL 5F88B 5EOQL 3QZWA 1RFDL 4Z0XA 4YFEA 5JOPD 3U7AA 5ICXA 2CD0A 4CVXA 3QFJA 3VGFA 2ICWA 3RY5A 4NM4L 5SX5H 5IWLA 1C08A 4JR9H 5A16B 2R2BB 5I1HH 3SPVB 5JNYA 2BC4B 1ZANL 4L4VE 5FECB 4JGUA 1L0QA 3QCVL 1WWAX 1QHPA 3GO1H 4D0CB 4Z76B 5KVDL 3VWKB 1NCDL 3QDJB 1RIVH 5HHNA 1D6VH 1HHGB 4LSRH 3FHAA 3ARGC 3P9MA 1Z9MA 5FYKD 1YEDB 2DLFH 2CGRH 5ALCL 4KROB 2DQFB 1ADQH 1HINL 2DI7A 4Q58C 4PLKC 4N0CD 1KCKA 2NW3B 4XPFL 3S98A 3FQTA 4MNHA 5F7KC 1KJ2H 4WU5A 2XTJC 3TYGH 4KDTA 1HSBA 2BVTA 4AJ0A 3K2MC 2G60L 4HH9B 3TA3D 4I77L 4LLQA 4HKXB 4OD2B 3GMQB 4P3DB 5EC2B 2GITA 5JXAL 5DJAA 2Z4QB 4FQXC 1MFAL 3NN8B 1RUAH 2P24B 4YDKH 3ARFB 4OFYD 1LE9A 5JHLH 5AWNH 1EZVX 4KHXH 4LAQH 2EDTA 4XH2A 4H1LB 1LMKA 2EDWA 2Q3ZA 5KN5A 2VISA 1SYSA 1CXFA 5CINL 3HMXH 1U8PA 1MJ7L 5IHBA 1KIRA 5CCKL 2EC8A 3PP4L 4MXQC 1KJVA 3I3BA 4RMSA 1SYVA 1DEEA 1MHHA 1ZT1A 3X3FL 5KAQG 5BW7A 4Z95L 3OKOA 3T65A 4ZOCA 2DQTH 3EJZC 1LDPL 3ARPA 1ND0A 1G1CA 4F37K 1I75A 3E2HC 4NKIH 1P4LA 4MJIE 5GRWA 1DANT 2HN7A 3MJ8A 3U6RB 1FGNH 3I84A 2NXYD 1S5HB 3QXWA 2F53E 4OM1H 2JCCA 1IZJA 3GJFK 4NP4L 4CGTA 2JB6A 2QV2A 4NUJA 1N0XL 1PEWA 4PJEF 1XR8B 4PJCF 1BHGA 1DVFD 4PP1C 1OAKL 3I75B 4NN6C 4YUEL 3B5GA 1AQKH 4QTIH 2DI8A 4A2MA 3HRZB 1LO0H 1J0ZA 1HH9A 1LO2L 1V3LA 5I17B 2F8OA 4FZEL 2JKXA 2D0GA 3MZGB 4X99A 1N5AB 1CFQB 2VR4A 3ZDXE 4NQDA 5DI8A 3S9DB 2VZ1A 3S5LB 3MCKA 1C12A 4ZXBD 3FQXB 3OHXB 3TJHD 2O5XL 1U93A 2SEBB 3CFIC 4LASL 3GMPB 1MPAH 2X1OA 1T5WB 5HXMA 3C6SA 4G9FD 3Q6GL 1IKFL 5DD0L 4G3YL 2R1XA 1RJCA 3D6GA 4W70A 1OSPL 2DJ4A 5BZDB 2NTFB 3M8OH 3MJ9L 4HIIB 4F57H 2XY2A 1QG3A 5D7KD 5EU3A 4CL7A 4KTDH 3TBWB 3MLRH 3L3JB 3IDJB 1QEWA 3DI3B 4FOMA 4QHNA 3V0AC 4R9HA 1MH5A 4S1SL 2CIIA 4R0LC 4OV6F 4GAFB 1T89A 3D85A 3QEGL 5ISZE 1U3HD 4RNRA 4GBXC 4MNGE 1MOEA 3OJVC 2HFTA 2FJHA 3FO1A 4KRMB 4J1UA 4HXAH 2FYYB 4PJHF 4PJBE 1EV2E 2RGSA 4XP5L 3ZZ1A 4M7JH 3EFDH 4OCYL 1HNFA 4MWFA 4OZIA 5GRUL 3GI9L 4H0GA 6FABH 1FBIL 1JYVA 4L3CB 5E6IB 5TDNB 4LQFH 1X7QB 2W0KA 3UPRA 1M05B 2B4CH 3QNXA 5EDXA 5F8QC 4PRAB 3TWCH 1Y18A 5JOPE 4K94H 5ID1B 1KYOK 1JFQL 5FK9B 5GGVY 2GIYA 4QRPB 1XF3B 5E99L 4OF8A 5DJ2A 1GIGL 4F9LA 3ELAT 4UDTB 1WZKA 5CBEA 5KSUA 5EULV 1B4JL 2OR9H 1S3KL 2AV1B 1HQ4A 3HB3D 1NL0H 3BUYA 3QAZC 4KK8D 4F7MA 2A74A 2BVQA 4UINL 1C8PA 32C2B 4GG6B 1LGVA 3M1BA 2G75A 5FYKE 4I18C 3QIBC 4P49A 5TH2A 5CP7A 1UZ8B 5C0IA 3WFZA 3FQWA 2IH1B 3BPOB 5C1MB 1FFRA 2ADFH 5GSRB 5H94A 3TCXA 1RZGB 4HS3B 1JZ6A 1YPZF 2R29L 3AU1A 3MLYL 4UT6H 4Y2OA 3GSNB 1I7TA 1IC4L 1GAFH 1TJGL 3UJJH 5E4EC 3HNTH 4QRUB 5EUKB 5I1GH 4ORZC 3WHE0 3SGEH 1QRNA 2H3NB 1JN6A 4NC1C 4S0TD 2V2TA 1MRDH 3TP4A 1MY5A 1NJ9A 4LCIH 4KTEL 1VA9A 4WW2A 1H5BB 5MHSD 1JF6A 3H7BB 3I6GA 4NO2A 3ARDA 4KFZC 5MI0B 3IS0X 3HPJB 4HQQH 5IBUG 4JGMA 4ZTPL 1J1PL 1WT5A 4MVBC 3WDIA 4HUXB 5TE7H 3HMWL 4LLUA 4OCXL 3IDGB 5D72H 4APQA 5E8EA 2VXSL 5DHVB 1ONQB 5E1AB 2Y25A 1WWBX 5J12B 1EAPB 3STBA 5EO0A 5B39B 1U8KB 5KSBE 2DF3A 2VLJA 3ZSSA 1IEBB 2XV6B 4PFEA 3ZDZF 2XACC 1A0QL 1UM4L 2BOCA 3FOLA 2LVCA 4PLJD 1CK0L 4OF7A 2ADGB 1WTLA 2RCSL 4U3HA 1P1ZB 2BY0A 1A6VH 1HYRC 2FB4H 5HGGS 3TT1L 3GSUA 1NEZB 1J9CT 1KCSH 4GQ9H 4X8JA 5BOPA 3TN0D 1EDQA 4BQCA 3DOSA 4MQXC 2P8LA 4X6BB 1K8DB 5JOFB 4J7RA 3L3GA 1X3DA 4NPYB 1G9MC 1S7TA 1CG9B 3AVEA 3AY4A 2I07A 3KPSA 3L5WB 1T6WA 3A0OA 4J3XA 4OFVA 4FN0A 3SE4A 5KVFH 5MERA 3CZJA 1AI1H 3DVNB 1KJ3L 2DYPB 3LZFH 2ENSA 3EBAA 5INDB 3I6KB 2JK5B 2C1OA 3GGWB 4L1HA 4O2EB 1RUQL 2EEBA 5MEQB 2L4OA 3OXRB 4TNWK 4FQCL 2PO6B 4B7IA 5HGAB 4GMSL 3RWFB 3GMNA 3T0XA 4WI8A 4DGVL 3ZT6A 1NCWL 2VRAA 3TO2B 1H8SA 4P57A 2G5BA 4UILH 1FRGH 5IFHH 1BX2A 3TVMD 2J1KA 3K1DA 2Y6SC 1T03L 4HS6A 1URLA 3LQZB 5D7KE 1IT9H 2QR0A 4A6YH 4XCYB 5C09B 5IBLD 3PHOB 4OZ4A 3G5XA 2X4UB 3CDGA 3UTZA 2RHEA 1GGBL 3H8NA 1EHXA 2FZ3B 4OT1L 3SDCB 4PJFA 3OAUL 2HP4A 5C0DB 3AS1A 3ZE2F 5IMOA 3ARGA 5LG1A 4MDIB 4TSBL 2VAAB 5IR1B 3FFDB 4N5UA 1YYLL 5D6DC 2PYFA 3BWAA 4LSPH 5MENA 5C8JA 3G6JB 4N5ED 5CJQH 1MWAL 4U6YB 3OWEA 4YHYC 4GAJL 4ZODA 1RHFA 3H3KA 4NZTL 5JW3H 4MSWA 2PR4H 4LDEB 3F7VB 3D0VB 4F9PA 4CMHB 3KLHC 3EYSH 3ULUF 2HLFC 4P3CL 3MJ7A 3SGKA 3DHJA 3C5ZB 1N5YL 3SDXE 3C2AL 3WFCL 4AQOA 3LMJH 1I3GH 3QUYB 1IKNC 3MNZB 4D0DA 1OAUH 3ARYA 3DX8B 1DE4A 2C4XA 3T4YB 1IGTB 5IT2L 1WFUA 4C55A 2D03L 2B1AL 2DD8L 1KC5H 5J6HB 1DANU 4F15B 2XZCH 3QUKA 4WI3A 2P45B 3T3PE 4ACPA 2AI0L 4QXUL 3S4SA 1UYWH 5CIPB 2F58H 5ESQA 4Y4FD 2W60A 4BSVB 4R4NC 3SEPA 4QHUA 4JFDD 2ADJA 4NC2B 1CLOH 4OLYH 2VDPL 3NFPB 4Y5XC 1CLZH 2FWOA 1IAKA 2ESVB 1GGIL 1RZKC 1Z9LA 1CIDA 5C9JB 2H2PD 1PLGL 3FQRA 4OD3L 4EIGB 1CR9L 4KY1H 4G42B 2PXYC 3HLAB 1KN4H 5IF0A 3VW3L 3L3DB 4FQ1H 4BFIA 4B41A 3ES6A 5EO9A 15C8L 1J8HB 5JMOC 1A3QA 5DUMH 3VCLB 3WFHB 3V6FA 4CU8A 2AJZB 4RMUA 3CLEH 3MRFB 2CUIA 4NJAL 5MHSE 4KMQA 1A47A 3MA7B 2IQAB 4XNMA 1FZJB 5DD1H 2X09A 4FS0A 4NOFA 4JY5H 3D9AL 4UDUB 5BMFL 3U2SA 4XCNA 4F3FB 3TNMB 3W2DH 1NAMA 4C56A 1IM9B 3IVKB 3ZMRA 1UWEL 4Y4HB 2ATPA 2VN7A 4HZLA 3F12A 3O6FC 2AQ1A 5IJVB 3GNMH 4MS8C 4NNXA 2XKUA 5HHOB 4M5YH 2HH0L 1R5WA 4YDLB 5IB4B 1UM5L 4UQ3B 2ZOKB 4PTTB 3ZKXB 2X4TB 3AREB 5DF0A 1H3PH 4P5TC 1EX0A 2WNGA 4GG6F 4NZRH 3MRPA 2YA2A 5F1NB 1U2HA 1FZKB 4BSJA 5F96L 3C8KA 2X4PA 3ARBC 1UT9A 4ZFOA 3VFMB 3QO1A 1F5WA 1RQ5A 1OAXH 2OJZL 5IP4A 5IVXE 5KS9E 3HE6B 3P9WB 5CIPH 5DK0B 2OSLB 4POZC 3BISA 1XCQA 4U0RC 3RNQB 4O9HL 3MV9A 5D2NC 5GIRB 2DQIH 1TZHA 1EHLL 2YN5A 3BUTA 1KG0B 5EZLA 5CJBA 3V4UL 3D85D 4HFUL 2VLKB 1CICC 4PJ8B 4H0IA 4WHCA 3C60C 3IDUA 3QCTL 3SGDH 5F9JB 2VH5L 4OF5A 1MLCA 2NZIA 4WVRA 1U6AL 4Y16B 3O41B 1YEGL 3IGAA 3PNWB 3RP1A 3DUSA 3LB6C 1BM3H 4X8XA 5JQ6H 3N9GL 3GDBA 4TVSa 1AGBB 2CK0H 4QXGL 4EBQL 2OZ4A 4G6ML 5F89A 3W9EB 1OOAA 2BY1A 2VDRL 3RUGA 4WHYH 5DURB 2NPLX 5E56A 3AGVA 3MRCA 4KWUA 3L5HA 3MFGB 3TBTB 1EHAA 4XPBH 1K4CA 5DFVC 1IVLA 1YY9D 3NIGF 4I2XB 4QOKA 3ZTJG 3HNVL 4G8GB 2QHLA 4QCIB 3IT8D 2NZ9D 4XRCB 1YECH 4JPKL 1DFBL 5TDPB 3BGMA 4ZQKB 4WTZG 1IFHL 2BSTA 3HI1A 4U1JA 1DN2A 3RWJA 1ZEAL 2O61B 4OD1H 1Z5LB 5GZOD 3VWKC 1JWUB 3QIBA 1CWVA 4WI7A 3BH9B 4GQPH 4FQQB 4E42B 3VFVB 3ILQC 3EFFA 3QRFM 3MO1A 1ZGLB 1VDGA 5L88L 4KROC 4U7MA 4PJIB 4P9HH 5BVPH 2Q8AH 5IVZB 3GRWH 1NC4D 1LE5A 3HR5A 1T1ZB 1OWWA 2HFEA 4C83A 3BN9C 1P4BH 2XZAH 1JCKA 1WEJH 1C1EH 1T20A 3K2UL 4LU5H 4GLRI 3SO3B 3O3DA 4NWUH 5DJ8B 4ODVH 1BBDH 5FYKL 1MRFH 3ARFC 3U0PA 3KXFA 2Q7YA 1OP3K 1P2CB 1C5DA 2HLAB 4PJ5D 2J88H 1DSFL 5GQBA 3QYCA 4S1RL 4HC1A 2OL3H 3KLSA 4S2SA 4MXWL 4GKSB 1BJMA 3S37L 1YYMH 2DDQL 4U6HA 4JHWL 3MSPA 1YN6B 4JFDE 4OLEA 3R8BB 4LFHG 5T5FH 2I9TB 1G6RB 1MFBH 1CGSH 3O4OB 2LAAA 3C9NB 4LSVL 2P46B 1K6QH 1UEYA 3LHPH 2GSIA 1A7OL 5KVEL 3BEVB 1WBXA 5HDBF 1VSCA 5ITFA 4G43B 1T7WA 3G6JF 5IB2A 1OB1A 3BIKB 4ZMAT 3CH8A 3MUY1 1R24A 4S0SD 3MBXL 2DQUL 3TH4T 3CAFA 5FGCE 5I1DB 1JGLL 2ZWLT 2DQDL 4WNQA 4YC2B 4YLQT 2IGFH 4DWHA 4AEFA 1LD9B 3RWEB 3QNZB 1SQ2N 4NQVB 4EUPB 3H0TB 2BNQB 4TYUA 1JPSH 3HCVA 4H1LG 3SQOL 3V8CA 2AJUL 3NZ8A 2F54A 1HHJA 1J1OL 4AH2B 3HC4H 3ULUC 4PPTA 4UBDD 4TUOB 5I71B 4XWGL 2QQLL 3O3EB 2CPCA 3CMOL 2OP4L 3RDTC 1T1XA 1A4KB 1QFWI 3PL6C 2CQVA 4NIKB 5BV7H 1LP9B 1WK0A 1YEIH 2DRUA 4IS6A 2YC1B 1M71B 2AP2A 3LRSB 5IW6B 4H8WH 4XVJH 1HH6B 1KXQE 3V5KB 3HZKA 3BPNB 1KNOA 1P84J 1VFBB 3DRQA 3P0VL 1N64L 1OGTB 5JLZB 5TFSL 5KTEL 4XAWH 2A9MH 4AENB 3UJIH 3L3HB 5D6DA 4TSAH 2BSRB 1INEL 3IJHA 2GAZB 5BJTA 1KCUH 2FBJH 4LDLB 3KWWB 5ICYB 4FFZL 1MJJB 1UB5B 4K9EC 4X83A 1WZ1L 2Y7QA 4PJCA 4PJEA 1NFIA 4U1NB 4OZFH 5JPNB 4PTUB 3WDHA 1JI2A 1S9XA 5JMRA 3ARGD 4N8VB 4RMQA 4ALAL 5A2FA 4OKDA 3X14B 2AJXH 3WKNA 5DTFB 1ACYL 2JE8A 3HG1A 2V7HA 5FYJH 2Q87A 4NQCA 1AD0A 1CT8B 2GTZB 2XTJD 4PS4H 2KBGA 4U1IA 4M6MH 5E6IC 3L1OH 5C0AA 5HDQH 2WINB 1CE1L 4FNLH 1AO7B 3SQBA 3WIHH 5F1OB 2APFA 1AE6L 1IM3A 1RUPH 3B2UC 4FQXD 3M45A 4HWZB 1VKXB 4M8QA 2BVEA 3H42H 3GSXA 1JGVH 2QKIB 1PY4A 2DQHH 5BOZG 1DBAH 5FUZL 1YMMA 1U8IA 4PRPA 2H32A 4MXQD 1XF2A 1A4JA 4ODHH 4Y5XA 4JFEB 4ONHB 4I0KA 4JPVL 4YGVB 4MJ2A 2A83A 3N1PC 3HUJE 1ERNA 2EYSA 4NQED 2VL4A 1A3LH 3EJZD 4JANA 4LQ1A 3WUZA 4YEFA 1PBYA 3LKOB 4JQXC 2GHWB 4NYLA 3CJJA 1FN4B 4K8RH 1E6OL 4MA8H 4KQ4L 4URTB 4Z9KB 4K7FA 1UWXK 1BQUA 1JRHL 2OXGA 1BPVA 5DD6B 4XAKD 2R2HB 3MROA 2CIKB 1FZOB 4HAFA 2ATKB 4LIQE 4NO0B 3KJ6H 1YMHB 3LKSB 4NN7B 1PQZB 1PKQA 4AIZA 4QRSA 2BHYA 5JR1L 3PGCB 2AK4D 2MWCA 2I27N 4PP1D 1DQLL 1ZHNA 2OR7A 1T0NA 4LBEA 1LEIB 5EA0H 4PJDE 1I8IA 3U7WH 1H5BC 3OG6B 4PJ5E 5KG9A 1X5LA 1AR1C 2VDKH 5C92A 3CX5K 3O6FA 4AQ1B 2BOBB 1S5IL 5IGXH 4CNIA 2HWZL 2R4RL 3CSGA 1TTUA 1MIMH 3U30B 3H9HB 1VHPA 5FHBH 4N8PA 3V5HA 3MRHB 4X7SH 5SWSA 5J11B 5GSVA 1NDMA 1Q9WA 4YQXL 3QPQC 5ACLA 4XCEA 5KJRL 4RIRA 5DRZB 5J12C 4WY7L 2MQCA 4QHLA 1CFSB 1IGFH 1KJ2A 2BSSB 3LEYH 3KPRB 1Q0YH 5FYLD 5LWYL 3A6OA 3ARBA 1Q8MA 4L3EA 1CLYL 3DUUB 5IG7B 4FQJH 4PJIF 4U1HA 4Z7QE 1J0JA 3R1GH 1NGPH 3UO1L 1MI5A 4OCSL 1RK0B 1S9YA 1O0VA 5CP3A 4PB9H 3IAPA 5D2NA 5ENWB 2W65B 4Y2DB 2YUXA 2XN9B 2E5EA 2B7DT 1N8ZA 1A3RH 1U3YA 4S1QL 4RGND 1TVHB 1YPZA 4LF3B 4PGCA 5EOCL 4ZSOB 2B0SL 3HMXA 1W0WA 1Q1JL 3KR3L 3C60A 4CW1A 1MAMH 4GBXD 2OLDA 1A9EB 4R97B 4P3WA 3WFDH 1EEZA 4LLMB 1CN4A 1YY8A 2E6JA 5E8NB 4H88H 2QSTA 3GIZL 4JKPH 1HHIA 3EO0A 1YUHB 3VGAB 3UROR 5ADOH 4M7LH 5T1KA 3B83A 1KCLA 1KXTB 5F88A 3TV3L 2WAHA 2PO6C 3AMKA 3WHXB 5J8OA 4N0RA 3E6HA 5B39G 5E00B 4I3GA 2QSCH 1I8KA 2FO4B 2CXKA 2VDLH 1REIA 5A16A 3NCMA 2R2BA 1CDGA 3SPVA 4DGYH 2OYPA 1Y0LB 4CMMB 1MFCH 2BC4A 5FECA 5D7IE 4WHTA 3G5ZB 2VZOA 4D0CA 3SDCC 2AERT 2IG2H 4Z76A 1NEZG 4O02H 3VWKA 3QDJA 3VRLE 2IC2A 2DWDB 3MYZA 1HHGA 3OJDB 5A40E 5LQBL 1G7HA 3RA7H 3THMH 4LEOB 1YEDA 4NBZB 4R96B 4JFYB 2NW3A 5FO7B 3PWPB 3Q6GH 1X9QA 2R0LL 4HH9A 5DHYA 3QIBD 4LVNB 4TVPH 4OD2A 2AJVL 4L4TD 4P3DA 4GAGL 4HXBL 5EC2A 3FHQA 2C7UA 5L6YL 2XTJE 3O9WD 3QUML 4JFFB 4CMHC 2P24A 3S34L 3ARFA 1UJ3C 2PW2B 4KV5E 4GKZB 3HE7B 4H1LA 3I50H 4Q9CA 4WJ5B 1MIEH 3VXSD 1NUDA 4WGVB 3OQ3B 4OTXL 4MD5B 2R0ZH 1MCKA 1EVUA 1LP9F 3OAYH 1MHPH 3KPTA 3VFTB 4HV8B 2P48B 5GJSH 3PUCA 3KS0H 1U9KA 4F15C 3QXDA 3UTPD 3GMLB 1FO0L 3KXFD 1EMTL 1T0MB 3QR2A 4MVBD 3GBNH 3RVVC 1UGNA 3FFCD 3SE8H 3U6RA 4PUBL 4NQEE 5F1IA 1S5HA 1NMCB 4LKXB 1RUKL 5F7LB 2VC2L 3S36L 1GHFH 4DTGH 4LL9A 4LHUB 2DBLH 5FF6B 1XR8A 4G8EB 5K9JH 2EE2A 5BRZD 1JWMA 4XAKE 1XGQB 4DN4H 3I75A 2X4SB 3WS3B 1P4IH 5J9PB 5JTWA 2Q20A 3HRZA 4YXKH 5FUCC 4YK4B 2A77L 5H2BB 1NFKA 4OF0A 2IH3B 2AK4E 1TMCB 1N5AA 1CFQA 3PP3H 5EBLB 4MQXD 3S5LA 1BAFH 2WWMC 3FQXA 4X9GA 3OHXA 4XGZB 1P84K 3GMPA 2VMFA 1FE8H 4YDVA 1BOYA 3HZYB 3O11B 4IRSB 4HKJB 4Y19D 4Y4HC 3FN3A 2CKBL 2FBOJ 5FCUL 2NTFA 5BZDA 5D1ZC 4HIIA 2DLGA 2F54D 5IV2B 3IKCB 3JWOL 4FQLH 3IDIB 5C6PB 5FYLE 3TPUB 4DZ8B 1N6UA 3ZKXC 3AREC 3L3JA 3IDJA 1KN2H 1YQVL 4N90D 2Y6SD 3VG0L 8FABA 1A7NL 3JV4B 5IOPB 4XBPB 4KKAC 5DC9B 5BXFA 1CZ8L 4I3RH 3WIIH 4PB0L 3HE6C 1NAKL 4RGNE 4EI5A 1GZQB 3DUHA 3P2TA 1MAKA 3PWUB 1FQ9C 3NVQA 2IPTH 4P23B 5BZWB 4Z7NE 3BZEA 3C08H 1XGTA 4L3CA 5E6IA 5TDNA 1X7QA 3QG6B 1I9IL 2G9HB 3LEXB 1OD9A 1M05A 1MWAB 4Y16C 3VH8G 4KU1A 4PRAA 3ARVA 3VD9A 3VA2C 5M7QA 5GGSB 2KKQA 3KLHD 3IU4H 2VYRE 3S8WA 2HLFD 4QRPA 1U36A 2I5YH 1XF3A 4KGLA 1Q9OB 2NY0B 3RWGB 1J86A 4XHJC 1MCPL 4NQCD 4UDTA 5JHDB 4D94A 2F8XC 4G6JH 2XRAL 4N0YH 3NZHL 1DQQB 2AV1A 2QEJA 3VFOB 3OKNB 3N06B 3VA6A 5EU7E 3IF1B 32C2A 3OAZK 2QL1A 4GG6A 1DBMH 1ZA3B 3VWJB 2J6EH 1U8HB 1KCRL 1XF1A 1TPXB 4IHOB 4X4MA 1OL0A 1F58L 1R5IB 2JB5H 3TZVA 1UZ8A 4D3CL 3HC3H 5GS0H 2IH1A 1UC6A 4R4ND 5C6TH 4G9DB 5GSRA 1YMMD 5CD3A 1RZGA 4PRPD 3E8UL 3GSNA 3MRDA 1IGCL 4TUJB 1MELA 4M8VA 5D8JL 4L4TE 4RISL 4QRUA 5EUKA 3SE9L 4F33B 4EXPX 2H3NA 4X7CC 2PXYD 2MPAL 5KANI 4J2XA 2LAGB 4EOWL 1BIIB 4N1CA 1H5BA 3SO3C 2VR9A 3H7BA 4NC1E 3VXSE 2WZPD 4DEPC 4AM0B 2ZG1A 3JWDL 4OCMC 4D0BB 3HPJA 3NACH 2XXCB 4JJ5B 1XR9B 4WDIB 4OUUB 4JKWA 3IDGA 5EFIB 4X6EB 4MJIB 5DHVA 5C07D 3UTPE 3KXFE 3PHQB 5F72S 1BFVH 4HMEA 4WUKH 1EAPA 1U8KA 1T5XB 5B38B 4KUZL 3FFCE 1P7QD 4MMZC 1HXMB 2A6KB 4MS8D 4BZ1H 3O4OC 4NCC2 2F19L 2ADGA 2E9JA 1QBLH 3MLZL 1P1ZA 1KENL 5EU5B 3BKCH 3GUTA 3SGJC 1Z3GH 3OGOE 5BRZE 1A7RL 1NEZA 1UZ6F 3HNSL 4P5TD 4NRYB 4WEMB 4X6BA 1K8DA 5JOFA 2MQ3A 5CILH 3NAAL 4BQBA 4Y5YC 1F2XK 4NPYA 1CG9A 3D0LB 3L5WA 4AG4H 1DL7H 2IAND 3ARBD 4GMTL 4KQ3H 4YC2C 4L3ED 4XC1L 2D7NA 2ZCHL 5BVJB 3DVNA 2DYPA 1JGDA 3EIFA 3MFFB 1MI5D 4YFDB 4POZD 4Z18A 5GHWH 1RZ8B 3BP5B 2R69H 5INDA 3I6KA 5DZOA 1GGCL 2JK5A 3KYKH 3GGWA 5C2UB 1AHWB 4O2EA 4Y19E 1UH3A 5MEQA 2VDPH 3OXRA 1NUNB 2PO6A 5HGAA 3RWFA 4G7YL 4H20L 3P0GB 5F9OL 3TO2A 2QQKH 3FAWA 4FQHB 5HYJB 1CICD 5ABDE 5I71C 4FZ8H 4P0DA 4EQ3A 1DBBH 2BMKB 5DJZB 1CR9H 1LO3L 5D7JD 2F54E 4W6YB 3SJVD 1KJMB 1SJEB 3LQZA 1U8MB 3DO3A 1FIGL 3IXAB 5C09A 4OBSA 5IB5B 2X4UA 4CU7A 2MSPA 3JWNC 5T1KD 3B9DA 3HI5L 4N90E 1FL3B 1AGDB 2FZ3A 3WHE1 3SDCA 5AZ2H 3EOAB 4MNGB 5C0DA 1U92B 1QSEB 5GS2D 3P9LB 1FH5L 1R0AH 4FQ2L 4N9GB 2ILLA 4MDIA 5DFVD 2VAAA 5IR1A 4NT6B 3FFDA 1BGXL 1OARH 3X13A 4JZJB 4MHHI 2ZUXA 1D5IH 3FQNB 5FA3B 3AXLB 1INDL 4HCRH 2X1PA 3QUXB 3KHOA 2LQRA 5I8CB 4EUPG 5ADPH 4U6YA 4Z7WB 1AQDB 4KK5C 3VWKD 3QDJD 4LFHD 2A73B 5LXGL 4JO4H 2V5TA 1CVSC 3ILQD 5KZCB 3F7VA 3U83A 3K74B 5CEZD 4HT1L 4KROD 2A0LD 3B8YA 3C5ZA 3UDWC 4PJEE 5GGQH 3QUYA 5CD5C 5A2JH 2X4QB 2M1KA 3AC0A 3DX8A 3MNZA 4R4BB 3VI3E 1KEGH 2X89A 3T4YA 1IGTA 4WW1B 1A5FH 3B8SA 3BN9D 2A6DB 3DSFH 4M5ZL 4ZFGL 4XPTL 2LVEA 1RZFH 2Q86B 5J6HA 3T4AB 4NQCE 3CSYB 2E27H 1HZHH 1Z9OA 2XNAA 3PDOB 3FQUA 3RHWK 4CDHA 1PGRB 3ARFD 4WFGD 4XXCC 5CBAB 1NCAH 4LAJH 1PAMA 3IRPX 4LCUB 4O9HH 5CIPA 3X11B 1VEOA 4BSVA 2FDBP 1LVEA 3HZMB 4GUPA 4C4KO 5I66A 4OKVA 5IVOA 1UXWB 3TJEL 3NCYS 3NBNA 2XWJB 3CC5B 2ESVA 3GHBL 3I6LD 3TA3B 1SBBA 3QQ3A 2FGZA 5C9JA 3RVXD 1YMME 1PW3A 2XICA 1FLTX 4PRPE 1J5OH 3HLAA 4ONOA 3H3PL 1IC7H 3L3DA 3V95A 3NABH 1JL8A 5CAYB 1BQHA 3RI5K 3LS4H 4QXGH 1J8HA 1E4WH 3CDYA 3VCLA 3WFHA 1JGUH 1JPGB 4NQSA 2UZIH 2AJZA 3F62A 3MRFA 4NN7C 5ID0B 4NHCH 4JQIH 1LO4L 5DQDL 2ZSWB 2E9IA 2IQAA 3U7YH 1FZJA 2VLMD 4UDUA 5CSBA 4HMCA 4F3FA 4JZNB 2ED9A 3TNMA 3QNYA 3MA9L 2OJEB 4PJHE 3F58L 2C26A 1PKQE 3QULB 3IVKA 1LK3H 1RURL 4Y4HA 4HPOL 4FFYL 4NGHL 4X80L 3MNVB 1LDSA 2FGWL 3OKMB 1W72L 5C07E 4Q0XH 4RX4D 5LVEA 3FMGH 2YZ8A 2I9LA 5D6CA 1X5GA 5KANG 5KSBB 3U30C 4KAQL 2R4SH 4GRLB 5IM7B 3W39A 2NTSP 4HPYH 1P6AB 2AEQH 5J11C 1S7WB 3NFNB 5IB4A 1BF2A 1UVQB 4JFPB 4KMTH 1T2QL 2VITB 2ZOKA 4PTTA 1CXHA 1RV6X 4UQ3A 3ULUD 2X4TA 3AREA 1ZLVK 1AGCA 5IESH 4ELME 1ITBB 5JW4R 5E5MA 3GRWA 3RDTD 4JO2H 4M7KH 1L7IH 5F1NA 1N26A 3PL6D 3WBDA 5L8JB 1FZKA 4U6XB 1WGOA 2EH7L 3G9VA 4M6OH 3IJYB 4P59L 4XMPL 3I2CH 2VZSA 1CTOA 3VFMA 1T6VN 3MV7E 3C2SA 4P4RB 3HE6A 2OSLA 4WEUD 1NFDE 1DZBA 4RGMC 3RNQA 5GIRA 2IANE 3QHFH 5EO1B 4Y2DC 4L3EE 5DD3H 5IBTH 2HA1A 2H8PB 2D31A 1KG0A 2ED7A 3MXWL 3B2VH 3V6BR 3D18B 5T1MB 1MI5E 4JFOB 2VLKA 3V8OA 4PJ8A 1DBJL 5D2NE 5F9JA 4U1KB 4R97C 4PJGF 3AS2A 1KB9K 2YD3A 4LRIC 3O41A 3D2UD 3PNWA 4HK0B 4JN2B 1V3MA 4LMQI 5HHXH 1YPZE 4JO1L 3JUZA 2NY5L 1QTYT 3VGAC 3Q3GB 1AGBA 4YHLH 1S9VB 1KPUB 3MV8D 1I3RB 3D3VB 4PG2A 4IDJH 4WEBL 3SJVE 3W9EA 5JORB 2YN3A 5E6ID 3TBTA 5E70A 1K5NB 5E94B 5IQ7L 4HUKB 4ZO8A 4I2XA 4M62L 3ZO0A 4G8GA 4HBCL 1G0DA 1L0YA 4GRMB 5L2JB 4QCIA 4M1DH 4XRCA 1D7FA 3B2UD 3WIFB 4L29B 3PQYA 5TDPA 1JHKH 2NLJB 1J88A 3X12B 4ZQKA 3BE1H 3OG4B 4OM0L 4QRPD 1Z5LA 3DWTA 3G6DL 1CU4L 4FQQA 1IEHA 1S7RB 3VFVA 1T66C 2R9HC 3ZDXF 3DV4B 1JIBA 2BCKB 1RVFL 1WAAE 2BFVL 4LVEA 1VFMA 5DEGB 3ZKMC 3SKUD 3QDJE 5IVZA 4M48H 4JM4H 3IFNL 3BDYH 3ZDZE 5JW4N 5ILTL 5CEZE 2D7TL 4MHHG 4LVNC 3WLWC 1X5HA 1AC6A 5DXWA 1J05B 5DMIL 4G5ZH 3SHSA 4GH7B 4KVNL 5DJ8A 4MB5A 3TEUA 3TYFB 2FX7L 2NX5B 5LGHL 1P2CA 3REWA 1B9ZA 3HE7C 2A6JA 1OAQL 3T09A 2YD5A 4UU9B 2Q1EA 3QT2A 2Y36L 5D7LB 1IQDB 1E4XH 2O5ZH 3UXFA 5C0GB 2EDJA 4P5KB 4MNQB 3ZT7A 1AR1D 2JJVA 4HWUA 1UADC 1PSKH 2I9TA 1TQCB 3AB0C 4K23L 3C9NA 1AGEB 2W9LA 3I6LE 4OZFA 4R90H 3QDMB 3FO0H 3IFOB 4OGAC 3BEVA 3QPQD 1NMCC 5I1AB 1RZ7H 4LHJB 1HI6A 3MR9B 5FV2A 1X5YA 3RIFF 4P2QA 4G8FB 2XA3A 3VFWB 4Z7WF 4IMKC 2XWBB 4OCWL 5IHLB 4C58B 5I1DA 1AFVL 2J4WH 5SWZB 5K9QI 1J0IA 3QCUH 2HFGH 3ZE2E 2EDHA 1LD9A 3P3YA 3FCTB 3QNZA 2YKLL 4NQVA 2DTSA 4YK4C 2DL9A 4P2OC 3H0TA 5T5NF 1MVUB 2VLME 1MHEB 2YMXL 4LGRB 3AM8C 4HWEL 2J8UE 5FUZH 3FKUS 2OMNA 2XQBL 3P0YL 2GT9B 4AH2A 3H3BC 1ZWIB 3Q6FB 4TUOA 3ARUA 4KJQC 2A1WH 5E2UH 2L7UA 3RBGA 3RVUC 4M4PA 4FABH 7FABH 2EEAA 2DYPD 1A4KA 3ULUE 2EYRB 2BRQA 25C8L 3EGSB 5FAAA 4F58H 1E4JA 1M71A 2YC1A 4UB0L 3LRSA 4XNYH 3RX5A 3TN0B 5IW6A 1HH6A 3V5KA 4CAGA 4JY6B 1CD1B 5E2WH 1VFBA 5IVXB 5KS9B 3EO1B 2FR4B 1OGTA 5MP6L 5JLZA 3ZT5A 4AENA 2W0LA 3L3HA 1UA6H 1DQLH 2BSRA 3BN3B 5C09D 3FL7A 2GAZA 1OY3B 4OB5L 2Z8WC 4M93B 3UBXB 1QACA 3KWWA 1GZPB 3CPLB 5ICYA 5EG6C 1MJJA 5E2VH 5GGRB 5CJXC 4RZCB 1S5IH 3RFZC 2FD6H 4DKAA 4B5EA 2Z8SA 4U1NA 2P4AB 4OGYL 1WFOA 4N8VA 3ALXA 3JVGA 12E8H 3X14A 1XF4B 2CJUL 4P23C 2OM5A 3UDWA 3O6LL 4GT7A 5DTFA 5JW4M 4LGSB 1TJHL 1XGRB 5HI5C 1CT8A 2GTZA 3H9SD 4NNPH 2VQ1A 4NZUL 2Z8VC 3MV8E 1AO7A 5KSBF 1IC5L 2EXWC 1CL7H 1ITCA 2Y07H 2YD4A 5DGRA 4YHML 4D9LL 4JM2D 3MX0A 2ZCKH 3EKCA 3SE3A 4HWZA 2N7BA 1VKXA 4YIQB 3UO1H 3QUMB 1NANH 2YPLD 5E7BA 2QKIA 3ETBF 3O4LE 2NY0C 1UWGL 4K2UL 4R3SB 5E9DD 4RSVA 5F1KC 2X89D 1V7NH 3ULVE 5EOCH 3F8UB 5I30H 4QRPE 3PGDB 4L3AA 4JFEA 4ONHA 3QQ9C 5F7EL 1ZLSL 2VDML 3MLVH 3QEQB 3VWJC 2FX9H 1SM3H 4UZGA 3WJJA 3H7LA 1TPXC 3LKOA 3UTSB 4B7LA 5GJTH 1FO0B 1FN4A 1EPFA 3RVVD 4M3JA 5M95B 2VXTL 4GG6E 5DD6A 2R2HA 2CIKA 3MUGB 5K9KB 2EE3A 1I85C 4ZD3H 3IDXH 1YMHA 3LKSA 3F6LA 1PQZA 5CHNB 3T0DA 5T1DH 1SJHB 1NGXB 4R26L 3PGCA 1JNLH 4LKCB 3U4BL 2DM3A 2VDOL 1N2RB 1NLDL 1LEIA 1J8HD 5DR5L 3RJQB 1XIWA 4LRNH 2X1QA 4Y4FB 5T3XL 2AQ3A 3EHBC 2NY2B 2FHCA 4K3JL 3H9HA 1E28B 4IRJD 3MRHA 2WWMD 4HF5L 4Q7DA 1NMAL 4L5FH 1E0OB 4M00A 4Q6IA 2FATH 5DRZA 5GZNC 1IM9D 1MCCA 4Y4HD 1F4AA 2BSSA 3X17A 3KPRA 1JNNL 4OCRL 2CKBB 5D1ZD 3IDNB 5HHOD 1C5BH 1VESA 4KHTH 3MJ9A 1GL4B 4UIMB 3ARQA 5C3LD 1YNLH 1A7PL 2XTLA 4NFCA 3GKZA 1VFOA 1RK0A 1KTKE 3C6LA 3LAFA 4JRYA 2IADB 3ARED 3KAAA 3NIGE 4R4FL 3RQ3A 4XC3L 5DSCB 1UCTA 3N1GC 2F74A 3NCCB 2W65A 3VD7A 3WV0A 2XN9A 1VENA 1ZMYA 4N0UE 4YX2H 1OTSC 4E41D 43C9B 4ZSOA 3MJGX 1BD2D 3A67H 5HVGB 4KKAD 1A9EA 2JELH 4XNQB 4B53A 1F4WL 2W9EL 4LRIA 4LLMA 3VXOB 3AAZA 4RRPG 5E8NA 4M61B 5IB1B 3B9EA 1EMTH 2GKIA 1FSKC 1YUHA 4J6RH 3O45B 3BZFA 4DFIA 5HDLA 3OKDB 3TM6A 5I1IH 1OPGH 3MLTA 4RCAA 3CDFA 3WHXA 2VLKD 4XVTL 2IFFL 3ZTNH 7CGTA 3DXAD 4NHUB 1TDQA 5B38G 4E9LA 4ODXB 4WCYH 1RZIB 5GGSY 2MCG1 3RVTD 1CTNA 5CZXC 5INCB 1FFPB 4Y16D 1D6EB 2HJFB 5ALBL 2P8PB 1Y0LA 4CMMA 1R3IH 1X5KA 4JVWA 3WXWL 5IEKB 1S7UB 1R3HB 3ZL4L 3G5ZA 3CD4A 4TOYL 2OBGA 1U8LB 3U1SL 1VFAA 4MB4A 5C09E 3I9GL 2Z35A 3OJDA 4LEOA 4JJHA 4NM8H 4R96A 3CNKA 1VPOH 4G8GD 1IAIL 1GC1L 1AY1H 3MRBB 2OS7A 3RZWA 2I24N 5FO7A 3PWPA 2ZJSL 2X4RB 1F6LL 2AEIT 3T1WA 5DRNB 2YSSB 3FT2B 5FCUH 5DUPH 3HR6A 4Q9RH 3WKML 4HJJH 5J13B 3G6JE 2W0PA 3H9SE 2Y06L 2XKNB 4JKKA 4HG4J 4K7PL 2OK0L 4GKZA 5D7SL 3HE7A 3VE0B 3MNWB 2P47B 5I8KH 4WJ5A 1K4DA 4TUKH 4MD5A 5GRVL 2YPLE 2GY5A 3VFTA 4HV8A 2R0WL 4P46A 4UT9L 3DTXA 5EOCJ 1H3XA 1WBZB 3V0WL 1OHQA 5E9DE 5FUOL 3GK8H 1YNKH 2D3VA 1AXTL 3GMLA 5CEZL 3HUJB 5IVXF 4YHOL 5KS9F 3TO4B 4IRZL 2ERJB 1T0MA 3OJ2C 4RAUB 2BJML 3WNKA 1BBJA 2C3VB 3M07A 2YPVH 3QWQB 3MXVH 1P69B 3BKYL 4LKXA 1O7VA 2X10A 1F42A 5IMKB 3HI6L 1JRHI 4U2YA 4JG0H 4YHNB 4LHUA 5FF6A 4KZEH 5FGBC 4G8EA 5IEHB 4MAUH 3UTTA 1XGQA 2MKLC 1JYNA 3VXPB 1QBML 3OZ9L 2X4SA 4DZBA 3WS3A 5J9PA 4OFDA 1FYHB 5ELIA 4JDVB 1HKLL 3QEUB 2IH3A 2V5MA 1D9KA 3F7YB 4RFOH 4ONFL 5EBLA 2CDFB 1N6QH 4CVWA 1QHOA 1J8HE 1SY6L 3RL1B 5FUCE 4HEME 1WC7B 3VD3A 1Z6JT 5B21A 1KLGB 1G7IB 5T3ZD 3HZYA 3MGTB 3O11A 1IGJB 1U91A 4IRSA 2AEWA 4HKJA 5DS8B 5JW5B 3OF6A 4ESKA 1NUGA 2EDFA 5FGSA 4NFBA 2BNQD 3BRFA 3FB5B 3WNOA 4LVOB 4GRLC 3DYMA 4KJWC 5I75B 5JIIA 1ZHLB 1XF5B 5IV2A 3IKCA 3E8UH 4LSUH 3TPUA 4GO6B 4DZ8A 4HX1B 4JG1L 1BWMA 5D9SB 4G6FD 4O4YL 5CMAA 1ZS8A 1F4HA 2X9YA 5HHOE 4QEGA 3RAJL 3LPFA 5HHQB 5GGTH 3JV4A 5IOPA 5JXEA 4XBPA 2J12B 2APWA 1OGAD 3VDAA 1C5CH 3JWDH 5C0BE 4E41E 1BD2E 2HRLA 1HE7A 1GZQA 3T3MF 1A6WH 3MOBH 5DT1H 4J8RB 3PWUA 1JTTA 5FGRA 5C2BL 3VGEA 4P23A 5EWIL 5BZWA 5DJYA 4LIQH 3T77B 4I3SL 1NGWB 4KUZH 5C0JA 4ZO6A 2G9HA 3LEXA 5J0BA 2DKSA 3LKNB 4KK5D 4DKEH 4M43H 1VGEL 4V1DB 4XP9H 4XI5C 4PRHB 4Y4KB 2VLKE 2B2XH 4XCCH 3DXAE 3RX7A 2CR6A 1CGTA 4I5BB 4ZAKC 3MRMB 1Q9OA 3MGOB 5MEOB 3RWGA 4PY7B 4OZGB 5CD5D 3ZDYE 3EOTL 1J0YA 4P4KB 5JHDA 1UB6B 3K4AA 2H26B 4QNPF 4HEPG 4DAGH 1A2YB 4BFEA 2QADC 1DQQA 4YXHH 3OKNA 4RBPK 4LARL 5EU4A 3IF1A 4P2YA 4TSCL 4X6CB 1B2WL 3VWJA 1F45A 1U8HA 2X9WA 4NO5B 2WUCH 3LDBC 1TJIH 4I0PB 1CVRA 4IHOA 5L8LB 3NGBC 4ZOEA 1R5IA 4G8GE 4OQTL 1DJSA 3KLAA 2C3HA 5CEYA 4PRID 4LLYB 2I26N 5TQ0H 1MNUH 1EBAA 1KEML 4M7ZC 4JFED 4TUJA 2Z92B 3VI4F 2ZCLH 3GJFB 4F33A 5HD8C 5D2LE 5AZEH 3MRRB 2ICEB 2XIDA 1G7QB 3ULVL 3MLSH 4PJIE 5GGUB 3WE6B 4HLZG 1AC0A 2HG5B 4YHZL 2O5YH 2Y5TB 4JRXB 5FXCH 5IFJA 1ZK9A 4EDXA 4UOJA 4YO0B 3RU8H 4AM0A 4D0BA 3WO3B 1Y6NR 4NO0D 4U7SA 3WS6C 4JJ5A 4WDIA 4V2BA 4OUUA 5EFIA 1TETL 5TPWH 5E8PB 4X6EA 4MJIA 1N7MH 3MMEB 3O8XD 4JHAL 4NQEB 1F8TH 3VXRB 4WHYG 4Z8FL 1T5XA 4HCRA 3WFBH 4PLNC 1RI8A 4LPCA 3E2HB 3BYYA 4ZYKB 1HXMA 1W72B 1D5XB 1TQCC 3IAGC 5CLTA 3CLFL 1Q9LB 5EU5A 1UCBH 4Z6AT 4OF6A 5EUOB 2VE6B 4YR6B 1EFXB 3H9YA 3O6MH 5T1LA 1A6UH 2IWGA 1DLHB 3OSKA 4J12A 3KPRD 4O58H 4XPTH 3D0LA 5C7XL 3PWLB 5F3HB 3MV01 1NLBH 4PP2A 2ORBH 2GUOB 3QIWA 5HGHB 3MFFA 4ORGA 5EORH 5CJOH 1RZ8A 2IQ9L 2YXMA 4OCNC 5TE6L 5DVNA 3EDDA 2YD1A 4Y2DD 5T3ZE 2XN9D 1AHWA 1OM3H 3FONA 1KT2B 2C9AA 5CSZB 5IUSA 2BNQE 5HYJA 4MCZB 2LV4A 4UT7H 1U58A 4XXDB 1IGIH 2BMKA 1M6OB 3KNBB 5DJZA 5FEBA 3ARZA 1KJMA 1SJEA 3HUJF 1O7SA 1MJUH 2DQCH 1U8MA 5TQ2H 4F7TB 5D1XB 1EEYB 1G9NL 2GSGB 4XPHH 3EO9H 3S35H 1KB5L 1INQA 1FL3A 5F97E 5GGVH 4LCWB 3EOAA 4MNGA 3MUJA 1U92A 1QSEA 1KACB 5E8DL 4EKXA 1I7ZA 3P9LA 4L9DA 2HAZA 1AKJD 1LP9E 2EYTB 2UUDK 4RGNB 4JPIB 1OGAE 4N9GA 3RL2B 4JCMA 4NT6A 4XMLH 5JZ7C 2YK1L 2WWKT 3C5SB 4JZJA 2CMRH 4GBXB 3TT3H 1MLBB 2HKHL 3ZHKA 5CUSL 3FQNA 2DKMA 1TCRB 4JFZL 5FA3A 3AXLA 4G6AC 4M93C 4H8WC 3QUXA 1B0GB 3MCLL 3QDGD 5I8CA 3MLXL 2ZUQB 3UP1A 5C0CE 4Z7WA 1AQDA 1F4XL 2A73A 4ZFZB 1T66D 2R9HD 4FP8L 3GSQB 3O2VL 1I9RL 3CVHL 1G7JB 3IFLL 2WBJC 1JVKA 2BNUB 5TDOB 3ESVF 3ZKMD 2PUQT 3ECBB 2E8ZA 1FCCA 5DJ0B 1FL6B 4MMXC 2X4QA 4R4BA 4GKOA 5BS0D 1N3NB 5JOEA 3OKLB 3D1MC 4WW1A 4ZPTB 3BGAA 1LWRA 2A6DA 4BZ2H 5J7CC 1FNEB 1WZMA 4XNUL 2Q86A 3T4AA 3CSYA 4JFFD 3PDOA 3UC0H 3I85A 1WV7T 5JPMA 3O0RL 5CBAA 2WBKA 3SDYH 2IAMB 4LCUA 3X11A 3HE7D 4JO3L 3HZMA 4OLVL 1NAMH 1BLNB 3TPKA 5TGBB 1UXWA 3V52L 4DKFH 3DBXB 1X4XA 1F11B 5ERWB 4TRPH 3CCHB 5FYLH 3BKMH 3RKDD 1KTLB 1IAOB 3G5YA 3WFEL 2IMMA 1CF8L 2Q76B 3P40A 3DIFB 3TA3A 3ARXA 1XGYH 4XVSL 1NGQH 4PRIE 4L4TB 5FGBA 1QOKA 4UTBH 3O3BB 3O9WB 3L5XH 3R06A 4D9RD 4JFEE 5GPRA 4OFYA 2P1YA 2ICES 1GSMA 5E4EB 4X98B 4HK3N 4OGAD 1JPGA 3OR7B 5CEXB 4PGEB 4RDQF 1E6JL 4JB9L 1IBGL 5ID0A 2RFXB 4MA1B 3WSQH 4JFXB 4LLWB 3FN0L 1KBGL 2ZSWA 4LHUD 3MODL 5DQJB 1MJ8L 2YA1A 3CFDB 1TZGL 4K8RC 5HTSA 3UYRL 4JZNA 3PV7A 2DB8A 1L9NA 2OJEA 1PX4A 3NFSL 1L7TH 3QULA 2P5EE 4RGOH 2VXVL 3W9DB 4BYHA 4GKNB 1KIPB 4P2OD 4Y4FC 3MNVA 3REVB 3G6AB 4OZGF 3FFCB 4NDMB 2NY2C 5KSBA 3VRLF 4GRLA 5IM7A 4MAYD 3O6KH 1B90A 3ZSTA 3IFPB 3NFNA 3EOBB 1UVQA 4JFPA 2VITA 1PVHA 3T08A 4KJQD 1FGVH 4X6CF 5GISL 5BRZB 3RY4A 3VFGH 3RVUD 4L8SC 2DICA 3GKWH 4RWYL 1X6NA 3CFJB 2OZ4H 4BUHA 3BD5A 4KMLB 1YEKH 4U6XA 4DGIL 2X44D 1LHZA 3U46B 3IJYA 4M1GH 3QI9B 4LSSL 1BJ1J 3OKEB 43CAB 4P4RA 3JWOC 3KPRE 4D8PB 2N7AA 3PDDA 3IJSB 5BO1H 4KV5F 3HAEG 5FO9B 2H8PA 4KXZI 4YHIA 3WD5H 3D18A 4PRNB 5GGRY 5T1MA 4Z7UF 4CVZB 3WL9B 4XT1C 4JFOA 4LSQL 1I1YB 4ZFFB 4JRWA 2HKFL 2ZG3A 4U1KA 2XN9E 4JFQB 4JN2A 4RWHA 2VKWA 3HPLB 4K23H 4KDVA 5E8OB 1HSAA 3KHQA 3MUZ1 5E95B 1S9VA 3LCYA 1NCBH 1ZVYA 2DMKA 2HRPL 1KPUA 2D7OA 4HJ0D 1I3RA 3D3VA 1SBSL 4PV9B 4HS8H 4P23D 5TF1L 5JORA 1OVZA 3Q2CA 2R1WB 1CD8A 5HI5D 4PV8B 5E94A 1MHCB 3IB4A 1VADB 1MF2H 1GXEA 1NCCL 1U3HA 3OKYA 3STLB 3VMOA 2EXWD 3BO8B 4GRMA 5L2JA 4LEXH 3WIFA 4L29A 4LGPB 4FQIL 2VNCA 2NLJA 3DNKA 4L9LB 3X12A 1FP5A 3TCLB 2DTMH 1E4KC 1NUFA 5EUOF 2IBBA 4ELKB 1QSZA 2X4NA 1ULVA 4J3WA 5H35B 3BX7C 2NY0D 2V7NB 4HC1H 3U4EB 4JPWH 1S7RA 4XNXL 4DUWA 3PIQB 5JHDD 2BCKA 3D25B 3QDGE 5CZKA 3ARRA 5I8OL 5DEGA 1ZTXL 2AV7B 2J8OA 4KK6C 4WI4A 1NBYB 1R5VA 2PCPA 3NPSB 3QQ9D 3FJTA 4U1SB 5HSFA 3SDXA 2HVKB 3VWJD 3N1MC 1CYGA 3BIAX 3QG7H 3LIZL 3RWCB 1HIML 4HIJB 3MOQA 1J05A 1G7LB 1UZ6E 2P7TB 4GXVL 1JZ5A 4TN9A 5BS0E 3EYVB 4NRZB 3H6JA 3LN9A 3TYFA 5J06A 3BPLB 5J1TC 2NX5A 1G9MH 4G7VH 1DN0B 5CZVH 4EXKA 5IHZB 1YY9C 2WWKO 1IQWH 1KFAH 4JFFE 4XB7A 5JA8B 3GM8A 1JF1B 3KLDA 2FJFB 1UACH 2F5BL 4KJYB 4GW4A 5D7LA 2VAJA 1IQDA 1SVZA 2H1PL 2NY7H 1EO8H 5GZOC 4OLUH 1SEQH 3E0GA 3K4DA 1GJIA 5D70L 1DP0A 4HKZB 1QD0A 1MCOL 3EHBD 3TO4C 2ERJC 5EB9A 5D1QD 1AGEA 4N8CH 4ODTH 2E6PA 3QPXL 3QRGH 5I1EL 1KYOJ 4JDTL 3PXJA 4YHPA 4D9RE 1SJXA 3MR9A 3WN5B 4G8FA 3VFWA 1OP9A 4U1MB 3CSBA 4HFWB 5IJKC 1DBKH 5SWZA 1HDMB 4BM7A 1YN7B 4LPWA 4LSTL 5IHUL 1J1XH 3FRPG 3FCTA 4PJHB 2V5YA 4PRBB 2BDNH 1MHEA 1YEHH 1OSZB 1HYSC 4JLRA 1FLRH 2BX5A 4XP6L 3BSZH 3RWIB 2GT9A 5AUMA 1OTSD 1ZWIA 3Q6FA 3CVIL 2MJWA 1A6PA 1BREA 2EDDA 1QKZL 2LTQB 4ELMB 4AMKH 3CMGA 1F2QA 3OAYK 3RVWC 1EHNA 4POUB 4H5SB 4NCC1 1WICA 4LVOC 2ARJQ 4O2FB 3RGHA 1I8MB 1GPOL 5I75C 3VFNB 1BMGA 2VXTH 3ZE0E 1FNSH 3DGCR 3TN0A 4I4WB 4OI7A 3GBML 4JY6A 1CD1A 1FPTL 2K3TA 3MV7B 5HYJD 4NSKB 1F6AB 5IVXA 1F6FB 3GSWB 5KS9A 3EO1A 2FR4A 1NFDB 4XPGL 3S88L 1YEEL 2IANB 5ACZB 3VXUE 1V8HA 2V17L 2QHRH 2W9DL 3UBXA 2NY3C 5C6WH 4LMQE 5H37H 4OSUL 1GZPA 3CPLA 3DECA 1SHMA 5GGRA 4RZCA 2H32H 1J0KA 3V0VA 4HK3J 1QSED 4F7PB 4HF5H 1SMOA 5D5MB 1KLUB 1RZKH 4FXGB 4XCFH 5EIIB 1TLKA 5CFHA 4LCYB 3WNPA 2ZKHH 3PGFL 2A9NL 1UJTA 3PP3K 2OMBA 5D7JB 3SJVB 4WWID 1XGRA 3V4PL 2AXGB 1EGJL 4NWTL 1BFSA 1OT2A 1XGPB 3N0PB 4QRQB 4P5MB 4Y4KC 4CJ1A 1S7QB 2R56L 5KZCD 3RWDB 1VFUA 3PF2A 3TGXA 3K46A 1ZOXA 3BP6B 3OPZL 2DI9A 4YIQA 2MTPA 3QUMA 4TNWF 3DX6B 4Y5VB 1D5MB 4XC3H 1NGZB 4MA3A 4R3SA 4P4KC 5L7XH 2ZOLA 5L0QC 5GRXG 2VKXA 3OGCB 2P8MB 1X5FA 3FT3B 3PGDA 3T0VA 2QBWA 4MQSB 4ONGL 3VGDA 5JHDE 5IQ9B 3LSOB 4I0PC 4OLXH 3UTSA 3NA9L 4Y89A 1FO0A 3GHEH 2QQNL 1T1WA 1F4YH 1BVKB 4TQEH 3QHZH 5DJDB 4YXLH 1MREL 1N59A 1GGTA 2IBZX 3DVFA 3MLWH 5C0RL 2JIXD 4RDQG 5SV4A 3BRDA 3TIDA 4ZNEA 3ZTJH 1G0YR 3BKJL 3RGVD 5CHNA 4AEHH 3BMVA 1SJHA 4RAHA 3JXAA 1NGXA 2R15A 5T33L 3C8DA 4YHKL 1LK2B 1YNTB 2ZSVA 1MFEL 1Q72H 5CP3H 3DURB 1S9KC 5IVNA 3BZDA 4Y0GA 3OMZA 3ME0A 5GRJH 1MEXH 4Y4FA 5SX4H 1PFCA 3CH1A 1NGYB 3CDCA 4XMKL 1MVFA 4JFDA 5B22A 4HSQA 1DLFH 1E28A 4JDZB 3ZKQD 4WV1B 4XBEH 1KCVH 1XCTB 4HIXL 3MACL 4PJGE 4ZS7L 1ZLWK 4AIXA 2MCPH 2QJDA 4MJ6A 2IEPA 1CFVH 35C8H 5AG9A 4AL8L 2NY4B 3A6BH 1RZJL 5KSAD 1F3JB 5C3TA 4IJ3B 3RTQB 4FXKB 4UTAL 3MV11 3WNNA 4GRLD 5HYEA 4KJWD 5GS2H 1JPTL 3L3IB 5LBSH 2CKBA 5L9DL 1FAIH 4UIMA 1OP3H 2WP3O 5KVGH 1RD6A 3EYFB 2IADA 5DSCA 1I3VA 2FIRT 1YJDL 2W0FB 3CFCL 3AROA 3BHBB 4YDIH 3VI3F 2E7HA 2J8UB 4NUGL 2B1HL 4Z0XB 3NA4A 43C9A 3U9PH 2PTUA 4XP4H 3U48A 3W82A 2ICWB 3VDBA 3LN4B 4XNQA 2ZZUT 1QLRA 1MQKL 4LPTA 3BAEL 2Q6WB 3VXOA 3QJFB 4M61A 1QO3B 5IB1A 2BK8A 1RJZB 4NBXB 5B3JF 3O45A 1RULL 3OKDA 2VZ3A 3LQAL 1GCFA 2Y5EA 3DMMB 2WBWB 3WEXB 1H3GA 3P73B 1H3VA 4S10A 5DLMH 2C3XA 3RDTB 3V4VL 1JZ7A 1EZVY 5IROC 2AABL 4J4PC 4NHUA 2VDNH 1A7QH 3PL6B 1QLEL 4ODXA 2VL5A 5DD5H 1RZIA 1CCZA 3WXVL 1I1FB 1U8QA 5INCA 1FFPA 1D6EA 2HJFA 3P11H 3FQTB 1JWSA 4XI5D 5D1XC 4DQOL 4HJGA 2P8PA 4DN3L 5F70A 1RIHH 4HGWB 5HYJE 5IEKA 3KPOA 2NY5C 1S7UA 4H1LH 1R3HA 3N85L 1MUJB 4ZAKD 3D3VD 5C0ND 2VQUA 4U1GB 1U8LA 1MCNA 4NRXB 2GITB 3UYPA 3X3GL 3R8QA 4EQ2A 3JBG7 1JHLH 4RGNC 1JZ2A 4ZOAA 5HHVH 4KKNA 3V6OC 5E2TH 3LEVL 4LPUA 4YH6A 2QADD 5FHAL 4ZNCD 3T2NL 3ISWA 5HGBA 1QSEE 3MRBA 5DFWH 3ZYIA 3D2UB 4OLWH 4DW2H 4FFWD 1U8PB 4ZTOL 1MFDH 2ZUQC 1WCQA 5DRNA 2YSSA 4J3OC 3FT2A 1MHHB 4DJMA 2Q8BL 2WUBL 3B43A 4KPHH 5K59F 3MV8B 1TIUA 1WSST 3CSPA 2XKNA 4NJ9L 4EN3B 1T80A 1ND0B 4Z7WE 3QJHB 3BP4B 4YNYB 3LS5H 3MNWA 3O4LB 5HD8D 4ELMF 1FNGB 3I3DA 5FKAB 3L6FB 1WLHA 5AAWA 1NDGB 2JCCB 3QO0B 4YWGH 2VIRB 5GGTA 2JB6B 4NUJB 3BYTA 1WBZA 5EPMB 4JR9L 5I1HL 5EU7C 2HT3C 3RZCB 4OLZH 3HUJA 4Y88A 4N68A 2NX5D 2IAMC 3LKPB 3TO4A 3ULUH 3MBEB 4RAUA 4L1DA 1NFDF 4OJFH 4XNZB 1CE6B 2BVYA 5DJ6A 2AK1H 3GO1L 4MYWB 1RHHB 2V5RA 1NC4A 2Z93B 1RIVL 2R8SH 4NQDB 3MCG1 1D6VL 5D7LD 4LSRL 3MCKB 3GMMB 5IMKA 2X6MA 3EDEA 4WO4C 2DLFL 2CGRL 4MNQD 1K85A 5IJKA 5IMMB 1ADQL 5IEHA 4MJ4A 4X7TB 5A43C 1FG9C 4JCLA 3O9WC 3VXPA 1FG2A 1KJ2L 4OFPA 5D5MF 2RJMA 3BFOA 1TZIA 3TYGL 3BT2L 4LPXA 3VXTB 5A1AA 1RUMH 4LP4A 3QDMD 4JDVA 4PJDA 1QVOB 1Q9KA 3QEUA 3F7YA 4PJ5A 2CDFA 3H2WA 2VQTA 4MA1C 2QTEA 1R3LB 1RUAL 5EU3B 4YDKL 3RL1A 3VXNB 1QR1B 5JUEH 5JHLL 5AWNL 1T2JA 3V79C 4K9EH 1WC7A 2CUMA 4KHXL 4LAQL 5SWZD 1KLGA 4U33A 1G7IA 4TSCH 4HIEB 4QHNB 2AJYH 3MGTA 1IGJA 1MH5B 5DS8A 5JW5A 3HMXL 1KIQA 4UQ2B 3MLPA 2G2RB 5I16A 3CUPB 5IB3B 3FB5A 3MOAH 5J57B 2X7LB 4KK9C 5I15H 5E08H 1WAAF 2DQTL 1S7XB 4XB8A 2PF6A 5F9DC 2XG4A 2Y1VA 4OI8A 4NKIL 5D9SA 5ITBH 1QNZH 3DV6B 1V7MH 2EIEA 1FGNL 4PG9A 5HHQA 4OM1L 1WIPA 2OTUB 4N0UB 2X4OA 3SN6N 2YXFA 1N4XH 3QI9C 1KB5B 4PJ9D 1S78C 1Y18B 3ET9F 3D69A 3CK0H 2GW5A 1AQKL 2EE6A 3N50A 5KW9H 4QRTA 4QTIL 3BDBA 4KRPB 4AK1A 2QSVA 1LO0L 4J8RA 4EEEA 5JZ7D 2NR6D 3KG5A 5DJ2B 1CBVH 4ETQB 4JHAH 4PIRF 3CU1A 1JP5A 1AP2B 3T77A 4G6AD 5C0EA 1QUNA 4HUMB 1NGWA 4Z7VE 4W81A 3LKNA 3BUYB 4V1DA 2HMIC 3GSNH 3IS1X 4PRHA 4Y4KA 1MPAL 5C70A 1QA9B 3M1BB 2WBJD 4P2RE 3CVHB 4ODSH 1IE5A 3ZLQC 2EEDA 2XG5A 3BQUB 3FB8B 1S7VB 5D7IA 3FB6A 3MGOA 5MEOA 5SWQB 5ESVB 4PY7A 3L3OB 1AJ7L 3M8OL 1R3JB 2ZPKH 3NTCH 4I1NB 1W8OA 2I25N 1NBVH 4F57L 1JPFB 1A2YA 4FG6C 3D3VE 1NSNH 3MLRL 4KZDH 1WWWX 1QRNB 3O2WH 4L9LC 4X6CA 3MUHL 4NO5A 2WM0A 3QWRD 2E9BA 4Z0BH 1IAII 5DHVH 5TE6H 1DQMH 2EE9A 2J8UF 3HFMH 4R8WH 4LLYA 4HXAL 3MQIA 3H9SB 3L7FB 3NPSC 4M7JL 2Z92A 3EFDL 2VERN 4APQB 3GJFA 5DA4A 2AEPL 3QEQD 2ICEA 1Q0XH 4JM2B 4LVHB 1G7QA 4FQXA 1SEBB 5GGUA 4YPJA 4WIQA 3UTSD 3WE6A 1QSFD 6FABL 2HG5A 4NKQB 1WCBB 1QFWH 4JAMB 2Y5TA 2YPLB 1I9JH 4JRXA 4LQFL 1UJ3B 5L8KB 1L9MA 2ICWJ 4YO0A 1OLLA 1CQYA 2B4CL 5A2IH 4X9IA 5E9DB 3BPLC 3TWCL 2Z31C 3MLUL 4HWBH 2Z9TA 1RU9H 4K94L 4AYFA 4XPAH 5E8PA 2HKHH 3MMEA 4R2GB 2DMBA 4K8RD 4XP1H 2NX5E 3BH8B 4NQEA 3QIUB 3VXRA 3MCLH 4PREB 3ARWA 1ETZB 3FT4B 3OL2A 4L8CB 5E1HB 1OAZH 4ZYKA 2OR9L 1FZMB 1NL0L 2NY2D 1CGYA 2FH6A 1W72A 5HYSG 1NMBH 4N0FB 1D5XA 4U6VH 5D7LE 4M1CD 1JGEB 1UXSB 3W0WB 5DJCB 3QXUA 1Q9LA 1LEGB 4MNQE 3DSNA 4OUOA 2VUYA 4IBLT 1M7DB 4O5LH 5EUOA 2VE6A 5I18H 1VERA 4TPRH 3U0WH 2EH8H 2ADFL 2AK4A 4G6KH 1FYTB 3WN5C 2Z0BA 4UT6L 1DLHA 3QDME 2E7CA 3UJJL 4P57B 4BA8A 5EC1A 1BX2B 3HNTL 3B9KD 3PWLA 4GSDH 4QGTA 2DL2A 2P5WB 2GUOA 4WI2A 1MRDL 2QR0B 2BHUA 4NBYB 5HGHA 4IRJB 3G5XB 3VGBA 5I1JL 4LCIL 5SWZE 5DZNA 1CXIA 1QFWM 5J1AA 3EYUH 4PJFB 1DQJA 3VFSB 4X4ZA 4OZHE 1KT2A 1BQLH 3IU3B 1WITA 2JCCF 5CSZA 5FKPB 3ULVF 2R0KH 4HQQL 4K3DH 1FVDB 4MCZA 4TULH 5IROA 4XXDA 2ZUYA 3MGAA 5TE7L 1M6OA 3GI8H 3KNBA 2XZQH 5D72L 3IAQA 2LTQC 1KELH 3VH8B 5J56B 5D1ZB 4F7TA 3DPBA 5D1XA 5C8JB 2GSGA 4PJ7B 5ANME 3GMOB 4OV5B 3WNLA 1X4YA 2GJZB 2XY1A 4LCWA 1G7PB 2ICWI 3TH2T 1TFHA 4Y8AA 4ZUSB 3CX5J 4R0LA 2EYTA 4JPIA 5C0BB 4E41B 4EDWH 1BD2B 1A6VL 2PW1A 3RL2A 3VG9B 3V6OA 2FB4L 3T1FA 4OAWB 3C5SA 1QFUH 3UYRH 4GBXA 1MLBA 1KCSL 1PG7H 4GQ9L 3ARTA 1TCRA 3NCBB 4GRWF 1DE4B 3SY0B 3ZE1F 5FV1L 1B0GA 3VGHA 1UKTA 1WVZA 4PBVC 1DQDH 3SKNB 2HT2C 4Z78B 1NPUA 3QISA 3KYMB 4JGJA 4OF3A 4ZFZA 5KVFL 2XQYK 3GSQA 2VDQH 1MRCH 1G7JA 5IIEB 1FNLA 4M6NH 4DVRL 1AI1L 2BNUA 5TDOA 4CRPA 3A6CH 5HHPA 2XQYG 3ECBA 3LZFL 3DXAB 4KK6D 1A64A 5DJ0A 3UJTH 2GEEA 5D7JC 1T3FB 1QYGL 5TE4H 1GC1C 2H6PB 1BVZA 1N3NA 3V2AR 3P77B 2APXA 3FRUB 3OKLA 3QQ4B 4ZPTA 2FWOB 4K3EH 4OI9A 4Y1AD 3WUWG 1FNEA 1FRGL 2ZUTA 5IFHL 4OIIH 4PJXB 2I60H 2Q3AA 4NKOB 2KZ1B 1IT9L 4A6YL 2XA8H 4Y5VC 1B88A 2IAMA 5I1LA 4KI1A 2FX8H 1BLNA 3EZ8A 5TGBA 5EZOH 4YE4H 3V5DB 3DBXA 1F11A 5ERWA 3CCHA 4LLVB 1KTLA 1A14H 2GK0B 4I18A 4JN1H 1YQ2A 3DIFA 3ABZA 3W11D 5KSVB 3NCJH 4XNMB 4L4TA 4JFHD 3U2SB 3JTSB 4BQ9A 4LSPL 5E5UB 3O3BA 3ZKND 5D2LB 2GTWB 3O9WA 3TO4D 5HI3C 1JHTB 2A0LC 1MCDA 5AEAA 5CJQL 4HZLB 1SBSH 2NNAB 4I13B 1LO5B 3QEQE 4FFVC 3VXSA 5JW3L 3UTSE 4MA7H 1QSFE 2PR4L 4Z77A 3DRTB 2RFXA 2CO7B 4X0KB 4JFXA 3M17A 2VXQH 2BRRH 4LLWA 5DQJA 5LCVH 3EYSL 3CFDA 5CGYD 2D9QB 3LMJL 1I3GL 1LILA 1OAUL 4DEPB 3OAZH 3VXQB 4IM8A 4ZNEE 4RQQB 5DHXB 3T3ME 4GKNA 4PJAB 1KIPA 2DQEH 3REVA 3G6AA 3HS0A 1KC5L 3FFCA 1E27B 2EKJA 4NDMA 1HYSD 1Z9SA 4XBGB 3SOBH 3B5HA 1UENA 2GFBA 3LQMA 4WV1C 5GRVK 2APBA 2F5AH 2XZCL 5EZIH 3IFPA 3EOBA 5C08B 1U41A 1A6AB 1XCQB 3UZEA 4GS7B 2VR5A 1UYWL 4G8IB 3RVXC 1EJOH 1UM6H 2F58L 4CN1A 5AYUH 5BRZA 4QHMB 2NY4C 4E0RA 4NO3B 2D0FA 4P9MH 1CLOL 3CFJA 1EBPA 3IDMA 4IJ3C 4OLYL 3RTQC 3RVWD 5B3NA 1CLZL 4X6DB 1VB9A 4FTVD 4BKLB 3U46A 5HVWA 1FDLH 4ERSH 3T2PA 1KV3A 4GXVH 4MQTB 5F6HJ 3OKEA 4KY1L 2AXHA 43CAA 1KN4L 2PTTB 4QNPE 4FQ1L 3KYAA 4D8PA 3IJSA 4D9QD 4Y5YB 5FO9A 1JI1A 3RIAK 4JM2F 4Y8DC 1YEFH 1DQTA 4PRNA 5IFAH 4AEEA 4CVZA 4Y19A 3CLEL 2NY3D 4KJPC 1K4CB 3WDJA 3O2DH 3KPQB 1I1YA 4ZFFA 4E5XB 1J7VR 4QOKB 5DD1L 4JFQA 4KKLC 4JY5L 4LLAA 4K07A 5DWUH 1IGMH 3HPLA 5I1KH 3HKFA 3W2DL 2XYCA 2BSTB 4U1JB 1EEUA 2DQGH 2EKSB 3TNNB 4QWWD 2HYMA 3VI4E 5ICZB 4PV9A 4G6FB 3DMMC 5BQ7B 4K55A 3GNML 1QSVA 1IRAY 2UYLB 3EFFB 2R1WA 4M5YL 4IIQB 1VADA 3INUH 4WI5A 3STLA 1OGAB 1EFQA 4V1DD 3Q0HA 3BO8A 4PRHD 4Y4KD 1H3PL 2HFEB 4K7PY 4NZRL 2QQQA 2D7PA 3TCLA 1P7HL 4WUUD 4EVNB 5J1SC 5LGJB 4ELKA 1EXUB 4U1GC 1NCTA 5H35A 1KSRA 2V7NA 1ZHKB 5C0CB 5HVHB 3EZJB 2C3WA 4GG8B 3PIQA 3QZWG 4P4KD 3D25A 4DK3A 3QH3B 1CD9B 1OAXL 4HD9A 2Q7YB 2AV7A 1JV5B 1NBYA 1G6RH 4U1SA 5I76B 2DQIL 1BEYH 4UIKH 5DC4B 5HPMB 2HVKA 3SKJH 3O81A 1T4KA 3LH2H 4I0PD 4Z7OF 4X6FB 4HIJA 1PDKA 4PJFF 1G7LA 2P7TA 2VXUH 4MX7B 2VLRD 1LNUB 4EN3C 4NRZA 1IKNA 3K81A 5F6HI 1ZGLM 1BM3L 5JQ6L 4RFNB 4Y1AE 2CK0L 5AD0B 5IHZA 5T3ZH 1FORH 3LRHA 3C5JA 1HWGB 3FTGB 1JF1A 1WBXB 2CRYA 2FJFA 4KJYA 1M1SA 4PJ7F 4EUPH 1YEJH 5IB2B 1DDHB 3K7UA 3ULVC 2YPKB 4JRXD 1QBAA 5F1SA 1LQSR 4XPBL 5IMLB 4ZOBA 4OGXH 4HKZA 3RZCC 2XKSA 5I19H 4PRIB 1OW0C 5L2KD 3E6FB 3FB7A 3MBEC 3P30H 4XNZC 4YEEA 2ITCB 4DFHA 5C71A 2PYED 1EIBA 4OD1L 4UV4H 4YBQC 4JFHE 1ORQA 2WW8A 1XT5A 2AJSH 3H9ZA 3VXRD 2PXYA 4NWTH 4U3XA 3WN5A 3IDYB 4U1MA 5BVPL 2Q8AL 1PYWB