1OSDA

Crystal structure of oxidized merp from ralstonia metallidurans ch34
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
ATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Oxidized Form of the Periplasmic Mercury-binding Protein MerP from Ralstonia metallidurans CH34
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
molecule keywords hypothetical protein MerP
total genus 17
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1osdA00
3HFKA 4Y2MA 4YDXA 2HFOA 1YJUA 2W4CA 3QGPA 2XMTA 2FB0A 1KVJA 4HI2A 2LQ9A 1YG0A 2FIUA 2K1RB 2G9OA 4YEAA 2FHMA 3KG0A 1Y3JA 2QLXA 2BJEA 1SI9A 2IFXA 3FRYA 2ZDPA 2K2PA 2OMOA 3LO3A 5K9FA 3CJKB 4EFAC 2OFGX 3MCSA 2QIFA 2XMUA 3E8OA 2XMJA 5B0AA 3DXSX 2L3MA 4DL0C 1KVIA 1N5SA 5B0EA 3BN7A 5F0WA 1JK9B 2K7JA 1S6UA 5B0FA 5KAKA 2IYIA 2GA7A 2HQIA 3TOQA 3KNGA 2OKQA 3LGMA 4ZA1A 1Q8BA 4U9RA 3LGNA 1AFJA 3TNVA 1AW0A 1TL5A 2FTRA 3GZ7A 4QOTA 4HH1A 4Q2MA 2KKHA 1FVQA 4Q2LA 3HHLB 2HFNA 5B08A 2JDJA 2GCFA 2W4DA 1V3ZA 3HF5A 4OIXA 5A6WA 1FEEA 1FESA 2OAUA 3WDOA 1P6TA 4NPOA 2AJ1A 3F44A 1Y3KA 1CC8A 2RMLA 1K0VA 1CPZA 2VV5A 1IUJA 1P8GA 2LDIA 4A4JA 1Y0HA 2AP6A 2XMWA 4Y2IA 1OQ6A 4HI1A 1N5VA 1YJTA 1AFIA 3HHLD 4OJ1A 2BBEA 1W2IA 1X8DA 1ULRA 2PGCA 1N5QA 1TL4A 2RILA 2ROEA 3CJKA 3T9NA 4A48A 4F67A 3VTIA 1U7LA 2PD1A 2RU9A 2VH7A 2GFFA 1XBWA 1TUVA 4DN9A 2Q3PA 3KKFA 4OJHA 1OPZA 2ROGA 4ZOSA 1Q53A 5B09A 1SB6A 5B0CA 2XMVA 3MZIA 1OSDA 1X0PA 2CRLA 3BF4A 5B0DA 1SQEA 1Y9OA 4Y2KA 5B0GA 3FGVA 2AJ0A 2IYGA 1MWZA 1QUPA 2OD6A 2K1RA 1TR0A 2N4CA 1FE0A 1MWYA 2HIQA 2RSQA 2LXFA 3K7RA 3KG1A 4A47A 3DCAA 1R6YA 2XMKA 2KT2A 3HHLC 1KQKA 2GV1A 2BJDA 2GGPB 3BB5A 4OJGA 1VQYA 1APSA 1GXTA 1URRA 2KT3A 2OD4A 1Q8LA 3IWXA 5B0BA 3HDSA 3BDEA 1FVSA 1RJJA 1WD6A 2ACYA 2GO8A 2LQBA 2N7YA 2BUNA 2ROPA 3BM7A 3FMBA 4FNIA 4OJ3A 4A46A 4NL5A 2K7KA 3I9ZA 2HLTA 2BYCA 1YRXA 2EW9A 2HLUA 3UDCA 4DPOA 1N5TA 1FD8A 1S6OA 5T7LA 3HX9A 4HH0A 5A6PA 2GGPA 2KYZA 1VQSA 1Q4RA 2XMMA 3BR8A 3TRGA 4FNHA 1LQ9A 1OQ3A 3IWLA 1CC7A 2OP5A 1YJRA 2ZDOA 2ASYA 5F0UA 2QYCA 1JWWA 4HL9A 1YJVA 2W4PA 1TZ0A 2AW0A 2QLWA 3BGUA 3HHLA 5IXUA 1X7VA 3QMQA 1FE4A 2OFHX 5T7LB 1GXUA 2N4DA
chains in the Genus database with same CATH superfamily
3PEHA 2EG1A 4NRUA 2MLYA 3MMBA 4N8NA 4B3SJ 2H9ZA 3W65A 1T9YA 2CQ2A 3E01A 4QR2A 1OIAA 1TQLA 1YG0A 5CCMA 2ZZMA 1PYOB 5K8NA 2OSQA 3DMJB 1KHVA 4LFAF 4KHRA 3DN9A 4JI5J 2YKOA 4Q43A 3CDUA 4I2QA 3CEDA 1NU4A 4WZMA 5B0AA 5EX3A 3OVAA 1Q7LB 5GAHU 4USUA 5HVFA 4DS5A 2ASLA 4B9MA 1UVNA 5ETPA 2HRUA 3D3CJ 2W7OA 2XI2A 2ZH9A 3GP9A 4TY8A 2FLLA 4DL3A 3V6DA 2VHGA 1SBRA 3K5MA 4KGKA 4M5DA 2V4JA 2HBQB 3CO0P 5BR8J 4IO9Q 1KRPA 2XS7A 1CQNA 3PHTA 2VFUA 1Q78A 1T9TA 4LSLA 2P6SA 3DNCA 3HHLB 4JB8B 2CPFA 8ATCB 4NXNF 3KLIB 2W9AA 2XYHB 3TUPA 2CQIA 2A18A 2J5AA 4R5PB 2ZZNA 4M1KA 1Q79A 1EQ0A 4Q8EA 4C11B 5BYQA 4DL6A 2HVHA 1T9XA 2FVRA 1X4EA 2RMLA 2Y0SD 2HSEB 1TL7A 4IH7A 4EBEA 2QL9B 2HHHF 5J2QA 3R5BA 2IA6A 2LDIA 3DM2A 1MU2A 3NS7B 2J0XA 1VIOA 2OELA 2ZBRA 2QMWA 2DH8A 3T5JA 3SXLA 4ZVOB 3MFIA 2BM1A 2A1BA 2CQ1A 4KO0B 1V5VA 2M2BA 2L08A 2V94A 2W2MP 2YBVA 3IR7B 3P5TL 2MY8A 4WTOB 1EQMA 1SC3B 2R7UA 1KLNA 5FJ4A 2XWYA 3K58A 2E9RX 2E7VA 4IR1A 4UW2A 2UU9F 2AWZA 3ELHA 3W63A 2HS3A 4JI0F 4JV0A 1KKHA 3EGVA 2XEXA 2AQ4A 2HWHA 1HNWF 2AJFE 2I2YA 1OSDA 1RA7A 2MJUA 3SSRA 1N33F 2RNEA 1E6YA 1N34J 3JSRA 1ZA2B 1TKZB 1TV6A 1VJQA 2QV6A 2CQCA 2WK4A 2DD8S 1PAEX 3HZEA 4HACB 2B9XA 4RW9A 1RKJA 1T9WA 5GADI 1J5EJ 1UVJA 2CQGA 4DL7A 4EBDA 4PZVA 2XSFA 3OL8A 3VAIA 1FE0A 4DV0F 2E1AA 5KFAA 4ZHRB 4RZRA 4PWDB 1VQLS 3HP6A 1REGX 4NLRA 4NXMJ 4OFZA 3CCMS 4Q8FA 4U8VA 4YUDA 1TFYA 1S0VA 1NHKL 1APSA 5A0YA 3EXYA 1ZETA 2H1YA 2FC8A 4OZ2A 1RCXB 2DH9A 2E1PA 2OSRA 3CJ5A 3HCXA 5G0RB 2BM0A 1YX2A 1IKWA 1RJJA 2RDIA 2LQBA 4WU2A 5KFPA 2ZJRQ 1JJCB 1RCOB 1S1UA 4FNIA 2DY1A 2XS5A 3J7Z5 2KU7A 2F63A 3D67A 3OXFA 4K5RA 1BQMB 4CRJA 4DX6A 5L38A 2LA4A 1HWIA 4J9UE 3CSKA 1C0TB 4P74A 1UJ6A 3P45B 5T7LA 1K0TA 3CJTA 3Q89A 1G7CB 1Q4RA 4UQTA 3S01A 4HHHA 1K47A 2X3DA 3TRGA 3KK3B 3CPWR 2CPHA 2MY7A 1L3TA 2AJ2A 3W66A 3SQGB 3GG1A 3NG8A 4GKKJ 4NASA 3KK1B 4YB6A 5LMUJ 4V19X 1YJVA 3U1MA 5AE3A 4PWDA 1IN0A 2PFDA 3KHHA 5JVGQ 4ES2A 4ZN1A 4LR7A 3RR8A 3V81B 2XLIA 5MAOA 4Z2XA 2DNGA 4OHXA 3SCLE 2OFHX 4WYLA 1WWHA 4YDDB 5L1KA 2I5JA 4J9VA 2QN6B 2YVSA 3UN5A 4ED6A 1Q82T 4ELVA 4JI8J 3LP1A 4AQYJ 1HWUA 4RNHA 3ENVA 2WVDA 2G9OA 1JLFA 3MM8A 5LXYA 4LF5F 3TP2A 2DNMA 5EWEA 2IFXA 2KRBA 3FRYA 3POTB 4LIRA 1I94J 4FF3A 1LXNA 5ETRA 1N32F 5IFMA 3RBXA 4KKOB 1NDPA 2M70A 4RL1A 2QFJA 3CMES 3ILOA 4JYAJ 1Y00A 1JXVA 4F3OA 4Y65A 1RUSA 1UAWA 2B6AB 2EFPA 4GO5X 4ZIWA 5K8PA 3OTOF 4C3MA 1HQUA 2XWXA 4IH6A 3VGUA 4OZLA 5IS2A 3CJQA 4PR6A 3TI0A 1RT5A 2Q43A 2V68A 4N7TA 1CVJA 3LUYA 4RUAA 4YR2A 2AU0A 2E5LJ 2XGQA 1WEXA 2OEKA 4WJBA 4TQRA 1NSPA 4ZVFA 2IDLA 4DV7J 3AOAA 3LALA 1RWMB 3RGIA 4PG7A 4ECUA 1CC8A 4ERDA 8AT1B 4DV5J 4F2SA 3TYTA 3RRHA 3UCGA 1TL3B 1NB7A 2VKZG 2FVSA 1YQHA 1N5QA 3MMJA 3MPWA 5CYMB 4A48A 2MGZA 2W9CA 1Y7PA 2JLGA 4LBPA 1JKHA 1U7LA 2HYIB 4JI4F 1IQTA 4AT1B 4N77A 4O3NA 3OQ2A 5C24B 3EGWB 3PG9A 4OYAA 5F41A 2ZH3A 2CJQA 3Q22A 2Q3PA 2VD3A 1C0UA 3JYTA 3N6MA 1SB6A 1R3NA 4NLDA 2Z2LA 1X0PA 4OI6A 2IDEA 3PY8A 1SQEA 3PTWA 3S6EA 3R9LA 1W2BR 2FHJD 1W26A 1H3DA 3QFWA 2LECA 1TUWA 2CFXA 2XCAA 4C8NA 3I5AA 4ZDNA 1TR0A 3BQ2A 1BD6A 1ZBTA 1ZPVA 1MMLA 2W1BA 2ZOMA 4IO1A 3G71S 1HYSB 4ITSA 3JXOA 3HKZD 2CVIA 1CBKA 2A0FB 2ZVIA 3WZ0A 3OJSA 3OFHA 2ZKUA 2V5HG 3I0RB 4A8XA 3KLHB 1UEUA 2M52A 4K8RA 5GAEI 4B9SA 4LF5J 1W25A 1FK9B 1GAOA 3BQ1A 3PV8A 4DV2F 2KH9A 4CCHA 2OEJA 4FXDA 3M7VA 4JI8F 3H8YA 3T5HA 4QU6A 2I1RA 4R5PA 2HVDA 1FF2A 2HQFA 4L3NA 1O6XA 3D1HA 3QQCD 1YZ6A 3J7YI 2IMWP 1B0PA 3SCIE 3C3LA 2WHOA 2JOQA 4FN5A 4KTQA 2CPEA 3BBBA 4F4KA 2UUTA 3V81A 5CD4H 3HFVA 3O8WA 4USVA 5ETVA 3GIRA 4FXWA 2HMIA 2LLZA 1HWJA 2C3UA 3LQVA 5J2NB 1T05A 4DZDA 1GMVA 1OPIA 2F40A 3BBCA 5U47A 1IBKF 2AMCB 3K0JA 2XO7A 1ZM9A 3H98A 1QD1A 2FZCB 3PW4A 1X4HA 4K59A 5D0EA 3GCXP 2CZ9A 1F9EB 3AA8A 3H2UB 4UZBA 2MHNA 3PYEA 4ZP7A 4FBTA 2AW0A 2EFVA 3T1YF 1NKBA 1YIJS 3MEEA 1UFWA 3P5BP 2P2CB 3VAMA 5HBMA 3MF5A 3K17A 2BX6A 1PYTA 1T94A 5C5JA 2ZEJA 1H38A 1UVMA 3IS9A 3QRPA 1KWMA 3JSBA 4HACA 1FKPA 3JQKA 3OR1A 1C4AA 4GC6A 2LQ9A 3JTOA 3PW5A 3IP0A 2CJYB 4FBUA 4KB7A 3LGHA 2BV3A 4DFMA 1Y3JA 1H0HB 1NSAA 2PEBA 3AA9A 3Q2TC 4C8ZA 1F2HA 3BYPA 2DR8A 4IQXA 3IM8A 3SSQA 2VOPA 1RXOB 4ZJQA 1GX5A 3E8OA 2HWTA 3P8BB 2J9DE 4NLSA 3NLCA 4DV0J 4DSEA 2KT5A 4NWBA 5GMEA 2ZBPA 5KT6A 2UU9J 1DTTA 1HL6A 1X5PA 2L41A 5J2QB 3M2VA 5DM7Q 2XY5A 2IJFA 2R3VA 5HLFB 1NZAA 3ETMA 3TOQA 2J9DA 3EGNA 2UXCJ 1KR4A 4PG6A 4KO0A 4C7QA 3WX4A 2DTJA 2ZNZA 2UXDJ 3FZBA 1IBLF 1GEHA 1UPPA 1Z2ZA 5THWA 2YWFA 2CQHA 3QAUA 5M2PA 2MKIA 4LRCA 1SCJB 2JC1A 2CZVC 2MKSA 2Z30B 3AXMA 3PRDA 3C14B 4M63A 4RBTA 4USJC 4L74A 4UUXA 4DCJB 1KNZA 1IXKA 1P9QC 3GILA 3IS9B 2ZNYA 1KD1T 1GH8A 1ZAXA 4M94A 1C0UB 3JYTB 2BOPA 2I0XA 1RB0A 2C42A 4A4JA 3ENQA 5AXKA 5EWGA 2R7QA 4NE9C 4I69A 4X65J 1AFIA 4NZ6A 1K44A 2YKQA 2HBYB 4H4OB 5B0CA 3C16B 4LSZB 3NEKA 2P5VA 4G6VB 4Y0FA 3G96A 2UVVA 2WVFA 2W9BB 1KVKA 3MM6A 2QC3A 2UUCJ 1ZS6A 3B82A 1UVKA 4USWA 5HMXA 2YH0A 5D6GA 2VIHA 1JIHA 2C3YA 2XYPB 5E33A 3KMSA 1OPZA 4CDIA 2QG9B 2C2RA 2XMVA 4DLEA 3NNHA 2BKOA 4TN2A 4E98A 1VC6A 4X4VA 2ZD1B 3O44A 5BR8F 3GQCA 2KZZA 2UUBJ 2YWKA 4HVZA 3D6HB 5EHHA 1YGYA 3KLGB 1RWWB 3LAKA 4JI2J 4EO8A 2BE7D 1FERA 4QWAA 4DV3J 4RBVA 3MEGB 2UV8A 3DU6A 5ADZA 1B7FA 3IAM9 5KT2A 3R5JB 2LP4A 4NLGA 1EHWA 4WP8A 5HQLA 1BHNA 3BGRA 4BWMA 1KEKA 4JI5F 4DEZA 5HMZA 5I3UB 4WZQA 1NJZA 2QMXA 4UTGA 2NXNA 2RDJA 4ZVHA 2NXUA 4HKQA 1KS2A 1RT2B 3BDEA 2DNQA 5EGYA 1WOSA 3RYLA 1RTIA 3FCVA 3MUMP 2UUCF 1AB8A 1Z4UA 3W9JA 2FJXA 1M0SA 3OTEA 2ZH2A 3GFXA 4J9NA 1RTHB 5AJ3F 1URNA 4ETZA 1UWBB 2CNNB 1JLAA 5ETKA 1SPBP 2R7WA 1CSJA 2KYZA 3QO9B 3JB9k 1WF2A 4P71A 4E8UA 4Y28C 2W9CB 3LP0B 2XY6A 4CT9A 4ZCKA 2FHJA 2FPHX 3JSMB 2R9LA 3BO2A 4DL5A 1C1CB 3LOUA 3UVJA 4G1QB 5CCLA 1VQ6S 3SFUA 1HW8A 1REVA 4DHVA 2UUAF 1O5JA 1LKZA 3OL9A 4JP8A 1FFGB 4ED1A 1RWKB 2D3OR 2N3LA 3D54A 2RS8A 3GWCA 1Y4ZB 2VB6A 3UWTA 1VK3A 4JUZA 5T7LB 1VBZA 5K5MA 4DFPA 1IKXB 1MNEA 1RI7A 1WI6A 3I4PA 4L6V3 1QAJA 2ZC3A 1FWLA 4ZPWR 1KFDA 2LYVA 2R8JA 2MZTA 5H9FK 3BPDA 3ITHA 2CDQA 3MECB 2MQMA 4H54A 1RTHA 4OX8A 1TKXA 3KUGA 1YI2S 1XR6A 3RG6A 5KFTA 3GIKA 4DR5F 1WC5A 4KFBA 3C14A 2ZOFA 3MCNA 5K14B 2OGUA 4O3QA 3ZFVA 5HO4A 4DQIA 1GTHA 3QO9A 3U1NA 4CYUB 1YK9A 4EK2A 1QE1A 2MTLA 1XIQA 1X5OA 2ILZA 4QIGA 3FEXB 5FD1A 3W1YC 4A8OA 4GKJF 4QWCA 2UXBJ 2FZGB 5BXIA 4CZCA 2HNYB 5AXNA 1C1CA 2OKQA 1F5CA 6FD1A 3LGNA 3VAFA 3TNVA 2BDPA 4OHYA 4OLPA 4LF2A 4CO1A 1SH0A 3GZ7A 1D8YA 3BBFA 3CCTA 3NBPB 1FJ7A 3CJ8A 1KDNA 2OMLA 3HSJA 2JDJA 2OHDA 1FWPA 5E3RA 2W8LA 2ZJPQ 3KXDA 4ID5A 1KP6A 4M8LA 1FEEA 4LF7J 2C1EB 2CQPA 4NMLA 3RBZA 3RB4A 2M9KA 4CH0S 2A6OA 1PBAA 3R1HA 2YNGA 1NPRA 5HP1A 3PNIA 3C15A 2DNYA 3IFEA 4WP3A 2RQCA 4ED8A 3N6LA 2AP6A 2LQ8A 2PO4A 2HHPA 1M5KC 2AEFA 3W2WB 4IKAA 2Y8WA 4LF9J 1TKXB 3M2RB 3J81Y 2E7XA 1DTQB 2F4FA 2I6WA 5HVHA 1ZAWA 3CCSS 1CJUA 2X1BA 2RU9A 1RTJB 3TX8A 1SVDA 2O5DA 1N5YA 1L3UA 2HHUA 3W7BA 3AD8C 3QT8A 1N52B 1WF1A 3PX6A 1TFWA 2Z2ZA 2EPIA 2BW2A 3CJ3A 3HSDA 1EETB 1TAQA 1FWKA 4LUBA 4YHHJ 3PKMA 4DV2J 1CULB 3UDLA 4ZCLA 3PRBA 2IM3A 3GJSB 1PILA 1SKUB 3D66A 4W98A 4OI1A 2FD2A 3IG1A 3B6BA 4Y6IA 2G2OA 2XG8A 5KG4A 5BYSA 2F4VJ 3Q83A 1FCAA 2RD5C 3C6TB 3WIUA 1OYEA 4J9LA 3HSGA 4KHPF 2HVZA 3CDWA 4C11A 1Y5LB 2HHXA 1QY7A 2KI2A 2R42A 3EICA 4RW7B 2MQPA 2N4CA 2BZ2A 3W5XA 3NGRA 1TMJA 5L1JA 4LQ3A 3C6UB 2BANB 1FX2A 3DDKA 4GO7X 4K0KF 5E2QA 2OIHA 1MU2B 1Q7YT 3HHLC 2XZWA 2ALZA 1U26A 3Q8RB 4ECVA 1GXTA 3CDEA 4GMKA 2MKHA 3W61A 3HHDA 1NKEA 5ETOA 1IBMF 2L9NA 2B43A 3LF0A 3U02A 4ED3A 2DVIA 3HDSA 4DSLA 2OPSA 4G3IA 3QT5A 1FT8A 2FHKA 3GLJA 1P9YA 3K8VA 1EKSA 1FJCA 2IA0A 2BKPA 2FLNA 3MM9B 1EETA 1HA1A 4B3TF 2ZH7A 2N3OA 4USTA 4DPOA 1T02A 2YWHA 5LSLA 2KFZA 4NCAA 4KGVB 1O8BA 5HBMB 1KLMB 2HKEA 1LWCB 3H90A 2AF6A 3LWLA 3C6TA 4ZS6A 2IAJB 3N5BA 3IBWA 3BR8A 2DGSA 3M8ZA 1FRMA 2DGXA 3EDRB 3E2EA 2JL9A 5C2GA 5L1IA 4B02A 4O0NA 5F0UA 1YJRA 1FDNA 4NYOA 4RR5A 2Z57B 4A8MP 2WCXA 1ZOTA 2W4PA 1FDBA 3ILLA 8RUCA 3NNCA 1RHUB 5KFJA 3E01B 3FFIA 1T95A 1RT3B 4FXVA 3M8QB 1VQNS 4JV5F 5A0YB 1HI8A 1NNDA 4I0WA 4NLQA 4PXCA 1VQOS 1LWEA 1NXIA 1HIYA 2N4DA 4DR2F 1XJWB 5E3AA 5M2RA 2DR5A 4DUZJ 1U1KA 2UZAA 2HNZA 3BN4A 1N56A 3HKWA 2DH7A 2HIYA 4DPWA 3M8PB 2NREA 4JYAF 1RSCA 3U7JA 3KG0A 4DXLA 3UPFA 1D09B 3R5GA 3C19A 4EZ6A 2DCUB 3A8KA 3M6VA 3QFHA 2L9WA 1QTNB 2ZOGA 5KFYA 3CJ2A 2E5GA 4QPXA 2AEMA 1T03A 2ZFHA 4G65A 2XMJA 3PDNA 3ZZRA 4IG3B 4DL0C 4H4MA 3BN7A 2YKNB 3T1HJ 1U45A 1BMQB 1U09A 2K7JA 2EI5A 3HJVA 1Y5IB 1HBUB 2DIVA 2J7WA 3D6TB 4X84A 5E3QA 1TAUA 5IQQA 4CH7A 4Q2MA 1HBNA 1X4DA 4TU8A 4ECYA 2BRLA 2FJEB 3H4BA 2FZKB 1V5IB 1WEZA 1P1LA 5KFDA 5LJ3Y 4IOAQ 1S1TA 3CCWA 1NB2A 1HNXF 4USHA 4K7QA 3T19A 5DZ6A 2EC0A 4XO0A 1VHIA 3TWZA 1CPZA 4PG5A 1OQ6A 1YLXA 4LREA 1OJ4A 4NCGB 2ZWPA 2V8PA 4QWEA 4JI6J 4YR0A 4NCBA 1PSDA 2B9EA 2CVEA 3KMQA 4DR4J 1T0TV 3I87A 3RBEA 3QGHA 1S59A 3HD1A 3HO1A 2RJZA 2BJ9A 4CLLA 1LK5A 1UJ4A 1R31A 2DHAA 4C6AA 4P9SA 3QZ8A 4TY8B 2R2SA 4YB7A 4HEA9 3RAQA 2MLZA 2WB1D 3LPEA 4IFYB 1Q5YA 2HS0A 1Q53A 2F1FA 3HULA 4ZITA 3DLGB 4RW4A 5I42B 1HQEB 2DKOB 3OTDA 1IBCB 1SH2A 2Y1LB 3TA0A 3MUTP 4X4SA 1WTBA 1FKAF 4F02A 3CC7S 1GQEA 3AAWB 2CPDA 4KC5A 3FGVA 3R5DA 2HQCA 9ATCB 2AT1B 4NLUA 2MEWA 3M6UA 3PFOA 3I96A 4DV6J 1RWOB 1IKVA 1I51B 1PKUA 2BJ8A 2F8EX 2WSCC 3HVTA 2D69A 1HNXJ 2RH3A 2ZC4A 3BSNA 1Z2LA 1NDLA 4RU9A 3D0HE 1RWVB 1UTAA 1NLKL 3G86A 2W2QP 4M5DB 1UKUA 3J7YU 5MLCV 1FDDA 2WBMA 4WE1B 3TAQA 3F41A 4EI2A 4WKRA 3DGPB 4JI0J 2Z2YB 1HBOB 2J7KA 4I1TA 3R27A 2J6TA 2V69A 4OYWA 3BM7A 2KZMA 1E6VA 4AUKA 5GAEU 3DLEA 1RACB 2UP1A 2CQ3A 2BQ3A 3NRBA 4CP5A 3R2DJ 2VG6B 4ZLLA 3HLUA 5FDLA 3OHBA 1JX4A 3QIDA 3M8QA 2DGVA 2YNHA 4RX6A 5LL6d 5KFIA 1VGYA 5JUMA 3CMAS 1UPMB 5A6PA 5L9NA 3DOKB 4ZPCA 3TO8A 1TV6B 3FDSA 3CCRS 5IT4A 4N56A 4WFNQ 1FKOB 1VRTB 1FO1A 2M4MA 2MZJA 3OXLA 4DZ6A 3MECA 4F3QA 2HHQA 4DR2J 2CJ9A 3BKUA 2E44A 3QWUA 4DG1B 1HBMB 1G1XA 1QUVA 4J5OA 2F9JA 4ZPDA 2C2MB 5L46A 1FXLA 4QYZK 3CJ4A 2ZUGA 4B9LA 3SIPB 3BSCA 4DX8H 1FNXH 2MYFA 5G0RA 2VJUA 2KG0A 2BR0A 1DRZA 1VBXA 4JV2A 4ILLA 1YWXA 1Q8KA 1S1WB 5IV3A 4IRKA 1YJUA 2W4CA 1NO8A 2DNNA 3ISNC 2B4OA 4B9VA 4GVBB 4KKOA 3MAAB 4M5NA 1M5SA 5K8MA 2XI3A 4ECTA 2BQRA 2YKMA 3AFGA 2KB2A 4G1QA 4HDGA 4WYWA 2LA6A 5SZTA 2HMIB 4PQAA 1U6ZA 3VGVA 5DQIA 4WXWA 1M1HA 2VZ9A 2C3OA 4EFAC 3PX4A 4JV1A 2XS2A 1FRXA 3JTNA 3CF5Q 2W2OP 3RRGA 3ZZOA 4DR6J 2IBKA 1SL1A 2YX1A 1KVIA 2M3DA 3H5YA 1R0AA 1T9UA 5HN0A 1UEVA 1JB0C 3K5PA 1EKRA 2OPPB 2QMUB 1T3OA 4U8YA 5B0FA 2HFVA 4NRTA 4I6AA 3VF0B 3L3CA 4LFBJ 1HI1A 2MQNA 1YRTA 5KG7A 2NCKL 5KOXA 2QX0A 3Q2SC 2XMAA 1S4FA 5EX0A 1A0OB 3ZNUA 2NXEA 3RB3A 3V2UC 2HHVA 1WHVA 1XN9A 2X1FA 4DR7J 1GMWA 1I3OB 4DBQA 2KXFA 3IRXB 2OPRB 2XZTB 4F4WA 2HQ3A 5KFLA 4K0KJ 4ZPVR 3V6KA 5DZ7A 1HNZF 4F36A 2BA9A 3T5KA 1IUJA 1NRKA 2HRYA 1K9MT 4USMA 3FUYA 1YJTA 2BBEA 2LCWA 2DISA 3KUEA 2R7OA 5KFVA 5A2QU 3LWMA 4EUVA 4WWSA 4FVCA 5DG7A 2GFFA 2BANA 2AX1A 1BWVA 5DGAA 4O4GB 2OH2A 3BJYA 4TYAA 1QTMA 3CULA 2FGOA 1NDCA 1HARA 5CA5A 4ZLPA 3BDPA 1BQXA 1SL0A 1XEZA 2VJVA 3CC4S 3W3SA 1G2EA 1EAYC 3L4BC 3UDVA 4B17A 3ZTQA 2NPIA 3DHWC 4OZ5A 2VPXB 3ZC4A 4LF8F 4LF9F 4ZJOA 3ZNJ1 2BXJA 1SJ4P 3MHYA 1NH7A 1RAAB 4ID8A 4ZPBA 4F0KA 4A8WA 4B9TA 2RSQA 5DO2A 4D3GA 4ELUA 5CZVA 5CYQA 5CABA 1WTFA 1E6YB 1HHSA 3R3TA 3H59A 4HT5A 3PZPA 1CS4A 2KT2A 2ZHBA 3QJLA 3CD5A 4DR1J 3OL6A 1KLMA 4C8KA 2V4JB 1VQYA 1O0PA 2LU1A 1AA1B 4HHUA 4DV4J 2CPZA 1PYSB 3QLHB 2MXYA 2VA2A 1IKYB 3MR7A 2POKA 3KLIA 1KTVA 1FKOA 1MW7A 5HMYA 4DR1F 1K1QA 1FVSA 4JBCA 4LR9A 3ZTRA 2BUNA 3OLAA 3D3BJ 4P52A 4DV1J 1XNRF 1FI4A 2K7KA 2VUGA 1HBMA 1NPPA 2EW9A 1XERA 1YRXA 1JXLA 4LBIA 2IVFB 4U7UD 4HLBA 1PJ6A 1Q1KA 3DM2B 2H3EB 3Q0AA 2B8PA 2IY5B 3GR0A 3R6LB 3MM5B 5GADU 4FPRA 1Q95G 1YJ9S 3GG0A 3GSDA 4B3RJ 1EZZB 5D15A 4FNHA 2FJDB 4ENOA 3UFCX 3MURP 4NA1A 3THPA 2RF2B 2V8GA 3QGIA 3BGFA 4HL9A 2Y1JA 3TVYA 2Y1IA 2FGCA 2BQUA 1UL3A 1S77D 3UD3P 2R7XA 2C22A 1TZ0A 1FKPB 3GYNA 4IDKB 4RKUC 4NLWA 2VC1A 5E7OB 1QSLA 1DAXA 2OO4A 2QE5A 2DHSA 2V0NA 1RT6A 2XULA 3M30B 2QSWA 1HQEA 2WONA 3JTPA 3KK1A 2FYXA 2Y3YA 3NS6A 4OZ1A 2XLJA 2V4RA 2UUAJ 1F1BB 2AZ1A 3BH6B 3QPIA 1RTDB 4Q45A 2PE8A 3W62A 4X4OA 2YQ3A 1RT1A 3KTQA 3HK2A 3G8QA 2WB4A 3UN2A 1NZ8A 2DGWA 2FHMA 1VCTA 1HBNB 1RBOB 3CDBA 3DOLB 4GRSA 2IIHA 3VQSA 3MR3A 3MCMA 1UWBA 1VQ9S 3OFFA 4PQUA 2H5EA 1KBRA 4I6WA 2FLPA 1L3SA 2QIFA 1TKDA 1HR0J 2L3MA 2VPWB 3ICLA 4ANEA 2ATLA 4OI0A 5B0EA 2HNDB 1FJEB 2WVEA 3FBCA 3N01A 1SJRA 2HQGA 2QGFB 3POTA 4YB1P 4G1IA 2GA7A 3W2VA 2NSBA 3DYAA 2DHGA 4NCGA 2DJWA 2IC3B 5KFOA 1TL5A 4ER8A 4LFCF 2J0SD 2B7CB 3GPAA 2DT9A 5D4LA 1HD1A 3KHLA 2B6AA 3H5SA 5LM7E 1ITPA 3OXGA 1FRLA 2XSJB 3K2YA 1GX6A 2MHEA 2W4DA 1M1GA 4J9PA 1H74A 2Z0GA 1FESA 2OAUA 3DLKA 1U1RA 3D4JA 1TK0A 2EK6A 2B51A 5CH7B 4CO4A 4DCPB 1BGXT 1M5VC 1RABB 1HR0F 3I55S 4MIBA 3KK3A 1U1LA 4JI2F 2ZITA 4ALZA 5A8WA 4N41A 4HI1A 3AQPA 3A1YG 2UUBF 4K4ZA 3NOGA 1W2IA 2ILYA 2CPYA 3LP2B 3T9NA 4PYAA 2HHTA 1H6KX 2COLA 3Q23A 4X4PA 2EKYA 3I82A 4CYUA 1YJ7A 4WIQA 4DL2A 2C2DA 2HAFA 1SC6A 2W2PP 5KTQA 1S6PB 2G13A 2H65B 1NK7A 1XBWA 2E29A 3UI3A 2GNKA 3ZZ0A 2B9WA 2ROGA 2DNZA 3ET6A 5HAOA 2CNKB 1X4FA 4NLVA 3HSZA 4DUYJ 1C1BA 3KDOA 4MIWA 1SJQA 3D6FB 4WTYA 2HEKA 5C24A 5DDOC 3IGVA 4YN3B 3H4DA 4X65F 4EYHB 1Y9OA 4ED2A 3X1LB 1SKRA 3P96A 3TAPA 4P73A 1CJTA 2DNHA 2IYGA 4OX7A 1VOMA 4MYTA 3M2UA 4MKAA 4UOCA 3EGZA 1HNVA 2V4QA 1U49A 2LXFA 3CW2C 3CJSA 4R8UA 2NS1B 3FBBA 3EZ5A 1ZH5A 1CLFA 2AJQA 3HM9A 1C4CA 5GMKa 4QWDA 2YNFB 5FLXY 3W60A 5J2NA 5J2MA 1T05B 4BDPA 4Z37A 3SDEA 4R0JA 4JI7F 1CQMA 3D68A 2QEXS 2G2ZA 2WOMB 5LOQA 3QRQA 1U4BA 3R2CJ 2DB1A 4ILRA 3TZWA 2X1GA 4A46A 3JSMA 3V6JA 5A8KB 4OYMA 2VFVA 1RYSA 1IKVB 1JNZB 3HVTB 2VFRA 5LMNJ 3A8EA 4BBYA 3OBIA 1NSQA 4DV6F 3GSIA 3L7OA 1VQ7S 2YNIA 2MB0B 4WP9A 1R7IA 2HPUA 1RHQB 2VPYB 2DNRA 4GKJJ 4LRDA 5AE1A 3NKYA 1HMVB 1S7IA 1RTDA 3KG4A 2HURA 3EZOA 1QDUB 5BJRA 3DXBA 3HVAA 2DGTA 4F0MA 3OL7A 1F5AA 2DCLA 3MPDA 1LWXA 3A3OB 4UZCA 4UT4A 3AB2B 5FLXU 1X31C 4O3OA 1UFLA 4TU7A 2RB7A 4LRBA 3FK4A 1SJ1A 3W8GA 1BWEA 1WACA 4EYIB 4YQWA 2GJFA 2FVPA 2HHWA 3FRZA 4JI6F 2WOMA 4ECSA 4OZ0A 4OQJA 4QU7A 3HFKA 3NS5A 1LFWA 5HLFA 3JQMA 2Q6BA 3RU0A 4X4QA 2QA2A 3CCLS 3RB6A 1IBKJ 3AOCA 2GO9A 3KLFA 5D0HA 4BLGA 1RU1A 2HBRB 4ED7A 4O3SA 2K2PA 4OI3A 2CKWA 2HS4A 3QIPB 1CJVB 3NL0A 3DLKB 2H4WB 3I0RA 4YP3A 2DNLA 2GS8A 1WEYA 2YH1A 3CCES 5KFGA 1UWAA 1IM4A 3FKBA 2V8DA 3AOBA 3DRYA 2N7CA 3R5AA 3AB4B 1KC8T 1GT8A 5KFRA 1YHQS 4XTTA 1HKAA 4QW9A 4ECWA 4WFYA 2HZVA 2YKMB 5EDWA 4QOTA 2ZH5A 3F56A 1FVQA 5E0OA 1VC5A 4MJKA 4J9KA 3RAMA 4P6QA 4LFBF 2GCFA 1RADB 1S5ZA 4OIXA 4OLOA 5ETNA 5A6WA 1SUQB 1WDTA 3EMTA 1V6HA 1RP5A 4OHVA 2K06A 1F3VA 3BREA 5D0GA 5J2PA 3RB0A 2ZBCA 2F8MA 4DU8A 4DR6F 2DIUA 2C2KB 3SZ2A 5KG1A 9RUBA 2DY9A 3K5LA 4AFFA 4W92B 1RTJA 1N5YB 2SXLA 2VA3A 2DEIA 3JAMY 2CA9A 4C97A 2WRMA 3IMQJ 3Q8YA 3BO4A 3PVXA 2R8HA 1QSSA 1FXRA 2RILA 4CLWA 5GVQA 3TUIC 1NDKA 2XBPA 3RTVA 1CJTB 1NBEB 2DRAA 1LW0B 2BKNA 1QE1B 3NMAA 4PG4A 1UJ5A 2D1CA 3QAEA 4MFBB 3W9HA 3DLJA 2R8IA 1NUEA 4V1Ak 3HVRA 4L76A 1PG5B 1NCLA 3B8HA 4I56A 4RWXA 3IBCB 1LNQA 3VAKA 4USKA 4U7CA 2U1AA 3PYDA 4KT0C 3B4DA 4CO3A 3MDFA 1S76D 1AZSB 2FHOB 5B0GA 1XQIA 3S7RA 4PXEA 5KFFA 2M88A 3FNNA 2AYGA 4B3OA 2IJNA 4K50A 1LXJA 3H42A 3AQOA 2RU3A 4B3TJ 1JLEA 2B56A 3CDAA 3MOJB 2CUYA 2ZE2A 5DDQC 3KJVB 2XMKA 2OPSB 3VHQA 2GIQA 3DGVA 2VOOA 1JLAB 2BJDA 4ZVRB 2IC3A 1DURA 1IBMJ 4DSFA 2Y8YA 3NMRA 2OD4A 1D8ZA 3G82B 5KG0A 2NUHA 5DDRC 3KK2B 3HT3A 1K73T 1QSYA 2ZH1A 1IVZA 3QT7A 4IG0A 4AE5A 4DQQA 4OJ3A 4QW8A 1N6QB 2KG1A 3EDQB 5I4MA 2LQ5A 1KN6A 1PBUA 2DK2A 2HAIA 5IWAF 4RW4B 2VICA 2V34A 2J76E 4FZVA 1KQFB 4ZVPB 4EEYA 5I42A 1N32J 1S79A 2O01C 2YQ0A 4WU3A 2F4VF 1Z1ZA 2EXUA 2DYAA 3T5LA 1UZDA 4F26A 4UF4A 1S6QA 3TARA 2NZ4A 4WFXA 3GIIA 2XGPA 1YJWS 1JLEB 1R8CA 2NYHA 1G4CA 4QBUA 3EYZA 3VAGA 4OYPA 3CCUS 7AT1B 4CLTA 2ATCB 2VQEJ 2GHWA 3EUNA 3GFZA 1ZYQA 4LVNP 3ZTPA 4X64J 2GX8A 4NLOA 2Y0BB 3TAMA 1ZZFA 3BGUA 5IV4A 1OMSA 2CQ4A 4OX9F 4ATNA 1N36J 4JOUA 2KJWA 2BRKA 2ZHOA 3G82A 4KYZA 1S97A 2QT7A 4M5GA 1DFDA 4P7TA 1D0EA 1U47A 3WX8A 1T8EA 1B7YB 3FEZA 4CO2A 5HQ8A 1QM9A 4ZVSB 3TQEA 4IYQA 4CO0A 3KLGA 2OUGA 5CYJA 4FF4A 5F8NA 3MEGA 4DLGA 4YEAA 2IMOA 3V6HA 3KLEA 2JFKA 3A8JA 2HFUA 4CLZA 5FDLB 3T3FA 1YBTA 4PWUA 1OY6A 1MMDA 4IOBA 4RPFA 3H0PA 5K9FA 3CJKB 1N0UA 2A3JA 3TZXA 1PCAA 2OFGX 3QGGA 1B0TA 4OZ3A 1MSWD 5KFCA 1R89A 2G0JA 2W7PA 1K8AT 4K4VA 2KFYA 1PIEA 1TKTA 4QIFA 2CDRB 1RHKB 3M4XA 4DPTA 1BC6A 1C2PA 2MMYA 1LV5A 2B3TB 3OPKA 1A7GE 5KAKA 1S1VA 3ZZPA 3VALA 3GYXB 3KNGA 3NAIA 1B3TA 1SJ3P 4U9RA 5IOLA 1VIXA 5D0RA 4DCOB 1SQFA 5LSOA 2FTRA 3PIOQ 1RWUA 4C8LA 2QLJB 4IRCA 5HROA 2GVZB 4Q2LA 3J80U 2VQEF 1RAIB 4NX9A 1UFKA 3MGJA 1WDDA 3EJMA 4GC7A 1RHJB 1V3ZA 2RKIA 1RE1B 2HGLA 3MI7X 4KY3A 4P2XA 4CM0A 1R6VA 2AX0A 1LWEB 3GR1A 4FYXB 1A9NB 5HJYA 2NQPA 1U6FA 1Y3KA 3VV2B 3VZHA 1U25A 5GAHI 2IAJA 4URQU 1WOPA 3MAAA 3MAHA 4X4NA 3PACA 4NYPA 2MQLA 3MMAA 4Z7YA 1IR0A 1RT4B 5D4NA 3J7AN 4RUCA 3PJ9A 4OJ1A 4TLQA 5IWAJ 3NCRA 2XLKA 2YQ1A 4WCEQ 3NWGA 1TUGB 3R6GB 1H2TZ 3R97A 2MKCA 2PD1A 5AXMA 2R2RA 1ZTWA 2VG5B 2YKNA 1W7WA 3D28A 2CYYA 3KWMA 4O44B 1TUVA 1T9VA 2CJKA 5CD4A 1MWQA 3I31A 4ICLA 1DTQA 2B5JB 2MLXA 4RW9B 1F0XA 2RRAA 1U24A 2BJ7A 3EVOA 4PYDA 1VLYA 3KOAA 3ZZZA 5L9XA 2GVZA 3BPSP 1A6LA 2EFNA 3PCOB 1WSVA 4NA2A 4DWIA 1MN9A 4WFBQ 1XMBA 1Q5VA 3QIPA 1KTQA 2PT0A 4XK8C 4DDFA 5RUBA 1KONA 3NGDA 1MWZA 4JI1F 1CULA 4ZVGA 2K1RA 4IUFA 4QYZJ 1GTEA 3VQTA 2DNKA 1VBYA 3IG1B 3W64A 4XPCA 2KJVA 5KFHA 2DRBA 1KSPA 1TKZA 1IKWB 4P72A 4U7UK 2JEGA 4NI2A 2HBZB 1MROB 3FVYA 4EBCA 2W01A 3N28A 1HHQA 4WFZA 1C1BB 4J9MA 2ZH8A 2PI5A 3MUVP 2HZAA 2QYGA 3DRPB 4HHJA 3QJPA 4AD6A 1JLBB 2E1MC 2N7YA 2ROPA 4C0BA 2MZSA 3OFEA 4I7FB 2E5LF 2NXCA 3M8WA 1FFWB 4NLPA 3GCWP 4AL5A 2JNJA 2BYCA 3EZUA 2EEYA 3GMGA 1R0BG 5HP1B 2E9TA 4DV3F 4MIAA 1N5TA 4RUBA 3RRKA 1S6OA 2F7VA 1G6BA 3T1YJ 5J2MB 2GGPA 5GAGI 3IN5A 2F65A 2H51B 4DSKA 2YX4A 3IA0A 1EP4A 5LSRA 3D0IE 4FF1A 3VAHA 4WIIA 4DR3F 2W7AA 2HK2A 1I94F 2NLWA 3B78A 1IM6A 1DLOB 1TL3A 2CG4A 2GC8A 2XTJP 3TEGA 1XMOJ 4EU0A 4L72B 3UR3C 3C2PA 1ZM4A 2DXFA 3HHLA 4F2RA 4W90B 2DNPA 1IR2A 1FK9A 2CJBA 3D1QA 3MMCB 4OHZA 2VQFJ 1FE4A 3UR0A 4S0MA 4KGMA 3OVSA 1RWXB 3UCZP 3BV8A 2E7WA 2L9DA 1LOUA 4YDXA 4Y2MA 1S1VB 5ETTA 1X0FA 3CGIA 4UY85 4CLKA 4CWBA 2D74B 1TL1B 1S9EA 4LF4F 3DI6B 5F9LA 1F3FA 5HMWA 5AXLA 5I3QA 5LMUF 3ZZYA 4PRFA 4OYIA 4CIOA 1HQUB 1MLAA 3FBFA 1VQKS 2E1CA 3DU5A 4JI3F 3GJTB 3P4UB 3VGTA 2JFDA 1WC6A 4ZJLA 3DOKA 4ECZA 4XDCA 3UD4P 1UA1A 2VU5A 1EP4B 5AE2A 2FJWA 3QSIA 3MD1A 4MTPA 1HFEL 3PFEA 3DRRB 1YKWA 4LF1A 2XO6A 1RQ0A 3PW0A 5F8JA 3SEOA 4CQ1A 5KFBA 1AW0A 1RT4A 1VI7A 1DQ9A 2PA8D 1X5TA 2AHOB 2WSEC 2MQQA 2AGPA 3GTYX 3JQJA 5KFXA 2P6TA 2P9CA 5T14A 2DITA 2KXNB 4ZVQB 5C25A 1XTZA 5IZHA 2WSFC 3SCJE 4RBUA 4ZP9A 3WDOA 2UXBF 1PAUB 3N9UC 2ZBIA 3OTCA 2EC2A 2PMWA 2KN4A 2ABYA 3GV8B 3EXCX 1HW9A 2RE1A 4X62J 3ZXWA 2J0WA 4NXMF 4I2PB 3TVKA 1Y0HA 2ZUAA 3AJDA 4X66J 2Q1LA 2E9ZA 5D4PA 2N82B 1V3SA 1VHFA 1WHWA 1S1TB 2RAQA 4N5SA 1U1PA 2KVIA 2I38A 2ZWOA 3G6XA 2ROEA 1SL2A 4ETXA 5I3PA 3SBMA 2O67A 2VBZA 1F9HA 4P7VA 3GIJA 4FS2A 4WFAQ 2KHDA 2ZE2B 3LH2S 4WBFA 1LEOA 2VPZB 2UV8G 4J9QA 1N33J 1RWNB 2B4PA 2QTWA 3DYAB 2NSCA 2ZKTA 4AYBD 3MZIA 1FJGF 1KOHA 1S0NA 4JI3J 1FHTA 4KHMA 5C25B 3QYYA 2VBYA 1ZA1B 3G6ES 2BE9B 4Y2KA 1JLBA 1SC1B 4BWJA 2Z58B 4L3KA 5IM0B 1UCNA 4OZJA 2UVWA 2V2ZA 3CD6S 4MAKA 3OW2R 5DQGA 2CG8A 2XNRA 1FA0A 1U8SA 1XWLA 1BUXA 4MFBA 1NK5A 3DRXA 1QAXA 3FSXA 2LVWA 3HI9A 4EGLA 2ADBA 2VQFF 2V6AA 2LFVA 3WHIA 2GV1A 4YFUA 2GGPB 1EIYB 1FEHA 4OL8A 4Y2CA 2GIRA 3FC9A 1BXNA 3MD3A 1SQGA 4CLSA 1GMWD 5B0BA 3M2VB 2I5JB 4CI0B 2ZVSA 2RKIB 3KLFB 1WD6A 1RK8A 2GO8A 3FMBA 3LP1B 1GNKA 2DPJA 1DLOA 2HQDA 2PDAA 2YPYA 3OD2A 3CC2S 4NL5A 3R7NB 2YWEA 5KG2A 1DJ0A 4WE1A 4O4GA 2RHSB 2VG7B 3ZTOA 5KFSA 2M8HA 3FSYA 4YY3F 1VQ5S 1MG7A 1XMOF 2XCPA 2YY3A 1S1UB 5FIIA 1VK8A 1VQPS 4K4SA 2FY1A 3V4IB 4ED4A 1BQNA 4DUTA 1CG2A 4K4XA 2JLFA 3BEGB 4UQGA 3J7ZT 3NNAA 3M2UB 4CH1A 2OP5A 4LFAJ 3DRSB 3MPYA 2PA3A 2VFSA 4KAIA 2BOAA 3LPYA 1L5UA 1JJ4A 2MSSA 2R7RA 3PX0A 1B99A 2KL8A 2PMZD 1RAGB 4DL4A 4NA3A 2FDNA 2P9GA 3O2IA 3SQGA 3TVZA 3QLHA 5B08A 1T3NA 2PI4A 3QATA 2BMBA 2NPFA 1PJ7A 4PKDB 1TELA 2XMTA 3DDNA 2UVRA 1RISA 2FB0A 2H48B 2KVQE 4HI2A 2JC0A 4MKVA 4Z7CA 4JI1J 2K1RB 2EK1A 3CIZA 5HROB 5IQ6A 2HFZA 2OEMA 1TMMA 2QLXA 4CM2A 2BJEA 4F4YA 4IOCQ 2DPIA 1EX8A 1QAYA 4DV7F 2OMOA 2NUUG 3MPUB 4NEYA 5HK4A 2ZZTA 2CIMA 3BKTA 3OR1B 4LIWA 1MROA 2K8GA 2QLFB 4NI2B 3DXSX 3MPVA 4J37A 3M6WA 2DGUA 2FUG9 1N5SA 3NBPA 3NY0A 3Q8UA 2PN6A 4WPAA 1H2UX 1UA0A 1JK9B 4CTAB 1GXLA 2HVEA 2H4YB 5C42B 3BQ0A 3M8YA 3A13A 1S99A 1S1XB 4M5MA 3I5BA 3T41A 3LW5C 3OTOJ 2IPOB 4FKXA 2UXCF 3I0SA 1VR6A 2MZQA 3KUHA 4FYWB 1R0AB 3M1VA 1PGZA 2MZ1A 1TVRB 5DLFA 1X4AA 1H7XA 1RBLA 2XZDB 4PUOB 1D1UA 4K5SA 5CHCB 3M2RA 4O44A 5E3CA 1Q86T 3HZGA 3NGSA 1K0VA 5KFZA 3C46A 1H2VZ 3NAHA 2OTJS 2VV5A 2B8QA 4AQYF 2IVMA 2QL7B 2EVZA 3T6BA 4Y2IA 2Y1RI 3M9NB 1VQMS 2CNOB 4R25A 2QO3A 2VC0A 4C2MA 5HSPA 3D5MA 1LWFB 4CLPA 2AYBA 4IFVA 4J9SA 2C2ZB 1N4LA 2V2KA 4K2XA 3ENAA 4TXSA 1VDHA 4MK8A 2G0CA 4OI2A 1SKWA 2ASDA 5C42A 2XHCA 5CYMA 3K57A 2HW3A 3L95X 1UVLA 4QPTA 4RW7A 3BZQA 1KQSR 3RR7A 3MMAB 5D78A 2C3MA 5DM6Q 5KT3A 3OUYB 3C6UA 2VBWA 4HDHA 2CRLA 4MMOA 3WQPA 5B0DA 4B3MJ 1WG5A 1XNQJ 2MKYA 1HPZA 2AJ0A 4QWBA 1U1MA 3PO4A 4Q0BA 1S72S 1ROFA 4A8SA 2OD6A 3VVTA 2GQCA 4C3LA 5J1EA 1WKLA 2I8EA 3PYFA 2G2YA 4LF8J 4A47A 4BHQA 1R27B 1UEKA 2YWWA 4Q7AA 5DRKA 1Q81T 2J0QD 2WZ1A 3MFHA 1S9FA 2EFOA 3SI8A 1N36F 3BB5A 5E5NA 4C0HA 4WK3A 4NMXA 1QJHA 4LSNA 5BYRA 2ZJQQ 1R8PA 4HYKA 3CJRA 1I1GA 2XB2D 5IT0A 2ACYA 3BGRB 4ZOSA 1M5PC 1S6PA 1F6TA 1WG4A 3Q8QB 4NYZA 2D7SA 2CQDA 1S4EA 1S9GA 4FVMA 3PJXA 4IDKA 5E3PA 3I5CA 3UNYA 2KM8B 4OX9J 4BC9A 3PXGa 3RZAA 1RT6B 4I2PA 5T41A 1UZHA 3FCHA 1RKIA 1YDLA 2GJ2A 5A8WB 1L3VA 1N34F 5KFKA 1B70B 2P9EA 2YNGB 1HNZJ 2FVQA 3KHRA 1ZZNA 3W9IA 3KLVA 2MKKA 3CTRA 1U02A 1OQ3A 3IWLA 4AL6A 3UCUP 3IR5B 3U27A 1RAHB 3WIVA 2J6SA 4L75A 1U2RA 2K3IA 1U2CA 2FC9A 3CCQS 2RQMA 1EJ7L 3WC2A 1IWAA 2RUGA 3D1OA 2B4UA 1DQ8A 4DMZA 2EFQA 2D3UA 1T11A 2J8AA 3DRRA 5EUHA 3TA1A 5F3TA 2QFIA 4C98A 3DLHA 3HJFA 3H5UA 4JI4J 4N8OA 3RJMB 3W2VB 5IM0A 1N6QA 2GJIA 5JXSA 1RDRA 1AUSL 4HR2A 3SSSA 4C4WA 1XK8A 4H4MB 5DLGA 2WONB 2KXHA 4FYYB 5KFMA 3E51A 1YSJA 3BGOP 3CIMA 2M0GB 1ICEB 1RU2A 1WKJA 3JSYA 4P2MA 3UNGC 4U67Q 3MCSA 4I4BA 2YKAA 4RW8A 3Q24A 4DV5F 4PUOA 4NLXA 4DF8A 5I3UA 1IJFB 4DPUA 1HHTP 2MQOA 1HWKA 1ZM2A 6AT1B 5F0WA 2Z2MA 4TY9A 3TJ8A 5HVGA 2ADCA 3IC1A 1NKCA 5DG8A 1IQZA 1P1TA 2HQIA 4LJMA 2J9CA 1NHUA 2E5HA 5J2PB 1QVFR 4Y2AA 4RNOA 3MTKA 2GHVC 1TL1A 2ALYB 2LKZA 5C7PA 3OSNA 3DI6A 4DSJA 3O6QA 4FS1A 3I6PA 1RHRB 3AJ1A 1RT3A 1S10A 4IFVB 4BS2A 2F3JA 3A3PB 4DQPA 2OPQB 3UDEA 2V50A 5LJ5Y 1SV5A 2L48A 5G4DA 5ETMA 2NZCA 3GONA 1RLCL 4K4UA 1LW0A 3GYGA 1B64A 1X4CA 3D6MB 2RF2A 4C8YA 3BR9A 4N76A 3Q86A 1HPZB 4ZK7M 4X4TA 2BJ1A 4Y00A 3QZ7A 2EWHA 1WUUA 4UOFA 3X3UA 4F67A 4LR8A 3VTIA 3H40A 1ZAVA 1RT2A 1J2VA 4KRWA 1X9WA 1TK5A 1U0HB 5F8MA 3MM7A 2KYXA 1EB0A 3I9V9 3GJRB 4K2JA 5J1NA 3HHEA 3C16A 1ELOA 1NHVA 4P10A 1HBUA 2JEFA 5D8HB 2CJXB 2RQKA 3CVKA 3NP5A 2FJVA 2QJ3A 1DZ5A 2DHHA 1PJ5A 3MM6B 2CPIA 4P75A 1J5OA 4ZHRA 3G8TA 5D3GA 2B0GA 4CNYA 2IM0A 4U95A 4QZVB 4QQBA 1V9OA 1WC4A 2WTFA 1UVIA 2F9DA 4GKKF 3FEYB 2R8KA 3LP0A 1QUPA 4E0DA 2JRSA 3DFEA 3Q8PB 2VG7A 3MR5A 3CCJS 3G9CA 3RW6A 4CTAA 3OR2B 4RNMA 5CXTA 3TZZA 4ED5A 4C3KA 3AD9C 3LAMA 4OJGA 3UD5A 2YWGA 4DPXA 4Q44A 1FJGJ 1WSRA 2CWXA 5KFUA 1HNVB 4F8RA 1VRQC 2A10A 2H5IB 1DQAA 3GIMA 3M1VB 2X51A 1TVRA 1SH3A 2VG5A 4O3PA 1U0HA 1U8WA 2KRRA 1ZM3A 3C66A 4ILMA 2FY8A 4HTIA 2R8GA 5J1PA 2B4VA 4LSLB 3I9ZA 1NJXA 1KFSA 4DX5A 2OI2A 3IWNC 4IQMA 4QR1A 4CLFA 4Y3CA 2HG4A 4A8YA 3SV4A 1OY8A 4ZPAA 2CWKA 5JVHQ 1HD0A 4X66F 4O23A 4K4YA 5A8KA 2APOA 4DG1A 1U1QA 4CT8A 1TL7B 5LMNF 2XMMA 3N79A 3TAMB 1J5EF 2V9KA 2MQ8A 4P2FA 5K8OA 2LXUA 1CC7A 2QYCA 2QSFA 1FDAA 2VASA 2W24A 3OR2A 1HNWJ 1PC5A 2G4BA 1WELA 4J9OA 1CJVA 4K4WA 2IRUA 4V19J 2VBXA 1X7VA 2JJ4D 1JLCB 3FBEA 3HT0A 2EKNA 1HNIA 2RVJA 3UVJB 3PR5B 1NK9A 3ONQA 4KIAA 3W5ZA 4C0OC 3PW7A 4LT6A 2UXDF 1BQNB 2GIFA 3QGPA 2Q6CA 1KVJA 4UUWA 1HQ2A 3H2VE 4M5KA 3L7PA 3DOMB 4F04B 4XIUA 3ADAC 3DRSA 1XR7A 2DXEA 3MEKA 1R8HA 2GMLA 3H2LA 2YNHB 5GAGU 2QZ8A 1VRUB 4DUYF 4I68A 3K59A 4MT1A 3SCKE 3PO5A 1YRUA 2YNFA 1B0VA 2BABA 3EWGA 4M5LA 4EZ9A 1CJUB 3T6JA 3S8SA 2RHQB 4LF6F 3EPGA 1XMQF 4YB5A 4F0HA 1VRTA 2V2QA 2C3PA 3CD7A 3DC2A 3J7A1 5ETQA 3WC0A 2OPRA 2R7TA 4WF9Q 4NZ0A 2GVDB 1VC0A 4I67A 1U48A 2W8KA 4IH5A 2V63A 1TP7A 1PC4A 1M90T 5JMNA 1T7PA 4KH0B 2YNIB 3HF5A 4KV8A 1R8BA 3V5RA 4DFJA 3V6DB 1H72C 3HVWA 4NPOA 4KJIA 2AJ1A 3F44A 5HANA 2AGOA 3FQKA 4H4KA 3H20A 4DR3J 1GK8A 2YKPA 2BE2A 4GVBA 4QIVA 1NK4A 2VONA 3TQ1A 2Y9HA 3PEJA 1X4BA 2HVIA 2XMWA 1NPKA 1VBKA 1VYAA 4ES3A 3P49B 3OUYA 4FYVB 4A8FA 3CMQA 3OLBA 1VRUA 1ULRA 2MKJA 3QNWB 1TL4A 2AV5A 2PSZA 4ICLB 4LVOP 2VL1A 2V8VA 4B3SF 2VH7A 4OV6A 5AT1B 1VLOA 5B7WA 4DSIA 3KJVA 4ZLNA 4IRDA 3MXHP 3KKFA 2GMHA 1OWXA 3QJJA 4N47A 3SFGA 3PM9A 2GVDA 3MEEB 3V4MA 4XPEA 4ANDA 3SMZA 3R7BB 3NCPA 1IJEB 3KLEB 2V9WA 1BE4A 3AT1B 4LFCJ 1S12A 3BF4A 1HYSA 1H98A 1WORA 5HQMA 3J81j 1O51A 2JWNA 1L3KA 2MGZB 5KFWA 3IM9A 2KO1A 3GFYA 4RW8B 3M8RA 4TLRA 2M8DB 1QAIA 3UW1A 2RIJA 1DARA 5A8RA 1JLFB 3MM8B 1MWYA 2GAHC 2HIQA 1FXDA 1UW4A 2G1HA 2A6MA 5KG6A 3K5OA 5CQGA 4KH1B 5ETSA 2CPJA 4I7FA 3DLBA 2C2OB 3E3XA 3Q8SB 1D3WA 1U1NA 2F5GA 1URRA 3QT6A 4YHHF 2GZOA 4YR3A 3K89A 5DQHA 5DJBA 1S6QB 3IWXA 4B08A 3G6YA 5H9EK 2C2EA 1HI0P 3ZTSA 3UO0A 3P6YC 4ZVTB 1DY3A 5KG3A 5JJBA 2CZ4A 2O1PA 1RT5B 4FKYA 3MM5A 2ZH6A 4DN0A 5DETA 2KHCA 4DPYA 4F7VA 5J1EB 3KK2A 2RQ4A 4LRAA 2ERRA 2DBBA 3DGPA 3G4SS 2RS2A 4RU2A 1JLCA 1NSKL 4MYUA 3KLHA 2JVOA 2WVBA 2G1DA 4M5IA 4F25A 2X3GA 5HATA 3QBCA 4ZMMA 2F8HA 4PXDA 1SKSA 2ASJA 4LSNB 3L7UA 4ZN3A 4KE5A 2D3O1 1JMTA 3LA0A 3W8PA 3A12A 1LQ9A 1C0TA 1SIWB 3CO9A 5H1SV 5KG5A 3J80Y 3UE2A 2ASYA 4TQSA 3PKYA 1NEEA 1S0OA 3G87A 1MMNA 1WG1A 3K8WA 3ULHA 1Y11A 4PXBA 4O3RA 4OYBA 4DJBA 5IXUA 4RJVA 2G0IA 4AL7A 1U6BA 2E66A 1JJHA 2YX7A 2CAJA 4DU7A 5EWFA 2Z8QA 4WK1A 2W9BA 1GXUA 1GMUA 1WJ9A 3EE3A 1FX4A 5IC6B 1VQ4S 3ETOA 2HFOA 4QJVA 4ZVEA 2WW4A 3QRRA 4B3OB 3LANA 2JX2A 3MR2A 4F4XA 1IR1A 4TU9A 5GMDA 4A8QA 4HTJA 1SXLA 3KJFB 4F4ZA 1UMJA 1SI9A 4USIA 1RAOA 2ZDPA 3GV7B 1FD2A 3BGLA 2V67A 2FVCA 3MOZA 2VDHA 4OMFG 3DHXA 1TK8A 2XMUA 1EARA 3OHAA 4MK7A 3OT9A 3H5XA 4OI4A 2BE2B 5CYQB 3RAXA 2B7BB 5HL7Q 4PPDA 3BH7B 3F0NA 2XHWA 2V8HA 3GJQB 2D9PA 4ZA1A 1AFJA 1Q16B 2D3ZA 2HGNA 2QA1A 2HWIA 1YBUA 1JLQB 2P8IA 3QWPA 3TX0A 1N0VC 3VAJA 1F2GA 1TKTB 2KKHA 1NMEB 4F4AA 2O3DA 1QLNA 2HFNA 3FMWA 4X64F 4X4UA 4UOGA 1B4SA 2JHEA 2DXDA 2YTCA 4C9DA 1RLDA 1J27A 2BJ3A 3THTA 3MM7B 4H4OA 3NWRA 3OSPA 3I32A 5SUHA 2B5JA 1DTTB 4ES1A 1FRHA 1RT1B 1XC9A 2EBGA 1WKKA 3KJNB 1P8GA 3S1TA 3ZO7A 2DGOA 5KFQA 5EN1A 3AD7C 5DS7A 1NAQA 1R43A 3IRXA 1J5OB 1N5VA 2K3KA 5AJ3J 2IRYA 3HHLD 3M05A 2JEJA 2BW7A 2MDAA 3RUBL 2DHXA 2VFTA 2QA4G 1H7WA 5DGBA 1AYEA 2CADA 3IRWP 3KDNA 4X4RA 2WVCA 1YITS 2EBEA 3CD0A 4M5JA 2OPQA 3PHEA 4DN9A 4DR7F 3J81U 1S1WA 4U96A 3UN3A 5KOWA 1FNOA 1S1XA 4OV1A 3BSAA 2VG6A 5B09A 2CQ0A 1BY9A 1CEZA 3TA2A 3B54A 4M5HA 2XYGB 3GV5B 2KFNA 2GHPA 1LW2A 4R8UB 3TJAA 3BO3A 4KSEB 4MK9A 1YZ7A 3IBFB 3M9OB 2R7VA 2W25A 2ZHAA 4QIEA 3NCQA 1VQ8S 3CCZA 3KG1A 2A2CA 2CXEA 2Q79A 2HHSA 2FJAB 1R6YA 1RYRA 5K20B 4RLEA 4C8MA 1FRKA 1FTCA 1LK7A 2GQ2A 1KQKA 1RHMB 1S48A 3EX7B 2KT3A 4L73A 4K4TA 1UETA 4PAAA 1V3RA 1Q8IA 1TTHB 4I6YA 1TU0B 2EFGA 4RW6A 2PMHA 5D3GB 1X9MA 4DOZA 2A2DA 2KM8C 4ZCMA 1F60B 1VMBA 5LXRA 1RTZA 1JLGA 3TW0A 1MN7A 4RNFA 2HLTA 4KPYA 1OO0B 4TVAB 4KR0B 3PYGA 4KBIA 3ET6B 4WXOA 4X2BA 3IGNA 4RUHA 4ELTA 4KGZB 2O66A 4ID5B 2ZM6J 1FRIA 5D77A 1U1OA 1LW2B 4CLYA 2DO0A 1REVB 2LU2A 3DLEB 4Q5VA 3BSOA 4A8KA 4ZPTR 4LF6J 3M6XA 3C15B 4DF4A 1N88A 2JZ5A 4FF2A 4ECXA 2NR0A 4QIWD 3LTOA 2OPPA 4RNNA 1SJFA 2AJ4A 4YS2A 3OVBA 3W2WA 3DMJA 1JWWA 5KT7A 3N5FA 4C48A 5F9NA 2GQQA 3B4MA 1IBLJ 1HLWA 2AGQA 2AIRB 3VWSA 5F8HA 3SDEB 3CJ0A 5DDPC 2DGQA 2AKWB 3BKFA 3ITHB 1SC4B 3AXKA 2C28A 5F8IA 3JS9A 3FQLA 3PRVA 3D0GE 4DQSA 5IT9Y 2RT3A 5A8RB 4ZP6A 3VVUA 1F5BA 1XR5A 3ISZA 3ENWA 2WAQD 3LO3A 4H4KC 4ZP8A 3MEDA 3EVMA 1NH8A 1JKHB 3V4IA 1S9EB 2PIIA 1WC1A 2XNQA 2NXJA 3TEHB 2AD9A 4DX7A 1IKYA 2RRNA 4J9RA 3DLLQ 2I9SA 4ECQA 2IYIA 4PQUB 4TKTA 3LGMA 3C8YA 1Q8BA 1WF0A 2UUWA 2VF3A 1NJIT 4DR4F 3DOMA 2UVUA 3A3NB 2J7UA 2CPXA 4O4RA 2HZCA 2ZD1A 3T9ZA 2IM2A 3MCOA 3TUJC 1OSCA 3CE8A 3MAQA 3NOCA 1YBAA 4KFBB 3BS9A 4NOHA 5K14A 2WBRA 3EPIA 2IHR1 2KTQA 4NLTA 4KQZA 3T1AA 1X9SA 2VKRA 4IR9A 2BACA 2QLBB 3AODA 3IR6B 1I5OB 3GFHA 1S7HA 7FDRA 2MJNA 1R0CB 4XAKA 2XSJA 1CS4B 2OLWA 2YXLA 3OV7A 5HI7A 3TJ9A 3RW7A 1WHXA 1PO6A 1G3OA 2PGCA 3CT9A 4LBHA 1I6JA 4B9NA 4PPZA 4ZVUB 3Q8VA 5L39A 2YPZA 4FPIA 5L8RC 3EVWA 3N6NA 3MMCA 1T03B 4KV8B 5HJXA 3DKDA 2GAGC 4NLYA 1RTIB 4ZIVA 2WW8A 2CQBA 4OX6A 1YTYA 2PFFB 3T1HF 3LP2A 3FSIA 1NK0A 1YVFA 2V2VA 1AUDA 4Q0BB 1QVGR 3US5A 2X1AA 4JI7J 5IC4B 2LMIA 2QL5B 4EO6A 3DOLA 4RO0A 3ZZUA 2XM3A 4ECRA 1S0MA 1IWGA 2JH3A 2KDOA 4P2SA 5A76A 3M32B 5F8LA 3AY0A 3H7HB 5ITHA 2XY7A 2E5IA 1RA6A 1WHYA 2HNZB 3CUNA 3A8IA 1RAJA 4XDDA 4TYBA 3SYZA 3P3DA 3K7RA 1BQMA 2ZM6F 3DCAA 1RT7B 4TNOA 3ILJA 2M7SA 2DO4A 1HWLA 4MH8A 3OJUA 4F50A 1N8RT 1FRJA 3UQSA 3HHNB 2ACMA 2AYEA 2MZRA 5D4OA 5KT5A 4JV5J 1M5OC 3M30A 2H54B 1JNRB 4QR0A 5H9FJ 3VCDA 4QCLA 4G1PA 3EM1A 1Q8LA 2FLOA 2PC6A 3KHGA 4DUZF 2J6UA 1M1KT 2AEJA 4W4MA 2DR7A 4LRFA 2E1RA 1X4GA 1WC0A 3MTJA 3PR4A 3KNAA 4MKBA 2RUSA 5DG9A 3N4WA 2OTLS 2R7SA 4I64A 3K5NA 1Y10A 4ZLJA 2D41A 2R2UA 3L9ZA 2JEIA 2HLUA 3UDCA 2M5YA 5C2CA 5LT5A 5CAAA 3GE9A 1WI8A 3SV3A 3VR1A 1M5HA 3O5TB 2CNLB 1RAEB 1WOOA 4OZNA 3M32A 1VFJA 3QSYB 2Z56B 4CNZA 2XC9A 3AHPA 1LFPA 4NEZA 2JVRA 4KGXB 3R7SB 2DR6A 2IJRA 2ZDOA 3R1LA 3BYRA 2QA4S 5KT4A 4FYDA 3G2XA 3HD2A 2CJAA 3MM9A 1OYDA 2VODA 4J91A 4C8OA 2FQQB 3N0VA 3HMJG 5A2QY 3QMQA 3HPOA 4UY8T 1D9DA 3I4HX 4ANCA 3IXQA 4DS4A 4M95A 1RAFB 1YJNS 4DI6A 4ED0A 1FFSB 4CO5A 2DRDA 3NGTA 1DBDA 1U2FA 5ETLA 4RWWA 4YMEA 1UP1A 1VS3A 3IAS9 1WNEA 2FIUA 1H73A 4J90A 3R5CA 1D9AA 1RGVA 4OYXA 3G6VA 2B9YA 5E41A 2EG2A 3R8YA 3SQOP 1ZTTA 3JAMU 2C2NA 3M9MB 4YY3J 1D9FA 3FFIB 4R0EA 1KQGB 2E5JA 3AH6A 3AJ2A 3ISND 4OYZA 4KPCA 5F3ZA 1JJ2R 4KHPJ 4O0IA 4RW6B 3HHKA 4LQ9A 1S6UA 1KOOA 3MMBB 4EWTA 4D3HA 2ZBQA 4PABA 1OS5A 4GVLA 1S49A 1XMQJ 1S9GB 4HH1A 1AROP 4FP9A 3FZ2A 2HNDA 4PCQA 3WBZA 4B3RF 1N48A 2H5JB 2IM1A 1NJYA 2IBOA 4I2QB 2AYMA 2J9EA 1P6TA 1Y5NB 4BCAA 1HMVA 4MKYA 3MR6A 4AXIA 3I0SB 3PIPQ 1KHWA 1NK6A 3F73A 3FJ2A 2J8SA 2RRBA 1RBAA 2BEFA 4LMZA 1P27B 1NJWA 1AXQA 1JLQA 2JLEA 1DHMA 4QYRA 1X8DA 3CJKA 3PW2A 4IFYA 2LDYA 2MSTA 4NZ7A 4CLUA 3THVA 3CB4A 1Q0NA 2R4FA 3KJQB 4DQRA 4DV1F 1XNRJ 2VDIA 4B3MF 3CNQP 1XNQF 3U1LA 1JXEA 5L1LA 2GW8A 1RT7A 4LF7F 1FNMA 2HRTA 4OJHA 1U0SA 1FTRA 1ACMB 4OYOA 4DV4F 4ZCIA 3KYLA 7FD1A 1X5SA 2RDDA 3L09A 3M8SA 4PWWA 2U2FA 1JQGA 4DR5J 1LWCA 2MPUA 3NGUA 3O1LA 3OTBA 2Q66A 3ZZTA 2LQJA 3MEDB 4FDFA 3D9BA 3G8SA 5IT9U 3TZYA 3H25A 3CWJA 1K1SA 4URSA 4X62F 1S57A 1VISA 2DNOA 3FCWA 5KFEA 1CJKA 2IRXA 1AZSA 2FJBB 4PEOA 4IG0B 1ZPWX 3W5YA 4U6PA 2D9OA 1NM2A 1RZMA 3OFGA 2HK3A 5KFNA 3DLGA 2LEAA 3HFZB 4IG3A 4UOHA 5M2UA 3TANA 4YOEA 4Y34A 3A4TA 1AT1B 2GMJA 3O3LA 4F3MA 3I56S 4J7CA 1IKXA 2JSXA 3VZIA 1GFWB 3TUZC 1RWPB 4PG8A 2AZ3A 2ZH4A 3GU0A 3MWBA 3KFWX 4B9UA 2BVZA 4URGA 3M8PA 1SV5B 5CZXA 3NGKA 4E2FB 1NK8A 3NXZA 1FD8A 1N54B 2DEJA 3HX9A 4HH0A 4OHWA 4EMDA 2HFSA 2PEHA 3D7SB 1VQSA 3DDIA 1F9FA 3ILIA 4ZKAA 5H9EJ 2HHHJ 4WKYA 1SIZA 2LXIA 4AXJA 4LF4J 3TR5A 1HBOA 1LWFA 2HGMA 3VGSA 1VJWA 1HNIB 2HNYA 3IO1A 3CXCR 4DFKA 1E6VB 1R8AA 2IVYA 2W2NP 1CJKB 1OY9A 1JLGB 4HT7A 6FDRA 4NXNJ 3GB0A 1WC3A 4BC7A 2R2TA 2XQCA 2QLWA 1UW9A 2LEPA 3RBDA 3CCVS 2QRRA 2Z4PA 3D2WA 2LEBA 1X60A 5F8GA 1BLUA 2DR9A 2OJ3A 1SUQA 3HXMA 2NYIA 2X7IA 3DRPA 3PJWA
chains in the Genus database with same CATH topology
3PEHA 2EG1A 4NRUA 3MMBA 4N8NA 2H9ZA 2CQ2A 3E01A 4QR2A 1OIAA 1TQLA 1YG0A 5CCMA 2ZZMA 5K8NA 2OSQA 3DMJB 1KHVA 4LFAF 4KHRA 3DN9A 2YKOA 4Q43A 3CDUA 4I2QA 3CEDA 1NU4A 4WZMA 5B0AA 5EX3A 3OVAA 1Q7LB 5GAHU 4DS5A 2ASLA 4B9MA 1UVNA 2HRUA 2W7OA 2XI2A 2ZH9A 4TY8A 2FLLA 4DL3A 3V6DA 1SBRA 3K5MA 4KGKA 4M5DA 2V4JA 4IO9Q 1KRPA 2XS7A 1CQNA 4LSLA 2VFUA 1Q78A 2P6SA 3DNCA 3HHLB 4NXNF 2CPFA 3KLIB 2W9AA 2CQIA 2A18A 2J5AA 4R5PB 2ZZNA 4M1KA 1Q79A 4Q8EA 4C11B 5BYQA 4DL6A 2HVHA 2FVRA 1X4EA 2RMLA 2Y0SD 4IH7A 4EBEA 2HHHF 5J2QA 3R5BA 2IA6A 2LDIA 3DM2A 1MU2A 2J0XA 1VIOA 2QMWA 2DH8A 3T5JA 3SXLA 3MFIA 2BM1A 2A1BA 2CQ1A 4KO0B 2M2BA 3P5TL 2L08A 2V94A 3IR7B 2MY8A 2R7UA 1KLNA 5FJ4A 2XWYA 3K58A 2E9RX 4IR1A 4UW2A 2UU9F 2AWZA 2HS3A 4JI0F 4JV0A 2XEXA 1HNWF 2HWHA 2AJFE 2I2YA 1OSDA 1RA7A 2MJUA 3SSRA 1N33F 2RNEA 1E6YA 3JSRA 1TKZB 1TV6A 2QV6A 2WK4A 2CQCA 2DD8S 1RKJA 3HZEA 1UVJA 2B9XA 4RW9A 5GADI 2CQGA 4DL7A 4EBDA 2XSFA 3OL8A 3VAIA 1FE0A 4DV0F 2E1AA 5KFAA 4ZHRB 4RZRA 4PWDB 1VQLS 3HP6A 4NLRA 4OFZA 3CCMS 4Q8FA 4YUDA 1TFYA 1S0VA 1APSA 5A0YA 3EXYA 1ZETA 2FC8A 2DH9A 3CJ5A 5G0RB 2OSRA 2BM0A 1IKWA 1RJJA 2RDIA 2LQBA 4WU2A 5KFPA 2ZJRQ 1S1UA 4FNIA 4J9MA 2XS5A 3J7Z5 2KU7A 3OXFA 5L38A 4K5RA 1BQMB 2LA4A 1HWIA 3CSKA 1C0TB 1UJ6A 5T7LA 1K0TA 1G7CB 1Q4RA 4UQTA 3S01A 3TRGA 3KK3B 3CPWR 1L3TA 2CPHA 2MY7A 3SQGB 3GG1A 3NG8A 3KK1B 4YB6A 4V19X 1YJVA 3U1MA 5AE3A 4PWDA 1IN0A 3KHHA 5JVGQ 4ES2A 3RR8A 3V81B 2XLIA 5MAOA 4Z2XA 2DNGA 4OHXA 3SCLE 2OFHX 4WYLA 1WWHA 4YDDB 5L1KA 2I5JA 2YVSA 4ED6A 1Q82T 4ELVA 3LP1A 1HWUA 4RNHA 3ENVA 2G9OA 1JLFA 3MM8A 5LXYA 4LF5F 2DNMA 5EWEA 2IFXA 2KRBA 3FRYA 3POTB 4LIRA 4FF3A 1LXNA 1N32F 5IFMA 4KKOB 2M70A 3CMES 2QFJA 1Y00A 4F3OA 4Y65A 2B6AB 1UAWA 5K8PA 2EFPA 4GO5X 3OTOF 4C3MA 1HQUA 2XWXA 4IH6A 4OZLA 5IS2A 4PR6A 1RT5A 2Q43A 1CVJA 3LUYA 4RUAA 4YR2A 2AU0A 2XGQA 1WEXA 4WJBA 4TQRA 4ZVFA 3LALA 4PG7A 4ECUA 1CC8A 4ERDA 4F2SA 3TYTA 3RRHA 3UCGA 1TL3B 1NB7A 2VKZG 2FVSA 1YQHA 1N5QA 3MMJA 3MPWA 5CYMB 4A48A 2MGZA 2W9CA 1Y7PA 2JLGA 4JI4F 1JKHA 1U7LA 2HYIB 1IQTA 4N77A 4O3NA 3OQ2A 5C24B 3EGWB 5F41A 2ZH3A 2CJQA 3Q22A 2Q3PA 2VD3A 1C0UA 3JYTA 3N6MA 1SB6A 1R3NA 4NLDA 2Z2LA 1X0PA 4OI6A 3PY8A 1SQEA 3S6EA 1W2BR 2FHJD 1H3DA 2LECA 2CFXA 2XCAA 4C8NA 3I5AA 4ZDNA 1TR0A 3BQ2A 1BD6A 1ZBTA 1ZPVA 1MMLA 2ZOMA 4IO1A 3G71S 1HYSB 4ITSA 3HKZD 2CVIA 3WZ0A 3KLHB 3OJSA 2MB0B 3OFHA 2ZKUA 2V5HG 3I0RB 4A8XA 4B9SA 1UEUA 2M52A 5GAEI 1W25A 1FK9B 1GAOA 3BQ1A 3PV8A 4DV2F 2KH9A 4CCHA 4FXDA 4JI8F 3H8YA 3T5HA 4QU6A 2I1RA 4R5PA 1FF2A 4L3NA 3D1HA 3J7YI 2IMWP 1B0PA 3SCIE 3C3LA 2WHOA 2JOQA 4FN5A 4KTQA 2CPEA 4F4KA 2UUTA 3V81A 5CD4H 2HMIA 3O8WA 4FXWA 2LLZA 1HWJA 2C3UA 3LQVA 5J2NB 1T05A 1OPIA 2F40A 5U47A 1IBKF 3K0JA 2XO7A 1ZM9A 3H98A 3PW4A 1X4HA 4K59A 3AA8A 3H2UB 2MHNA 4ZP7A 4FBTA 2AW0A 2EFVA 3T1YF 1NKBA 1YIJS 3MEEA 1UFWA 3VAMA 5HBMA 3MF5A 1T94A 5C5JA 1UVMA 1H38A 3IS9A 3JSBA 1FKPA 3OR1A 1C4AA 4GC6A 2LQ9A 3JTOA 3PW5A 4FBUA 4KB7A 2BV3A 4DFMA 1Y3JA 1H0HB 3AA9A 3Q2TC 4C8ZA 2DR8A 4IQXA 2VOPA 3SSQA 1S9FA 1GX5A 3E8OA 2HWTA 4NLSA 2J9DE 4DSEA 3NLCA 2KT5A 4NWBA 5KT6A 1DTTA 1HL6A 1X5PA 2L41A 5J2QB 3M2VA 5DM7Q 2XY5A 2IJFA 5HLFB 1NZAA 3TOQA 2J9DA 3EGNA 1KR4A 4PG6A 4KO0A 4C7QA 3WX4A 2DTJA 2ZNZA 3FZBA 1IBLF 1Z2ZA 5THWA 2MKIA 2YWFA 2CQHA 3QAUA 5M2PA 5KFKA 2JC1A 2MKSA 2CZVC 4M63A 5KFQA 3PRDA 4RBTA 4USJC 4UUXA 1KNZA 1IXKA 1P9QC 3GILA 3IS9B 2ZNYA 1KD1T 1GH8A 1ZAXA 4M94A 1C0UB 3JYTB 2BOPA 2I0XA 2C42A 4A4JA 3ENQA 5AXKA 5EWGA 2R7QA 4I69A 1AFIA 4NZ6A 2YKQA 4H4OB 5B0CA 2P5VA 4G6VB 4Y0FA 3G96A 2UVVA 2W9BB 3MM6A 3B82A 1UVKA 5HMXA 2YH0A 5D6GA 1JIHA 2C3YA 5E33A 3KMSA 1OPZA 2C2RA 2XMVA 4DLEA 3NNHA 4TN2A 4E98A 1VC6A 4X4VA 2ZD1B 3O44A 5BR8F 3GQCA 2KZZA 2YWKA 4HVZA 5EHHA 1YGYA 3KLGB 3LAKA 4EO8A 4QWAA 1FERA 4RBVA 3MEGB 2UV8A 3DU6A 5ADZA 1B7FA 3IAM9 5KT2A 4NLGA 3BGRA 4BWMA 1KEKA 4JI5F 4DEZA 5HMZA 5I3UB 4WZQA 1NJZA 2QMXA 2RDJA 4ZVHA 2NXUA 4HKQA 1KS2A 1RT2B 3BDEA 2DNQA 5EGYA 3RYLA 1RTIA 2UUCF 3MUMP 1Z4UA 2FJXA 1M0SA 3OTEA 2ZH2A 3GFXA 4J9NA 1RTHB 5AJ3F 1URNA 4ETZA 1UWBB 1JLAA 2R7WA 1CSJA 2KYZA 3QO9B 3JB9k 1WF2A 4E8UA 4Y28C 2W9CB 3LP0B 2XY6A 4CT9A 4ZCKA 2FHJA 2FPHX 3JSMB 2R9LA 3BO2A 4DL5A 1C1CB 3LOUA 1VQ6S 4G1QB 5CCLA 3SFUA 1HW8A 1REVA 4DHVA 2UUAF 1O5JA 1LKZA 3OL9A 4ED1A 2D3OR 2N3LA 3D54A 2RS8A 3GWCA 1Y4ZB 2VB6A 3UWTA 1VK3A 4JUZA 5T7LB 1VBZA 5K5MA 4DFPA 1IKXB 1MNEA 1RI7A 1WI6A 3I4PA 4L6V3 1QAJA 2ZC3A 4ZPWR 1KFDA 2LYVA 2R8JA 2MZTA 3ITHA 3MECB 2CDQA 4H54A 2MQMA 4OX8A 1RTHA 1TKXA 1XR6A 5KFTA 3GIKA 4DR5F 4KFBA 5K14B 2ZOFA 4O3QA 3ZFVA 5HO4A 4DQIA 1GTHA 3QO9A 3U1NA 1QE1A 2ILZA 1X5OA 4QIGA 5FD1A 3FEXB 4A8OA 4GKJF 4QWCA 4CZCA 2HNYB 5AXNA 1C1CA 2OKQA 1F5CA 6FD1A 3LGNA 3VAFA 3TNVA 2BDPA 4OHYA 4OLPA 4CO1A 1D8YA 1SH0A 3GZ7A 1FJ7A 3CCTA 3NBPB 2OMLA 2W8LA 2JDJA 5E3RA 2ZJPQ 4ID5A 4M8LA 1FEEA 2CQPA 4NMLA 3RB4A 2M9KA 4CH0S 3R1HA 2YNGA 5HP1A 3PNIA 2DNYA 3IFEA 2RQCA 4ED8A 3N6LA 2AP6A 2PO4A 2HHPA 1M5KC 3W2WB 4IKAA 1TKXB 3M2RB 2E7XA 1DTQB 1ZAWA 3CCSS 2X1BA 2RU9A 1RTJB 3TX8A 2O5DA 1N5YA 1L3UA 2HHUA 3W7BA 1N52B 1WF1A 3PX6A 1TFWA 3CJ3A 2BW2A 2EPIA 4LUBA 3PKMA 1EETB 1TAQA 3UDLA 4ZCLA 3PRBA 2IM3A 1PILA 4OI1A 2FD2A 3IG1A 4Y6IA 5BYSA 5KG4A 2XG8A 4J9LA 1FCAA 2RD5C 3C6TB 4KHPF 2HVZA 3CDWA 4C11A 1Y5LB 2HHXA 1QY7A 2KI2A 4RW7B 2MQPA 1YI2S 2N4CA 2BZ2A 5L1JA 4LQ3A 3C6UB 2BANB 3DDKA 4GO7X 4K0KF 5E2QA 2OIHA 1MU2B 1Q7YT 3HHLC 2XZWA 2ALZA 1U26A 3Q8RB 4ECVA 1GXTA 3CDEA 4GMKA 2MKHA 3HHDA 1NKEA 1IBMF 2L9NA 2B43A 3LF0A 3U02A 4ED3A 2DVIA 3HDSA 4DSLA 2OPSA 4G3IA 1FT8A 2FHKA 3K8VA 1FJCA 2IA0A 2FLNA 3MM9B 1EETA 1HA1A 4B3TF 2ZH7A 2N3OA 4DPOA 1T02A 2YWHA 5LSLA 2KFZA 4NCAA 1O8BA 5HBMB 1KLMB 1LWCB 2AF6A 3LWLA 3C6TA 4ZS6A 2IAJB 3N5BA 3IBWA 3BR8A 2DGSA 1FRMA 2DGXA 4QU7A 3E2EA 2JL9A 5L1IA 4B02A 5F0UA 1YJRA 1FDNA 4NYOA 4A8MP 2WCXA 1ZOTA 2W4PA 1FDBA 3NNCA 5KFJA 3E01B 3FFIA 1T95A 1RT3B 4FXVA 3M8QB 1VQNS 4JV5F 5A0YB 1HI8A 1NNDA 4I0WA 4NLQA 4PXCA 1VQOS 1LWEA 2N4DA 4DR2F 5E3AA 5M2RA 2DR5A 1U1KA 2UZAA 2HNZA 3BN4A 1N56A 3HKWA 2DH7A 3M8PB 2NREA 4JYAF 3U7JA 3KG0A 3UPFA 4EZ6A 2DCUB 3M6VA 5KFYA 3TP2A 2L9WA 2ZOGA 4QPXA 3CJ2A 2E5GA 2ZFHA 2XMJA 3PDNA 3ZZRA 4IG3B 4DL0C 4H4MA 3BN7A 2YKNB 1U45A 1U09A 2K7JA 2EI5A 1Y5IB 1HBUB 2DIVA 2J7WA 4X84A 5E3QA 1TAUA 5IQQA 4CH7A 4Q2MA 1HBNA 1X4DA 4TU8A 4ECYA 2BRLA 2FJEB 3H4BA 1WEZA 1P1LA 5KFDA 5LJ3Y 1S1TA 3CCWA 1HNXF 4USHA 3T19A 2EC0A 1CPZA 4XO0A 4PG5A 1OQ6A 4NCGB 4QWEA 4YR0A 4NCBA 1PSDA 2CVEA 3KMQA 3I87A 3RBEA 3QGHA 3HO1A 2RJZA 1LK5A 1UJ4A 1R31A 2DHAA 3QZ8A 4TY8B 2R2SA 4YB7A 4HEA9 3RAQA 2WB1D 4IFYB 2HS0A 1Q53A 2F1FA 3DLGB 4RW4A 5I42B 1HQEB 3OTDA 1SH2A 3TA0A 3MUTP 4X4SA 1WTBA 1FKAF 4F02A 3CC7S 1GQEA 3AAWB 2CPDA 4KC5A 3FGVA 3R5DA 4NLUA 3PFOA 3M6UA 3I96A 1IKVA 3HVTA 2WSCC 2F8EX 2RH3A 2ZC4A 3BSNA 1Z2LA 4RU9A 3D0HE 3G86A 4M5DB 1UKUA 3J7YU 5MLCV 1FDDA 2WBMA 4WE1B 3TAQA 3F41A 4WKRA 1HBOB 2J7KA 4I1TA 3R27A 2J6TA 3BM7A 2KZMA 1E6VA 4AUKA 5GAEU 3DLEA 2UP1A 2CQ3A 2BQ3A 3NRBA 2VG6B 1JX4A 3HLUA 5FDLA 3OHBA 3QIDA 3M8QA 2DGVA 2YNHA 4RX6A 5LL6d 5KFIA 1VGYA 5JUMA 3CMAS 5A6PA 5L9NA 3DOKB 4ZPCA 3TO8A 1TV6B 3FDSA 3CCRS 5IT4A 4N56A 4WFNQ 1FKOB