1OSDA

Crystal structure of oxidized merp from ralstonia metallidurans ch34
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
ATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein MerP
publication title Crystal Structure of the Oxidized Form of the Periplasmic Mercury-binding Protein MerP from Ralstonia metallidurans CH34
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 17
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1osdA00
5B0EA 1YRXA 5T7LB 3BF4A 1Q53A 1APSA 2AJ1A 2HLTA 2AJ0A 4Y2IA 1URRA 5T7LA 2G9OA 2L3MA 1AFIA 2IYIA 4QOTA 2K1RB 1QUPA 3FGVA 2OD4A 4U9RA 2KYZA 1YJVA 1LQ9A 2OD6A 2QIFA 2XMUA 1X0PA 1SQEA 5B0DA 3E8OA 3MZIA 2AW0A 5B09A 4FNIA 3BGUA 1FESA 3T9NA 2HLUA 3BB5A 3KKFA 4DPOA 3LO3A 2W4CA 4NPOA 2XMKA 3HHLD 4HL9A 4NL5A 4HH1A 2OMOA 2ROGA 1FVQA 3LGMA 1FE0A 2IYGA 2ZDOA 1P6TA 2XMVA 2JDJA 2HFOA 2GGPB 2GA7A 2OFHX 1MWYA 2LQ9A 1JK9B 1IUJA 1N5TA 3BDEA 2HFNA 2BBEA 2GV1A 5F0WA 5B0GA 2GGPA 1Y3KA 2QYCA 4A48A 2FB0A 1K0VA 5F0UA 1OQ3A 2GFFA 2KKHA 1V3ZA 2ASYA 2GCFA 2LQBA 2QLWA 2BJDA 2XMMA 4OJ3A 1WD6A 3FRYA 1SI9A 4OJGA 2K7JA 3DXSX 4Y2KA 2QLXA 3HHLA 3TRGA 2HIQA 2XMWA 4YDXA 2BYCA 1KQKA 2OKQA 3UDCA 2VV5A 4OJ1A 3TNVA 4HI1A 2AP6A 1YG0A 4Q2MA 2W4DA 3QMQA 2FTRA 1S6UA 3HDSA 3MCSA 1VQSA 3KG0A 3I9ZA 4HI2A 1FD8A 1AW0A 1YJUA 1OQ6A 4EFAC 1RJJA 1TUVA 2OAUA 3KG1A 4ZOSA 2RU9A 5A6PA 5A6WA 5K9FA 1GXUA 2XMTA 1N5VA 2ROPA 1CPZA 1CC7A 2PD1A 2XMJA 4OJHA 3HHLB 2FIUA 4OIXA 1N5SA 1GXTA 1W2IA 1Y9OA 2FHMA 5B0AA 2N4CA 2LDIA 2K7KA 3DCAA 1OSDA 3WDOA 5IXUA 1FE4A 3QGPA 5B08A 1JWWA 1Q8BA 4Q2LA 4YEAA 2EW9A 3TOQA 1S6OA 4A4JA 3BR8A 3GZ7A 4A46A 2RSQA 3BN7A 3BM7A 3F44A 3HF5A 4FNHA 4ZA1A 3FMBA 4Y2MA 1CC8A 5B0FA 3HFKA 2KT2A 2LXFA 2N4DA 1TL5A 2PGCA 3LGNA 2KT3A 1ULRA 1R6YA 2CRLA 1X7VA 2W4PA 5B0CA 1SB6A 5B0BA 5KAKA 2RILA 1FEEA 2ZDPA 1X8DA 4DL0C 2VH7A 3K7RA 1U7LA 3IWXA 3HX9A 1KVIA 1TR0A 3HHLC 2K1RA 1TZ0A 3KNGA 3CJKB 2BUNA 4DN9A 1Q8LA 1YJTA 1MWZA 2OP5A 2Q3PA 2K2PA 4A47A 3CJKA 1Y3JA 1FVSA 2RMLA 2BJEA 1AFJA 3VTIA 1XBWA 1YJRA 1N5QA 2OFGX 1OPZA 1VQYA 4F67A 2N7YA 1TL4A 1P8GA 2ROEA 2HQIA 4HH0A 2ACYA 2IFXA 3IWLA 1KVJA 1Q4RA 1Y0HA 2GO8A
chains in the Genus database with same CATH superfamily
2AEJA 2ZNZA 3NEKA 4NRUA 4R5PA 1VR6A 5DDRC 1MROB 3VVTA 4MK7A 4F4YA 4RW9A 5LMNJ 1PGZA 4QJVA 2HIYA 5M2RA 1IKWA 5HN0A 3V6DA 2F1FA 2FHKA 2FZKB 4CLLA 2GZOA 1K0TA 5J2QA 4G1QA 3OLBA 1T9WA 3L09A 4O4RA 3H42A 1C1BA 1RACB 5LXYA 3T1HF 2XM3A 2PFFB 1KRPA 1UFWA 1WJ9A 1Q78A 2CG8A 2O5DA 3DRYA 3R9LA 2G2YA 4QZVB 1WF1A 1F2HA 1J5OA 1P9QC 2H9ZA 4DV0F 3UVJA 1YZ7A 2WAQD 1CJKB 2GO9A 2PI5A 1B99A 2OPRA 3UCUP 4A8FA 2GNKA 2OLWA 3V6HA 3M8QA 2GAHC 1Y3JA 1QSYA 5KT3A 1XMQJ 4PXCA 1T02A 3CCSS 4AL6A 5FLXY 1QY7A 2EK6A 3CJSA 4RNNA 1VK8A 5M2UA 2L3MA 3NAIA 2XLIA 5BYRA 2CA9A 2FJXA 3U1MA 4PUOB 1NCLA 1M5HA 4KKOB 3E51A 2OPQA 2GVDB 3MCOA 4IOCQ 3KOAA 1Y4ZB 5D4PA 3X1LB 3WHIA 3D0HE 5EUHA 5AE3A 1YZ6A 1GH8A 2BKPA 4CLKA 2AJ2A 2R2TA 5HVGA 1FNXH 1VQLS 1HA1A 3WIVA 3DOKA 1MMNA 2BACA 2BQ3A 1HQEA 4W92B 4LBPA 3AQOA 3CJ3A 3CDWA 1HNIB 4RW7B 3CIZA 2XO7A 1EKRA 1WUUA 1S6QB 3CDAA 4C48A 4RWXA 4USKA 4UUWA 2ZZNA 4DBQA 2PFDA 3QT5A 4BCAA 5K8OA 3QZ7A 1LWEA 4LFBF 1PC5A 2H48B 3DXBA 3DU5A 1Y0HA 5J1PA 3JTNA 2IVYA 4KV8B 3M6VA 4M5GA 7AT1B 3IAM9 1HWUA 4AT1B 4YB6A 4DR2F 5AXKA 4WK3A 4Y6IA 4S0MA 4KGZB 1CEZA 2VFTA 1WOOA 3JSRA 2BJDA 3I0RA 2VA3A 2BE2A 4OJGA 5DM7Q 2MKYA 3A8KA 1N0UA 1LW0B 4CM0A 3D6TB 4J9RA 5D0EA 2ADCA 2YXLA 3T6BA 1DQ9A 3KUEA 2HG4A 1SL0A 3T9ZA 1U6FA 1RHJB 1PO6A 4ZP6A 1YIJS 2PD1A 1RU1A 2G2OA 3FEXB 3OTEA 2CNOB 2HVEA 2CKWA 5ETLA 4FBUA 4FF2A 3SDEA 1UL3A 4H4KC 2LLZA 1RWMB 2G0CA 1SKRA 2CJBA 3EICA 2CJXB 2DGTA 3OL8A 1VQOS 2E5IA 1FXLA 4HH0A 3PX6A 2HQFA 2QGFB 5D78A 4JI7J 2YKAA 1WC5A 2HWIA 1CJVA 2ZHOA 1MSWD 4JBCA 3GWCA 4P2MA 4RWWA 3NS6A 1RBLA 3ZZRA 2XLKA 5LMUF 2QA1A 3R5GA 2FB0A 1AZSB 1DAXA 4H4KA 3HSGA 2AD9A 2EWHA 3PM9A 4LSLB 2PE8A 4C0HA 1HWIA 2DISA 4OX8A 1FRIA 4JB8B 3M6XA 4ED7A 1PYOB 4EWTA 2V9WA 1RAJA 1DFDA 2AX1A 2RF2B 5J1EB 2RDDA 4ZPBA 5IT9Y 1XK8A 1WSRA 1KSPA 2JL9A 3QGIA 2GVZB 4ZLJA 3SMZA 2DKOB 1N88A 1LWFA 1RAAB 4K4WA 2FJDB 2PEBA 5D3GA 4H4MA 4TQRA 4DR5J 3WZ0A 2APOA 3IAS9 4ECVA 2HGNA 4NLDA 3W8GA 5EX3A 1U0HA 3VZIA 2A10A 3LP1A 5J2NB 4BHQA 1CJTB 1XR7A 4N7TA 3OFEA 1X0PA 1R43A 3Q2SC 3AD8C 2XS7A 4J9UE 4QOTA 4UQGA 3OJSA 2KYZA 1WTFA 3D2WA 2ZNYA 4WU3A 2DRDA 5IM0B 1Q7YT 1R6VA 3ENVA 3EZOA 3HCXA 3M8PA 4LRFA 4A8WA 1QTNB 2J8SA 4C7QA 5CA5A 2OJ3A 2RKIB 3TJAA 3BDEA 1HQUA 1J5EF 4WPAA 3OV7A 1NDPA 2DPJA 2XMMA 1SI9A 2JVOA 1F6TA 2GJ2A 3LP2B 3DLBA 2PMZD 3SXLA 4JI5F 3MAAB 2MKCA 3DHXA 1NZAA 1S6UA 3BN4A 2HQCA 1IBCB 3N01A 2VF3A 1D9DA 1C0TA 4ED3A 2Q1LA 4PXDA 2ERRA 3EXYA 4P75A 1FJEB 4NZ6A 3BJYA 3D28A 3IR7B 3V4IB 1ULRA 2UUBJ 2CRLA 3M8ZA 2DNNA 4ECUA 1MW7A 2MMYA 2NXJA 4NYOA 2MZJA 4CCHA 1OO0B 5AJ3J 5DGBA 2AJQA 3SFGA 3IR6B 3D0GE 1IM4A 5ETVA 5KFPA 3T3FA 1QE1B 3I96A 2AGQA 4DPYA 3RR7A 4UY8T 1RSCA 3IM9A 2Z4PA 1JQGA 3IG1B 4ZPAA 4DPTA 1N6QB 1U47A 2W2QP 3T19A 4OX9J 3AA8A 4PG7A 3ZTSA 1TUGB 1F5CA 1TK5A 1FD2A 1VJQA 2QLJB 3T5JA 4OX9F 4NXNJ 2HRTA 1ZZNA 2OEMA 2Z58B 3R1HA 4URSA 3LWLA 4KO0A 2C22A 1S7IA 1D8YA 1S5ZA 3MEEA 3SEOA 3NG8A 3KLHB 3VAJA 3SCLE 4L74A 4NXNF 3T1YJ 3CD6S 5D4LA 3W66A 3G71S 1TV6B 3SIPB 3TUPA 3FEYB 1NNDA 4JOUA 2ZE2A 1EP4B 1RTHA 1XBWA 1G4CA 4Z7CA 3GONA 2NYHA 4ZVRB 2G9OA 3DDKA 1X9SA 4DV1J 1SUQA 2QL5B 4ZLPA 4Y3CA 1ZPVA 4LVOP 3DC2A 1M1KT 1N54B 3WX4A 3P45B 3C6UA 5BJRA 4DV6F 2BOAA 2DNYA 4OV6A 2ACMA 4XPCA 3F41A 4E8UA 2ZVIA 2JFKA 2R8KA 3UDCA 1N52B 4OZNA 1KC8T 4QR1A 3VCDA 1I1GA 3DYAA 1QDUB 3HFVA 3CCWA 2GHWA 2FIUA 1N5SA 2R7VA 4JI1F 3NL0A 3QZ8A 4ED6A 1NHUA 4NEZA 2KHDA 3M2RB 4F7VA 1WG5A 4ILLA 2KM8C 3JQKA 1V5VA 5CYMA 2XBPA 2FZGB 1HYSB 3P4UB 4DV4J 1U8WA 4NI2A 3TZZA 2VJUA 3R5CA 1RTDA 3IRXB 4PQUA 2ZHAA 3FCHA 2ZD1B 3P5TL 3C6TA 4DV4F 4C8KA 2AU0A 4O4GB 3K59A 3DLJA 3BO3A 1SH2A 3DRSB 3FKBA 3R27A 4LRCA 2QFIA 3GSDA 1S9EA 2M2BA 1KOOA 2V4JB 1CBKA 1EETA 4OZ0A 4FYDA 2C1EB 1E6YB 4M94A 1U1KA 2ZBCA 5A6PA 5KTQA 4CLYA 1CPZA 4EU0A 3PEJA 2JRSA 2EK1A 1YDLA 2UVWA 3CIMA 3C16A 2Y3YA 1HMVA 5C24B 1H7XA 3KLIA 4C6AA 2ZOGA 3DLEA 5KFEA 3HKZD 2BUNA 4X66F 2ZJQQ 5KFVA 4NYPA 3M2UB 1XEZA 2Y1RI 5KFFA 1NHKL 4J9NA 5LSLA 1MWQA 1S0OA 1O0PA 4F02A 2E9RX 1U0SA 2HQGA 3GFZA 1S97A 4F50A 4F4ZA 4V19X 3I0SA 3DGPA 4I1TA 1XR5A 4RLEA 5KFXA 1FFWB 1Y5LB 4R25A 1KHVA 2FJWA 2ZJPQ 4ELTA 1T95A 3N0VA 1RYSA 1KR4A 2QV6A 2IAJA 2CQ2A 2CQIA 2Z2LA 4QYRA 5D4OA 1U6ZA 4I69A 3FMWA 4LBIA 4X2BA 3HVAA 2DRAA 3BH7B 2CQBA 2DNMA 3K58A 4MK8A 3HVRA 2DNKA 1YWXA 2VUGA 1SH3A 2KZZA 1BQXA 4DXLA 1KTVA 1OYDA 1ZA1B 3QFHA 3QBCA 2UU9F 1G1XA 3D0IE 2RU3A 5CH7B 3RRKA 2GMJA 2YH0A 1BQMB 2CWKA 4J9MA 1UZDA 2A2DA 2JC0A 1NKEA 4F67A 3MMBA 3ZZPA 1DY3A 2E29A 2DHGA 3EGWB 3PTWA 1Q53A 3TUJC 1TVRB 4U7CA 4Y2IA 3ICLA 1AXQA 4N41A 4WJBA 2WB1D 3KUGA 1GK8A 2GQCA 1W26A 3ILIA 1YHQS 3LGMA 2X3GA 1REGX 3J80U 2QYCA 4ETZA 1QAJA 2YX7A 3QT7A 2QLFB 3UDLA 5AE1A 1RWPB 3GIMA 1VQNS 2JEFA 2D41A 1PSDA 4EI2A 1RTIA 4JI4F 2NPFA 3NCPA 1YG0A 4USJC 2DXDA 4FPRA 1ITPA 1FKOB 5F8NA 3VR1A 4ZVGA 4ECYA 2HHPA 1JIHA 2HBZB 5MAOA 5I3PA 3KJNB 1RT3B 3KHGA 5CYQB 1FFSB 5F9NA 3BN7A 5B0FA 2HS4A 2E1MC 2A3JA 1F2GA 1KKHA 4TY8B 3M4XA 1X7VA 5DDQC 5B0BA 4O0IA 3UW1A 4QPTA 2FUG9 2Y0SD 1F60B 5HMZA 2ZH1A 3KG4A 4MKYA 2HHHJ 1N34J 2VONA 1IKXB 6AT1B 4U9RA 5KOWA 1BGXT 4DV3F 2UUCF 3RTVA 3I4PA 4HKQA 2DNPA 3QO9B 1WACA 2DGQA 4NLQA 4LFCJ 3KJFB 2BR0A 1HLWA 2GA7A 2HZVA 2B56A 3ZNUA 2XO6A 3FSXA 2AEMA 5BXIA 2BKOA 2QLXA 2C3YA 3VALA 3S8SA 1KDNA 2C2DA 4IO1A 2BYCA 1M5KC 1KP6A 1RWNB 1H2VZ 4TYAA 1W2BR 4ZLNA 4O44B 2D7SA 1BQNA 4C3LA 1WC0A 4IG3B 3FQKA 4IFVA 4C0OC 1TU0B 2ROPA 4CLFA 2J0QD 4B9MA 1HBNB 2DIUA 4UZBA 3H2VE 1X4AA 2IRYA 3PIOQ 3KJVA 3CT9A 2IC3B 3HFKA 4NLOA 1JLBA 4F0KA 5JUMA 1U09A 3UD5A 4DX6A 3UO0A 2QFJA 4JYAF 4F3QA 4L3NA 2EG2A 4HHHA 1X8DA 2BJ8A 2HAFA 1IBLJ 1JLGB 2ZKUA 3PRBA 2RB7A 1RT6B 2LXUA 4NLRA 4HHJA 1RKJA 3PO4A 1YK9A 1HPZA 2B9YA 2VG7B 4HACB 4ECZA 1VMBA 3K89A 2ZWOA 1XN9A 5KFUA 2QMWA 3QFWA 5AE2A 1WKLA 2BBEA 2YQ1A 2V68A 4DQSA 4P52A 3DXSX 3V2UC 3OR2B 3DNCA 2HIQA 4TU8A 1U45A 4RJVA 3M9MB 4FYYB 3BPSP 5KFNA 1YQHA 2ZH2A 1PJ6A 5E0OA 3IGNA 1DBDA 3LTOA 2RU9A 3N5BA 4NYZA 4IYQA 5HK4A 1C0UA 3HHLB 2RS8A 3OSPA 1RWOB 3OXLA 3UR0A 3OFHA 2M5YA 1CS4B 3I9V9 1K8AT 3CPWR 3GPAA 1FX2A 2QT7A 5KFCA 4WZQA 1PG5B 1IWAA 3O2IA 1LWCB 2UZAA 2ZC3A 2I8EA 1MWZA 3RGIA 3TVZA 1RT1B 4A8OA 3ENWA 3UD4P 1VRUB 2AJFE 2ALYB 2CQPA 4GKKF 1HW9A 4IOAQ 1H7WA 4K4VA 2I5JA 3CULA 2HPUA 3MM8A 5KT4A 1X4HA 3MPYA 3R8YA 4DU8A 5F3TA 3GILA 1K73T 4DL3A 4FVMA 2GGPB 2WONB 4IQMA 5C42A 3SSQA 3NBPA 1GAOA 2W7PA 1Q7LB 5F8JA 4MKVA 2DY9A 1X5OA 3OW2R 1Q8KA 2JSXA 1SJ3P 4LVNP 3MI7X 4FNHA 5A8RA 3M1VB 1YBAA 4X4OA 3PW2A 4ED8A 2HURA 2PEHA 2VH7A 4OZ3A 1Q82T 4UOHA 1TAUA 2HVIA 2W9BA 3J80Y 4LF1A 4OHVA 1L3KA 3GJSB 3N4WA 2VG6A 4ZHRA 1HI8A 1OMSA 2XG8A 1JLCA 4WXOA 3OTCA 4IH7A 4LF8J 4R8UB 2ZH4A 3CDUA 4LR8A 4YB7A 3MFHA 5DJBA 4LF4F 1WOPA 2FC8A 2V94A 4MFBA 4B3OB 3CSKA 2HFSA 2MQNA 3HJVA 5LSRA 1N0VC 3DKDA 1RWWB 5H1SV 1KEKA 2WSFC 2V6AA 4ZCMA 2AIRB 4DQQA 2X1GA 2MZTA 2SXLA 4J9SA 4MIBA 2EKNA 1CG2A 2ZVSA 3R5JB 3S1TA 4LSNB 3K5PA 2J6SA 2UVRA 2ZDPA 4JI0F 3DRPB 3RAXA 1UVMA 4WP9A 4GVBB 1KBRA 2W1BA 4UOCA 4OYWA 2R2SA 3B78A 2BMBA 4Y00A 4ZJOA 2QZ8A 4UW2A 1RTJB 4KGXB 2IYIA 2XULA 3LH2S 3Q24A 4JI3J 2R42A 5F3ZA 2JOQA 2Z0GA 1PIEA 3T5LA 1BHNA 2KFYA 2HMIB 4I2PA 1VFJA 4MKBA 2YPYA 2CPXA 3GB0A 3RBZA 2R8JA 2CZ4A 2W8LA 3EZ5A 4PXBA 4Y34A 3H25A 1F9HA 2V69A 2COLA 5C2CA 2BXJA 3RB3A 4I64A 1F0XA 2F3JA 2CWXA 2IJFA 2Q6CA 2YNGA 3MOJB 8RUCA 3WDOA 4CLWA 4NLUA 4XO0A 2W2OP 3PV8A 2QTWA 5L1LA 4ZVPB 3PO5A 2CNNB 2LQ8A 2MGZA 1J27A 1JKHB 1FJGF 1FVSA 1GMWD 1WORA 3H8YA 4NA1A 1N5QA 1NLKL 3KDNA 4ZP7A 2DH8A 3DM2A 2V9KA 4C8YA 1S72S 3OR1B 2NR0A 4G6VB 1S10A 3NMRA 3FGVA 5IS2A 2DGSA 2HHTA 1FJ7A 2CAJA 1OJ4A 5E33A 4ANEA 1RABB 3DOLB 4DS5A 1FRLA 1B0PA 2G0IA 3CCJS 4A8KA 4OI0A 2R4FA 4J9VA 1TFYA 2HWTA 5HLFA 1U4BA 4PKDB 1TMMA 5FDLB 4DV2F 2FJEB 1VIOA 1PBUA 3RRGA 3C66A 1VI7A 4KHPF 3PX4A 4L3KA 2WW8A 3N9UC 4DCJB 1LK5A 3M05A 3CXCR 4A8XA 1TFWA 1CC8A 3O8WA 4IG0A 4MTPA 2RILA 3LP0A 1U8SA 4CTAB 4P7TA 4LT6A 1PCAA 1OY6A 3I87A 2YKOA 2E66A 2IMWP 4DF4A 5KG7A 3I55S 2Z56B 4IQXA 2IVMA 4ZVFA 4DPUA 4ZJQA 5RUBA 2BW2A 2G0JA 3H4DA 1VDHA 3HD1A 3IBCB 1SC3B 3CJQA 4EGLA 2QMUB 2NXCA 3FZBA 2A6MA 3RJMB 3OBIA 1JLEB 2WOMA 1HKAA 3DGVA 4PYAA 4W4MA 1RT4A 3IBFB 3NGDA 4DL2A 2R7RA 2LQJA 3JYTA 1GMVA 3G6XA 1NPPA 1RT5B 3H7HB 4TLRA 2V8GA 1LXJA 3LOUA 3ZXWA 1WELA 4A46A 4KHRA 1RWKB 3RW7A 3BDPA 3R6GB 2JEJA 1BC6A 2C3OA 3AY0A 4RW4B 3BPDA 3KK1A 4WKYA 4OYXA 5F41A 3R97A 3PACA 2V2QA 3C14B 5F8MA 3MEGB 3AH6A 4DL5A 1NEEA 1U1MA 3EVOA 4K2JA 2V8HA 5BYSA 2HNYA 1DURA 2VU5A 2MXYA 3BZQA 1S7HA 4OLOA 4CO3A 2HFVA 2KI2A 3GFXA 1JXVA 1S9GA 4GKJJ 2XSFA 4QU6A 4X4NA 4OHZA 5GADU 3GLJA 3R1LA 4IFYA 3PXGa 3FRYA 4TXSA 2D74B 2I38A 1WKJA 4DCOB 3H59A 4G1QB 4WP8A 4DSIA 3QSIA 3D68A 5BR8J 3R2CJ 1EARA 1Y11A 2O1PA 1FO1A 1ZPWX 2XHCA 2J9EA 1F3FA 5J2MA 1VLYA 1VBZA 4J9PA 4DSFA 1RAEB 1UWBB 3MPUB 2H1YA 3KTQA 1J5OB 3UFCX 2R7TA 3UVJB 5DQGA 4KBIA 4P6QA 1NHVA 2RQCA 5J1NA 1IBMJ 2QRRA 4H4OB 2J6TA 1KVJA 2IM3A 2DBBA 2QMXA 3TQ1A 5T7LA 1S1XA 1FTRA 2CQDA 2GC8A 2JEGA 4DQIA 3MZIA 4IRKA 4CYUB 2JJ4D 1IBMF 3ADAC 1EZZB 2Q43A 2IVFB 2XGPA 3P8BB 3G6ES 1HHQA 3HK2A 4YY3J 3FBFA 4URGA 4CLZA 2VQEJ 3IP0A 2HS0A 4ZCLA 1S1VA 2LQBA 1H2UX 3MAQA 4X65J 4DFJA 1OIAA 2F4VF 4YY3F 1NRKA 3BGFA 1RISA 5JJBA 1JLAA 2LDYA 3HFZB 4B3MF 1JJ2R 4DQRA 2KVIA 1M1GA 4X65F 4DV5F 1MU2B 2XWXA 3DOKB 1FERA 2MPUA 5I4MA 2YNFA 3BO4A 2BRKA 2AV5A 5GMKa 1VBXA 2UXBJ 1QM9A 3HVTA 3DLKB 2VB6A 4DSKA 1YRXA 4D3HA 2AT1B 4EO6A 1SQFA 5HO4A 2UXBF 1LWEB 4RL1A 1VBKA 3CE8A 3CW2C 1FHTA 2PA8D 4QWCA 3GYXB 1M0SA 1S6PB 3Q2TC 3TA1A 5DS7A 1U1PA 1XNRF 1GMWA 5KFMA 4TKTA 1H2TZ 3QIPA 2E7XA 2VPYB 4C11B 2EVZA 1HWLA 2WVFA 3DRRB 4OYPA 3I0RB 4L73A 3W5ZA 1F1BB 3EDQB 4LIRA 2MKHA 5D0GA 4ZVTB 2OPSA 2VPWB 5IC6B 1NJWA 4ZA1A 3N79A 2R2UA 3FBEA 2XZDB 3VV2B 2FGOA 4KQZA 4WF9Q 1O6XA 3SCJE 4QIGA 1TL3B 1S49A 2LU1A 4TN2A 3UN5A 2PDAA 3RB4A 2KRRA 3PY8A 1UCNA 2Y1IA 3O44A 1YJVA 3G4SS 3PFOA 2C2NA 3C15B 1MROA 3MUTP 4EYHB 2HK3A 1NU4A 3W9HA 3RAQA 4OLPA 2YKPA 5CAAA 1B4SA 1VISA 3UDVA 2UXDF 3GCXP 4ZVOB 1P9YA 3TZYA 1CQNA 3RRHA 3V6JA 3NOGA 4UQTA 2IBKA 4IR1A 2FGCA 1HR0J 2C3UA 2ATCB 2W2NP 1HI0P 5CD4H 4QWBA 2LFVA 1T03B 5HBMB 4HVZA 2EC2A 1CJKA 2VFRA 1YJNS 3F73A 3E2EA 1HNVA 3TA2A 4URQU 2Q66A 3MECB 2RMLA 1FKPB 2VOOA 1SCJB 3GYNA 3BEGB 2YVSA 3TVKA 5B09A 1U0HB 2DNZA 2ILZA 2XMAA 1NM2A 4PUOA 3MMAB 4DUYJ 4AYBD 1X4DA 1QAXA 3PG9A 2GVDA 5HQ8A 5IFMA 1TKTA 2IRXA 4ZKAA 3B4DA 4FF1A 4ZITA 1SC4B 4DUTA 3LANA 4DUYF 4O3QA 4P2FA 1PILA 3ISND 1HQUB 3GCWP 1NH7A 4PABA 4B17A 5AXLA 4V19J 2DXFA 4KAIA 1XMOJ 3FFIB 3NWRA 1Q79A 3MCNA 4LF5J 1HNZJ 1HNIA 4RW7A 2QA2A 5I3QA 1S6QA 5ITHA 3B4MA 1XMOF 4NLWA 2L48A 3PVXA 2B0GA 1PKUA 1AFJA 1NK8A 3IWNC 1FDAA 3HZEA 3RB0A 4WE1B 2WSEC 4DR3J 4IH5A 4KV8A 5CZXA 2OO4A 1LQ9A 1YVFA 3FBBA 1KD1T 1YTYA 4QIVA 4KIAA 1WG1A 3JSBA 3MFIA 2J8AA 4DR3F 4P10A 1FE0A 1H72C 2R8HA 5F9LA 3VAHA 1FT8A 2IA6A 5CCMA 3TJ9A 4IRCA 4EK2A 4F4KA 4ZPVR 1LW0A 2VBYA 1ZM4A 4P72A 5KFOA 1VQSA 2YKNB 3TEHB 4EFAC 3D7SB 2E5JA 3A12A 2XMTA 3HHKA 3CD5A 5DZ6A 3BBFA 5F8GA 3U7JA 4F3OA 4JV2A 3AT1B 2DGWA 4L6V3 3ZO7A 1VRTB 2WVCA 2W2MP 3J7A1 3R3TA 2OMLA 4DR6J 3M6WA 4ID5B 2RNEA 4RBTA 3QQCD 3TANA 2DEJA 3HHEA 4J9QA 5EWFA 1WI6A 2LECA 5ETSA 2KG0A 2W25A 5KFTA 3T9NA 2LQ5A 5KG5A 3OFFA 1WNEA 1HNWF 1JX4A 2XNQA 4DCPB 1QSSA 1RGVA 1AZSA 3ELHA 4WIIA 4LSLA 2V2KA 3US5A 2X1AA 5CYJA 1OS5A 1HHTP 1NJZA 3C6UB 1OWXA 2RF2A 5U47A 1YRUA 1I94F 2R7WA 4ECRA 1MLAA 4J9OA 2GVZA 2QSWA 3O1LA 1RQ0A 1VQ9S 4ECSA 1ZETA 3OSNA 3GZ7A 4RUHA 2LXFA 4NCAA 2YTCA 4B02A 2VOPA 4IDKB 4ER8A 1RZMA 2ILYA 1KWMA 1U1LA 4NXMF 3FK4A 2D9PA 2ZH5A 1S1UB 1LKZA 2Q6BA 4ENOA 4K59A 4KB7A 2ROEA 4OHYA 1CJTA 4DUZJ 1NMEB 1NDCA 2XEXA 1A7GE 4RW8B 1WEZA 2E9TA 4N5SA 2OD4A 3LALA 3CB4A 5CYMB 4FNIA 4OV1A 5K20B 4ECTA 5IM0A 1S48A 3P49B 2B51A 1XQIA 3E01A 2QLBB 1BE4A 3CCES 1HBMA 3VAKA 4PQUB 4M8LA 3R2DJ 1VQ5S 1V3ZA 4OJ3A 3HP6A 2HBYB 3OD2A 3H20A 4IH6A 4BS2A 3LP2A 1XNQJ 1VYAA 1HFEL 3GE9A 4NZ0A 4ILMA 3MAAA 1OSCA 2XLJA 1X5TA 4TVAB 2JLGA 2HHSA 2MQMA 1EIYB 3RG6A 3KDOA 2N7CA 2J0SD 3OTBA 1VJWA 4YEAA 1SQGA 2PMHA 3LGNA 3QGGA 3Q89A 1X4FA 3V4IA 5C2GA 3V4MA 1BUXA 4ZCIA 3GJRB 4CO0A 3AHPA 2AYEA 2JLFA 2EXUA 3KK3B 2Z2MA 2ZZMA 2EI5A 3M8WA 1S0NA 4CWBA 1FK9B 1X5PA 3BO2A 5K14B 4C97A 5AXMA 2AJ0A 1XWLA 4EUVA 4QWDA 1QE1A 2HHXA 4ELVA 4Z7YA 4GO7X 4M5IA 4J91A 3VVUA 3AODA 2FC9A 5AT1B 2ZJRQ 1ZM9A 3H90A 4LF6J 1JK9B 2ZC4A 1VS3A 2R7UA 2AEFA 3W60A 1N6QA 3FCVA 4F0MA 2HW3A 2F4FA 2RRNA 3WX8A 4G1PA 5G0RB 2MQOA 3LA0A 2V50A 2DGXA 2RAQA 3K2YA 4Q2LA 2GJFA 2RQKA 2UVUA 5GMEA 3G87A 1RU2A 2C42A 3KLHA 3D6MB 5H9EJ 5D0RA 2KO1A 2Y1LB 1QAIA 2G1HA 1NK5A 3PYFA 1QD1A 1KQGB 5E3RA 4DLGA 2CZVC 2CJ9A 2D69A 2MTLA 4USIA 1HIYA 4ANCA 3OHBA 1R3NA 3CCLS 4C8LA 2NZ4A 3I5AA 1Q86T 4NL5A 4ITSA 4QIFA 3TARA 1HNXF 2POKA 4Y28C 3TW0A 5ETPA 1JNRB 1V5IB 2DJWA 2IMOA 2VQFF 3VHQA 4LREA 3POTB 3EPIA 2GMHA 4Y2KA 4ECQA 1D9FA 3SYZA 4USHA 5EX0A 2B7CB 3QMQA 1RAOA 2H5IB 3R7SB 4JI2J 4UF4A 1GXUA 5KFRA 3QIDA 1RHQB 5LL6d 4Y65A 4ZK7M 2DO4A 2BVZA 2O01C 4CZCA 8AT1B 1XJWB 1FI4A 4KGMA 4JI2F 3TYTA 2ABYA 2FVCA 3K7RA 3EZUA 3DLGB 3M2RA 2VKZG 2UUAF 3BKUA 3MAHA 5KFJA 1LNQA 3PRVA 2NXEA 4PQAA 5ETKA 1RBOB 3T1HJ 2RHSB 1HYSA 4I0WA 1VQ6S 1WEYA 3IRXA 2R7OA 1YBUA 3M6UA 2QX0A 4NLGA 4YHHF 3P3DA 2ZD1A 3LO3A 4DV0J 2BQRA 3HHLD 5CD4A 2JWNA 5EDWA 4O4GA 4M5DA 2KT5A 8ATCB 3T41A 3W2VB 5IZHA 3DRSA 3SV4A 1T8EA 4NLYA 3CDEA 1Q8IA 2CPDA 2O66A 1H73A 4QR2A 2O3DA 2B8PA 2VICA 1CJUB 2OKQA 3C19A 1RWXB 2VKRA 2HHUA 2QA4G 2XC9A 2MKKA 2V4JA 4JP8A 2KXHA 2HHQA 3R7NB 1J2VA 3G9CA 3SQOP 3NGRA 2ALZA 5C24A 4ZJLA 3HXMA 4IFVB 2V8PA 4X4VA 3CJKB 1YKWA 2JVRA 2BJ9A 3QLHA 2HS3A 3M2UA 4F36A 3HM9A 2W9AA 3V6KA 4BWJA 1UEVA 4PR6A 4ELUA 5E7OB 1TL7A 1OY9A 4DR4F 3KKFA 1ZM3A 3MXHP 1SJQA 4HH1A 1DLOA 1D09B 2UV8G 3BGRB 1WSVA 4QIWD 4K4UA 2WW4A 5KG0A 1WD6A 2VBZA 2ATLA 1FDDA 3DHWC 4XDDA 2RE1A 1YBTA 4LFBJ 4PEOA 2RRAA 1RA6A 4LFAJ 2ZBRA 2DCLA 1SPBP 4RUBA 2P5VA 2OPPB 3KWMA 3PHTA 3DI6B 2QL7B 3A3NB 1IR0A 4DR2J 4LFAF 2PGCA 2AKWB 4YR2A 3G6YA 1JJHA 2V34A 1S1TB 1C0UB 3TVYA 1M1HA 1ZOTA 3MPWA 1ZAVA 5D4NA 2DNRA 2EBGA 4DN0A 2YKMB 1URNA 1KLMB 1FXDA 2LU2A 2R7QA 2WRMA 2AJ1A 2QO3A 1Z2LA 1TVRA 4J37A 4PXEA 3MM9B 2F65A 1U6BA 2CPEA 3PNIA 2OH2A 5KFHA 2ROGA 5ADZA 2J7WA 2VBWA 4F8RA 5GAHU 4LF7J 1VK3A 1F5BA 1U02A 4DFPA 4N8OA 2XYHB 3TRGA 2BQUA 2BZ2A 2C28A 5ETOA 3UN3A 5KFDA 4QYZK 4DHVA 1AB8A 1M5PC 4LF7F 1OQ6A 1FKOA 3PKYA 4DFMA 4RNOA 2LCWA 3CO0P 1NPRA 4RR5A 5C42B 3R5AA 1W2IA 1RT3A 2HHWA 2FHMA 4CH0S 2K7KA 3NBPB 2DH7A 4TY8A 5LMUJ 2R2RA 2UUWA 4DV7F 4B3SF 2IJRA 3CUNA 1YJRA 4N76A 1ZYQA 5E3PA 2IM1A 2D3ZA 2NREA 1KLNA 2C3PA 5KFAA 1IKXA 3W64A 5GVQA 3JQMA 4DL6A 3MM5B 3QO9A 1UAWA 4ED1A 3JAMU 5CHCB 3BSAA 3PR5B 2VG6B 4ZHRB 3FEZA 1IUJA 3Q22A 2B9EA 3M9OB 3W2WA 1R8HA 2VODA 4BWMA 3K5OA 4X64F 2H65B 1QSLA 2IBOA 2HVDA 2AP6A 1NSAA 5LJ3Y 4O44A 2P8IA 1NK7A 2ZEJA 4P9SA 4K0KF 1EQ0A 4CNYA 1WC3A 5KOXA 1H6KX 1IQTA 4ZN3A 1YITS 3W5YA 1HBNA 2AYGA 2HNDA 1SL1A 4ZMMA 2KT3A 2IC3A 1IKYB 4FBTA 3I31A 4HT7A 4K4TA 1J5EJ 2JC1A 2WCXA 4YQWA 3PYDA 5T41A 2B43A 1RT6A 1NZ8A 4JI5J 2GQ2A 4Q45A 2HFUA 3MF5A 1UJ6A 4JI6F 2D3O1 1GQEA 4U8VA 2M70A 3D1HA 3FSIA 2UV8A 4AXIA 2H4YB 2QG9B 2HFOA 1UVJA 3K17A 4B3TJ 4AUKA 2GCFA 4M5KA 2A1BA 1IR2A 4C3KA 4IRDA 2VC0A 3OR2A 2CADA 4X4TA 4ZVEA 3KLFB 5A8KB 3VGVA 2HKEA 3I5CA 3TEGA 4EMDA 4ANDA 5GMDA 1WHYA 4B3TF 2V4QA 4MAKA 4I4BA 1HBUA 1D3WA 4OJHA 4OI4A 5E41A 4KT0C 2VG5B 1Q8BA 4OZJA 5IQ6A 1FRXA 2N4DA 1C1CB 3RZAA 2XSJB 5ETMA 2MLYA 1RAFB 5LM7E 2DYAA 1TR0A 1Y00A 2YNGB 2KU7A 1LWCA 3VQSA 3ZZOA 1RT1A 1IKVB 1P8GA 2PMWA 2RUSA 3QSYB 4ZP8A 3R6LB 3CC7S 3GTYX 1QUPA 1UEUA 1UFKA 2NSBA 3TJ8A 3TR5A 3MWBA 4HL9A 1FVQA 2DGUA 5DLFA 2OI2A 2BANB 2GGPA 2WONA 2GFFA 2HQDA 2B4VA 2H4WB 2KFNA 1V9OA 1F9FA 1R7IA 3KNAA 5HI7A 1FRMA 3QJPA 3AD7C 1UPPA 3KG0A 1S0MA 2AMCB 5CQGA 1OY8A 4N56A 5HLFB 2OGUA 3CD7A 1LW2B 5KFWA 1OSDA 4X4RA 2BW7A 4A4JA 3P6YC 4NMLA 4Q7AA 1N33F 4P2XA 3M1VA 2F40A 2MY7A 3MEDB 2F9DA 3Q0AA 1TKDA 4DV6J 2HGLA 4PWUA 5HQLA 3CO9A 5H9FJ 3Q23A 4X62F 2PI4A 5DDOC 5A76A 2ZUGA 1RWUA 3IN5A 3AJ1A 3JQJA 3CCMS 3WQPA 2DHHA 1KONA 1E6VB 3EMTA 4JI1J 2B4UA 2XMKA 4ECWA 2DHSA 3MPVA 1TK8A 2JDJA 2YNHB 2PN6A 1T0TV 1RYRA 4G3IA 4BLGA 4DR1F 2BV3A 4B3OA 2N3LA 2F8MA 4FN5A 3NXZA 4M5LA 3S7RA 4NE9C 1VLOA 2K06A 2AWZA 2P6SA 1VHFA 2WOMB 2H3EB 1SBRA 1JLQB 1GMUA 5KFBA 5DG9A 3SQGB 5B7WA 1RCXB 2ZM6J 2PA3A 1X9WA 3NNAA 3JYTB 3BSCA 5LXRA 3DU6A 1RE1B 1L3SA 2V8DA 1MNEA 4MMOA 4OZ1A 2XZTB 3MM7A 1UJ5A 4NLPA 4XK8C 3W1YC 3H5XA 5J2PA 2ZM6F 4O23A 1TZ0A 4WFAQ 3JAMY 3DRPA 5F8LA 5KFIA 3MURP 2OFGX 1ZH5A 3ET6B 1UVKA 2AX0A 4DOZA 5EN1A 2HYIB 2XGQA 4FVCA 1DQAA 2DO0A 2OD6A 5C25B 1JJ4A 4A8YA 2M7SA 3SSSA 1K44A 3UWTA 4DWIA 2HMIA 2LEBA 4FXVA 1Z2ZA 1V6HA 2IIHA 2LEAA 4PZVA 1UVIA 2RVJA 3THTA 4X66J 2VPXB 1I51B 1TUWA 1KQKA 1NSKL 2CXEA 4F4AA 3OTOJ 2ZKTA 1RJJA 4PWDB 2EFOA 4I2QB 2JHEA 3VQTA 2UUTA 1NAQA 3VZHA 3OL7A 1HD1A 3UPFA 1DTQB 1UW9A 2N3OA 3OTOF 4GRSA 2XY6A 4JV5F 2WHOA 2W2PP 1FEEA 2AGPA 3M8RA 5KG4A 3WC2A 3FRZA 1U1OA 1N32J 4DN9A 3UE2A 1O8BA 2OP5A 1RHKB 1JKHA 2G2ZA 1WKKA 3MOZA 2MJUA 5J2MB 4RW6B 4PWWA 3LPYA 2BM1A 1A0OB 2XZWA 4YP3A 1N32F 3KYLA 3ZZ0A 5L8RC 3OR1A 3GJTB 3BSOA 4OQJA 4GMKA 1JXEA 1VQ4S 2BABA 4ED5A 3PDNA 5GAEU 3RU0A 2ZBPA 2RD5C 3L7UA 2W9CB 1UMJA 1S1XB 3DOLA 2UU9J 3KMSA 4P73A 2DNGA 2XNRA 3ENQA 3J81U 2KJVA 1Y5NB 3MUMP 4NRTA 4G65A 5FDLA 3UCGA 3LW5C 3W63A 5A0YB 1RAGB 4KHMA 1GFWB 4A8MP 3OVBA 5B0AA 3DCAA 1M5SA 1AYEA 1UTAA 2Y0BB 5A2QU 2J0WA 3EX7B 2RIJA 1F3VA 1N36J 1VQKS 1U25A 2OTJS 3O3LA 5IT0A 3QPIA 2LA4A 2P2CB 2F9JA 4CQ1A 4JV1A 4CTAA 2FLPA 4P74A 3UN2A 1SKWA 1EJ7L 1N36F 3MPDA 2Z8QA 2HZAA 5GADI 4JI4J 1SC1B 2L9NA 1FWPA 3NMAA 4BBYA 4WU2A 3NGSA 3KUHA 2VPZB 4KFBB 1NDKA 1F9EB 3UD3P 3OVAA 2G4BA 1HI1A 5K8NA 3MR5A 5GAGU 3AOBA 4KSEB 4MYUA 5DZ7A 2E1RA 1N5TA 2XYGB 5HQMA 5MLCV 2ASYA 3MD1A 1GX6A 3M2VB 3V5RA 4OI1A 3BQ0A 2E1CA 3QRPA 1JJCB 4L76A 4TLQA 5EWGA 4G1IA 5KG2A 4F2SA 3LUYA 1GEHA 1RHMB 2CPYA 4DV3J 2UUCJ 3CEDA 2X1BA 3PW7A 1Q81T 5HL7Q 1AA1B 3QIPB 2J0XA 4CDIA 2WK4A 5KFKA 1RTZA 2I0XA 1OPIA 1K1QA 3NOCA 1ZTTA 4B3RF 3UR3C 4RW4A 2K1RA 2XTJP 4ZDNA 5I3UB 4X4PA 3MEGA 2Y9HA 3DOMA 3DLLQ 2CNKB 2EPIA 3AB2B 3AB4B 1G6BA 3GIJA 1RLDA 1WEXA 3A4TA 2IPOB 2BX6A 2GMLA 3I6PA 4NPOA 4M5MA 3W61A 1TP7A 3F0NA 1ZM2A 3IFEA 4U67Q 3TAPA 1T9YA 3SV3A 1T05B 2K8GA 2OFHX 6FDRA 4JYAJ 1T9UA 2KKHA 4U7UK 1D0EA 4WFYA 4UZCA 3VWSA 2EC0A 3D3CJ 3NWGA 2E1PA 4WZMA 2CNLB 1TKXB 2PSZA 5LMNF 2BA9A 3P5BP 4HTJA 2MLZA 4USUA 4OL8A 4K4XA 5HP1B 3C8YA 2KL8A 1REVA 4PRFA 4EEYA 3BKFA 4Q0BB 2EFQA 1UWBA 1UETA 3BYPA 3AQPA 3W3SA 1YI2S 2M0GB 5IT4A 1VQ8S 3QRQA 2RS2A 2RUGA 3UDEA 3PCOB 3NCRA 4H4OA 2VL1A 1U2CA 1VC6A 3G82B 1HNVB 4TNOA 3T1AA 2DNQA 4OYIA 3BGOP 4DL4A 5ETQA 4F25A 4WTOB 2W4CA 4PG6A 4CYUA 2FPHX 4RU2A 2HVZA 4IUFA 3KLGB 4LRAA 2MQ8A 1WHWA 1K0VA 1KTQA 5K8MA 5D15A 1ZBTA 1XMQF 2BJ7A 4DZ6A 3ZC4A 2CQGA 3UCZP 1IWGA 4GKKJ 2FLLA 1FD8A 1TKTB 1PC4A 5A6WA 1FA0A 3IMQJ 1Y7PA 1CC7A 2M8DB 4OYZA 4OIXA 4ZPWR 1MU2A 4LMZA 5HROB 3F44A 4OZ2A 1KQSR 4B9SA 1R6YA 3GFYA 3CMAS 3KLVA 1X9MA 1EQMA 2YY3A 1VC0A 3TWZA 5ETNA 3DLKA 5HSPA 2W7AA 1RI7A 3PYGA 1S4EA 4FP9A 3B8HA 1WHVA 3L3CA 4A8SA 2W7OA 3K8VA 3J81Y 2KH9A 4Y2AA 1ELOA 5DQHA 1K47A 3EGNA 4DPOA 4DEZA 4P71A 4TY9A 1B7FA 2IM0A 3W8PA 5K5MA 2Y8YA 4ED4A 1S76D 4JI8J 2QN6B 4F04B 2HNZA 3MD3A 1S6PA 2AJ4A 4B9VA 2ASDA 5A2QY 2ZH6A 4JI8F 3IS9B 4FF3A 1RWVB 2M52A 2J7UA 2KJWA 2M88A 1UA0A 3RAMA 3PFEA 2ZOFA 4CO1A 4YFUA 4C11A 1I3OB 1UPMB 1SV5B 3DRRA 3NKYA 3OUYB 4K4SA 4FKYA 1PBAA 5IV4A 3Q8RB 4LF4J 4RU9A 3L4BC 1XMBA 2OEJA 4LRBA 2J6UA 5FD1A 2V0NA 3ETMA 5HANA 4C8MA 4KPYA 2DRBA 1KQFB 5CZVA 1X60A 2B5JB 3OFGA 1TL3A 1KN6A 1SH0A 3VF0B 3CJ0A 2JFDA 4QIEA 1URRA 1DARA 1QVGR 1CULB 2YKQA 2BEFA 3C15A 2A6OA 3MDFA 2E44A 2LVWA 3T5HA 1NPKA 3C46A 3EGZA 2D3OR 4YMEA 5IV3A 4HYKA 4JI0J 2P9GA 1VC5A 2K7JA 1RT2B 4LRDA 2ZH3A 3MR6A 2PT0A 1H3DA 1U26A 4E2FB 4FZVA 1JLFA 2W4DA 3K5LA 4NLTA 2B4PA 2KYXA 2ZOMA 4JI7F 3HVWA 4KGKA 2P9CA 4TQSA 5L9NA 2CPJA 2PC6A 4LIWA 1T03A 5HBMA 1KNZA 1TL5A 3RUBL 2VDIA 3KK2A 3KJQB 2DR5A 2DNLA 4ERDA 3M32B 2FDNA 2ASLA 2UVVA 1B0TA 1SXLA 3FCWA 4OYOA 2MYFA 4HDHA 2X7IA 3MECA 1IJEB 1QTMA 4L75A 1FKPA 4NA2A 1WC4A 2O67A 3M9NB 2CQ0A 2W24A 2M9KA 1APSA 3CTRA 1TKZA 1U49A 2ZH8A 1HBOA 2V63A 5KG6A 4DX7A 3MMCB 4OMFG 4AXJA 1FKAF 3BB5A 3CCQS 3GQCA 4WBFA 3TAMB 3MCMA 1FWKA 3O6QA 3CCUS 1YJWS 1ZAWA 4AD6A 3MMAA 4DR5F 1H38A 3RR8A 1NDLA 3TZXA 1S77D 3BKTA 2RJZA 2WBMA 1W25A 1KS2A 3ZTOA 3ILLA 3CWJA 3JSMA 2OSQA 1FJGJ 4DG1B 2VV5A 3E01B 4WTYA 1N4LA 3LF0A 1MG7A 1HBMB 3I9ZA 1AW0A 1EHWA 4LBHA 1IVZA 5D6GA 1T3OA 3UQSA 1Y9OA 4LF2A 1DZ5A 3I56S 3FFIA 5L9XA 2VZ9A 2RDJA 1LFWA 1O5JA 5T14A 1SB6A 4DZDA 2R3VA 2V5HG 4OX6A 3D66A 3QNWB 3BV8A 3IO1A 1WDTA 1GTEA 2C2KB 4NOHA 4NLSA 1OPZA 4IR9A 2XI3A 4WE1A 2WVBA 2DGOA 4I7FB 3BH6B 4DV2J 4YUDA 1M5OC 3ITHB 4I6WA 4KHPJ 1JB0C 4HEA9 4YB5A 2A2CA 4ZVQB 2UUBF 2L08A 5DQIA 1R0AB 5I42B 3ETOA 1RT7B 2HFNA 1RCOB 3SI8A 4NZ7A 3I82A 1GTHA 4WFNQ 4EBCA 3MM6A 4ZIVA 3W9IA 1IN0A 5AJ3F 1FRKA 1VIXA 2XY5A 4FYVB 4B9TA 1R8AA 2YPZA 1JXLA 4HI2A 1YJUA 3OT9A 1XTZA 2YKNA 2QL9B 3TQEA 3CCZA 1VQMS 1LFPA 3A3PB 3TX0A 2BE9B 3W7BA 4DL0C 1VOMA 2A18A 3B82A 1VRTA 1YJTA 1TL1A 2LP4A 3KLEB 3IBWA 5E3QA 4ID5A 3MEKA 2HBQB 1S1WA 2MZRA 4USTA 3G8QA 1L3TA 3D6HB 2F63A 3DMJB 4X4QA 2V67A 5B0DA 3P96A 2AW0A 3TZWA 4QYZJ 3LGHA 1WG4A 4NEYA 4PPDA 4Z37A 2OMOA 3D6FB 4DSLA 3VGSA 1DQ8A 3T1YF 1T7PA 2HGMA 4NCGB 2YNIB 5F0WA 2E7WA 2VDHA 4B9LA 5DDPC 1YRTA 1FXRA 1EAYC 4AQYJ 4DX5A 2VFSA 2LMIA 3JS9A 2YWEA 4HI1A 4DQPA 1D1UA 2YWGA 1WF2A 3AOAA 4O3RA 4DV1F 4AQYF 3G86A 4CLPA 3V81A 3J7YI 4LR7A 5M2PA 3QWPA 3D54A 5KFGA 1DTTB 1IR1A 1WHXA 1T9VA 5KT6A 3UNYA 3BQ2A 2VBXA 1UW4A 4ICLA 4PCQA 1U1QA 1HW8A 4YR0A 3NS5A 1HWJA 3Q8PB 3IWXA 4RZRA 4IDKA 4USVA 1Q8LA 4FDFA 5LSOA 1L3VA 5A8WA 3NNHA 1S1UA 1U48A 4R5PB 2DR8A 1CLFA 1T9XA 5D0HA 3CC2S 3THVA 1QAYA 3BYRA 1EB0A 4RW8A 4F3MA 4RW9B 3AA9A 4RUAA 1UZHA 5DO2A 5E5NA 1HARA 1X0FA 3U1LA 1IKWB 4CNZA 3V6DB 2ZBIA 5EHHA 2B9XA 3PHEA 4MIWA 4OZ5A 5J2QB 2GV1A 2A0FB 3M30A 4EZ9A 4FF4A 2JLEA 1C1BB 4NLVA 1UJ4A 5HVHA 1NKCA 2Z30B 1RHRB 2EFPA 3CC4S 2KVQE 4M5DB 1TK0A 2FVSA 2CQCA 2DK2A 1SVDA 4XAKA 3RW6A 3HHDA 3RB6A 4OFZA 1LV5A 4NWBA 1WC1A 2QSFA 2ZUAA 1TUVA 4ZP9A 2B3TB 1KOHA 2X3DA 9ATCB 1XR6A 1UKUA 1PJ7A 5IXUA 2D3UA 4USMA 3BR9A 4J7CA 3A8EA 2OPRB 2D9OA 2DNOA 2HK2A 1R8BA 3M8QB 2OIHA 3X3UA 3T5KA 2C2EA 2IHR1 3KK3A 4IO9Q 2MY8A 2J7KA 2F4VJ 1U2RA 3MR3A 5K8PA 1FK9A 2CVIA 1S57A 2V8VA 2R8IA 5K14A 5E3AA 3CCTA 4B3MJ 2CUYA 3N6NA 2JH3A 4DV5J 5KT2A 3QLHB 1MN9A 2DB1A 2RQMA 2OPQB 2B6AA 1FTCA 3SCIE 3L9ZA 2AZ1A 4ES2A 4MT1A 3H2LA 3PW0A 1TL7B 3NGUA 1FDNA 2BRLA 1LXNA 4QBUA 4J9KA 2QYGA 1H74A 2XMWA 1A9NB 2L9DA 1N5YA 1DLOB 2H5JB 1FJCA 4OHXA 1Y5IB 2MSSA 1HQEB 3D67A 2EEYA 2B8QA 4FKXA 4K4ZA 3G8SA 4NASA 4DSEA 2J76E 5G0RA 2FYXA 4ES1A 3ZZUA 2DCUB 4ZN1A 4ZPDA 3GIRA 2ZFHA 5LJ5Y 2DR6A 1I5OB 1XNRJ 4L72B 3EE3A 5ETRA 2U1AA 3QAUA 2K3IA 2CQ3A 4O3NA 2CQHA 3BS9A 4DR7J 2KZMA 4RNFA 3K57A 2OSRA 4I6YA 2H5EA 4RNHA 2YWWA 1SJFA 4UOFA 1S0VA 4CLTA 3BGUA 4ZPCA 4DR7F 1B0VA 2AGOA 3QJJA 3OL9A 1ZAXA 3A8IA 4P7VA 3N6LA 2BE2B 5DG7A 5E3CA 3M7VA 3POTA 3EWGA 2IDEA 2OTLS 4E98A 3CVKA 2MDAA 2FJVA 1W7WA 4M63A 3MCSA 5C7PA 1UWAA 1QJHA 4RNMA 1GXTA 4LJMA 1TTHB 2B9WA 4HT5A 2L9WA 3SDEB 4OI6A 2YWFA 3KXDA 3M8YA 2EFNA 3ONQA 1IM6A 2UXDJ 2EG1A 2KXFA 3DLGA 3CCVS 1VRQC 4A47A 3LQVA 2MQLA 3K5MA 3FUYA 3THPA 1PAEX 3FJ2A 3PX0A 2YQ3A 4N8NA 4Q5VA 3ZFVA 3J7ZT 2PO4A 3CJRA 2C2OB 1AFIA 3H5SA 1CJVB 3TAQA 3FC9A 1WI8A 4FXDA 2HLUA 2CJKA 2VIHA 4AL7A 4F4XA 2R8GA 2QJ3A 4YR3A 1L3UA 3W2VA 5HMWA 4J9LA 2DVIA 1X31C 2FJBB 1NK6A 1JNZB 1ZS6A 2HHHF 2E5LJ 4DDFA 1CJUA 1V3RA 1N34F 4DMZA 3TI0A 3W2WB 1RKIA 2AYMA 1R31A 2Z2ZA 5JXSA 4LFCF 1LWFB 4DF8A 2E5LF 5D3GB 3BBBA 3R5BA 2MHEA 3HF5A 4O3PA 4H4MB 4M5JA 2KT2A 4I68A 4DL7A 4NX9A 1RBAA 3W9JA 4ZVHA 2FVRA 3OXGA 4Q8FA 3CJKA 3HT3A 2DEIA 3LP1B 2KB2A 2HNDB 3HMJG 4KKOA 1I6JA 1Q4RA 3FSYA 5GAHI 1BMQB 1C2PA 2AQ4A 4USWA 3HULA 3E8OA 4D3GA 1QVFR 1P1TA 4C98A 2MZ1A 2YX1A 3M8PB 1GNKA 2ADBA 3H98A 2K3KA 2QE5A 1S4FA 3ISZA 2AZ3A 1IBLF 1SKSA 3BGRA 2AF6A 3FBCA 1FFGB 2DD8S 5JMNA 3NRBA 2NPIA 2X51A 1C0TB 2OAUA 1N5VA 4DS4A 2X1FA 3DN9A 4AE5A 2OPPA 1U1RA 3DI6A 2FY8A 4HHUA 4Z2XA 4M5NA 4PG5A 5B0CA 2ASJA 2NUUG 1KVKA 3NNCA 4KTQA 1HBUB 1S1TA 3KNGA 1NUEA 2G1DA 1AT1B 2CDQA 2MJNA 4JUZA 2YKMA 1KLMA 2CG4A 3BREA 1DJ0A 3LWMA 2E5HA 4EBEA 2AHOB 3MMJA 4KC5A 3MM9A 5CCLA 4OYBA 1NSQA 4KR0B 3SFUA 4XIUA 3DDNA 3NP5A 3N6MA 5BYQA 5H9EK 2JX2A 4YDXA 5L1KA 2U2FA 3GIIA 2DNHA 3U02A 2RHQB 4ID8A 2RRBA 4YS2A 2FLOA 4ZOSA 2MHNA 5HMYA 4WYWA 4KO0B 4ZVSB 1S99A 3O5TB 1BWEA 1B3TA 1IJFB 3QGPA 4YN3B 3MEEB 5CABA 3FMBA 4I56A 3GYGA 3CJ5A 1HNWJ 4OHWA 2MQQA 1PAUB 4K8RA 2ZE2B 1RTHB 3CDBA 2GIQA 2N7YA 4QW9A 2MSTA 3IR5B 4CIOA 1SUQB 1I94J 1R8PA 3ZTPA 1SQEA 4WYLA 2ZH9A 5DRKA 2DHAA 4ZPTR 3MM5A 2FQQB 3OPKA 4CO2A 2CQ1A 1RA7A 2BJ3A 1S59A 5C5JA 5J1EA 1RUSA 4RPFA 7FD1A 2KTQA 1R0CB 5KT7A 4OX7A 1U2FA 4NXMJ 2VFVA 3SSRA 3EYZA 3KHRA 3DYAB 4QW8A 4UOGA 4PG8A 2DGVA 4XDCA 3ZNJ1 4LF8F 1X5SA 3LAKA 2LDIA 4FXWA 3BR8A 2RSQA 4K4YA 1UP1A 5J2NA 4XPEA 3TX8A 1UFLA 1IKYA 4CH1A 5IWAJ 4HLBA 1RXOB 2CPZA 2BJEA 3RBEA 5D77A 3GR1A 5SUHA 4F0HA 5HATA 4K50A 4NI2B 3MM7B 1RHUB 3B54A 3VGUA 2FY1A 2DPIA 1RTDB 5IWAF 2VC1A 2RKIA 5J2PB 4EBDA 1UVNA 1Z1ZA 2EBEA 4B9UA 1VGYA 3C6TB 2I2YA 7FDRA 3I32A 2NQPA 2IYGA 4R0JA 5DETA 1Z4UA 4O3SA 3SBMA 2GW8A 4BC7A 1Y3KA 4QU7A 1WWHA 2F8HA 2KM8B 4EZ6A 3MHYA 1S9EB 4OJ1A 3EM1A 2E7VA 2HRUA 4Q2MA 3KLFA 1EETB 4OYAA 5A8KA 3IM8A 1U1NA 2CIMA 1JMTA 1F5AA 3AAWB 3MGJA 4JI3F 5KFYA 3PRDA 3J7YU 2CJAA 3TUZC 3FDSA 3Q8QB 2OEKA 4CT8A 4NLXA 3C16B 2VASA 2NUHA 3B6BA 3J7AN 2BE7D 2QEXS 1HMVB 3CCRS 3A13A 2VG5A 3OHAA 1HHSA 3PR4A 3L7PA 3KLIB 1SJ4P 1C1CA 4WFZA 3G8TA 2CZ9A 3H2UB 3DLEB 2XSJA 2MEWA 3D1QA 2ZH7A 5LOQA 4OI3A 4B08A 1HWKA 3OXFA 1S12A 1YJ7A 1IKVA 2KFZA 2IFXA 3IG1A 3KHHA 3WBZA 5E2QA 2XMUA 4LR9A 3ISNC 1XIQA 1UA1A 3I0SB 3DGPB 1DRZA 3NS7B 2KN4A 3FVYA 2EKYA 2BANA 2RH3A 4LQ3A 4B9NA 4Q8EA 4GO5X 2XWYA 1ZZFA 1TQLA 3TP2A 4E0DA 2VA2A 2IAJB 3VAMA 4WFXA 1G7CB 1D9AA 4K7QA 1TV6A 4OZLA 2VHGA 2XMJA 1FE4A 1SJRA 3EDRB 2DIVA 2EW9A 1EP4A 4YOEA 1LW2A 2IY5B 5F8IA 1HNXJ 2RQ4A 3UI3A 6FD1A 4FYWB 3EUNA 3MEDA 3HKWA 2VQFJ 1A6LA 2CFXA 4WP3A 5L39A 2H51B 3HI9A 4TU7A 9RUBA 3ILOA 1X4EA 3MMBB 4CH7A 5DGAA 2J9DA 4WKRA 3OVSA 3W65A 1OYEA 1NH8A 1NB2A 5KFLA 3BF4A 3JTPA 4X84A 2XCPA 2XHWA 2C2RA 4QR0A 2QA4S 5DM6Q 2R7SA 3HLUA 3C2PA 1E6VA 4M5HA 4K5RA 3CMQA 2I6WA 1SC6A 2ZDOA 2AYBA 2G13A 4CT9A 3JXOA 2YNHA 2GJIA 2DHXA 2MKIA 3EGVA 1T3NA 2P9EA 1RTIB 2UUAJ 2RDIA 4CO4A 2FHJD 3VAGA 3N28A 3GG1A 3WIUA 1RAIB 2HBRB 3HSZA 4ILRA 3A8JA 1JLQA 4CRJA 3SQGA 1XERA 4X4UA 4WCEQ 5JVHQ 3H5YA 4YHHJ 1B64A 2V2VA 4ZIWA 2FVQA 4QQBA 2J5AA 4C9DA 1WOSA 5HJYA 1FNOA 3CGIA 1U7LA 5KFSA 1M5VC 3N5FA 3IRWP 2CQ4A 5KG3A 5GAEI 5IQQA 1AUSL 1KFSA 3ET6A 4C8NA 4F26A 4PG4A 2K1RB 3DDIA 1M90T 2LYVA 1FNMA 3JSYA 5C25A 5L46A 3KHLA 3S6EA 3D3BJ 2I1RA 3DOMB 2BM0A 4WFBQ 4Y2CA 2PIIA 3CJTA 5B0GA 1BD6A 1LWXA 3FQLA 2E5GA 1E6YA 2P6TA 1FX4A 4UY85 5DG8A 2CPFA 1BQNB 1AUDA 1V3SA 2BDPA 1BXNA 4MH8A 3KG1A 5IOLA 1O51A 1WDDA 4PWDA 1WC6A 4I2QA 5HAOA 2ZBQA 4DR4J 4ZCKA 3KJVB 3U1NA 1JLBB 1DTQA 4GKJF 3Q8UA 1U24A 2MKJA 3Q8YA 2JEIA 1PYSB 3FZ2A 2F8EX 1X4CA 2MZSA 1MMDA 3I4HX 3HX9A 1YJ9S 2VD3A 3GFHA 1TAQA 3R7BB 3A1YG 1S9FA 2CJYB 5GAGI 4HR2A 4U96A 3IGVA 4DLEA 3C3LA 1REVB 4RW6A 4FYXB 3DRXA 1CSJA 1ROFA 4KJIA 1HPZB 3CJ8A 1FEHA 4ETXA 5BR8F 1FESA 1C4CA 3UNGC 2HAIA 2XMVA 2YQ0A 2W9CA 1PJ5A 2WVEA 3CD0A 5F0UA 2XY7A 1VQPS 2FHOB 2YBVA 4UTGA 2Y1JA 1B70B 2V4RA 1NK4A 3OL6A 4RBUA 2HQ3A 2XQCA 1FDBA 4IKAA 2CVEA 3J81j 3MR2A 2ZWPA 1NK0A 2DTJA 1DHMA 1Q16B 5A0YA 3AOCA 4JV0A 3ZTQA 4FPIA 1BQMA 3PEHA 1RK8A 1BWVA 3HZGA 2CPHA 2VQEF 4KYZA 2LEPA 1AROP 1G3OA 4CM2A 1LOUA 2C2MB 3BGLA 1FF2A 1NXIA 4CLUA 4LUBA 2WTFA 3GV5B 1H0HB 3NY0A 1HD0A 1P27B 4I67A 2NSCA 1PYTA 2ACYA 2I5JB 1C4AA 3MM8B 4M1KA 3HHNB 2Q79A 3EVWA 4KFBA 2OUGA 4HDGA 2M8HA 4KRWA 2OELA 3AXKA 3ILJA 2F7VA 1IBKJ 1YX2A 3GV7B 3I5BA 1EX8A 4A48A 4O0NA 2GS8A 3PW4A 4DV7J 2LA6A 1LK7A 3MUVP 4B3SJ 2W8KA 3M2VA 1BLUA 1VCTA 5CYQA 4AFFA 1IBKF 2HNZB 4ALZA 2ZITA 5H9FK 3ZZYA 1MMLA 1Q0NA 4ZVUB 3ZTRA 1NJYA 2IJNA 4W90B 2WBRA 5B08A 1JWWA 5KFZA 5A8RB 1ZTWA 1SIWB 5L1IA 1B7YB 4Q43A 3AXMA 2W9BB 2D1CA 1SL2A 1X4BA 2XI2A 4X64J 5I3UA 3ENAA 3EVMA 1JLCB 2DXEA 1GT8A 4UUXA 1QUVA 1N56A 3T6JA 4K0KJ 3KMQA 4V1Ak 3G6VA 2M3DA 1R89A 2KRBA 3PJWA 2NS1B 3EJMA 1P6TA 2XB2D 5HJXA 4MFBB 2KG1A 3BQ1A 1T05A 4IOBA 3IXQA 4IG3A 4C4WA 4DFKA 4RO0A 4DPWA 4O3OA 3BSNA 3PIPQ 4WIQA 3AFGA 3QYYA 3IC1A 3TA0A 3W62A 2NXUA 3VAIA 2KDOA 3ZZZA 3QGHA 2LKZA 1XC9A 5CXTA 1H98A 3PJ9A 5L1JA 3H4BA 4WK1A 1TKXA 4JI6J 1R27B 3S01A 2N4CA 4MK9A 3H40A 1JLGA 3TOQA 1KHWA 1FRJA 3HD2A 1NK9A 2W01A 2IM2A 1JLFB 4Y2MA 1UVLA 1K9MT 4TYBA 5HP1A 3OJUA 4Y0FA 3RBDA 4QWEA 3HHLC 5KFQA 4Q0BA 1RADB 5LT5A 2VG7A 4HACA 3MTJA 1NJIT 2FHJA 4ZLLA 4M95A 1HL6A 1ICEB 3NGKA 3KK2B 1HR0F 2GO8A 4RUCA 1IQZA 1YLXA 1R0BG 5F8HA 4DX8H 3G82A 3HPOA 3CJ2A 2C2ZB 1GX5A 2GX8A 4MIAA 4A8QA 3OLAA 4I2PB 2RT3A 3QWUA 3SCKE 3KLGA 5G4DA 4DI6A 1TKZB 2BOPA 3M8SA 1HBOB 3GG0A 1T9TA 2IRUA 4KH0B 3TO8A 4GC7A 3L7OA 3HHLA 1VBYA 3IA0A 4QPXA 2HZCA 3QAEA 1RDRA 4F4WA 2FD2A 2FZCB 1CS4A 2GAGC 2J9CA 4F2RA 4EYIB 4FS1A 2WZ1A 4HTIA 3JSMB 2F5GA 4PYDA 4R0EA 3G2XA 5KG1A 1S79A 1VRUA 2Z57B 3NGTA 3NLCA 5HROA 4C0BA 4U7UD 2HFZA 4QWAA 4ATNA 2DH9A 2EFVA 1G2EA 2MGZB 4C2MA 3NAHA 1KVIA 4KPCA 4ECXA 2WB4A 4CO5A 2K2PA 5DLGA 1Q5VA 1X4GA 2FJAB 4U95A 1Y10A 3DM2B 3DFEA 3LPEA 3LAMA 3J7Z5 3GIKA 2KXNB 1RAHB 4MJKA 2HLTA 3WC0A 3F56A 4ZS6A 4GC6A 3Q83A 2UP1A 5L38A 4NMXA 4LF5F 1HNZF 4FS2A 1N48A 1KFDA 1SIZA 1NBEB 4YB1P 1N33J 2J9DE 1HQ2A 1OQ3A 4P2SA 2QLWA 2L41A 3KFWX 2Y8WA 4QCLA 3VGTA 4ED0A 4I6AA 4WXWA 1T11A 3IS9A 3TNVA 3GJQB 4KE5A 2GHPA 4UT4A 4GVLA 4X62J 3G96A 2DT9A 4BDPA 2Z2YB 2GIFA 4N77A 1SV5A 3OTDA 2LXIA 4MKAA 3MM6B 2XCAA 3K0JA 1ACMB 4RKUC 1RB0A 3OUYA 2NLWA 4IG0B 2ZHBA 2MB0B 3LP0B 2YX4A 2BJ1A 3JB9k 5SZTA 3D4JA 4DR1J 1WF0A 2CJQA 4H54A 3D5MA 4R8UA 2YWKA 1VQYA 2CYYA 3VAFA 1N8RT 2HQIA 2B5JA 3Q8VA 3PW5A 4N47A 1YSJA 4LF9J 3A3OB 1TL1B 1CULA 3QT6A 4PPZA 4CP5A 3K8WA 1S1WB 3HO1A 2VFUA 4DJBA 3GU0A 4LF9F 3R5DA 1NKBA 4KY3A 1IXKA 4W98A 1RT4B 2VJVA 3HSJA 5KT5A 4DR6F 4OI2A 2IA0A 1RT2A 1WTBA 4Q44A 3MR7A 3BBCA 2WVDA 4LSNA 3GSIA 5D8HB 1LEOA 5HMXA 3MTKA 4GVBA 4LQ9A 2H54B 5EWEA 1EKSA 3ZZTA 2W4PA 1RTJA 3RBXA 3KK1B 3V81B 3M32A 2E9ZA 3CMES 1BY9A 5FJ4A 4ICLB 4LSZB 2GIRA 3H5UA 5FIIA 2YWHA 2HNYB 1QLNA 4C8ZA 1CQMA 3K5NA 2WSCC 2HEKA 3AJDA 2QIFA 3L95X 1VHIA 3JTOA 4J5OA 3HJFA 4C3MA 3MMCA 1S9GB 5A8WB 3TAMA 4CI0B 4IFYB 4JV5J 2LQ9A 5FLXU 3H0PA 3SZ2A 5AXNA 3PJXA 1GXLA 2FVPA 1L5UA 2HSEB 2YH1A 4DG1A 4DUZF 3QRRA 3QT8A 1K1SA 3Q86A 3M30B 3GV8B 1RP5A 5K9FA 1NJXA 2DR9A 1Q5YA 2NYIA 3PKMA 4K5SA 2MZQA 2DY1A 1NSPA 2DITA 3RYLA 3DLHA 2XYPB 1SKUB 3ULHA 1NB7A 1T94A 1TELA 2HWHA 2I9SA 2Q3PA 1UEKA 3TUIC 1XNQF 1P1LA 4TU9A 4RBVA 2MQPA 1Q95G 5IC4B 5JVGQ 3VTIA 5T7LB 4I7FA 1TMJA 2JZ5A 3ITHA 3QATA 2JNJA 1FCAA 1S1VB 2CPIA 2QC3A 1R0AA 5I42A 1D8ZA 1RT7A 3CNQP 2IDLA 4J90A 3GMGA 1RLCL 5THWA 2B6AB 1JLAB 4KGVB 3Q8SB 3HSDA 1ZA2B 1FRHA 3GP9A 2FLNA 2E1AA 4ED2A 1CVJA 3OQ2A 5HVFA 2ZZTA 3AJ2A 3D9BA 5EGYA 2NCKL 2MKSA 2M4MA 3W5XA 1N5YB 1S6OA 4LF6F 4X4SA 2HHVA 2XS5A 5ETTA 2YNFB 2V2ZA 3CF5Q 1YGYA 4OYMA 3HVTB 4PAAA 4EO8A 1NO8A 2CDRB 3KLEA 3EPGA 3FNNA 5B0EA 2NZCA 3AD9C 2GHVC 1JLEA 4CLSA 3DMJA 3PZPA 1Q1KA 2HRYA 4RX6A 3HT0A 4NA3A 2N82B 4NCBA 2OHDA 3CJ4A 1R8CA 1RT5A 2GQQA 1MWYA 3U27A 4NCGA 2YNIA 4B3RJ 1VQ7S 4MYTA 3PYEA 2C3MA 4ES3A 2UXCJ 2XS2A 2B4OA 4AL5A 4WWSA 2R7XA 2EFGA 2FTRA 3HDSA 3GR0A 4U8YA 3EXCX 2OPSB 4DU7A 2UXCF 1SJ1A 1DTTA 3QJLA 2R9LA 3C14A 4KH1B 4YDDB 1MN7A 3BM7A 2BKNA 4BC9A 3NCQA 2NXNA 5KAKA 4DPXA 4XTTA 1FWLA 5IT9U 3E3XA 2KHCA 3D1OA 4DSJA 2HVHA 4C8OA 1TL4A 2MLXA 4U6PA 4K2XA 2B7BB 3IWLA 2DR7A
chains in the Genus database with same CATH topology
2ZNZA 3FSYA 5GAHI 3H4DA 4ZP8A 4NRUA 4R5PA 1C2PA 3CC7S 2AQ4A 1QUPA 1UEUA 5DDRC 1MROB 4MK7A 2NSBA 4F4YA 3E8OA 4RW9A 4D3GA 1PGZA 4EGLA 1QVFR 1P1TA 4QJVA 3TR5A 4C98A 2MZ1A 2YX1A 3M8PB 1GNKA 2ADBA 3MWBA 4HL9A 5M2RA 3H98A 1IKWA 1FVQA 2K3KA 2QE5A 3FZBA 5HN0A 3V6DA 2DGUA 5DLFA 3OBIA 2F1FA 2BANB 1JLEB 2FHKA 1S4FA 3ISZA 2WOMA 1K0TA 2GGPA 1IBLF 1SKSA 2WONA 3BGRA 5J2QA 4G1QA 2GFFA 3OLBA 2B4VA 2AF6A 3L09A 4O4RA 2KFNA 1RT4A 2DD8S 1C1BA 5LXYA 3NGDA 4DL2A 2R7RA 3T1HF 2LQJA 2PFFB 3JYTA 1V9OA 1F9FA 3NRBA 1R7IA 3KNAA 5HI7A 1KRPA 1UFWA 3G6XA 1RT5B 2NPIA 1FRMA 3QJPA 4TLRA 1Q78A 2O5DA 2X51A 3DRYA 3KG0A 1C0TB 1S0MA 2OAUA 4QZVB 1WF1A 5CQGA 1N5VA 2V8GA 4DS4A 2X1FA 4N56A 5HLFB 3DN9A 1J5OA 1LXJA 3CD7A 3LOUA 4AE5A 1P9QC 2H9ZA 2OPPA 4DV0F 1LW2B 5KFWA 1OSDA 4X4RA 1WELA 1U1RA 4A4JA 3DI6A 4A46A 4KHRA 3P6YC 4NMLA 2WAQD 3RW7A 4Z2XA 3BDPA 4Q7AA 2JEJA 1N33F 4PG5A 3M1VA 1BC6A 5B0CA 2GO9A 2F40A 2C3OA 2ASJA 2PI5A 2MY7A 3MEDB 3AY0A 2OPRA 2NUUG 3UCUP 4RW4B 2F9DA 4A8FA 3NNCA 3KK1A 3Q0AA 1HBUB 2GNKA 1TKDA 1S1TA 2OLWA 4KTQA 4WKYA 3KNGA 5F41A 3V6HA 3M8QA 3PACA 2G1DA 1Y3JA 1QSYA 5F8MA 2HGLA 5KT3A 2CDQA 2MJNA 4PWUA 4PXCA 3CO9A 1T02A 3MEGB 4JUZA 5H9FJ 3CCSS 2YKMA 3AH6A 4AL6A 5FLXY 1KLMA 2CG4A 1QY7A 1NEEA 4DL5A 3Q23A 4X62F 3BREA 1U1MA 2PI4A 5DDOC 1DJ0A 2V8HA 2ZUGA 1RWUA 3IN5A 5BYSA 2EK6A 3AJ1A 3LWMA 4RNNA 1VK8A 5M2UA 2HNYA 1DURA 2E5HA 2MXYA 4EBEA 2L3MA 3NAIA 3BZQA 2XLIA 1S7HA 3CCMS 5BYRA 3MMJA 4KC5A 3MM9A 5CCLA 1KONA 2FJXA 1E6VB 4OLOA 4CO3A 3U1MA 4PUOB 2KI2A 2B4UA 2XMKA 3GFXA 4KR0B 1M5HA 4ECWA 1S9GA 3E51A 4KKOB 2OPQA 2DHSA 3MPVA 2XSFA 4IOCQ 3KOAA 4QU6A 3SFUA 1TK8A 4X4NA 2JDJA 2YNHB 4OHZA 5GADU 2PN6A 3R1LA 1Y4ZB 4IFYA 1RYRA 5D4PA 4G3IA 3X1LB 3D0HE 4XIUA 4DR1F 3PXGa 5EUHA 5AE3A 2BV3A 1GH8A 4B3OA 2N3LA 3DDNA 3NP5A 3FRYA 2R2TA 2F8MA 3N6MA 4FN5A 1FNXH 4TXSA 5BYQA 2D74B 2I38A 1VQLS 1HA1A 2JX2A 4YDXA 5L1KA 2U2FA 3DOKA 3S7RA 3GIIA 2DNHA 3U02A 2AWZA 1MMNA 2P6SA 4ID8A 1VHFA 2RRBA 2WOMB 2BACA 3H59A 1SBRA 1JLQB 2BQ3A 2FLOA 1HQEA 5KFBA 5DG9A 4G1QB 4ZOSA 3SQGB 2MHNA 5B7WA 4W92B 5HMYA 4WYWA 4KO0B 4DSIA 1S99A 3O5TB 1BWEA 2PA3A 3AQOA 1X9WA 3NNAA 3CJ3A 3CDWA 3JYTB 1IJFB 3QGPA 1HNIB 2O1PA 3BSCA 1FO1A 3DU6A 5LXRA 3MEEB 4RW7B 1ZPWX 1L3SA 3CIZA 2V8DA 2XO7A 1MNEA 3FMBA 2J9EA 4MMOA 4OZ1A 1S6QB 3CDAA 5J2MA 4I56A 1VLYA 3MM7A 1VBZA 1UJ5A 4NLPA 4XK8C 4RWXA 4J9PA 3H5XA 4UUWA 3CJ5A 4DSFA 2ZZNA 4DBQA 4OHWA 1UWBB 5J2PA 2ZM6F 4BCAA 2MQQA 4O23A 5K8OA 3KTQA 1J5OB 1TZ0A 4WFAQ 2ZE2B 3UFCX 3JAMY 3DRPA 3QZ7A 5F8LA 1LWEA 5KFIA 3MURP 1RTHB 3CDBA 2R7TA 5DQGA 4KBIA 4P6QA 4LFBF 1NHVA 1PC5A 2RQCA 2OFGX 2GIQA 4FYDA 5J1NA 2N7YA 1ZH5A 4QW9A 2QRRA 1UVKA 3DXBA 2AX0A 3DU5A 4H4OB 4DOZA 2J6TA 1KVJA 5EN1A 1Y0HA 2IM3A 2HYIB 2XGQA 2DBBA 5J1PA 4FVCA 2QMXA 2IVYA 2MSTA 3IR5B 1DQAA 3JTNA 3M6VA 4KV8B 1S1XA 5T7LA 4CIOA 2DO0A 1FTRA 2CQDA 1SUQB 2GC8A 2JEGA 2OD6A 3IAM9 4DQIA 1R8PA 5C25B 1SQEA 3MZIA 1HWUA 4WYLA 1JJ4A 4YB6A 4A8YA 2ZH9A 4DR2F 4IRKA 2JJ4D 5AXKA 5DRKA 1IBMF 2M7SA 2DHAA 4ZPTR 3MM5A 3OPKA 4CO2A 2CQ1A 1RA7A 2Q43A 2IVFB 2XGPA 3G6ES 3SSSA 3HK2A 3UWTA 4WK3A 4URGA 4Y6IA 4DWIA 2HS0A 4ZCLA 2HMIA 1CEZA 5C5JA 2VFTA 5J1EA 2LEBA 1S1VA 3JSRA 4FXVA 2LQBA 7FD1A 1H2UX 2BJDA 3I0RA 2VA3A 3MAQA 1Z2ZA 2BE2A 1V6HA 4OJGA 1OIAA 4DFJA 2LEAA 5DM7Q 1UVIA 2RVJA 3THTA 2VPXB 2KTQA 1N0UA 1LW0B 2F4VF 5KT7A 4J9RA 4OX7A 1KQKA 2ADCA 4YY3F 1NRKA 1U2FA 3BGFA 1RISA 5JJBA 1JLAA 3T6BA 2VFVA 3SSRA 3EYZA 2LDYA 1DQ9A 3KHRA 4B3MF 3DYAB 1JJ2R 4QW8A 4DQRA 2KVIA 2ZKTA 2HG4A 1RJJA 1SL0A 3T9ZA 1U6FA 4PG8A 4X65F 2DGVA 4XDCA 1PO6A 4PWDB 2EFOA 4I2QB 4DV5F 2JHEA 4ZP6A 3VQTA 2UUTA 1YIJS 1NAQA 3VZHA 3OL7A 4LF8F 1MU2B 2PD1A 1HD1A 1X5SA 3LAKA 2XWXA 2LDIA 3UPFA 1DTQB 3DOKB 2N3OA 4FXWA 3FEXB 3BR8A 3OTEA 2RSQA 4K4YA 1UP1A 1FERA 2CKWA 3OTOF 2XY6A 5J2NA 4FBUA 4FF2A 4JV5F 4XPEA 2MPUA 3SDEA 1UL3A 2WHOA 5I4MA 4H4KC 2LLZA 3TX8A 1UFLA 1IKYA 1FEEA 2YNFA 2AGPA 3M8RA 5KG4A 4CH1A 3WC2A 3FRZA 3BO4A 2BRKA 2AV5A 1U1OA 5GMKa 2G0CA 4HLBA 1VBXA 1SKRA 4DN9A 3UE2A 1O8BA 2CPZA 2OP5A 1QM9A 2CJBA 2BJEA 1JKHA 3RBEA 3HVTA 5D77A 3DLKB 3GR1A 5SUHA 3MOZA 2VB6A 2DGTA 4K50A 2MJUA 3OL8A 1VQOS 5J2MB 4RW6B 2E5IA 3MM7B 4DSKA 4HH0A 1FXLA 2FY1A 3PX6A 3LPYA 2DPIA 1RTDB 1YRXA 4D3HA 5IWAF 2VC1A 2BM1A 2RKIA 5J2PB 4EO6A 2XZWA 4YP3A 1N32F 3KYLA 5D78A 4EBDA 3ZZ0A 1UVNA 5L8RC 3OR1A 5HO4A 1Z1ZA 2UXBF 2EBEA 2YKAA 4B9UA 2HWIA 1LWEB 3BSOA 4OQJA 1VGYA 3CE8A 4GMKA 2ZHOA 3C6TB 2I2YA 1JXEA 7FDRA 1VQ4S 2PA8D 1FHTA 3I32A 2BABA 1MSWD 4ED5A 4JBCA 4QWCA 3GYXB 3PDNA 1M0SA 3GWCA 2NQPA 5GAEU 3RU0A 4RWWA 3NS6A 1S6PB 2IYGA 3ZZRA 2RD5C 4R0JA 5DETA 2W9CB 1Z4UA 2XLKA 5LMUF 4O3SA 1UMJA 3Q2TC 2QA1A 3TA1A 1S1XB 2GW8A 3DOLA 4BC7A 1Y3KA 5DS7A 2FB0A 3KMSA 1U1PA 2DNGA 1DAXA 1XNRF 4H4KA 2AD9A 4QU7A 2XNRA 3ENQA 2EWHA 3PM9A 4LSLB 2PE8A 1WWHA 2F8HA 4C0HA 1HWIA 2KM8B 4EZ6A 2DISA 4OX8A 1FRIA 3MHYA 3M6XA 4ED7A 1S9EB 4EWTA 5KFMA 1RAJA 2V9WA 4TKTA 2KJVA 4OJ1A 1H2TZ 1DFDA 1Y5NB 2HRUA 2E7XA 3QIPA 1EETB 2AX1A 4Q2MA 4NRTA 5A8KA 3KLFA 3MUMP 5FDLA 2RF2B 2VPYB 4C11B 2EVZA 3UCGA 5J1EB 1U1NA 1HWLA 3LW5C 4ZPBA 5IT9Y 1XK8A 2CIMA 1JMTA 5A0YB 3DRRB 1F5AA 3AAWB 3MGJA 1KSPA 4JI3F 2JL9A 5KFYA 3I0RB 3PRDA 3J7YU 3QGIA 2CJAA 3TUZC 4KHMA 3FDSA 3Q8QB 4CT8A 4NLXA 4LIRA 4A8MP 2MKHA 3SMZA 3OVBA 2VASA 1N88A 2NUHA 2OPSA 3DCAA 5B0AA 1M5SA 2VPWB 2QEXS 1HMVB 3CCRS 2J0WA 3EX7B 1LWFA 2RIJA 2VG5A 3OHAA 4ZA1A 1NJWA 4K4WA 1HHSA 3PR4A 3L7PA 2FJDB 3KLIB 3N79A 5D3GA 1VQKS 4H4MA 2R2UA 4TQRA 1U25A 1SJ4P 1C1CA 3WZ0A 2OTJS 3O3LA 2APOA 5IT0A 4WFZA 3G8TA 3H2UB 3DLEB 2FGOA 2XSJA 3QPIA 2LA4A 3IAS9 3D1QA 2F9JA 4CQ1A 4ECVA 4JV1A 4CTAA 2HGNA 4KQZA 4NLDA 2ZH7A 4WF9Q 2FLPA 3SCJE 5EX3A 4OI3A 4B08A 1SKWA 1HWKA 3VZIA 4QIGA 1N36F 1TL3B 3OXFA 2A10A 3LP1A 2Z8QA 5J2NB 4BHQA 1S49A 1XR7A 1IKVA 2KFZA 2LU1A 5GADI 4TN2A 2L9NA 2IFXA 3OFEA 1X0PA 3IG1A 2PDAA 3KHHA 1R43A 3RB4A 2KRRA 3NMAA 4BBYA 4WU2A 3Q2SC 3PY8A 2XS7A 4QOTA 4UQGA 3OJSA 3WBZA 3O44A 2KYZA 1YJVA 5E2QA 3G4SS 2Y1IA 3PFOA 2XMUA 2VPZB 1WTFA 4KFBB 3D2WA 3UD3P 3OVAA 1MROA 2ZNYA 3ISNC 2G4BA 4WU3A 1HI1A 3MUTP 1UA1A 5IM0B 1Q7YT 4EYHB 3I0SB 3ENVA 5K8NA 3MR5A 1DRZA 3M8PA 4A8WA 1NU4A 2KN4A 5GAGU 3FVYA 3RAQA 4OLPA 4KSEB 4C7QA 5CA5A 2OJ3A 4MYUA 2YKPA 2E1RA 2RKIB 2EKYA 3BDEA 1N5TA 2BANA 1HQUA 2UXDF 5MLCV 1J5EF 2RH3A 4LQ3A 3OV7A 2DPJA 2ASYA 3MD1A 4B9NA 2XMMA 1GX6A 1SI9A 3M2VB 4Q8EA 4GO5X 2JVOA 2XWYA 1ZZFA 3V5RA 1TQLA 2GJ2A 3TP2A 4E0DA 3LP2B 2IAJB 4OI1A 3BQ0A 2VA2A 2E1CA 3VAMA 3DLBA 2PMZD 3SXLA 1CQNA 3RRHA 4JI5F 3V6JA 2MKCA 4UQTA 4TLQA 3DHXA 4WFXA 1G7CB 1NZAA 1S6UA 4G1IA 5EWGA 5KG2A 3BN4A 2IBKA 2FGCA 4IR1A 2C3UA 1D9AA 3N01A 1D9DA 4F2SA 1C0TA 3LUYA 4ED3A 2Q1LA 1HI0P 5CD4H 1TV6A 2CPYA 4OZLA 4PXDA 2XMJA 4QWBA 2ERRA 3EXYA 3CEDA 1FE4A 1FJEB 1SJRA 2X1BA 2DIVA 2EW9A 1EP4A 4HVZA 1LW2A 4NZ6A 5HBMB 1T03B 3PW7A 1Q81T 4YOEA 5HL7Q 3BJYA 3D28A 3QIPB 2J0XA 2WK4A 5KFKA 3IR7B 5F8IA 3V4IB 2VFRA 1ULRA 2I0XA 2RQ4A 2CRLA 1YJNS 1OPIA 3UI3A 1K1QA 1ZTTA 6FD1A 2DNNA 4B3RF 3EUNA 4ECUA 3MEDA 3HKWA 1MW7A 3UR3C 4RW4A 3F73A 2MMYA 1HNVA 3E2EA 1A6LA 2K1RA 4NYOA 3TA2A 2CFXA 5L39A 2MZJA 4URQU 3HI9A 4TU7A 2Q66A 3MECB 2RMLA 4CCHA 1OO0