1OSMA

Osmoporin (ompk36) from klebsiella pneumoniae
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
342
structure length
342
Chain Sequence
AEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKGKDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional characterization of OmpK36, the osmoporin of Klebsiella pneumoniae.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Outer membrane protein
molecule keywords OMPK36
total genus 84
structure length 342
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1osmA00
2XE5A 2FGRA 2OMFA 5DL5A 3WI4A 3SYBA 1PRNA 4FSPA 4LSEA 1GFQA 3PRNA 3PORA 5DL8A 3HW9A 1GFMA 4GCSA 1BH3A 3SY9A 3T24A 3EMNX 2J4UP 3POUA 4LSFA 1HXUA 5DL7A 4KR4A 2XE2A 4D5UA 4D65A 3VZUX 3SZDA 3UU2A 4FT6A 1HXTA 5DL6A 4LSHA 3VY9X 2XE1A 3FYXA 2Y0HA 3VY8X 4FRTA 2QTKA 5JDPA 4JFBA 3HWBA 4RJWA 7PRNA 2Y0KA 3WI5A 3T20A 2ZLDA 4C69X 4RJXA 4GCPA 1OSMA 1HXXA 3VZTX 3O0EA 5PRNA 1BT9A 2XG6A 4LSIA 2ODJA 4FSOA 4FOZA 3SZVA 4KRAA 3SYSA 3SY7A 5FVNA 2Y2XA 3UPGA 2K4TA 3POQA 1OPFA 3A2SX 2PRNA 4GCQA 2O4VA 8PRNA 3POXA 3VZWX 1E54A 1MPFA 3K19A 2Y0LA 2ZFGA 2PORA 1GFNA 3JTYA 1PHOA 2XE3A 2J1NA 4FMSA 1GFPA 4AUIA 3NSGA 2FGQX 1GFOA 4D64A 6PRNA 3T0SA 4FRXA 4BUMX 1H6S1 4KR8A
chains in the Genus database with same CATH superfamily
2XE5A 2LHFA 2FGRA 3GP6A 5AFUL 2N2LA 4BUMX 1ZHYA 2KZ7A 4RLBA 1G90A 2OMFA 2R4OA 5DL5A 3V8UA 3VE2A 3UAQA 3WI4A 3PGRA 4N74A 3SYBA 4PUXA 1PRNA 4FSPA 4LSEA 3AAEA 1GFQA 2WJRA 1ORMA 2XTRA 3A0HO 3PORA 3PRNA 2KXPB 3HW9A 4N58A 4K3CA 5DL8A 2IWWA 2W80C 4E1SA 1GFMA 3AA0A 3AA6B 1BH3A 4GCSA 4UB8O 3DA3A 3LK2B 4O4XA 3SY9A 4PJ0O 3VE1A 2KC0A 4C00A 3QRAA 3T24A 1P4TA 3EMNX 2J4UP 4C4VB 3AAAA 3POUA 2Y7SA 4LSFA 1HXUA 3AA7A 5DL7A 5GTIO 5GTHO 2M06A 4AZLA 1S5LO 3A0BO 4FQEA 4KR4A 4RL9A 3PQSA 4GF4A 2XE2A 3BS0A 4D5UA 4QQ1A 1THQA 4GHBA 3AAAB 2R8AA 2ERVA 2IWVA 2JQYA 3DA4A 4RLCA 2GE4A 1Q9FA 3AA6A 3SZDA 3VZUX 3UU2A 4D65A 2R4LA 2JMMA 3RBHA 5EE2A 2F1TA 4FT6A 4G75A 3DZMA 4O3ZA 4O49A 4O3XB 4XNKA 3NJTA 4XNLA 1HXTA 1QJ9A 3AA0B 4AKRB 4PR7A 4N75A 3LK3A 4UB6O 1ZHZA 5T5FA 5D5DA 1IZNA 4IL6O 1QJPA 4FZLA 2R88A 5KAFO 4FUVA 2X27X 4AKMA 2LFUA 5DL6A 4LSHA 4Z3TA 1IZNB 4E1TA 2XMXA 3VY9X 1MM5A 3LK42 4AYNA 3BRZA 2KDYA 2KZ7B 2X9KA 1YS5A 1QJ8A 2XE1A 5G3AA 3FYXA 5B66O 2Y0HA 3VY8X 4AFKA 4AYEC 5TISO 2AXTO 1MM4A 1ZHTA 4FRTA 4JCHA 4B61A 2QTKA 5JDPA 4JFBA 1T1LA 3HWBA 4RJWA 7PRNA 3WU2O 5E79O 2WVPA 2Y0KA 3WI5A 3T20A 3AA7B 2ZLDA 3PQUA 4RJXA 4C69X 1T16A 4GCPA 1ZHXA 4AYMC 1OSMA 2WJQA 1HXXA 3AA1A 5KAIO 4N59A 3VZTX 3O0EA 5PRNA 1BT9A 2XG6A 4LSIA 2ODJA 5G38A 2W81C 4FOZA 4FSOA 3SZVA 4C4VA 3HOEA 4FZNA 4FZMA 5H2FO 4KRAA 2M07A 4G76A 2N2MA 3SYSA 4O3WA 5G39A 3SY7A 3KVDD 8PRNA 5FVNA 2Y2XA 4FESA 3AA1B 3UPGA 2K4TA 4K3BA 3DWNA 4AKRA 2F1VA 3POQA 1OPFA 3A2SX 2PRNA 2F1CX 2KXPA 2O4VA 3LK41 2R4PA 3C5OA 3POXA 4GCQA 3HOLA 2MNHA 1E54A 3VZWX 1MPFA 2YPVA 2YNKA 2XTQA 3K19A 3PF1A 4O3YA 2Y0LA 2ZFGA 2PORA 1GFNA 3DWOX 1Q9GA 3JTYA 3KZIO 1PHOA 4U9CA 2XE3A 5ADXL 3G7GA 2J1NA 3BRYA 5GV0A 4AYID 3LK2A 5IYUA 4FMSA 1GFPA 4AUIA 2R4NA 3TZGA 3NSGA 3QRCA 1BXWA 3AAEB 4CTDA 2K0LA 3PGUA 1ZHWA 5ADXK 4O4UA 2FGQX 1GFOA 4F4BA 3JCUO 3PGSA 4D64A 5AFUK 3LK3B 5G26A 6PRNA 3T0SA 5B5EO 4FRXA 2MHLA 1H6S1 2R89A 4AYDC 4KR8A
chains in the Genus database with same CATH topology
2XE5A 2LHFA 2FGRA 3GP6A 2N2LA 4BUMX 1ZHYA 2KZ7A 4RLBA 1G90A 2OMFA 5DL5A 3V8UA 3VE2A 3UAQA 3WI4A 3SYBA 4PUXA 1PRNA 4FSPA 4LSEA 3AAEA 1GFQA 4AZLA 1ORMA 2XTRA 3PORA 3PRNA 4N58A 2KXPB 3HW9A 5DL8A 4AKRA 2W80C 4E1SA 1GFMA 3AA0A 3AA6B 1BH3A 4GCSA 3SY9A 3DA3A 3LK2B 4O4XA 3VE1A 2KC0A 3QRAA 3T24A 1P4TA 3EMNX 2J4UP 3AAAA 3POUA 2Y7SA 4LSFA 1HXUA 3AA7A 5DL7A 2M06A 4KR4A 4RL9A 3PQSA 4GF4A 2XE2A 4D5UA 4QQ1A 1THQA 4GHBA 3AAAB 2ERVA 3DA4A 4RLCA 2GE4A 1Q9FA 3AA6A 3SZDA 3VZUX 3UU2A 4D65A 2JMMA 3RBHA 5EE2A 2F1TA 4FT6A 4G75A 4XNKA 4O3ZA 4O49A 4O3XB 4XNLA 4AKRB 1HXTA 1QJ9A 3AA0B 3LK3A 1ZHZA 5T5FA 5D5DA 1IZNA 1QJPA 4FZLA 4FUVA 2X27X 4AKMA 2LFUA 5DL6A 4LSHA 4Z3TA 1IZNB 4E1TA 2XMXA 3VY9X 1MM5A 3LK42 4AYNA 2KDYA 2KZ7B 1YS5A 1QJ8A 2XE1A 3FYXA 2Y0HA 3VY8X 4AFKA 4AYEC 1MM4A 1ZHTA 4FRTA 4JCHA 4B61A 2QTKA 5JDPA 4JFBA 3HWBA 4RJWA 7PRNA 2Y0KA 3WI5A 3T20A 3AA7B 2ZLDA 3PQUA 4RJXA 4C69X 4GCPA 1ZHXA 4AYMC 1OSMA 3AA1A 1HXXA 4N59A 3VZTX 3O0EA 5PRNA 1BT9A 2XG6A 4LSIA 2ODJA 2W81C 4FOZA 4FSOA 3SZVA 3HOEA 4FZNA 4FZMA 4KRAA 2M07A 4G76A 2N2MA 3SYSA 4O3WA 3SY7A 3KVDD 5FVNA 2Y2XA 4FESA 3AA1B 3UPGA 2K4TA 2F1VA 3POQA 1OPFA 3A2SX 2PRNA 3LK41 2KXPA 2O4VA 4GCQA 8PRNA 3C5OA 3POXA 3HOLA 2MNHA 1E54A 3VZWX 1MPFA 2YPVA 2YNKA 2XTQA 3K19A 4O3YA 2Y0LA 2ZFGA 2PORA 1GFNA 3JTYA 1Q9GA 4U9CA 5AFUL 1PHOA 2XE3A 5ADXL 3G7GA 2J1NA 5GV0A 4AYID 3LK2A 5IYUA 4FMSA 1GFPA 4AUIA 3TZGA 3NSGA 3QRCA 1BXWA 3AAEB 2K0LA 1ZHWA 5ADXK 4O4UA 2FGQX 1GFOA 4F4BA 4D64A 5AFUK 3LK3B 5G26A 6PRNA 3T0SA 4FRXA 2MHLA 1H6S1 4AYDC 4KR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE5 A;  2FGR A;  2OMF A;  5DL5 A;  3WI4 A;  3SYB A;  1PRN A;  4FSP A;  4LSE A;  1GFQ A;  3PRN A;  3POR A;  5DL8 A;  3HW9 A;  1GFM A;  4GCS A;  1BH3 A;  3SY9 A;  3T24 A;  3EMN X;  2J4U P;  3POU A;  4LSF A;  1HXU A;  5DL7 A;  4KR4 A;  2XE2 A;  4D5U A;  4D65 A;  3VZU X;  3SZD A;  3UU2 A;  4FT6 A;  1HXT A;  5DL6 A;  4LSH A;  3VY9 X;  2XE1 A;  3FYX A;  2Y0H A;  3VY8 X;  4FRT A;  2QTK A;  5JDP A;  4JFB A;  3HWB A;  4RJW A;  7PRN A;  2Y0K A;  3WI5 A;  3T20 A;  2ZLD A;  4C69 X;  4RJX A;  4GCP A;  1OSM A;  1HXX A;  3VZT X;  3O0E A;  5PRN A;  1BT9 A;  2XG6 A;  4LSI A;  2ODJ A;  4FSO A;  4FOZ A;  3SZV A;  4KRA A;  3SYS A;  3SY7 A;  5FVN A;  2Y2X A;  3UPG A;  2K4T A;  3POQ A;  1OPF A;  3A2S X;  2PRN A;  4GCQ A;  2O4V A;  8PRN A;  3POX A;  3VZW X;  1E54 A;  1MPF A;  3K19 A;  2Y0L A;  2ZFG A;  2POR A;  1GFN A;  3JTY A;  1PHO A;  2XE3 A;  2J1N A;  4FMS A;  1GFP A;  4AUI A;  3NSG A;  2FGQ X;  1GFO A;  4D64 A;  6PRN A;  3T0S A;  4FRX A;  4BUM X;  1H6S 1;  4KR8 A; 
#chains in the Genus database with same CATH topology
 2XE5 A;  2LHF A;  2FGR A;  3GP6 A;  5AFU L;  2N2L A;  4BUM X;  1ZHY A;  2KZ7 A;  4RLB A;  1G90 A;  2OMF A;  2R4O A;  5DL5 A;  3V8U A;  3VE2 A;  3UAQ A;  3WI4 A;  3PGR A;  4N74 A;  3SYB A;  4PUX A;  1PRN A;  4FSP A;  4LSE A;  3AAE A;  1GFQ A;  2WJR A;  1ORM A;  2XTR A;  3A0H O;  3POR A;  3PRN A;  2KXP B;  3HW9 A;  4N58 A;  4K3C A;  5DL8 A;  2IWW A;  2W80 C;  4E1S A;  1GFM A;  3AA0 A;  3AA6 B;  1BH3 A;  4GCS A;  4UB8 O;  3DA3 A;  3LK2 B;  4O4X A;  3SY9 A;  4PJ0 O;  3VE1 A;  2KC0 A;  4C00 A;  3QRA A;  3T24 A;  1P4T A;  3EMN X;  2J4U P;  4C4V B;  3AAA A;  3POU A;  2Y7S A;  4LSF A;  1HXU A;  3AA7 A;  5DL7 A;  5GTI O;  5GTH O;  2M06 A;  4AZL A;  1S5L O;  3A0B O;  4FQE A;  4KR4 A;  4RL9 A;  3PQS A;  4GF4 A;  2XE2 A;  3BS0 A;  4D5U A;  4QQ1 A;  1THQ A;  4GHB A;  3AAA B;  2R8A A;  2ERV A;  2IWV A;  2JQY A;  3DA4 A;  4RLC A;  2GE4 A;  1Q9F A;  3AA6 A;  3SZD A;  3VZU X;  3UU2 A;  4D65 A;  2R4L A;  2JMM A;  3RBH A;  5EE2 A;  2F1T A;  4FT6 A;  4G75 A;  3DZM A;  4O3Z A;  4O49 A;  4O3X B;  4XNK A;  3NJT A;  4XNL A;  1HXT A;  1QJ9 A;  3AA0 B;  4AKR B;  4PR7 A;  4N75 A;  3LK3 A;  4UB6 O;  1ZHZ A;  5T5F A;  5D5D A;  1IZN A;  4IL6 O;  1QJP A;  4FZL A;  2R88 A;  5KAF O;  4FUV A;  2X27 X;  4AKM A;  2LFU A;  5DL6 A;  4LSH A;  4Z3T A;  1IZN B;  4E1T A;  2XMX A;  3VY9 X;  1MM5 A;  3LK4 2;  4AYN A;  3BRZ A;  2KDY A;  2KZ7 B;  2X9K A;  1YS5 A;  1QJ8 A;  2XE1 A;  5G3A A;  3FYX A;  5B66 O;  2Y0H A;  3VY8 X;  4AFK A;  4AYE C;  5TIS O;  2AXT O;  1MM4 A;  1ZHT A;  4FRT A;  4JCH A;  4B61 A;  2QTK A;  5JDP A;  4JFB A;  1T1L A;  3HWB A;  4RJW A;  7PRN A;  3WU2 O;  5E79 O;  2WVP A;  2Y0K A;  3WI5 A;  3T20 A;  3AA7 B;  2ZLD A;  3PQU A;  4RJX A;  4C69 X;  1T16 A;  4GCP A;  1ZHX A;  4AYM C;  1OSM A;  2WJQ A;  1HXX A;  3AA1 A;  5KAI O;  4N59 A;  3VZT X;  3O0E A;  5PRN A;  1BT9 A;  2XG6 A;  4LSI A;  2ODJ A;  5G38 A;  2W81 C;  4FOZ A;  4FSO A;  3SZV A;  4C4V A;  3HOE A;  4FZN A;  4FZM A;  5H2F O;  4KRA A;  2M07 A;  4G76 A;  2N2M A;  3SYS A;  4O3W A;  5G39 A;  3SY7 A;  3KVD D;  8PRN A;  5FVN A;  2Y2X A;  4FES A;  3AA1 B;  3UPG A;  2K4T A;  4K3B A;  3DWN A;  4AKR A;  2F1V A;  3POQ A;  1OPF A;  3A2S X;  2PRN A;  2F1C X;  2KXP A;  2O4V A;  3LK4 1;  2R4P A;  3C5O A;  3POX A;  4GCQ A;  3HOL A;  2MNH A;  1E54 A;  3VZW X;  1MPF A;  2YPV A;  2YNK A;  2XTQ A;  3K19 A;  3PF1 A;  4O3Y A;  2Y0L A;  2ZFG A;  2POR A;  1GFN A;  3DWO X;  1Q9G A;  3JTY A;  3KZI O;  1PHO A;  4U9C A;  2XE3 A;  5ADX L;  3G7G A;  2J1N A;  3BRY A;  5GV0 A;  4AYI D;  3LK2 A;  5IYU A;  4FMS A;  1GFP A;  4AUI A;  2R4N A;  3TZG A;  3NSG A;  3QRC A;  1BXW A;  3AAE B;  4CTD A;  2K0L A;  3PGU A;  1ZHW A;  5ADX K;  4O4U A;  2FGQ X;  1GFO A;  4F4B A;  3JCU O;  3PGS A;  4D64 A;  5AFU K;  3LK3 B;  5G26 A;  6PRN A;  3T0S A;  5B5E O;  4FRX A;  2MHL A;  1H6S 1;  2R89 A;  4AYD C;  4KR8 A; 
#chains in the Genus database with same CATH homology
 2XE5 A;  2LHF A;  2FGR A;  3GP6 A;  2N2L A;  4BUM X;  1ZHY A;  2KZ7 A;  4RLB A;  1G90 A;  2OMF A;  5DL5 A;  3V8U A;  3VE2 A;  3UAQ A;  3WI4 A;  3SYB A;  4PUX A;  1PRN A;  4FSP A;  4LSE A;  3AAE A;  1GFQ A;  4AZL A;  1ORM A;  2XTR A;  3POR A;  3PRN A;  4N58 A;  2KXP B;  3HW9 A;  5DL8 A;  4AKR A;  2W80 C;  4E1S A;  1GFM A;  3AA0 A;  3AA6 B;  1BH3 A;  4GCS A;  3SY9 A;  3DA3 A;  3LK2 B;  4O4X A;  3VE1 A;  2KC0 A;  3QRA A;  3T24 A;  1P4T A;  3EMN X;  2J4U P;  3AAA A;  3POU A;  2Y7S A;  4LSF A;  1HXU A;  3AA7 A;  5DL7 A;  2M06 A;  4KR4 A;  4RL9 A;  3PQS A;  4GF4 A;  2XE2 A;  4D5U A;  4QQ1 A;  1THQ A;  4GHB A;  3AAA B;  2ERV A;  3DA4 A;  4RLC A;  2GE4 A;  1Q9F A;  3AA6 A;  3SZD A;  3VZU X;  3UU2 A;  4D65 A;  2JMM A;  3RBH A;  5EE2 A;  2F1T A;  4FT6 A;  4G75 A;  4XNK A;  4O3Z A;  4O49 A;  4O3X B;  4XNL A;  4AKR B;  1HXT A;  1QJ9 A;  3AA0 B;  3LK3 A;  1ZHZ A;  5T5F A;  5D5D A;  1IZN A;  1QJP A;  4FZL A;  4FUV A;  2X27 X;  4AKM A;  2LFU A;  5DL6 A;  4LSH A;  4Z3T A;  1IZN B;  4E1T A;  2XMX A;  3VY9 X;  1MM5 A;  3LK4 2;  4AYN A;  2KDY A;  2KZ7 B;  1YS5 A;  1QJ8 A;  2XE1 A;  3FYX A;  2Y0H A;  3VY8 X;  4AFK A;  4AYE C;  1MM4 A;  1ZHT A;  4FRT A;  4JCH A;  4B61 A;  2QTK A;  5JDP A;  4JFB A;  3HWB A;  4RJW A;  7PRN A;  2Y0K A;  3WI5 A;  3T20 A;  3AA7 B;  2ZLD A;  3PQU A;  4RJX A;  4C69 X;  4GCP A;  1ZHX A;  4AYM C;  1OSM A;  3AA1 A;  1HXX A;  4N59 A;  3VZT X;  3O0E A;  5PRN A;  1BT9 A;  2XG6 A;  4LSI A;  2ODJ A;  2W81 C;  4FOZ A;  4FSO A;  3SZV A;  3HOE A;  4FZN A;  4FZM A;  4KRA A;  2M07 A;  4G76 A;  2N2M A;  3SYS A;  4O3W A;  3SY7 A;  3KVD D;  5FVN A;  2Y2X A;  4FES A;  3AA1 B;  3UPG A;  2K4T A;  2F1V A;  3POQ A;  1OPF A;  3A2S X;  2PRN A;  3LK4 1;  2KXP A;  2O4V A;  4GCQ A;  8PRN A;  3C5O A;  3POX A;  3HOL A;  2MNH A;  1E54 A;  3VZW X;  1MPF A;  2YPV A;  2YNK A;  2XTQ A;  3K19 A;  4O3Y A;  2Y0L A;  2ZFG A;  2POR A;  1GFN A;  3JTY A;  1Q9G A;  4U9C A;  5AFU L;  1PHO A;  2XE3 A;  5ADX L;  3G7G A;  2J1N A;  5GV0 A;  4AYI D;  3LK2 A;  5IYU A;  4FMS A;  1GFP A;  4AUI A;  3TZG A;  3NSG A;  3QRC A;  1BXW A;  3AAE B;  2K0L A;  1ZHW A;  5ADX K;  4O4U A;  2FGQ X;  1GFO A;  4F4B A;  4D64 A;  5AFU K;  3LK3 B;  5G26 A;  6PRN A;  3T0S A;  4FRX A;  2MHL A;  1H6S 1;  4AYD C;  4KR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...