1OSMA

Osmoporin (ompk36) from klebsiella pneumoniae
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
342
structure length
342
Chain Sequence
AEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKGKDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional characterization of OmpK36, the osmoporin of Klebsiella pneumoniae.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Outer membrane protein
molecule keywords OMPK36
total genus 84
structure length 342
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1osmA00
3SY9A 2XE1A 3A2SX 3SZVA 3JTYA 4FT6A 3POXA 5JDPA 4RJWA 5PRNA 2Y0HA 2XE5A 4FSPA 3T24A 1E54A 3UU2A 3HWBA 2FGRA 1GFOA 4C69X 3O0EA 3POQA 2PORA 1GFMA 5DL5A 1HXXA 1HXUA 3PRNA 2XE3A 5DL7A 3VY8X 2K4TA 4FOZA 2XG6A 2XE2A 4D64A 1GFQA 4KR4A 3SZDA 3PORA 1MPFA 2ZLDA 3T20A 2FGQX 3FYXA 1BH3A 3VZTX 4AUIA 3T0SA 2J1NA 3VZWX 3EMNX 7PRNA 2OMFA 4LSHA 3SYBA 4JFBA 4BUMX 3WI5A 1OPFA 4D5UA 2QTKA 4GCPA 1OSMA 4FRTA 1PRNA 3VY9X 3SY7A 2Y2XA 1GFNA 4GCQA 3SYSA 5DL6A 1GFPA 3WI4A 2PRNA 1HXTA 4LSFA 3HW9A 4LSIA 3NSGA 3UPGA 8PRNA 1BT9A 4GCSA 3POUA 2ODJA 4KR8A 2ZFGA 3VZUX 2J4UP 1H6S1 3K19A 2Y0KA 1PHOA 5FVNA 2O4VA 4FSOA 4LSEA 5DL8A 4FRXA 6PRNA 4D65A 2Y0LA 4FMSA 4KRAA 4RJXA
chains in the Genus database with same CATH superfamily
5AFUL 4KRAA 1G90A 3AA1B 1YS5A 3SY9A 4PUXA 2XE1A 3A2SX 3SZVA 2N2LA 5G39A 1BXWA 3RBHA 3JTYA 4FT6A 4N74A 3POXA 4QQ1A 4AKRB 4AYID 2R8AA 2F1VA 3G7GA 5JDPA 5GTIO 4RJWA 5PRNA 5B5EO 4C00A 2Y0HA 2XE5A 4FZMA 4PR7A 2XMXA 4RLBA 5G38A 4FSPA 3AA6A 4FQEA 2ERVA 4AKMA 5H2FO 2KC0A 4CTDA 2X27X 2R4LA 3T24A 3JCUO 5IYUA 1E54A 2KZ7A 3UU2A 1ZHZA 3HWBA 2KZ7B 2FGRA 4XNKA 1ORMA 2KXPB 2R88A 1MM4A 1GFOA 5D5DA 2R4PA 4C69X 3AA6B 3O0EA 3POQA 4RLCA 2F1TA 2PORA 4O49A 4AYEC 1GFMA 3AA7B 3PGUA 5DL5A 1HXXA 4UB8O 5GTHO 3BS0A 3AA0B 2K0LA 1HXUA 3PRNA 2XE3A 5AFUK 4FESA 3A0HO 5DL7A 3KZIO 3VY8X 4N58A 4IL6O 2F1CX 2K4TA 2LFUA 4FOZA 2AXTO 2LHFA 2XG6A 3VE1A 2R4OA 2WVPA 3PF1A 2XTQA 4K3BA 2XE2A 1QJ8A 3VE2A 4D64A 4C4VB 5G26A 3GP6A 3HOLA 1GFQA 4KR4A 4O4XA 3PORA 4O3XB 3SZDA 2M06A 4F4BA 5TISO 3TZGA 1MPFA 3HOEA 3WU2O 1MM5A 2MHLA 2ZLDA 2R89A 4N59A 2KDYA 4O3WA 2FGQX 3AAAA 4O4UA 3FYXA 1P4TA 3T20A 2MNHA 3V8UA 1BH3A 4GHBA 4O3ZA 3PGSA 5B66O 2IWWA 4E1TA 3VZTX 4AUIA 2YPVA 3PQUA 3T0SA 2GE4A 3DZMA 2IWVA 3DWNA 2J1NA 2N2MA 3AAEA 3VZWX 4PJ0O 4AFKA 3AAEB 4AKRA 4C4VA 3LK42 3PQSA 1ZHWA 3EMNX 3DA4A 4AYDC 3LK3A 5EE2A 2OMFA 7PRNA 3LK3B 2W81C 3AAAB 4AYMC 3BRYA 2X9KA 4LSHA 3SYBA 1T16A 2XTRA 3KVDD 4AYNA 4JFBA 5T5FA 5GV0A 2JQYA 1T1LA 4BUMX 4FZNA 4O3YA 4RL9A 3WI5A 1OPFA 1ZHYA 4JCHA 1QJPA 4D5UA 2QTKA 4GCPA 1OSMA 3AA0A 4XNLA 5G3AA 4G75A 3LK2A 4FRTA 3UAQA 1PRNA 2M07A 3DA3A 4U9CA 3QRAA 3SY7A 3VY9X 4K3CA 2Y2XA 4E1SA 3DWOX 2KXPA 1GFNA 1IZNA 4GCQA 3A0BO 3SYSA 5DL6A 1S5LO 1GFPA 3PGRA 3QRCA 2PRNA 2R4NA 4GF4A 3WI4A 1HXTA 3NJTA 4LSFA 5E79O 2WJQA 3AA1A 3HW9A 3NSGA 4LSIA 4N75A 5KAFO 1ZHTA 1BT9A 8PRNA 4GCSA 3UPGA 3POUA 2ODJA 5KAIO 3LK41 4KR8A 1ZHXA 2ZFGA 4FUVA 3VZUX 4AZLA 1H6S1 3K19A 2J4UP 1Q9FA 2JMMA 2Y0KA 5ADXK 1PHOA 3AA7A 5FVNA 2O4VA 4FSOA 4LSEA 4FZLA 4FRXA 4UB6O 3LK2B 2W80C 5DL8A 6PRNA 4D65A 2Y0LA 2WJRA 5ADXL 2YNKA 4FMSA 1Q9GA 4G76A 4B61A 4Z3TA 1IZNB 3BRZA 3C5OA 1THQA 1QJ9A 4RJXA 2Y7SA
chains in the Genus database with same CATH topology
5AFUL 4KRAA 1G90A 3AA1B 1YS5A 3SY9A 4PUXA 2XE1A 3A2SX 3SZVA 2N2LA 3RBHA 1BXWA 3JTYA 4FT6A 3POXA 4QQ1A 4AKRB 4AYID 2F1VA 3G7GA 5JDPA 4RJWA 5PRNA 2Y0HA 2XE5A 4FZMA 2XMXA 4RLBA 4FSPA 3AA6A 2ERVA 4AKMA 2KC0A 2X27X 3T24A 5IYUA 1E54A 2KZ7A 3UU2A 1ZHZA 3HWBA 2KZ7B 2FGRA 4XNKA 1ORMA 2KXPB 1MM4A 1GFOA 5D5DA 4C69X 3AA6B 3O0EA 3POQA 4RLCA 2F1TA 2PORA 4O49A 4AYEC 1GFMA 3AA7B 5DL5A 1HXXA 3AA0B 2K0LA 1HXUA 3PRNA 2XE3A 5AFUK 4FESA 5DL7A 3VY8X 4N58A 2K4TA 2LFUA 4FOZA 2LHFA 2XG6A 3VE1A 2XTQA 2XE2A 1QJ8A 3VE2A 4D64A 5G26A 3GP6A 3HOLA 1GFQA 4KR4A 4O4XA 3PORA 4O3XB 3SZDA 2M06A 4F4BA 3TZGA 1MPFA 3HOEA 4AKRA 1MM5A 2MHLA 2ZLDA 4N59A 4O3WA 2KDYA 4XNLA 2FGQX 3AAAA 4O4UA 3FYXA 1P4TA 3T20A 2MNHA 3V8UA 1BH3A 4GHBA 4O3ZA 4E1TA 3VZTX 4AUIA 2YPVA 3PQUA 3T0SA 2GE4A 2J1NA 2N2MA 3AAEA 3VZWX 4AFKA 3AAEB 3LK42 3PQSA 1ZHWA 3EMNX 3DA4A 4AYDC 3LK3A 5EE2A 2OMFA 7PRNA 3LK3B 2W81C 3AAAB 4AYMC 4LSHA 4AYNA 3SYBA 2XTRA 3KVDD 4JFBA 5T5FA 5GV0A 4BUMX 4FZNA 4O3YA 4RL9A 3WI5A 1OPFA 1ZHYA 4JCHA 1QJPA 4D5UA 2QTKA 4GCPA 1OSMA 3AA0A 4G75A 3LK2A 4FRTA 3UAQA 1PRNA 2M07A 3DA3A 4U9CA 3QRAA 3SY7A 3VY9X 4E1SA 2Y2XA 2KXPA 1GFNA 1IZNA 4GCQA 3SYSA 5DL6A 3QRCA 1GFPA 4GF4A 3WI4A 2PRNA 1HXTA 4LSFA 3HW9A 3AA1A 3NSGA 4LSIA 3UPGA 8PRNA 1ZHTA 1BT9A 4GCSA 3POUA 2ODJA 3LK41 4KR8A 1ZHXA 2ZFGA 4FUVA 3VZUX 4AZLA 1H6S1 3K19A 2J4UP 1Q9FA 2JMMA 2Y0KA 5ADXK 1PHOA 3AA7A 5FVNA 2O4VA 4FSOA 4LSEA 4FZLA 4FRXA 5DL8A 3LK2B 2W80C 6PRNA 4D65A 2Y0LA 5ADXL 2YNKA 4FMSA 1Q9GA 4G76A 4B61A 4Z3TA 1IZNB 3C5OA 1THQA 1QJ9A 4RJXA 2Y7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY9 A;  2XE1 A;  3A2S X;  3SZV A;  3JTY A;  4FT6 A;  3POX A;  5JDP A;  4RJW A;  5PRN A;  2Y0H A;  2XE5 A;  4FSP A;  3T24 A;  1E54 A;  3UU2 A;  3HWB A;  2FGR A;  1GFO A;  4C69 X;  3O0E A;  3POQ A;  2POR A;  1GFM A;  5DL5 A;  1HXX A;  1HXU A;  3PRN A;  2XE3 A;  5DL7 A;  3VY8 X;  2K4T A;  4FOZ A;  2XG6 A;  2XE2 A;  4D64 A;  1GFQ A;  4KR4 A;  3SZD A;  3POR A;  1MPF A;  2ZLD A;  3T20 A;  2FGQ X;  3FYX A;  1BH3 A;  3VZT X;  4AUI A;  3T0S A;  2J1N A;  3VZW X;  3EMN X;  7PRN A;  2OMF A;  4LSH A;  3SYB A;  4JFB A;  4BUM X;  3WI5 A;  1OPF A;  4D5U A;  2QTK A;  4GCP A;  1OSM A;  4FRT A;  1PRN A;  3VY9 X;  3SY7 A;  2Y2X A;  1GFN A;  4GCQ A;  3SYS A;  5DL6 A;  1GFP A;  3WI4 A;  2PRN A;  1HXT A;  4LSF A;  3HW9 A;  4LSI A;  3NSG A;  3UPG A;  8PRN A;  1BT9 A;  4GCS A;  3POU A;  2ODJ A;  4KR8 A;  2ZFG A;  3VZU X;  2J4U P;  1H6S 1;  3K19 A;  2Y0K A;  1PHO A;  5FVN A;  2O4V A;  4FSO A;  4LSE A;  5DL8 A;  4FRX A;  6PRN A;  4D65 A;  2Y0L A;  4FMS A;  4KRA A;  4RJX A; 
#chains in the Genus database with same CATH topology
 5AFU L;  4KRA A;  1G90 A;  3AA1 B;  1YS5 A;  3SY9 A;  4PUX A;  2XE1 A;  3A2S X;  3SZV A;  2N2L A;  5G39 A;  1BXW A;  3RBH A;  3JTY A;  4FT6 A;  4N74 A;  3POX A;  4QQ1 A;  4AKR B;  4AYI D;  2R8A A;  2F1V A;  3G7G A;  5JDP A;  5GTI O;  4RJW A;  5PRN A;  5B5E O;  4C00 A;  2Y0H A;  2XE5 A;  4FZM A;  4PR7 A;  2XMX A;  4RLB A;  5G38 A;  4FSP A;  3AA6 A;  4FQE A;  2ERV A;  4AKM A;  5H2F O;  2KC0 A;  4CTD A;  2X27 X;  2R4L A;  3T24 A;  3JCU O;  5IYU A;  1E54 A;  2KZ7 A;  3UU2 A;  1ZHZ A;  3HWB A;  2KZ7 B;  2FGR A;  4XNK A;  1ORM A;  2KXP B;  2R88 A;  1MM4 A;  1GFO A;  5D5D A;  2R4P A;  4C69 X;  3AA6 B;  3O0E A;  3POQ A;  4RLC A;  2F1T A;  2POR A;  4O49 A;  4AYE C;  1GFM A;  3AA7 B;  3PGU A;  5DL5 A;  1HXX A;  4UB8 O;  5GTH O;  3BS0 A;  3AA0 B;  2K0L A;  1HXU A;  3PRN A;  2XE3 A;  5AFU K;  4FES A;  3A0H O;  5DL7 A;  3KZI O;  3VY8 X;  4N58 A;  4IL6 O;  2F1C X;  2K4T A;  2LFU A;  4FOZ A;  2AXT O;  2LHF A;  2XG6 A;  3VE1 A;  2R4O A;  2WVP A;  3PF1 A;  2XTQ A;  4K3B A;  2XE2 A;  1QJ8 A;  3VE2 A;  4D64 A;  4C4V B;  5G26 A;  3GP6 A;  3HOL A;  1GFQ A;  4KR4 A;  4O4X A;  3POR A;  4O3X B;  3SZD A;  2M06 A;  4F4B A;  5TIS O;  3TZG A;  1MPF A;  3HOE A;  3WU2 O;  1MM5 A;  2MHL A;  2ZLD A;  2R89 A;  4N59 A;  2KDY A;  4O3W A;  2FGQ X;  3AAA A;  4O4U A;  3FYX A;  1P4T A;  3T20 A;  2MNH A;  3V8U A;  1BH3 A;  4GHB A;  4O3Z A;  3PGS A;  5B66 O;  2IWW A;  4E1T A;  3VZT X;  4AUI A;  2YPV A;  3PQU A;  3T0S A;  2GE4 A;  3DZM A;  2IWV A;  3DWN A;  2J1N A;  2N2M A;  3AAE A;  3VZW X;  4PJ0 O;  4AFK A;  3AAE B;  4AKR A;  4C4V A;  3LK4 2;  3PQS A;  1ZHW A;  3EMN X;  3DA4 A;  4AYD C;  3LK3 A;  5EE2 A;  2OMF A;  7PRN A;  3LK3 B;  2W81 C;  3AAA B;  4AYM C;  3BRY A;  2X9K A;  4LSH A;  3SYB A;  1T16 A;  2XTR A;  3KVD D;  4AYN A;  4JFB A;  5T5F A;  5GV0 A;  2JQY A;  1T1L A;  4BUM X;  4FZN A;  4O3Y A;  4RL9 A;  3WI5 A;  1OPF A;  1ZHY A;  4JCH A;  1QJP A;  4D5U A;  2QTK A;  4GCP A;  1OSM A;  3AA0 A;  4XNL A;  5G3A A;  4G75 A;  3LK2 A;  4FRT A;  3UAQ A;  1PRN A;  2M07 A;  3DA3 A;  4U9C A;  3QRA A;  3SY7 A;  3VY9 X;  4K3C A;  2Y2X A;  4E1S A;  3DWO X;  2KXP A;  1GFN A;  1IZN A;  4GCQ A;  3A0B O;  3SYS A;  5DL6 A;  1S5L O;  1GFP A;  3PGR A;  3QRC A;  2PRN A;  2R4N A;  4GF4 A;  3WI4 A;  1HXT A;  3NJT A;  4LSF A;  5E79 O;  2WJQ A;  3AA1 A;  3HW9 A;  3NSG A;  4LSI A;  4N75 A;  5KAF O;  1ZHT A;  1BT9 A;  8PRN A;  4GCS A;  3UPG A;  3POU A;  2ODJ A;  5KAI O;  3LK4 1;  4KR8 A;  1ZHX A;  2ZFG A;  4FUV A;  3VZU X;  4AZL A;  1H6S 1;  3K19 A;  2J4U P;  1Q9F A;  2JMM A;  2Y0K A;  5ADX K;  1PHO A;  3AA7 A;  5FVN A;  2O4V A;  4FSO A;  4LSE A;  4FZL A;  4FRX A;  4UB6 O;  3LK2 B;  2W80 C;  5DL8 A;  6PRN A;  4D65 A;  2Y0L A;  2WJR A;  5ADX L;  2YNK A;  4FMS A;  1Q9G A;  4G76 A;  4B61 A;  4Z3T A;  1IZN B;  3BRZ A;  3C5O A;  1THQ A;  1QJ9 A;  4RJX A;  2Y7S A; 
#chains in the Genus database with same CATH homology
 5AFU L;  4KRA A;  1G90 A;  3AA1 B;  1YS5 A;  3SY9 A;  4PUX A;  2XE1 A;  3A2S X;  3SZV A;  2N2L A;  3RBH A;  1BXW A;  3JTY A;  4FT6 A;  3POX A;  4QQ1 A;  4AKR B;  4AYI D;  2F1V A;  3G7G A;  5JDP A;  4RJW A;  5PRN A;  2Y0H A;  2XE5 A;  4FZM A;  2XMX A;  4RLB A;  4FSP A;  3AA6 A;  2ERV A;  4AKM A;  2KC0 A;  2X27 X;  3T24 A;  5IYU A;  1E54 A;  2KZ7 A;  3UU2 A;  1ZHZ A;  3HWB A;  2KZ7 B;  2FGR A;  4XNK A;  1ORM A;  2KXP B;  1MM4 A;  1GFO A;  5D5D A;  4C69 X;  3AA6 B;  3O0E A;  3POQ A;  4RLC A;  2F1T A;  2POR A;  4O49 A;  4AYE C;  1GFM A;  3AA7 B;  5DL5 A;  1HXX A;  3AA0 B;  2K0L A;  1HXU A;  3PRN A;  2XE3 A;  5AFU K;  4FES A;  5DL7 A;  3VY8 X;  4N58 A;  2K4T A;  2LFU A;  4FOZ A;  2LHF A;  2XG6 A;  3VE1 A;  2XTQ A;  2XE2 A;  1QJ8 A;  3VE2 A;  4D64 A;  5G26 A;  3GP6 A;  3HOL A;  1GFQ A;  4KR4 A;  4O4X A;  3POR A;  4O3X B;  3SZD A;  2M06 A;  4F4B A;  3TZG A;  1MPF A;  3HOE A;  4AKR A;  1MM5 A;  2MHL A;  2ZLD A;  4N59 A;  4O3W A;  2KDY A;  4XNL A;  2FGQ X;  3AAA A;  4O4U A;  3FYX A;  1P4T A;  3T20 A;  2MNH A;  3V8U A;  1BH3 A;  4GHB A;  4O3Z A;  4E1T A;  3VZT X;  4AUI A;  2YPV A;  3PQU A;  3T0S A;  2GE4 A;  2J1N A;  2N2M A;  3AAE A;  3VZW X;  4AFK A;  3AAE B;  3LK4 2;  3PQS A;  1ZHW A;  3EMN X;  3DA4 A;  4AYD C;  3LK3 A;  5EE2 A;  2OMF A;  7PRN A;  3LK3 B;  2W81 C;  3AAA B;  4AYM C;  4LSH A;  4AYN A;  3SYB A;  2XTR A;  3KVD D;  4JFB A;  5T5F A;  5GV0 A;  4BUM X;  4FZN A;  4O3Y A;  4RL9 A;  3WI5 A;  1OPF A;  1ZHY A;  4JCH A;  1QJP A;  4D5U A;  2QTK A;  4GCP A;  1OSM A;  3AA0 A;  4G75 A;  3LK2 A;  4FRT A;  3UAQ A;  1PRN A;  2M07 A;  3DA3 A;  4U9C A;  3QRA A;  3SY7 A;  3VY9 X;  4E1S A;  2Y2X A;  2KXP A;  1GFN A;  1IZN A;  4GCQ A;  3SYS A;  5DL6 A;  3QRC A;  1GFP A;  4GF4 A;  3WI4 A;  2PRN A;  1HXT A;  4LSF A;  3HW9 A;  3AA1 A;  3NSG A;  4LSI A;  3UPG A;  8PRN A;  1ZHT A;  1BT9 A;  4GCS A;  3POU A;  2ODJ A;  3LK4 1;  4KR8 A;  1ZHX A;  2ZFG A;  4FUV A;  3VZU X;  4AZL A;  1H6S 1;  3K19 A;  2J4U P;  1Q9F A;  2JMM A;  2Y0K A;  5ADX K;  1PHO A;  3AA7 A;  5FVN A;  2O4V A;  4FSO A;  4LSE A;  4FZL A;  4FRX A;  5DL8 A;  3LK2 B;  2W80 C;  6PRN A;  4D65 A;  2Y0L A;  5ADX L;  2YNK A;  4FMS A;  1Q9G A;  4G76 A;  4B61 A;  4Z3T A;  1IZN B;  3C5O A;  1THQ A;  1QJ9 A;  4RJX A;  2Y7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...