1OSMA

Osmoporin (ompk36) from klebsiella pneumoniae
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
342
structure length
342
Chain Sequence
AEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKGKDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OMPK36
publication title Crystal structure and functional characterization of OmpK36, the osmoporin of Klebsiella pneumoniae.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Outer membrane protein
total genus 84
structure length 342
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1osmA00
2ZFGA 1BH3A 4AUIA 4RJXA 1BT9A 4KRAA 1GFQA 2XE3A 4LSHA 2XE2A 2OMFA 2O4VA 2PORA 4FRTA 2FGRA 2J1NA 8PRNA 6PRNA 2J4UP 3WI5A 2Y0LA 3T20A 5DL7A 3T24A 1HXUA 2XG6A 4FOZA 3SY9A 1OPFA 4FRXA 3VZTX 1H6S1 3SZDA 3WI4A 3FYXA 1GFPA 4FSOA 1PRNA 3VY8X 2ODJA 3JTYA 1GFMA 2FGQX 4FSPA 4GCPA 3HW9A 3A2SX 3PRNA 3SZVA 4GCQA 4LSFA 4LSEA 3VZUX 1HXTA 3VY9X 3SYBA 4FMSA 3POXA 1GFOA 3POUA 3PORA 4KR4A 4C69X 1E54A 3K19A 2Y0KA 5FVNA 1MPFA 2QTKA 3HWBA 3O0EA 5DL8A 4KR8A 4GCSA 1HXXA 1GFNA 5JDPA 5DL5A 3NSGA 2PRNA 2Y2XA 2Y0HA 4D5UA 2K4TA 5PRNA 5DL6A 7PRNA 3UPGA 4LSIA 4RJWA 2XE1A 4JFBA 3UU2A 4D65A 2ZLDA 4D64A 1PHOA 3T0SA 2XE5A 3SYSA 1OSMA 4FT6A 4BUMX 3POQA 3SY7A 3VZWX 3EMNX
chains in the Genus database with same CATH superfamily
2R88A 1BH3A 2R89A 2ZFGA 4AUIA 2MHLA 3AAEA 1BT9A 4RJXA 2JMMA 4KRAA 4QQ1A 5G3AA 1GFQA 5D5DA 1QJ9A 2XE3A 3C5OA 4PUXA 1MM5A 3QRAA 5EE2A 2XTRA 3DA4A 2R8AA 3DWNA 4LSHA 4K3CA 2XE2A 4AYDC 1ZHTA 3A0HO 4FZMA 3UAQA 4FZNA 4O3ZA 2OMFA 5G39A 1THQA 3AA1A 1T16A 2GE4A 5G26A 5T5FA 4IL6O 2O4VA 5E79O 2PORA 4G75A 2F1VA 4FRTA 3AAEB 2FGRA 3AA6B 4Z3TA 2LFUA 1BXWA 2J1NA 2KZ7A 2Y7SA 3AA0B 3LK3A 6PRNA 8PRNA 2J4UP 3LK41 3WI5A 1T1LA 2KXPB 2WJRA 2Y0LA 3KZIO 3WU2O 5GTHO 2R4LA 3T20A 5DL7A 3T24A 1HXUA 4E1TA 2XG6A 2WJQA 4FOZA 2ERVA 4N58A 1Q9GA 3AA1B 4FESA 4O3WA 3SY9A 4C4VA 5AFUK 4AFKA 1OPFA 2LHFA 3PF1A 1ZHWA 2IWVA 2R4PA 4FRXA 4C00A 5AFUL 4F4BA 3VZTX 1QJ8A 1H6S1 2KZ7B 2KC0A 3BRYA 1ORMA 2F1CX 3LK3B 3PGSA 4XNLA 3SZDA 3WI4A 3FYXA 1GFPA 3HOEA 5H2FO 1G90A 2F1TA 4FSOA 4FUVA 1MM4A 1QJPA 1PRNA 3VY8X 3KVDD 4E1SA 2ODJA 3JTYA 1GFMA 3PQUA 4GHBA 2FGQX 4FSPA 4GCPA 2IWWA 2XTQA 4FZLA 2R4NA 2X9KA 3HW9A 3A2SX 2YPVA 3PRNA 3PGRA 4XNKA 4AKMA 1ZHYA 4N74A 3SZVA 4AZLA 3AA7A 3QRCA 4GCQA 4LSFA 1ZHXA 4LSEA 3VZUX 3DWOX 1HXTA 3HOLA 3VY9X 3BS0A 4PR7A 4FMSA 3SYBA 4AYEC 3LK2A 4U9CA 5B5EO 4PJ0O 3POXA 1GFOA 3BRZA 3POUA 3PORA 4RLCA 2KDYA 2W81C 4KR4A 2WVPA 4RLBA 5GV0A 2K0LA 3AAAA 3AA7B 2M06A 5KAIO 4C69X 4GF4A 2YNKA 2W80C 5G38A 1E54A 4AKRA 3K19A 4O3XB 2N2MA 2Y0KA 3NJTA 3PQSA 4O3YA 5FVNA 3PGUA 3VE1A 2N2LA 1MPFA 2QTKA 3HWBA 3O0EA 4K3BA 4C4VB 4O4UA 3TZGA 3G7GA 5DL8A 5B66O 4KR8A 3GP6A 4GCSA 4AYNA 5TISO 1HXXA 5ADXK 1GFNA 5JDPA 5DL5A 4AYMC 2AXTO 3JCUO 5ADXL 3NSGA 3DA3A 2PRNA 2Y2XA 2Y0HA 4O4XA 1YS5A 4D5UA 5IYUA 3AA6A 4B61A 3AA0A 4O49A 4AYID 2K4TA 4RL9A 4AKRB 2KXPA 5PRNA 1P4TA 1Q9FA 5KAFO 2M07A 5DL6A 7PRNA 3V8UA 1IZNA 4G76A 3UPGA 4LSIA 2MNHA 2X27X 4RJWA 2JQYA 3LK42 1ZHZA 2XE1A 1S5LO 4JFBA 3DZMA 3UU2A 4FQEA 3VE2A 4CTDA 4UB6O 4D65A 2ZLDA 4N59A 5GTIO 4D64A 1PHOA 3T0SA 2XE5A 3SYSA 1OSMA 3LK2B 2R4OA 4UB8O 4FT6A 3A0BO 3RBHA 4BUMX 3POQA 2XMXA 3SY7A 4JCHA 1IZNB 3VZWX 4N75A 3EMNX 3AAAB
chains in the Genus database with same CATH topology
2ZFGA 1BH3A 4AUIA 2MHLA 3AAEA 1BT9A 4RJXA 2JMMA 4KRAA 4QQ1A 1GFQA 5D5DA 1QJ9A 2XE3A 3C5OA 4PUXA 1MM5A 3QRAA 5EE2A 2XTRA 3DA4A 4LSHA 2XE2A 4AYDC 1ZHTA 4FZMA 3UAQA 4FZNA 4O3ZA 2OMFA 1THQA 3AA1A 2GE4A 5G26A 5T5FA 2O4VA 2PORA 4G75A 2F1VA 4FRTA 3AAEB 2FGRA 3AA6B 4Z3TA 2LFUA 1BXWA 2J1NA 2KZ7A 2Y7SA 3AA0B 3LK3A 6PRNA 8PRNA 2J4UP 3LK41 3WI5A 2KXPB 2Y0LA 3T20A 5DL7A 3T24A 1HXUA 4E1TA 2XG6A 4FOZA 2ERVA 4N58A 1Q9GA 3AA1B 4FESA 4O3WA 3SY9A 5AFUK 1OPFA 2LHFA 1ZHWA 4FRXA 5AFUL 4F4BA 3VZTX 1QJ8A 1H6S1 2KZ7B 2KC0A 3LK3B 1ORMA 3SZDA 4XNLA 3WI4A 4AFKA 1G90A 3FYXA 1GFPA 3HOEA 2F1TA 4FSOA 4FUVA 1MM4A 1QJPA 1PRNA 3VY8X 3KVDD 4E1SA 2ODJA 3JTYA 1GFMA 3PQUA 4GHBA 2FGQX 4FSPA 4GCPA 2XTQA 4FZLA 3HW9A 3A2SX 2YPVA 3PRNA 4XNKA 4AKMA 1ZHYA 3SZVA 4AZLA 3AA7A 3QRCA 4GCQA 4LSFA 1ZHXA 4LSEA 3VZUX 3HOLA 1HXTA 3VY9X 3SYBA 4FMSA 4AYEC 3LK2A 4U9CA 3POXA 1GFOA 3POUA 3PORA 4RLCA 2KDYA 2W81C 4KR4A 4RLBA 5GV0A 2K0LA 3AAAA 3AA7B 2M06A 4C69X 4GF4A 2YNKA 2W80C 1E54A 4AKRA 3K19A 4O3XB 2N2MA 2Y0KA 3PQSA 4O3YA 5FVNA 3VE1A 2N2LA 1MPFA 2QTKA 3HWBA 3O0EA 4O4UA 3TZGA 3G7GA 5DL8A 4KR8A 3GP6A 4GCSA 4AYNA 5ADXK 1HXXA 1GFNA 5JDPA 5DL5A 4AYMC 5ADXL 3NSGA 3DA3A 2PRNA 2Y2XA 2Y0HA 4O4XA 1YS5A 4D5UA 5IYUA 3AA6A 4B61A 3AA0A 4O49A 4AYID 2K4TA 4RL9A 4AKRB 2KXPA 5PRNA 1P4TA 1Q9FA 2M07A 5DL6A 7PRNA 3V8UA 1IZNA 4G76A 3UPGA 4LSIA 2MNHA 2X27X 4RJWA 3LK42 1ZHZA 2XE1A 4JFBA 3UU2A 3VE2A 4D65A 2ZLDA 4N59A 4D64A 1PHOA 3T0SA 2XE5A 3SYSA 1OSMA 3LK2B 4FT6A 4BUMX 3RBHA 3POQA 2XMXA 3SY7A 4JCHA 1IZNB 3VZWX 3EMNX 3AAAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFG A;  1BH3 A;  4AUI A;  4RJX A;  1BT9 A;  4KRA A;  1GFQ A;  2XE3 A;  4LSH A;  2XE2 A;  2OMF A;  2O4V A;  2POR A;  4FRT A;  2FGR A;  2J1N A;  8PRN A;  6PRN A;  2J4U P;  3WI5 A;  2Y0L A;  3T20 A;  5DL7 A;  3T24 A;  1HXU A;  2XG6 A;  4FOZ A;  3SY9 A;  1OPF A;  4FRX A;  3VZT X;  1H6S 1;  3SZD A;  3WI4 A;  3FYX A;  1GFP A;  4FSO A;  1PRN A;  3VY8 X;  2ODJ A;  3JTY A;  1GFM A;  2FGQ X;  4FSP A;  4GCP A;  3HW9 A;  3A2S X;  3PRN A;  3SZV A;  4GCQ A;  4LSF A;  4LSE A;  3VZU X;  1HXT A;  3VY9 X;  3SYB A;  4FMS A;  3POX A;  1GFO A;  3POU A;  3POR A;  4KR4 A;  4C69 X;  1E54 A;  3K19 A;  2Y0K A;  5FVN A;  1MPF A;  2QTK A;  3HWB A;  3O0E A;  5DL8 A;  4KR8 A;  4GCS A;  1HXX A;  1GFN A;  5JDP A;  5DL5 A;  3NSG A;  2PRN A;  2Y2X A;  2Y0H A;  4D5U A;  2K4T A;  5PRN A;  5DL6 A;  7PRN A;  3UPG A;  4LSI A;  4RJW A;  2XE1 A;  4JFB A;  3UU2 A;  4D65 A;  2ZLD A;  4D64 A;  1PHO A;  3T0S A;  2XE5 A;  3SYS A;  1OSM A;  4FT6 A;  4BUM X;  3POQ A;  3SY7 A;  3VZW X;  3EMN X; 
#chains in the Genus database with same CATH topology
 2R88 A;  1BH3 A;  2R89 A;  2ZFG A;  4AUI A;  2MHL A;  3AAE A;  1BT9 A;  4RJX A;  2JMM A;  4KRA A;  4QQ1 A;  5G3A A;  1GFQ A;  5D5D A;  1QJ9 A;  2XE3 A;  3C5O A;  4PUX A;  1MM5 A;  3QRA A;  5EE2 A;  2XTR A;  3DA4 A;  2R8A A;  3DWN A;  4LSH A;  4K3C A;  2XE2 A;  4AYD C;  1ZHT A;  3A0H O;  4FZM A;  3UAQ A;  4FZN A;  4O3Z A;  2OMF A;  5G39 A;  1THQ A;  3AA1 A;  1T16 A;  2GE4 A;  5G26 A;  5T5F A;  4IL6 O;  2O4V A;  5E79 O;  2POR A;  4G75 A;  2F1V A;  4FRT A;  3AAE B;  2FGR A;  3AA6 B;  4Z3T A;  2LFU A;  1BXW A;  2J1N A;  2KZ7 A;  2Y7S A;  3AA0 B;  3LK3 A;  6PRN A;  8PRN A;  2J4U P;  3LK4 1;  3WI5 A;  1T1L A;  2KXP B;  2WJR A;  2Y0L A;  3KZI O;  3WU2 O;  5GTH O;  2R4L A;  3T20 A;  5DL7 A;  3T24 A;  1HXU A;  4E1T A;  2XG6 A;  2WJQ A;  4FOZ A;  2ERV A;  4N58 A;  1Q9G A;  3AA1 B;  4FES A;  4O3W A;  3SY9 A;  4C4V A;  5AFU K;  4AFK A;  1OPF A;  2LHF A;  3PF1 A;  1ZHW A;  2IWV A;  2R4P A;  4FRX A;  4C00 A;  5AFU L;  4F4B A;  3VZT X;  1QJ8 A;  1H6S 1;  2KZ7 B;  2KC0 A;  3BRY A;  1ORM A;  2F1C X;  3LK3 B;  3PGS A;  4XNL A;  3SZD A;  3WI4 A;  3FYX A;  1GFP A;  3HOE A;  5H2F O;  1G90 A;  2F1T A;  4FSO A;  4FUV A;  1MM4 A;  1QJP A;  1PRN A;  3VY8 X;  3KVD D;  4E1S A;  2ODJ A;  3JTY A;  1GFM A;  3PQU A;  4GHB A;  2FGQ X;  4FSP A;  4GCP A;  2IWW A;  2XTQ A;  4FZL A;  2R4N A;  2X9K A;  3HW9 A;  3A2S X;  2YPV A;  3PRN A;  3PGR A;  4XNK A;  4AKM A;  1ZHY A;  4N74 A;  3SZV A;  4AZL A;  3AA7 A;  3QRC A;  4GCQ A;  4LSF A;  1ZHX A;  4LSE A;  3VZU X;  3DWO X;  1HXT A;  3HOL A;  3VY9 X;  3BS0 A;  4PR7 A;  4FMS A;  3SYB A;  4AYE C;  3LK2 A;  4U9C A;  5B5E O;  4PJ0 O;  3POX A;  1GFO A;  3BRZ A;  3POU A;  3POR A;  4RLC A;  2KDY A;  2W81 C;  4KR4 A;  2WVP A;  4RLB A;  5GV0 A;  2K0L A;  3AAA A;  3AA7 B;  2M06 A;  5KAI O;  4C69 X;  4GF4 A;  2YNK A;  2W80 C;  5G38 A;  1E54 A;  4AKR A;  3K19 A;  4O3X B;  2N2M A;  2Y0K A;  3NJT A;  3PQS A;  4O3Y A;  5FVN A;  3PGU A;  3VE1 A;  2N2L A;  1MPF A;  2QTK A;  3HWB A;  3O0E A;  4K3B A;  4C4V B;  4O4U A;  3TZG A;  3G7G A;  5DL8 A;  5B66 O;  4KR8 A;  3GP6 A;  4GCS A;  4AYN A;  5TIS O;  1HXX A;  5ADX K;  1GFN A;  5JDP A;  5DL5 A;  4AYM C;  2AXT O;  3JCU O;  5ADX L;  3NSG A;  3DA3 A;  2PRN A;  2Y2X A;  2Y0H A;  4O4X A;  1YS5 A;  4D5U A;  5IYU A;  3AA6 A;  4B61 A;  3AA0 A;  4O49 A;  4AYI D;  2K4T A;  4RL9 A;  4AKR B;  2KXP A;  5PRN A;  1P4T A;  1Q9F A;  5KAF O;  2M07 A;  5DL6 A;  7PRN A;  3V8U A;  1IZN A;  4G76 A;  3UPG A;  4LSI A;  2MNH A;  2X27 X;  4RJW A;  2JQY A;  3LK4 2;  1ZHZ A;  2XE1 A;  1S5L O;  4JFB A;  3DZM A;  3UU2 A;  4FQE A;  3VE2 A;  4CTD A;  4UB6 O;  4D65 A;  2ZLD A;  4N59 A;  5GTI O;  4D64 A;  1PHO A;  3T0S A;  2XE5 A;  3SYS A;  1OSM A;  3LK2 B;  2R4O A;  4UB8 O;  4FT6 A;  3A0B O;  3RBH A;  4BUM X;  3POQ A;  2XMX A;  3SY7 A;  4JCH A;  1IZN B;  3VZW X;  4N75 A;  3EMN X;  3AAA B; 
#chains in the Genus database with same CATH homology
 2ZFG A;  1BH3 A;  4AUI A;  2MHL A;  3AAE A;  1BT9 A;  4RJX A;  2JMM A;  4KRA A;  4QQ1 A;  1GFQ A;  5D5D A;  1QJ9 A;  2XE3 A;  3C5O A;  4PUX A;  1MM5 A;  3QRA A;  5EE2 A;  2XTR A;  3DA4 A;  4LSH A;  2XE2 A;  4AYD C;  1ZHT A;  4FZM A;  3UAQ A;  4FZN A;  4O3Z A;  2OMF A;  1THQ A;  3AA1 A;  2GE4 A;  5G26 A;  5T5F A;  2O4V A;  2POR A;  4G75 A;  2F1V A;  4FRT A;  3AAE B;  2FGR A;  3AA6 B;  4Z3T A;  2LFU A;  1BXW A;  2J1N A;  2KZ7 A;  2Y7S A;  3AA0 B;  3LK3 A;  6PRN A;  8PRN A;  2J4U P;  3LK4 1;  3WI5 A;  2KXP B;  2Y0L A;  3T20 A;  5DL7 A;  3T24 A;  1HXU A;  4E1T A;  2XG6 A;  4FOZ A;  2ERV A;  4N58 A;  1Q9G A;  3AA1 B;  4FES A;  4O3W A;  3SY9 A;  5AFU K;  1OPF A;  2LHF A;  1ZHW A;  4FRX A;  5AFU L;  4F4B A;  3VZT X;  1QJ8 A;  1H6S 1;  2KZ7 B;  2KC0 A;  3LK3 B;  1ORM A;  3SZD A;  4XNL A;  3WI4 A;  4AFK A;  1G90 A;  3FYX A;  1GFP A;  3HOE A;  2F1T A;  4FSO A;  4FUV A;  1MM4 A;  1QJP A;  1PRN A;  3VY8 X;  3KVD D;  4E1S A;  2ODJ A;  3JTY A;  1GFM A;  3PQU A;  4GHB A;  2FGQ X;  4FSP A;  4GCP A;  2XTQ A;  4FZL A;  3HW9 A;  3A2S X;  2YPV A;  3PRN A;  4XNK A;  4AKM A;  1ZHY A;  3SZV A;  4AZL A;  3AA7 A;  3QRC A;  4GCQ A;  4LSF A;  1ZHX A;  4LSE A;  3VZU X;  3HOL A;  1HXT A;  3VY9 X;  3SYB A;  4FMS A;  4AYE C;  3LK2 A;  4U9C A;  3POX A;  1GFO A;  3POU A;  3POR A;  4RLC A;  2KDY A;  2W81 C;  4KR4 A;  4RLB A;  5GV0 A;  2K0L A;  3AAA A;  3AA7 B;  2M06 A;  4C69 X;  4GF4 A;  2YNK A;  2W80 C;  1E54 A;  4AKR A;  3K19 A;  4O3X B;  2N2M A;  2Y0K A;  3PQS A;  4O3Y A;  5FVN A;  3VE1 A;  2N2L A;  1MPF A;  2QTK A;  3HWB A;  3O0E A;  4O4U A;  3TZG A;  3G7G A;  5DL8 A;  4KR8 A;  3GP6 A;  4GCS A;  4AYN A;  5ADX K;  1HXX A;  1GFN A;  5JDP A;  5DL5 A;  4AYM C;  5ADX L;  3NSG A;  3DA3 A;  2PRN A;  2Y2X A;  2Y0H A;  4O4X A;  1YS5 A;  4D5U A;  5IYU A;  3AA6 A;  4B61 A;  3AA0 A;  4O49 A;  4AYI D;  2K4T A;  4RL9 A;  4AKR B;  2KXP A;  5PRN A;  1P4T A;  1Q9F A;  2M07 A;  5DL6 A;  7PRN A;  3V8U A;  1IZN A;  4G76 A;  3UPG A;  4LSI A;  2MNH A;  2X27 X;  4RJW A;  3LK4 2;  1ZHZ A;  2XE1 A;  4JFB A;  3UU2 A;  3VE2 A;  4D65 A;  2ZLD A;  4N59 A;  4D64 A;  1PHO A;  3T0S A;  2XE5 A;  3SYS A;  1OSM A;  3LK2 B;  4FT6 A;  4BUM X;  3RBH A;  3POQ A;  2XMX A;  3SY7 A;  4JCH A;  1IZN B;  3VZW X;  3EMN X;  3AAA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...