1OSPO

Crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
251
structure length
251
Chain Sequence
SLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKCKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 184.1
publication title Crystal structure of Lyme disease antigen outer surface protein A complexed with an Fab.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Complex (immunoglobulin/lipoprotein)
total genus 51
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 1996-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00820 Lipoprotein_1 Borrelia lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 1ospO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 1ospO02
2FKGA 2OL7A 2OY7A 2OYBO 3AUMO 5B3MO 2G8CO 2AF5A 2OL6O 5B11O 2I5ZO 5B10O 2FKJA 2OY1O 2OY5O 2OY8A 2OL8O 2HKDA 1FJ1E 1P4PA 2PI3O 1OSPO 3CKFA 3EC5A 5B2AO 3CKGA 2I5VO
chains in the Genus database with same CATH superfamily
4TKHA 1SWPA 1A3YA 1JYJA 1GKAA 2ZJRE 5CSEA 2HLVA 4UU2A 3Q6LA 3FA8A 3CD6E 1W2BE 3BSZE 5IRWA 3VG2A 2PI3O 5B2AO 4ALOA 3CF5E 2LA7A 3OE3A 1VWCB 1NJIG 3ELZA 5B29A 1Z24A 4IB8A 4ON1A 2OY5O 4RUUA 2G5LA 5JR8A 1YJNE 2NNEA 4C5PA 3I0AA 1JQPA 3BX7A 2RTQB 2QOMA 3QQ2A 1FTPA 2IZAA 1QY1A 4GJVA 3CBSA 1O1VA 4Z2OA 1TW4A 4Z28A 5EEEA 2Q2PA 3OJYC 4Z27A 3ZZVA 5B27A 4AZQA 4A8ZA 5B11O 3JS1A 4MEEA 1VWOB 4YCHA 1NDJA 1KQSE 3PDFA 1EIIA 4PSQA 1JJJA 2JU3A 4ZHHA 4QZTA 4KIIA 1KT4A 2A3FX 1VQ5E 1VQPE 1ICNA 2MF6A 4DQ4A 1KL4A 2C1QA 2Y32A 3LV4A 3P6GA 1SWUA 5H8TA 2KTSA 1SXYA 1K8AG 3RDUA 1JMZA 3CC2E 5F2BA 2R73A 5D8JA 4ZH9A 4XMGA 4EXZA 1SWGA 1SWFA 5B3MO 1O8VA 4BVMA 3S26A 1IKJA 5LJEA 4QGXA 1CBSA 1D2UA 1AVGI 4QYPA 1SWAA 2WEWA 5K67A 3UEVA 2VFBA 3DLLE 4QGVA 2JU7A 1A18A 4BQUA 5LJBA 1A2DA 5HA0A 1OBPA 3MVFA 2VFCA 2RN4A 5GADG 1YWDA 3APWA 1G5WA 1N43A 1DF3A 5GAHG 4O3XB 5FQ8E 5LJKA 4XMCA 1MVGA 3VHMA 4ML7B 1LDQA 5HAEA 3BS2A 1KL5A 1JZUA 2X8TA 1XKIA 2RTLA 2KTDA 4QNIA 1MX8A 2X4MA 1ADLA 5IXGA 1LIFA 4CPFA 2P8GA 2LKKA 3CC7E 1VQNE 3HTYA 4YBPA 1JBHA 4KC7A 4AZNA 2RTCB 3BY0A 1Y9TA 5F6BA 2WPUA 4D6AA 5CE4A 5B5GA 3AEHA 3WYQA 3T2WA 1LCVA 3BLGA 1YJWE 1GM6A 4TKBA 1B56A 1STRB 3CBCA 5IO6A 2OY1O 3P24A 1SWQA 2X32A 3FA6A 4WFUA 4LKPA 4AZMA 2OFAA 1YWCA 4OS8A 1S72E 2JMBA 1Q86G 1LCWA 4I6SA 3CCJE 1KC8G 1LIDA 4COTA 1VWKB 1GT4A 5IO5A 2WQAE 3RZYA 2IZIA 1HMTA 4OMXA 4GD9A 4GNWA 2FHLA 4NP1A 3I55E 4IO9E 4RUNA 4JO6A 5LJHA 4O4XA 3P6HA 1LIBA 2K62A 2L5PA 3L4RA 3U9PC 4OS0A 1SXXA 5MLCH 5F58A 3FA7A 2IZBA 1FE3A 3FLLA 3F8AA 1YUPA 4FQBB 1YITE 3OW2E 2MO5A 1YIJE 1OPAA 3X00A 3UEWA 1Y0GA 2A13A 2X8SA 1KQXA 5HBSA 1PMPA 3RDMA 4NV7A 1EIOA 1EXSA 3NR3A 4BX6A 4GZVA 5AQ6A 5HCEC 3CR6A 1Y52X 1LUQA 3CCQE 3EBWA 1R0UA 5KHPA 5H9LA 2HMBA 2OVEA 4NNTA 1OBQA 2GTLN 4TNNA 2AL0X 1YWBA 3UEXA 4Y0SA 3RY2A 1T68X 4CPHB 4UY8G 5F7GA 5B10O 2POAA 2AH7X 1VWNB 4OS3A 1OEKA 1CBIA 3WOVA 2QO4A 1EQDA 1KXOA 1HQPA 5L8NA 5GAEG 4O3ZA 5H9KA 1GKAB 3O2YA 4YMYA 2RQ0A 2ZJQE 5H1SI 2IFBA 1XCAA 2G78A 3I56E 4EEJA 4GGZA 2OF8A 4ARHA 3D9WA 4XMHA 3STMX 4ZHCA 4EKVA 5DPQA 4M7MA 3EYCA 1PEEA 3IGEA 2HZRA 2WWPA 1BBPA 1KOIA 3GE2A 2RTOB 3SZIA 4DQ3A 1GXAA 1KT7A 5CHKA 1ICMA 3ZQ3A 2JW1A 3LTWA 2AKQA 2QEXE 4O9SA 3NX1A 1ML7A 4ZJ0A 2ZAIA 4ID2A 2FS6A 4I95A 1BM5A 3CMAE 3APXA 1I04A 3BRNA 4OEMA 3G71E 5EPQA 2JU8A 4BX7B 3B2JA 2Z4HA 3U03A 2X34A 1QFTA 2RA6A 1QWDA 1IIUA 2WEXA 2WQ9A 3AUMO 1RSTB 1LNMA 4M6SA 1VQ8E 2IZJA 2NNQA 4CDDA 3MX7A 3HOLA 2IZLB 1I78A 2UYWA 3FR4A 2MJIA 1SLDB 1RLBE 1W5RA 4GDAA 1EALA 4EQAC 1N0SA 2RTJA 1EI5A 3KFHA 5HTDA 2L67A 1GGLA 5LKEA 5HL7E 4CPHA 1A57A 3WZQA 4BBOA 5FQ6E 4ZFXA 1KZWA 1CBQA 5F1EA 5HZQA 1NBXA 3WJCA 2C1SA 5GAGG 3WJEA 3MM0A 2RCQA 3DSZA 5HWZA 4QYNA 3RDSA 1VWJB 2RTDB 1KQWA 1TOWA 3FEKA 1UREA 1TVQA 2BC3A 2FR2A 4ORSA 1CRBA 1L6MA 1AB0A 4LZUA 2XSTA 4IMOA 1YP6A 3F6ZB 1EUOA 4ORYA 5HZ8A 4MISA 2AT3X 2W2FA 2IZDB 4YGHA 1HY2A 4A60A 1VQKE 4GGTA 1BLRA 4ZHDA 1GX3A 3VG4A 3CMPA 2WUTA 1SXWA 1SRFA 1X8NA 2OVAA 5D45A 3RE6A 2JGSA 2RTPB 3JQOA 1IJ8A 2Q9SA 2RTGB 1ZNDA 2FTBA 2CM4A 3UEUA 1VQLE 4ALBA 1VWDB 3RSWA 1GX9A 3ZWEA 3G6EE 5LJDA 1K9MG 3EBKA 1MDCA 2BS6A 3T6LA 1MX7A 1X8QA 4BJ8A 1BSYA 4BX7A 1SRJA 2R56A 1SWHA 1K24A 3VG3A 5BVTA 3RKGA 4ZGUA 4HPDA 1UYOX 2A2UA 1I4UA 1Q81G 3RDXA 1VQ9E 4WBKA 1CJ5A 2JN3A 1MUPA 1IFBA 2G7BA 2HZQA 4ZHGA 2CZTA 4ORUA 3TZSA 1VWIB 3SLJA 3STKA 1Q7YG 1MM9A 5LKFA 3CCRE 3Q34A 2UZ2A 1DZMA 2Z4IA 3NP1A 1BSOA 1KD1G 1E06A 4U8UM 1VQ6E 4HFOA 2ALLX 2XKLA 2O62A 1SMPI 1I05A 4GK9A 4BX6B 1DC9A 3SLOA 1DF8A 5K68A 5H9NA 3CCEE 2Q4NA 4IB6A 1QQSA 1LF7A 2C4IA 3PH6A 1NC9A 3J7ZG 1AVEA 3B2IA 3B2LA 1SWNA 3PP6A 2FKGA 1OPBA 1DZPA 3NQ3A 2QA4E 3WZNA 4OELA 2JOZA 3RE5A 1NP1A 2GC9A 3G7XA 1VQOE 1KL3A 1G7NA 2NP1A 5DM7E 3ZW2A 1P6PA 1TOUA 4YBUA 5AJBA 2ACPX 2X8FA 1Y9LA 1JMXA 3PEDA 3VHHA 4KC8A 5L8IA 1ZNHA 2QCBA 1X71A 3H3IA 4WFNE 3PQSA 1EPAA 3F9DA 4WFVA 2HKDA 2PY1A 3PECA 1S2PA 2YMSA 2RTNB 1E5PA 2QMIA 3VG6A 5HZ5A 3HOEA 2FS7A 3S60A 3CQRA 5DG4A 3TGCA 3AKNA 4Y59A 4IAWA 1I9HA 4ORRA 3CKFA 2FLJA 3MG5A 2RTHB 2FWVA 4A1HA 4L3RA 1HXZA 4GETA 3RY1A 3TGBA 3FELA 1GT3A 2WSJA 4KCAA 3WXQA 3KZAA 1SWSA 1DV9A 4XMFA 5K06A 1ERBA 1B4MA 1SY0A 3VG7A 2RTKA 1SWRA 3CPWE 4TJZA 2OF9A 1VPRA 5EDBA 3WJGA 1E00A 5EDCA 3TF6A 1RSUB 2LBAA 1U17A 3BX8A 2M4LA 5D47A 4YKOA 4KT5A 4WFBE 5AEOA 1LKEA 1LFOA 2L9CA 2Q39A 1WUBA 1VYFA 3VE2A 5C0NA 4TLJA 4IRWA 1Y55X 2RTIB 1FENA 2N93A 4MVIA 4QRLA 4K19A 4CV7A 2FGSA 3N91A 2IZEB 1RAVA 4YFRA 2LBVA 1VWLB 3D4RA 2GH7A 1FJ1E 1P4PA 2X56A 5FAZA 3CCVE 3NQ9A 4PJ2A 3VE1A 4NLIA 2FT9A 4O3YA 2OFRX 1BWYA 4U8UO 4QZUA 1LICA 1RL6A 1OSPO 2X46A 4L1NA 3U0DA 4Y5DA 2F73A 3CXCE 2OY7A 1B8EA 1SRIA 3MBTA 4U67E 1K3BA 1N9MA 4I3DA 3PIPE 3APUA 1NQNA 1KT3A 2ZAGA 1S7DA 2G79A 1SXUA 1KGLA 1VWBB 1LELA 2ACOA 2G8CO 3P02A 2AF5A 4FGIB 1SWKA 4AZRA 5FENA 3WJBA 2VDFA 1NP4A 1NGLA 2OVSA 4QQ1A 5BVSA 1X89A 2Y3FA 1GX8A 1X8PA 5F6ZA 2RTRB 1AELA 1G74A 1W6FA 3NADA 4NYQA 4YGGA 1MEPA 4MVEA 3HWGA 1QFVA 3QKGA 3V8UA 4QGWA 3S5VA 1VWAB 4HPCA 2FR3A 4Y0RA 4ZCBA 4CPEA 4GGRA 4LZVA 1S44A 4O4SA 3EMMA 2A8GA 3I17A 1PBYA 4Y0QA 2MWHA 4GKCA 4U3QA 1H91A 3IA8A 4AZPA 4QAEA 1BSQA 1VQ7E 2MM3A 1YWAA 3B2KA 2WR6A 1E2TA 1U18A 3PQUA 1QVFE 2K23A 2MHDA 5CYBA 1FDQA 1SWOA 4A1YA 2KW1A 3WYPA 4IOCE 2KD2A 2FRSA 2DJFA 1D3SA 5LJCA 4D6BA 2DM5A 3P6EA 1SLGB 1U0XA 2OYBO 1VYOA 2W2AA 4JGLA 4XMDA 4CDEA 3HWDA 3BU9A 1SREA 1PBOA 2RCTA 4YKMA 1CBRA 1STSB 3GAQA 3ZUIA 3C77X 1M1KG 3ZI8A 3E3CA 3C78X 1VQ4E 2OL7A 4KH8A 1VWMB 2IZKA 4OMWA 1BRPA 1W4TA 2CM9A 4YDAA 3FIQA 4ORWA 3VHIA 1OBUA 1SWJA 3PH5A 2FKJA 3SOTA 1SA8A 4ZH6A 5JVGE 4EFGA 1VWGB 1NQMA 1IKEA 2IZHB 3KFFA 4MVLA 1HXLA 4WHIA 3BDRA 3C76X 1STPA 1G85A 1HMRA 1SRGA 4I60A 2GTLM 1ERXA 1PTSA 1SWLA 4WF9E 3ZW1B 3FR2A 4HPAA 1YP7A 1SWTA 2R74A 1B0OA 5L8OA 4GE1A 1BEBA 4O49A 4XMEA 3ZW0A 2A2GA 2AMMX 2LFOA 1AQBA 1Q82G 4BOEA 4ORXA 1HMSA 1YI2E 5HTEA 2IZFB 3SZHA 3FMZA 4BX5B 3FA9A 2GJ5A 4AW8A 4B55A 2OVDA 1SY2A 3VPJE 1BJ7A 1N7YA 2CAMA 2RTFB 3G4SE 1JIWI 5H9AA 2X45A 3KQ0A 1VQME 1SRHA 4YFPA 4INNA 4NW4A 3PK2A 4I3CA 5B5FA 4ZR2A 2RTEB 3NX2A 2CBRA 4GRJA 1VWHB 4I9RA 1ZNEA 3TGAA 3P6FA 1SLFB 3RBYA 2QO5A 3CCUE 3WBGA 2OY8A 3HWFA 4JNJA 2RD7C 1HQQA 2OFMX 2X55A 3SZJA 1E02A 3D97A 4ES7A 2DJGA 4CK4A 1HN2A 1QABE 5HZ6A 1EPBA 4YFQA 1UYNX 1N4JA 1VWQB 3O22A 1SLEB 3STNA 5AJCA 5EEDA 5KIDA 3NPOA 4ZGFA 2CZUA 1PM1X 4I9SA 3CQNA 2E4JA 2FHNX 4TQ2A 1QY2A 1SWDA 1VWFB 2A0AA 1I06A 4N7CA 2F09A 4U46A 3ZUOA 1QVGE 4GDZA 4DCBA 4GUZA 2OZQA 1QY0A 5D48A 3AKMA 4GNYA 3D95A 2Y3EA 1HBQA 3ZW1A 1M90G 3WZPA 4AYHA 2OL6O 3EW1A 3IFBA 4YCEA 1K73G 2OFBA 3EM0A 1ZNLA 4Z6JA 5KICA 1T8VA 2OTLE 4FBRA 3D96A 5BYPA 5IRUA 2NNDA 5DM6E 1VWPB 4IAXA 1MOYA 3BU1A 4WFAE 5FQ7E 1LPJA 1FEMA 2BHVA 1BRQA 4BX5A 5JVHE 2KT4B 3O19A 3T1DA 3SAOA 1ACDA 3WJDA 1KT6A 2AT5X 3DTQA 1RJLC 3PIOE 5IRAA 2BLGA 2AT8X 1RXKA 5D4AA 3CKGA 4GH7A 4FBOA 2HNXA 4BGFA 4U9CA 5HCDC 5HA1A 2AT6X 2GTLO 3HWEA 4NYRA 1WBIA 1TXLA 3NQKA 3RWXA 2ASNX 4BCSA 1ALBA 4LQZA 2OTJE 2GTFX 1O1UA 4NV8A 1X8UA 1KT5A 1UZ2X 1FELA 2YG2A 1SWEA 3S5XA 2EU7X 3FR5A 5L3YA 4NLJA 2RTBB 3P6DA 3CCLE 3B2HA 3PPTA 2IZCB 2OL8O 1N8RG 4MIRA 1GT1A 1DZKA 3APVA 2LB6A 3KFGA 4YDBA 1AVDA 4CPIA 3CCSE 1KFFA 4EDEA 1QG5A 2QM9A 3T2XA 3OBLA 4ODDA 2RTAA 1SY1A 3NBXX 5BVQA 2RTMA 5HCCC 3CC4E 1OEEA 2A5BA 2L68A 4Z2VA 1RXJA 3VU1A 2CBSA 1ZRYA 1YIVA 4Z2PA 4HWMA 3HPEA 4YGZA 1LIEA 4WCEE 1JJ2E 3VGWA 4GJSA 2A5CA 1YHQE 1LDOA 1MK5A 4YH0A 1JV4A 4GU8A 3JSQA 1IW2A 1JYDA 3UAQA 5LJGA 5HZ9A 1RBPA 1RXHA 1VYGA 3RDOA 4LKTA 4ZHFA 5IO7A 4MVKA 4CDCA 1HBPA 4AZOA 1KZXA 3RDQA 4OKAA 3P6CA 4IBAA 4IOAE 2F01A 2ANSA 3CMEE 3LHNA 1N9YA 5JD2A 4O4UA 4IB9A 3EC5A 5FFHA 4JHQA 3OD9A 3FENA 1EW3A 3SLTA 1YJ9E 1VWEB 2AT0X 3ELXA 2HYSA 3KVNA 1SWBA 1VWRB 3VG5A 1Y53X 4O4OA 3FDCA 1SWCA 4UU3A 2Q2MA 4Y0PA 3FW5A 2ZSCA 4U8UN 2AVIA 2BT9A 3HK1A 4IABA 3FYFA 3FW4A 5EZ2A 3ZW0B 3WVMA 4FBVA 2QO6A 2CQLA 3IG9A 3EW2A 1ZNGA 3WJFA 4O3WA 4HPBA 1DFVA 4I3BA 1IFCA 2IZGB 1SY3A 4N7DA 2I5VO 4YVBA 4IMNA 2QOSC 3CWKA 2BSZA 3FIDA 1LCZA 2ZJPE 1ZNKA 2I5ZO 3KFIA 1DZJA 3CCME 4DNEA 3T6FA 1T0VA 5AN9B 3K3LA 1X8OA 1GT5A 4NNSA 2W2BA 4CSBA 4TKJA 1JJXA 2BS5A 1JJUA 3WZOA 1OEJA 3FEPA 4R0BA 4CDFA 4IB7A
chains in the Genus database with same CATH topology
3IG9A 2FKGA 2OL7A 2OY7A 2OYBO 3AUMO 5B3MO 1RJLC 2G8CO 2AF5A 2OL6O 5B11O 2I5ZO 5B10O 2FKJA 2OY1O 2OY5O 2OY8A 2OL8O 2HKDA 1FJ1E 1P4PA 2PI3O 1OSPO 3CKFA 3EC5A 5B2AO 3CKGA 3IGEA 2I5VO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKG A;  2OL7 A;  2OY7 A;  2OYB O;  3AUM O;  5B3M O;  2G8C O;  2AF5 A;  2OL6 O;  5B11 O;  2I5Z O;  5B10 O;  2FKJ A;  2OY1 O;  2OY5 O;  2OY8 A;  2OL8 O;  2HKD A;  1FJ1 E;  1P4P A;  2PI3 O;  1OSP O;  3CKF A;  3EC5 A;  5B2A O;  3CKG A;  2I5V O; 
#chains in the Genus database with same CATH topology
 4TKH A;  1SWP A;  1A3Y A;  1JYJ A;  1GKA A;  2ZJR E;  5CSE A;  2HLV A;  4UU2 A;  3Q6L A;  3FA8 A;  3CD6 E;  1W2B E;  3BSZ E;  5IRW A;  3VG2 A;  2PI3 O;  5B2A O;  4ALO A;  3CF5 E;  2LA7 A;  3OE3 A;  1VWC B;  1NJI G;  3ELZ A;  5B29 A;  1Z24 A;  4IB8 A;  4ON1 A;  2OY5 O;  4RUU A;  2G5L A;  5JR8 A;  1YJN E;  2NNE A;  4C5P A;  3I0A A;  1JQP A;  3BX7 A;  2RTQ B;  2QOM A;  3QQ2 A;  1FTP A;  2IZA A;  1QY1 A;  4GJV A;  3CBS A;  1O1V A;  4Z2O A;  1TW4 A;  4Z28 A;  5EEE A;  2Q2P A;  3OJY C;  4Z27 A;  3ZZV A;  5B27 A;  4AZQ A;  4A8Z A;  5B11 O;  3JS1 A;  4MEE A;  1VWO B;  4YCH A;  1NDJ A;  1KQS E;  3PDF A;  1EII A;  4PSQ A;  1JJJ A;  2JU3 A;  4ZHH A;  4QZT A;  4KII A;  1KT4 A;  2A3F X;  1VQ5 E;  1VQP E;  1ICN A;  2MF6 A;  4DQ4 A;  1KL4 A;  2C1Q A;  2Y32 A;  3LV4 A;  3P6G A;  1SWU A;  5H8T A;  2KTS A;  1SXY A;  1K8A G;  3RDU A;  1JMZ A;  3CC2 E;  5F2B A;  2R73 A;  5D8J A;  4ZH9 A;  4XMG A;  4EXZ A;  1SWG A;  1SWF A;  5B3M O;  1O8V A;  4BVM A;  3S26 A;  1IKJ A;  5LJE A;  4QGX A;  1CBS A;  1D2U A;  1AVG I;  4QYP A;  1SWA A;  2WEW A;  5K67 A;  3UEV A;  2VFB A;  3DLL E;  4QGV A;  2JU7 A;  1A18 A;  4BQU A;  5LJB A;  1A2D A;  5HA0 A;  1OBP A;  3MVF A;  2VFC A;  2RN4 A;  5GAD G;  1YWD A;  3APW A;  1G5W A;  1N43 A;  1DF3 A;  5GAH G;  4O3X B;  5FQ8 E;  5LJK A;  4XMC A;  1MVG A;  3VHM A;  4ML7 B;  1LDQ A;  5HAE A;  3BS2 A;  1KL5 A;  1JZU A;  2X8T A;  1XKI A;  2RTL A;  2KTD A;  4QNI A;  1MX8 A;  2X4M A;  1ADL A;  5IXG A;  1LIF A;  4CPF A;  2P8G A;  2LKK A;  3CC7 E;  1VQN E;  3HTY A;  4YBP A;  1JBH A;  4KC7 A;  4AZN A;  2RTC B;  3BY0 A;  1Y9T A;  5F6B A;  2WPU A;  4D6A A;  5CE4 A;  5B5G A;  3AEH A;  3WYQ A;  3T2W A;  1LCV A;  3BLG A;  1YJW E;  1GM6 A;  4TKB A;  1B56 A;  1STR B;  3CBC A;  5IO6 A;  2OY1 O;  3P24 A;  1SWQ A;  2X32 A;  3FA6 A;  4WFU A;  4LKP A;  4AZM A;  2OFA A;  1YWC A;  4OS8 A;  1S72 E;  2JMB A;  1Q86 G;  1LCW A;  4I6S A;  3CCJ E;  1KC8 G;  1LID A;  4COT A;  1VWK B;  1GT4 A;  5IO5 A;  2WQA E;  3RZY A;  2IZI A;  1HMT A;  4OMX A;  4GD9 A;  4GNW A;  2FHL A;  4NP1 A;  3I55 E;  4IO9 E;  4RUN A;  4JO6 A;  5LJH A;  4O4X A;  3P6H A;  1LIB A;  2K62 A;  2L5P A;  3L4R A;  3U9P C;  4OS0 A;  1SXX A;  5MLC H;  5F58 A;  3FA7 A;  2IZB A;  1FE3 A;  3FLL A;  3F8A A;  1YUP A;  4FQB B;  1YIT E;  3OW2 E;  2MO5 A;  1YIJ E;  1OPA A;  3X00 A;  3UEW A;  1Y0G A;  2A13 A;  2X8S A;  1KQX A;  5HBS A;  1PMP A;  3RDM A;  4NV7 A;  1EIO A;  1EXS A;  3NR3 A;  4BX6 A;  4GZV A;  5AQ6 A;  5HCE C;  3CR6 A;  1Y52 X;  1LUQ A;  3CCQ E;  3EBW A;  1R0U A;  5KHP A;  5H9L A;  2HMB A;  2OVE A;  4NNT A;  1OBQ A;  2GTL N;  4TNN A;  2AL0 X;  1YWB A;  3UEX A;  4Y0S A;  3RY2 A;  1T68 X;  4CPH B;  4UY8 G;  5F7G A;  5B10 O;  2POA A;  2AH7 X;  1VWN B;  4OS3 A;  1OEK A;  1CBI A;  3WOV A;  2QO4 A;  1EQD A;  1KXO A;  1HQP A;  5L8N A;  5GAE G;  4O3Z A;  5H9K A;  1GKA B;  3O2Y A;  4YMY A;  2RQ0 A;  2ZJQ E;  5H1S I;  2IFB A;  1XCA A;  2G78 A;  3I56 E;  4EEJ A;  4GGZ A;  2OF8 A;  4ARH A;  3D9W A;  4XMH A;  3STM X;  4ZHC A;  4EKV A;  5DPQ A;  4M7M A;  3EYC A;  1PEE A;  3IGE A;  2HZR A;  2WWP A;  1BBP A;  1KOI A;  3GE2 A;  2RTO B;  3SZI A;  4DQ3 A;  1GXA A;  1KT7 A;  5CHK A;  1ICM A;  3ZQ3 A;  2JW1 A;  3LTW A;  2AKQ A;  2QEX E;  4O9S A;  3NX1 A;  1ML7 A;  4ZJ0 A;  2ZAI A;  4ID2 A;  2FS6 A;  4I95 A;  1BM5 A;  3CMA E;  3APX A;  1I04 A;  3BRN A;  4OEM A;  3G71 E;  5EPQ A;  2JU8 A;  4BX7 B;  3B2J A;  2Z4H A;  3U03 A;  2X34 A;  1QFT A;  2RA6 A;  1QWD A;  1IIU A;  2WEX A;  2WQ9 A;  3AUM O;  1RST B;  1LNM A;  4M6S A;  1VQ8 E;  2IZJ A;  2NNQ A;  4CDD A;  3MX7 A;  3HOL A;  2IZL B;  1I78 A;  2UYW A;  3FR4 A;  2MJI A;  1SLD B;  1RLB E;  1W5R A;  4GDA A;  1EAL A;  4EQA C;  1N0S A;  2RTJ A;  1EI5 A;  3KFH A;  5HTD A;  2L67 A;  1GGL A;  5LKE A;  5HL7 E;  4CPH A;  1A57 A;  3WZQ A;  4BBO A;  5FQ6 E;  4ZFX A;  1KZW A;  1CBQ A;  5F1E A;  5HZQ A;  1NBX A;  3WJC A;  2C1S A;  5GAG G;  3WJE A;  3MM0 A;  2RCQ A;  3DSZ A;  5HWZ A;  4QYN A;  3RDS A;  1VWJ B;  2RTD B;  1KQW A;  1TOW A;  3FEK A;  1URE A;  1TVQ A;  2BC3 A;  2FR2 A;  4ORS A;  1CRB A;  1L6M A;  1AB0 A;  4LZU A;  2XST A;  4IMO A;  1YP6 A;  3F6Z B;  1EUO A;  4ORY A;  5HZ8 A;  4MIS A;  2AT3 X;  2W2F A;  2IZD B;  4YGH A;  1HY2 A;  4A60 A;  1VQK E;  4GGT A;  1BLR A;  4ZHD A;  1GX3 A;  3VG4 A;  3CMP A;  2WUT A;  1SXW A;  1SRF A;  1X8N A;  2OVA A;  5D45 A;  3RE6 A;  2JGS A;  2RTP B;  3JQO A;  1IJ8 A;  2Q9S A;  2RTG B;  1ZND A;  2FTB A;  2CM4 A;  3UEU A;  1VQL E;  4ALB A;  1VWD B;  3RSW A;  1GX9 A;  3ZWE A;  3G6E E;  5LJD A;  1K9M G;  3EBK A;  1MDC A;  2BS6 A;  3T6L A;  1MX7 A;  1X8Q A;  4BJ8 A;  1BSY A;  4BX7 A;  1SRJ A;  2R56 A;  1SWH A;  1K24 A;  3VG3 A;  5BVT A;  3RKG A;  4ZGU A;  4HPD A;  1UYO X;  2A2U A;  1I4U A;  1Q81 G;  3RDX A;  1VQ9 E;  4WBK A;  1CJ5 A;  2JN3 A;  1MUP A;  1IFB A;  2G7B A;  2HZQ A;  4ZHG A;  2CZT A;  4ORU A;  3TZS A;  1VWI B;  3SLJ A;  3STK A;  1Q7Y G;  1MM9 A;  5LKF A;  3CCR E;  3Q34 A;  2UZ2 A;  1DZM A;  2Z4I A;  3NP1 A;  1BSO A;  1KD1 G;  1E06 A;  4U8U M;  1VQ6 E;  4HFO A;  2ALL X;  2XKL A;  2O62 A;  1SMP I;  1I05 A;  4GK9 A;  4BX6 B;  1DC9 A;  3SLO A;  1DF8 A;  5K68 A;  5H9N A;  3CCE E;  2Q4N A;  4IB6 A;  1QQS A;  1LF7 A;  2C4I A;  3PH6 A;  1NC9 A;  3J7Z G;  1AVE A;  3B2I A;  3B2L A;  1SWN A;  3PP6 A;  2FKG A;  1OPB A;  1DZP A;  3NQ3 A;  2QA4 E;  3WZN A;  4OEL A;  2JOZ A;  3RE5 A;  1NP1 A;  2GC9 A;  3G7X A;  1VQO E;  1KL3 A;  1G7N A;  2NP1 A;  5DM7 E;  3ZW2 A;  1P6P A;  1TOU A;  4YBU A;  5AJB A;  2ACP X;  2X8F A;  1Y9L A;  1JMX A;  3PED A;  3VHH A;  4KC8 A;  5L8I A;  1ZNH A;  2QCB A;  1X71 A;  3H3I A;  4WFN E;  3PQS A;  1EPA A;  3F9D A;  4WFV A;  2HKD A;  2PY1 A;  3PEC A;  1S2P A;  2YMS A;  2RTN B;  1E5P A;  2QMI A;  3VG6 A;  5HZ5 A;  3HOE A;  2FS7 A;  3S60 A;  3CQR A;  5DG4 A;  3TGC A;  3AKN A;  4Y59 A;  4IAW A;  1I9H A;  4ORR A;  3CKF A;  2FLJ A;  3MG5 A;  2RTH B;  2FWV A;  4A1H A;  4L3R A;  1HXZ A;  4GET A;  3RY1 A;  3TGB A;  3FEL A;  1GT3 A;  2WSJ A;  4KCA A;  3WXQ A;  3KZA A;  1SWS A;  1DV9 A;  4XMF A;  5K06 A;  1ERB A;  1B4M A;  1SY0 A;  3VG7 A;  2RTK A;  1SWR A;  3CPW E;  4TJZ A;  2OF9 A;  1VPR A;  5EDB A;  3WJG A;  1E00 A;  5EDC A;  3TF6 A;  1RSU B;  2LBA A;  1U17 A;  3BX8 A;  2M4L A;  5D47 A;  4YKO A;  4KT5 A;  4WFB E;  5AEO A;  1LKE A;  1LFO A;  2L9C A;  2Q39 A;  1WUB A;  1VYF A;  3VE2 A;  5C0N A;  4TLJ A;  4IRW A;  1Y55 X;  2RTI B;  1FEN A;  2N93 A;  4MVI A;  4QRL A;  4K19 A;  4CV7 A;  2FGS A;  3N91 A;  2IZE B;  1RAV A;  4YFR A;  2LBV A;  1VWL B;  3D4R A;  2GH7 A;  1FJ1 E;  1P4P A;  2X56 A;  5FAZ A;  3CCV E;  3NQ9 A;  4PJ2 A;  3VE1 A;  4NLI A;  2FT9 A;  4O3Y A;  2OFR X;  1BWY A;  4U8U O;  4QZU A;  1LIC A;  1RL6 A;  1OSP O;  2X46 A;  4L1N A;  3U0D A;  4Y5D A;  2F73 A;  3CXC E;  2OY7 A;  1B8E A;  1SRI A;  3MBT A;  4U67 E;  1K3B A;  1N9M A;  4I3D A;  3PIP E;  3APU A;  1NQN A;  1KT3 A;  2ZAG A;  1S7D A;  2G79 A;  1SXU A;  1KGL A;  1VWB B;  1LEL A;  2ACO A;  2G8C O;  3P02 A;  2AF5 A;  4FGI B;  1SWK A;  4AZR A;  5FEN A;  3WJB A;  2VDF A;  1NP4 A;  1NGL A;  2OVS A;  4QQ1 A;  5BVS A;  1X89 A;  2Y3F A;  1GX8 A;  1X8P A;  5F6Z A;  2RTR B;  1AEL A;  1G74 A;  1W6F A;  3NAD A;  4NYQ A;  4YGG A;  1MEP A;  4MVE A;  3HWG A;  1QFV A;  3QKG A;  3V8U A;  4QGW A;  3S5V A;  1VWA B;  4HPC A;  2FR3 A;  4Y0R A;  4ZCB A;  4CPE A;  4GGR A;  4LZV A;  1S44 A;  4O4S A;  3EMM A;  2A8G A;  3I17 A;  1PBY A;  4Y0Q A;  2MWH A;  4GKC A;  4U3Q A;  1H91 A;  3IA8 A;  4AZP A;  4QAE A;  1BSQ A;  1VQ7 E;  2MM3 A;  1YWA A;  3B2K A;  2WR6 A;  1E2T A;  1U18 A;  3PQU A;  1QVF E;  2K23 A;  2MHD A;  5CYB A;  1FDQ A;  1SWO A;  4A1Y A;  2KW1 A;  3WYP A;  4IOC E;  2KD2 A;  2FRS A;  2DJF A;  1D3S A;  5LJC A;  4D6B A;  2DM5 A;  3P6E A;  1SLG B;  1U0X A;  2OYB O;  1VYO A;  2W2A A;  4JGL A;  4XMD A;  4CDE A;  3HWD A;  3BU9 A;  1SRE A;  1PBO A;  2RCT A;  4YKM A;  1CBR A;  1STS B;  3GAQ A;  3ZUI A;  3C77 X;  1M1K G;  3ZI8 A;  3E3C A;  3C78 X;  1VQ4 E;  2OL7 A;  4KH8 A;  1VWM B;  2IZK A;  4OMW A;  1BRP A;  1W4T A;  2CM9 A;  4YDA A;  3FIQ A;  4ORW A;  3VHI A;  1OBU A;  1SWJ A;  3PH5 A;  2FKJ A;  3SOT A;  1SA8 A;  4ZH6 A;  5JVG E;  4EFG A;  1VWG B;  1NQM A;  1IKE A;  2IZH B;  3KFF A;  4MVL A;  1HXL A;  4WHI A;  3BDR A;  3C76 X;  1STP A;  1G85 A;  1HMR A;  1SRG A;  4I60 A;  2GTL M;  1ERX A;  1PTS A;  1SWL A;  4WF9 E;  3ZW1 B;  3FR2 A;  4HPA A;  1YP7 A;  1SWT A;  2R74 A;  1B0O A;  5L8O A;  4GE1 A;  1BEB A;  4O49 A;  4XME A;  3ZW0 A;  2A2G A;  2AMM X;  2LFO A;  1AQB A;  1Q82 G;  4BOE A;  4ORX A;  1HMS A;  1YI2 E;  5HTE A;  2IZF B;  3SZH A;  3FMZ A;  4BX5 B;  3FA9 A;  2GJ5 A;  4AW8 A;  4B55 A;  2OVD A;  1SY2 A;  3VPJ E;  1BJ7 A;  1N7Y A;  2CAM A;  2RTF B;  3G4S E;  1JIW I;  5H9A A;  2X45 A;  3KQ0 A;  1VQM E;  1SRH A;  4YFP A;  4INN A;  4NW4 A;  3PK2 A;  4I3C A;  5B5F A;  4ZR2 A;  2RTE B;  3NX2 A;  2CBR A;  4GRJ A;  1VWH B;  4I9R A;  1ZNE A;  3TGA A;  3P6F A;  1SLF B;  3RBY A;  2QO5 A;  3CCU E;  3WBG A;  2OY8 A;  3HWF A;  4JNJ A;  2RD7 C;  1HQQ A;  2OFM X;  2X55 A;  3SZJ A;  1E02 A;  3D97 A;  4ES7 A;  2DJG A;  4CK4 A;  1HN2 A;  1QAB E;  5HZ6 A;  1EPB A;  4YFQ A;  1UYN X;  1N4J A;  1VWQ B;  3O22 A;  1SLE B;  3STN A;  5AJC A;  5EED A;  5KID A;  3NPO A;  4ZGF A;  2CZU A;  1PM1 X;  4I9S A;  3CQN A;  2E4J A;  2FHN X;  4TQ2 A;  1QY2 A;  1SWD A;  1VWF B;  2A0A A;  1I06 A;  4N7C A;  2F09 A;  4U46 A;  3ZUO A;  1QVG E;  4GDZ A;  4DCB A;  4GUZ A;  2OZQ A;  1QY0 A;  5D48 A;  3AKM A;  4GNY A;  3D95 A;  2Y3E A;  1HBQ A;  3ZW1 A;  1M90 G;  3WZP A;  4AYH A;  2OL6 O;  3EW1 A;  3IFB A;  4YCE A;  1K73 G;  2OFB A;  3EM0 A;  1ZNL A;  4Z6J A;  5KIC A;  1T8V A;  2OTL E;  4FBR A;  3D96 A;  5BYP A;  5IRU A;  2NND A;  5DM6 E;  1VWP B;  4IAX A;  1MOY A;  3BU1 A;  4WFA E;  5FQ7 E;  1LPJ A;  1FEM A;  2BHV A;  1BRQ A;  4BX5 A;  5JVH E;  2KT4 B;  3O19 A;  3T1D A;  3SAO A;  1ACD A;  3WJD A;  1KT6 A;  2AT5 X;  3DTQ A;  1RJL C;  3PIO E;  5IRA A;  2BLG A;  2AT8 X;  1RXK A;  5D4A A;  3CKG A;  4GH7 A;  4FBO A;  2HNX A;  4BGF A;  4U9C A;  5HCD C;  5HA1 A;  2AT6 X;  2GTL O;  3HWE A;  4NYR A;  1WBI A;  1TXL A;  3NQK A;  3RWX A;  2ASN X;  4BCS A;  1ALB A;  4LQZ A;  2OTJ E;  2GTF X;  1O1U A;  4NV8 A;  1X8U A;  1KT5 A;  1UZ2 X;  1FEL A;  2YG2 A;  1SWE A;  3S5X A;  2EU7 X;  3FR5 A;  5L3Y A;  4NLJ A;  2RTB B;  3P6D A;  3CCL E;  3B2H A;  3PPT A;  2IZC B;  2OL8 O;  1N8R G;  4MIR A;  1GT1 A;  1DZK A;  3APV A;  2LB6 A;  3KFG A;  4YDB A;  1AVD A;  4CPI A;  3CCS E;  1KFF A;  4EDE A;  1QG5 A;  2QM9 A;  3T2X A;  3OBL A;  4ODD A;  2RTA A;  1SY1 A;  3NBX X;  5BVQ A;  2RTM A;  5HCC C;  3CC4 E;  1OEE A;  2A5B A;  2L68 A;  4Z2V A;  1RXJ A;  3VU1 A;  2CBS A;  1ZRY A;  1YIV A;  4Z2P A;  4HWM A;  3HPE A;  4YGZ A;  1LIE A;  4WCE E;  1JJ2 E;  3VGW A;  4GJS A;  2A5C A;  1YHQ E;  1LDO A;  1MK5 A;  4YH0 A;  1JV4 A;  4GU8 A;  3JSQ A;  1IW2 A;  1JYD A;  3UAQ A;  5LJG A;  5HZ9 A;  1RBP A;  1RXH A;  1VYG A;  3RDO A;  4LKT A;  4ZHF A;  5IO7 A;  4MVK A;  4CDC A;  1HBP A;  4AZO A;  1KZX A;  3RDQ A;  4OKA A;  3P6C A;  4IBA A;  4IOA E;  2F01 A;  2ANS A;  3CME E;  3LHN A;  1N9Y A;  5JD2 A;  4O4U A;  4IB9 A;  3EC5 A;  5FFH A;  4JHQ A;  3OD9 A;  3FEN A;  1EW3 A;  3SLT A;  1YJ9 E;  1VWE B;  2AT0 X;  3ELX A;  2HYS A;  3KVN A;  1SWB A;  1VWR B;  3VG5 A;  1Y53 X;  4O4O A;  3FDC A;  1SWC A;  4UU3 A;  2Q2M A;  4Y0P A;  3FW5 A;  2ZSC A;  4U8U N;  2AVI A;  2BT9 A;  3HK1 A;  4IAB A;  3FYF A;  3FW4 A;  5EZ2 A;  3ZW0 B;  3WVM A;  4FBV A;  2QO6 A;  2CQL A;  3IG9 A;  3EW2 A;  1ZNG A;  3WJF A;  4O3W A;  4HPB A;  1DFV A;  4I3B A;  1IFC A;  2IZG B;  1SY3 A;  4N7D A;  2I5V O;  4YVB A;  4IMN A;  2QOS C;  3CWK A;  2BSZ A;  3FID A;  1LCZ A;  2ZJP E;  1ZNK A;  2I5Z O;  3KFI A;  1DZJ A;  3CCM E;  4DNE A;  3T6F A;  1T0V A;  5AN9 B;  3K3L A;  1X8O A;  1GT5 A;  4NNS A;  2W2B A;  4CSB A;  4TKJ A;  1JJX A;  2BS5 A;  1JJU A;  3WZO A;  1OEJ A;  3FEP A;  4R0B A;  4CDF A;  4IB7 A; 
#chains in the Genus database with same CATH homology
 3IG9 A;  2FKG A;  2OL7 A;  2OY7 A;  2OYB O;  3AUM O;  5B3M O;  1RJL C;  2G8C O;  2AF5 A;  2OL6 O;  5B11 O;  2I5Z O;  5B10 O;  2FKJ A;  2OY1 O;  2OY5 O;  2OY8 A;  2OL8 O;  2HKD A;  1FJ1 E;  1P4P A;  2PI3 O;  1OSP O;  3CKF A;  3EC5 A;  5B2A O;  3CKG A;  3IGE A;  2I5V O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...