1OT1A

Bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant d135a
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIAFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclomaltodextrin glucanotransferase
publication title The fully conserved Asp residue in Conserved sequence region I of the alpha-amylase Family is crucial for the Catalytic Site Architecture and Activity
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 237
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot1A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot1A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ot1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ot1A01
3BO8B 1IGIL 4R90L 4NBXB 4XWOD 2YRPA 3JWOC 4TSBH 1P9MA 5GS0D 3BP7B 4UV7L 2CPCA 1PX4A 2BFVL 5DUBA 1XR9A 1OAUH 3OZPA 1AD9B 2E8YA 3I9GH 1DQML 3EJSA 1XIWB 3NCYS 3I84A 3CUPA 1D5MA 3TO4C 4XPBH 4CNIA 1SEQL 3WFHB 4MCZB 1GVIA 2VLME 4N8VG 5CWSB 5SWZB 4BQCA 5TDNA 4XI5D 5FGBA 3S4SG 1H41A 1ZAGA 3UG5A 2YLAA 4MPKA 1KPVB 1S9YA 1KXTA 5I1KH 4MNMA 3DARA 1NMBH 4NQUA 4MAVA 2HFFA 4K55A 3QIUD 4Y4FC 5EBMB 1CFTB 4JN1L 3S6CA 4WI2A 1KXHA 4H04A 4JO4H 1YJDC 3O6FC 3VNZA 3MGOA 3P2TA 3TIDB 3ELAT 5EU3B 3V0VB 4ODVH 4S1RL 2V5RA 2W59A 4BZ1H 1JZ5A 3CZ8A 1RZ8B 2DF3A 4O51A 5TDNB 3ZZ1A 1CD1B 5T3XD 4KDWA 2CBVA 3KYOA 4ATWA 3NZHL 2C4FT 3SE4A 1S9YB 4GW5A 4BFGA 5KSAC 3THDA 2QHRH 3PP3H 3GIZL 2HFFB 1UXWB 2BVQA 3HA0A 4U6XA 1XGRB 4F9LC 4I5BA 4NFCA 1PG7W 3QUZB 5GXBB 5L88H 2CXGA 3WKZA 1A7PL 3NFPA 4HPYH 2EDXA 2W65B 4PMDA 2GFBB 1OSEA 3FB6A 1OGAE 1T22A 5I74B 4O51B 2YD5A 1EQCA 4ZUTA 4BSWB 1OSZA 3QH3B 2GDUA 4FQCL 2AV7B 2X1OA 1DVFB 1QFPA 4XBPA 1DL7L 1KC5L 4DGVL 1WBYA 2G75B 3W6MA 4WWKA 3MBXH 2VIRB 3WKNA 4Q6IC 3I3BA 1OGAA 4WV1A 1RZGA 3IDGA 1L9MA 1TZGL 1HHIA 4HC1A 4G8GD 4U6XB 2OYKA 2YBUA 4I5BB 2P5WA 3BPNC 4MNGA 4D0CA 5F71A 4RFNC 1HYSD 4D6IA 2PWHA 4Z2HA 1RQ5A 5E8EA 1CICB 4NNYA 3KEHA 4U3HA 3GMLA 4U05A 3RTQA 2D4FA 5EUKA 1UGNA 3VGEA 3SKOA 1E43A 4JDVA 3GJFA 4D3CH 1CNVA 3PWLA 5I8KL 1WDSA 5FYJE 4LLQB 4PJ7A 4MD4A 4WWKB 1R3IH 3NCMA 4PFEA 4P3CH 3DMMC 1RZGB 3IDGB 1VBUA 1LE5B 3N11A 5CGTA 4WHTA 3CFBB 2VX7A 1BSIA 1J8HB 4P46B 3K8MA 4MB4A 2VZSA 2HTLC 3OGCB 4NZTH 2YIHA 3PWPD 5E8EB 3ABZA 5JMOC 3QHNA 4X7TA 4D6CA 5IK3B 4JFVA 3L4WA 3ULUL 3MXVH 4OM0H 1BYCA 2WYSA 2BK8A 1H0DA 3GM8A 2VX4A 1JNHB 3LAFA 5EUKB 1ETZA 1TTGA 3OF6D 3SKOB 2AK1H 5T1LA 4QFUA 3NTCH 1WZAA 2A6IA 1TDQA 3GJFB 3FO1A 4RFEB 2UZIL 6A3HA 5FYLD 2PF0A 1CGYA 4HJJL 2F1BA 5BW7C 1K3ZA 3U0TA 3QO1A 2BCKA 4DTGH 1FZKA 1LO3L 2JB5H 5CJOH 4DZ8A 5HGBA 4P7OA 3MACH 1JPST 5IW3A 2V3DA 3UEQA 3SCNA 1U3YA 3BOVA 4E41E 1MRCH 4BFBD 3E2HB 3F12B 5TDPB 5GPRA 2Z4QB 1LQ0A 5EZJB 3BRFA 4ZS7H 2X2HA 4OD3L 4EEEA 4NO0A 4E41A 5T1LB 5T33L 4P7QA 1TVHA 3ROLA 2A6IB 4ZPVB 3LD8C 4QHNB 3POCA 3GMNB 3SCPA 4RIRB 5D5MF 1B0GA 1WNOA 4GQPH 2OP4L 3HI5H 2AKRA 3CSYB 5JZ7D 2DYPA 2VRKA 1BZ9A 4G8EA 4LOUD 4NJAH 4FQLH 3VXSD 1RV6X 3G04B 2XUCA 3OAYH 3GKWH 2CIPA 4AL8L 4YHYB 3DJ9A 5GHWL 2YC1B 3BD3A 2DI8A 4JREB 1S7SA 1RK0A 3QXVA 1DEEB 5C9JB 1JF1B 1LHZA 2NPLX 4L8BB 3GSNA 3B8SA 1DBBH 2W63A 5I1JH 4AD0A 3HPJA 3MLWL 4E41B 3EDEA 3ROLB 4YHKH 1QFUL 2CGRL 1I3RA 4L8SB 3NACL 5KVEL 1PZUB 2XVKA 5A3HA 4CVZB 4QTIH 1AXSB 4GRLA 3OKNB 5CZXD 3R0NA 1J5OH 2YFOA 2DL2A 3RFZC 3L3IB 4H20L 4PRHD 4Y5XC 3TEUA 4WKAA 4KKLD 3QUYC 2VLKE 3L5XH 2X2JA 1KJ3H 1AKJD 5HI5C 1MSPA 1D5ZB 2YUVA 3PABB 2BFGA 5D7JC 4KROB 5JOFB 5IB1A 3OJDB 2APWA 4G43A 4HFUL 3ARUA 1M7DB 4IPLA 3O9WC 1HILA 4Z7WF 3T0BA 4QHKJ 1XH2A 1FP8A 1Y6MR 3EYVA 4JRYE 5D93B 1AHWA 1WGOA 4BQ9A 4R0LB 3DETC 1E6RA 3RVTD 4MJID 1HIZA 2YD4A 4CJ0A 4AZGA 3W9EA 3REWB 3P4OB 2PNDA 4OLYL 35C8L 4ZAKD 1R85A 1VGKB 4FXGB 1ODUA 4YQXH 2CKBL 2Y72A 2EXYC 4B53A 2G41A 1FL3A 2VJXA 4X6CA 4OLUL 5DHVA 5IB1B 4HPHA 1D3CA 5ADPL 4JG0H 1V6YA 3QDMD 3MCLL 3VA6A 2VLKB 4JVWA 1I9RL 1UEYA 1S7QA 2QSCL 4XUYA 4P9ML 5DRNB 2LV4A 3TNMB 1NBVL 4KK9D 3CVHH 1U8KB 3QAZC 4OSUH 1H3UA 1U92A 1SBBA 3G6AB 3U7BA 4B5EA 4MHHI 4O9HH 1GRWA 3R8QA 4FQXD 5E1QA 3JV6A 4JRYB 2KH2B 2B0SL 3N85L 4OCRH 5L8LB 3DRQB 2V3EA 1FL3B 5DHVB 1JXJA 1NDMB 3VO0A 2IBZY 4R5EA 1Q6GA 4AD3A 1RIVH 2EECA 3VMPA 1EERB 4K7PH 1PVHA 5FOBB 1BAGA 2J75A 3OR7B 3AQUA 2VSDA 2PC8A 5DA4A 1MVUA 5CIPH 3KPOA 4OCLC 1C93A 7FABH 4XV0A 4BSVB 1FL6A 1A9EB 2XNAA 3PWNA 3WJLC 3C09C 2D03H 4D9QE 3ZYJA 1FL5B 3VIJA 3B3IA 2NYYC 3VILA 4XBEH 4BKLA 2OW7A 1OW0C 5GSVA 4LVNC 2E9WA 4ZUSB 9CGTA 2BJML 2VAJA 3BT2L 2IAMC 3FONA 3P9MA 1QSEE 3TWCH 4ZNCD 4BF7A 2WWKO 1CK0L 4X6EB 4YWGH 5HGGS 3O2VH 1AGFA 3KPPB 3BUQA 5F7HA 3S36H 4Z7VA 1TZ7A 2RQ8A 1HINL 3GRWH 4YGVB 4FQQA 4XPGH 3D4ZA 3HG2A 1QSEA 5D2LF 2ICWJ 1OIMA 4X7EC 1DHKA 3OIHA 3C5ZA 4UT9H 2GSIB 5D1XA 5K9KA 2OL3A 5C0IA 3LKQB 5EU4A 4PSPA 1ITXA 2VXVL 1MFUA 3FONB 5HI4D 4K7FA 1GC1H 1W91A 3CSBA 1BPLB 3PGFH 2ADGB 4G5ZH 1FVCB 4ODSL 4IRJA 4PRHB 1LEIB 4MXVF 3V52H 5CP3H 4RZCB 1YECH 4ALAL 2WCSA 2NW3A 3MMWA 1E6JH 2CK0L 4HXAH 5KANI 1TQVA 4K7PY 4YPJA 2Q87A 4NSBA 1A6WH 3EFDH 5MI0B 1GPFA 1ZLWK 1J12A 2KPNA 5DD1H 5IF0A 1YMME 1R7OA 1I1CA 3EMQA 4B3KA 4YBLB 2FATL 1ES0A 1KGCD 3O3AB 1QSFE 2GYSA 1TJGL 4MJIB 1U8HA 5IFAH 3SE8L 5F7KC 2B5IC 2Y7QB 2GAZB 3HB3D 3FN0L 4OZOA 4WSKA 3DPBA 3KPLB 4M7KL 1GPOL 5BVJA 5AWNL 5FYKH 4M8QB 4S11A 1F4YH 3IFLL 4F33B 2XVNA 5TF1L 3ARGC 1NAMH 2AJVL 1D5IH 5DLMH 1KIPB 1KQZA 1N64H 3B2UC 5CSZA 1NOWA 3GBNH 5IW1A 1CT8A 5KZ6A 3DTXB 3EKCA 2ZICA 1KCVL 4Q9CA 1CL7H 1J86A 3GHBH 4XNZB 2RJMA 3D3VD 2CETA 5D5ME 5GRVK 1HHKB 2ZOXA 5FDWB 1U8HB 3E3QE 3ZTNL 1P2CB 4Y19A 2P5ED 4W7WA 1WCBA 4UDTB 1T66C 1YMMB 1J05B 1GJIA 5DVKA 3LEYL 4MQSB 2OSLA 4OI7A 3KL5A 2O5XH 2DOCA 4L1HA 3QNZA 1YJDH 5EOCH 1QSFB 3TH3T 4EK7A 2I26N 1RIHL 3BAEH 5FHBH 2HVJA 1UM6H 2AJZB 3QI9A 1B4RA 3ARZA 5ABEA 2K9UA 4KZDH 1MCFA 5T3ZH 1RJZB 2X4PB 1CBGA 2ZX6A 4LYQA 3SDCC 2AI0L 1KBBA 2OBGA 1XHGA 1UZ8B 5C09E 3QWOB 3V2AR 5C0GB 4E42B 4LVOB 1O6IA 4M5ZL 1E4XH 3MV9D 4ACZB 2HFEB 2PXYC 3ARFC 2DBJA 5D5MB 5I1IH 1NGZA 2WQRA 2YD9A 5T5FH 1WJ3A 1RUQL 4JFQA 2DD8L 4KRMB 4PMQA 3VGHA 4Z7WE 1AE6H 1GORA 4POZD 3T0XA 3O4LD 1K8DB 3ZKMD 1LWRA 3QI9B 4PP1D 2XGIA 5IOPB 3JTTA 3GHEH 4JFFD 3N13A 4GRWH 4GPNA 5JHDD 3H7BA 1A0QH 1FPTL 1FGNL 4I77L 1M05A 1CGVA 3E6HA 1ZGLB 2E9MA 3ARXA 2ZWZA 1Z3GH 4LSSH 1ADQH 2VISA 4R97C 1B3VA 3W27A 4XVTH 2DBLH 5E9DD 5K9OA 1PSKL 3CFJB 2UUDK 1XGPA 3KNBA 5C09B 3BMWA 4I3SH 3OG6B 1UOKA 4K23H 3BAYA 2X9XA 3SPVA 3VWJC 4LDLB 1HJQA 1NFKA 4DEPB 4P2OA 2AJXH 3WF4A 2GJZA 4F2MA 4HV8A 1F45A 4LYRA 1BMGA 1HSBB 4I48B 5T5NF 4YDIL 2XFXA 4Z7WB 4JHZA 2JJTA 5FUZL 2DWEB 1A1OB 2F7OA 4FFYL 2NTFA 3GNPA 3BP5B 3TVMD 4EXPX 1GNXA 3OKKA 3BSZL 5IVXF 4HCRL 1IQDA 1YEFH 3HNSL 3ILPA 1R0AH 3U48A 5ADOH 5HHVH 4R4BB 4RAHA 3D69A 2XXMB 5C8JA 3HN3A 2IJ0C 1FORH 1RUML 1IZKA 5HXMA 1VACA 4OV5A 1ZHLA 3TV3H 3QDJA 3FQWA 3M8OH 2NT0A 5LWYH 1KTCA 1AFVH 2WINB 2F5AH 1WPCA 1W9UA 1EJOL 1ZA3B 4M6NL 3SQBA 5F9DC 1KJ2H 4PS4H 3WN5A 1E15A 3Q3GA 3WS3B 4MJ2A 4FLQA 4R7DB 4PRPA 3X12A 2WCAA 1G7IB 12E8H 3NCYP 5DZOA 3LXAA 1MQKL 5DEZA 4JO2H 2VAAA 3U2SA 5ICXA 1Z9OA 3CD4A 2XZZA 2VDMH 3KWXA 4M1RA 5EWIL 2QADC 3S5LA 4HZLB 1PKQB 4P5TD 4IM4A 4LCUB 2PW1A 1IM9A 3A6CH 4P2QE 5F9AC 1BZ7A 4FXKB 1D7FA 2CUIA 2QKIA 1FNGB 3GMPB 3GGWA 5LBSL 4HUUB 5D2LE 4YE4L 4FMVA 2CKNA 3LY6A 5ID0B 3M7SA 1KGUA 1IBGL 2E7MA 2Q7YB 1GOFA 5JOPE 5TFSH 3QG6A 2ZOKA 3B6SA 4G6AD 2HYMA 1IAKB 3V6OC 1MFDH 5D2LA 3V8CA 3I3DA 1FYTD 4LF3A 5ICXB 1JRHH 3U2SB 1NP0A 3B9KC 1MIMH 1FFNA 2P8PA 2WZIA 1NCTA 1KIQB 5F70A 5T1MA 1QNPA 2JEPA 4M56A 4MXVE 2WKLA 4N42A 5HBFA 4HULB 3VXNA 3WY3A 4JQVA 2J4WL 2D3VA 4TNWK 5FGCE 1WEJL 2O92A 3P9WB 3RVVD 4OLXH 1A6UL 4QXGH 4LKCB 4ZDHA 1CFSB 1QG3A 3QCTL 4GI9A 3FN3A 2B1AL 4PUBL 3GJEA 4FQIL 4P2QB 2B2XL 3FO9A 5MEQB 2R2EA 2ICES 5JXED 5ITFB 4XX6A 1I4FA 4OI9A 3QCVL 3OAZK 1DQDH 4HXBL 3JWNC 5D2LB 3BISA 1MHEA 1E4KA 4XH2A 3CFEA 3T08A 4R27A 3WF2A 1DQLH 4O2CB 5A8OA 4F8QA 2R0WH 3L6FA 2HT3C 3EOYG 3NAAH 5T1MB 2ZXBA 1V03A 2P47B 3PZ9A 3Q6GH 5IVOA 1FFOA 3DX9B 1QKZL 3ZYIA 1X5FA 1NEZG 1V3KA 3NFSH 3QWQB 4JFYA 5JNYA 5BMFH 2ATKA 3KJ6H 1LDPL 1RZIB 3DVNA 4G9DB 3AY4A 2G5RA 5A6JA 1HNFA 1B88A 2O5YH 1JHLH 1YYLL 4AK1A 1W9VA 1FNHA 5IBLD 2RR3A 3QHTC 3V0WH 1UH3A 2VL5A 4F8XA 4XH2B 5A6AA 3MJ7A 5DJ8A 5IT2L 5F6IB 2V17L 3WJJC 3VIOA 1SM3H 2IC2A 3AXXA 3UZEA 3GMOA 2BNQA 3EAKA 3IXTA 4B3LA 1XYFA 4EI5A 2ZUMA 3LPFA 3U4AA 2Y36H 1A4JA 3ARWA 1NCWH 4P4RA 1YY8A 3VDAA 2ERJC 2JEQA 2HFGH 2PYFA 2VLJD 3QDGA 4R4NC 1CTNA 3ESVF 5LCVL 3TPUA 2ARJQ 4WI4A 5EFFA 1DE4B 2F7QA 3EHBC 3NMEA 5HD8D 3AOFA 5GNXA 1DSFL 1FE8H 1T1WA 2A77L 4LSPL 3GZKA 5DJ8B 1GGIH 1T2QH 4ZO6A 4HPOL 1C5CH 4OGAD 4P0DA 1UQSB 1NAKH 5FCUL 5HDBF 3OTTA 4CADB 1A4JB 3G5XA 1XFPA 1YY8B 5GJSH 5AC5A 2XKNA 3LOWA 4PG2A 2AJ3A 1C8XA 2P44B 4Y8AA 5DD0L 4PJ9C 3MOBH 5D6DC 5I71B 2JLLA 4OLWL 4G7VH 4OCYL 1UR2A 1BVKB 3RJDA 3P0VH 1BOGA 5F3BB 3H42L 5E2TH 3MLZH 4MA3B 1GYAA 2WZPD 5T1DH 4ONGH 1YEJH 2DQJL 5EU7E 1CLYL 1T04A 1MWAH 1US3A 4U1SB 1WDRA 4V2XA 4XNMB 1U95B 2GJRA 4P57B 3HAEB 3C08L 1NC2D 5J13B 1NGQH 1KB3A 5I17A 4D1IA 5LYRA 2CR3A 2VZ3A 4NQTA 5IVXE 1CR9H 2FCBA 3GEWB 2HRPH 3WLBA 1W0WA 4U1GC 3TYGL 1LK2B 1JGVH 1ZANH 2J8UA 5IJKC 2AS5M 1ZXQA 3FXYA 4PJCA 1CE6A 1MCRA 1NCBL 5CD5D 4MNHA 1FNEA 1YEGH 3GSXB 1CXHA 3HE6D 4MJ5B 1QHOA 3Q1SL 1T04B 5ITBH 4IS6B 2HJFB 1KULA 4ZTPH 5IMOB 4D0BB 1PX3A 1HH6B 3T1FA 3TP4A 1R3KB 4G42A 5I17B 5HPCA 4RAUA 4CVXA 2OSYA 3VX0A 1OBAA 1XZ0B 4GT7A 4XCFL 5ENWB 3WLBB 1K9TA 3MQIA 4JL1A 1SHMA 2VITB 1FFPB 3RBSA 4UU9B 4HU8A 3EJRA 1VERA 3C6LA 1CE6B 4MJ6A 4HA4A 4MNHB 5D72L 5F7DA 3ULVF 3VWKA 5IVXB 5FYJU 1OM3H 3HKFA 4HPGA 2Z1KA 4IRSB 1KELL 4X9BA 5J6HA 4HDIB 1E6ZA 3RU8L 2NY7L 3G6DH 4LCWD 1VEMA 4NQCE 1JHKL 5CUSL 4PEEA 1G6RH 1VFFA 2ZCKL 2E8ZA 5E24E 4ZSOE 4WKHA 2D0HA 4R2GB 1MQQA 3FTGA 2AJSH 3TC9A 5A6LA 4PJ8D 3DOSA 2VLLA 4HJ0C 1GGCL 1FO0H 3F5WA 5D7LE 4TSCL 2PTUA 1A6TB 4N8VB 2VLJB 3C6LB 1SYVA 4LHQB 1WK0A 3BVXA 3OGVA 3S4SB 2VDKH 5FO7A 5MEOB 3EGSA 1HSAB 5DFAA 1LILA 1I9JH 1HXMA 2GFTA 2VN7A 1XF1A 5KVFH 3SDDA 4NKOA 2EDLA 3WUWA 2EDFA 3OB0H 1J8KA 1ZL1A 1NQBA 3H9SD 3FQXA 3BN3B 3VXTB 3AROA 4LPWA 1XGTA 4BUGA 1J1OL 4PJFF 3OLDA 4TUJA 3MCG1 3W25A 4HIIA 1ZS8A 4LIQE 2EXOA 4JGMA 3F5WB 3WEMA 4NQCB 4IOIA 4YXKL 1ZK9A 3LKNB 4H0IA 3RNKA 5DC0A 4XP9H 2FWOB 4ZSOB 2IFFL 2FEDC 4ZMAT 4OCXH 4EI6B 3VMNA 1U8LB 4AMWA 2AW2A 4DJMA 1FRGH 3ARDD 4ZPTB 1PG7L 1T7XA 1V5JA 4ZOEA 5D7LB 5FYJL 4JJHA 2AEQH 3TTYA 2YR3A 1P6AB 1F3DH 1ISWA 1KT2B 5BV7B 3MJ8A 4RISL 5FEBA 4LQ1A 1C16B 1KPRB 3CUGA 2ZSWA 4Z77B 2OR8A 3VIMA 3BEWA 3WQ6A 5C70A 3UETA 2FX7H 2YWYA 3JVGC 4YHLH 1VFUA 3RY5A 5A69A 1QVOB 4Y4HB 5CEYB 3LMJL 5E00A 3W0WD 1Q6FA 4FQ2L 4JKMA 3FB8B 4U6YA 3L7EB 1XGQB 3K4DA 4KK8D 3SGEH 2ADIB 4MS8C 3QHMA 3C2AL 1NC2B 3DSFH 3LH2H 3FQNA 3BUBA 3DI2B 5JDSA 1ZLVK 4ZYKA 1CLCA 1FH5L 4L3EE 4JN2B 4K8RH 5FA4B 4TVDA 3JV4B 2WVTA 1W3KA 2YZ1A 2CDGA 3NSXA 1QRKA 2H41A 4S0SD 3O0RL 4WW2C 3T0AA 4HK3N 2OM5A 1S7RB 3WNKA 4L3EA 4OBSA 2X1PA 3NA4A 4X9GA 5E00B 2FLRT 2Y5EA 4TULH 4M7ZB 1QZ1A 1VFOA 4QTHB 5HHPB 4F15C 2TAAA 3HG1D 4F66A 4LCCC 4JDTL 4TUKH 3FCTB 3VRIA 3UZVB 1LO2L 3FFCA 3PGDA 4H41A 1MAML 2XT1B 1A7RL 4GAJH 3WS6C 4OJYA 3L3OA 4HKJA 3EO0A 2R2BA 5IR1B 3G5VA 2R1XB 4Y2DB 5JDSB 2HKFL 5HDBE 3UTQA 2HG5B 4RA3A 4ZYKB 2X4OB 5CEXB 2APTA 3IDYB 5CP7A 3V7AG 4ATDA 4H1LA 4YDLB 2GTZA 1SFSA 5ABFB 5EORH 4E5XB 1EEYA 5L2KE 5ILTH 1QPKA 1X4ZA 1Q72H 2ZUYA 4X83A 1BVLB 4R4FL 3ETBF 1W1YA 1TJIH 4ORZC 3ZMRA 4RNRB 4U3CA 3WY2A 3DI3B 3U46A 1WLHA 4L3EB 2ZKHL 4GW1A 2X4TA 5DK0B 3Q48A 4FQHB 3SCWA 5L2KA 5I1HL 4DVBB 4ZXOA 2BOBB 1FVDA 1O7DC 4OQTL 3BAXA 1XF5A 4LSTL 3GI8L 5IJVA 5HDQH 4JM4L 4LARH 1PLGH 1RIUH 3RWDA 1EPFA 1U36A 2R4RL 5EIIB 2GTZB 5DD3H 1T03L 3GO1L 1OTSD 1ZOXA 1V6WA 2E27L 3BKYH 4WDIB 4NHCL 2IGTA 1SEBB 4F58H 5IHSA 3VXPB 5MHSE 1J1XH 3BVNA 4PLNC 5L2KB 1HK6A 3S96A 3BQUB 5IIEB 3UR8A 2F2HA 2VDNL 3O2DH 3IDNB 5TF0A 1XF5B 3DGGA 1TPXB 5SX4H 5B38G 3K74B 3BJLA 4HS3B 2MQ3A 3RWDB 5EN2A 5I8OH 1N7MH 1S78D 3TO2B 3DVGA 5EFIA 2NNAA 4HWBH 2WMIA 1DBMH 3CXHJ 4JZOA 4N90E 5LAXB 4C56E 3W39A 1UH2A 2X41A 4AG4L 1CLVA 3SY0A 4NZFA 32C2B 3T65B 4DFIA 2VQ1B 3LKPA 5B21A 1MJJA 4S0TD 4KI5C 4L3CB 1JCKA 5FUCC 3W11D 4KMLB 1HIMH 1X5LA 5F1OB 3ARDB 2XN9E 1HEZA 1G7MB 1GQKA 3FFDB 4UDUA 3VGAB 4XZBA 4WI9A 5EZLB 3HG1E 4U6VH 4OCWL 3P3YA 3MLRH 2AQ2A 3VXOA 3X3GH 5BYWA 5EN2B 3KR3L 2NNAB 3ULVE 1LG1A 4XP1L 4P7RA 2B8OT 1ZU8A 3KPSE 5FECA 3PWUB 3CVIH 8FABA 3LKPB 4HZ7A 5HY9B 1OF2B 1ONQA 3MUY1 2XZQH 1DLFH 5HVGB 1OD8A 4M6OH 5L6YL 3IKKA 4C56B 4OGZA 2R0ZH 4G80A 4P8XA 2Y5TB 3UTSE 2BC4A 3KPSA 1P4BH 4L4TE 4Q9BA 5CGYC 1XD0A 1D5XA 2P46B 4U1HB 3O6MH 2FSEB 3EYQD 1G7PA 1A6ZB 1T1XA 1DBKL 2G60L 3SO3B 3MO4A 4U6HA 1T0PB 2R69H 1AQKH 2XN9B 4KVNH 2F8QA 5TQ0L 2CIIB 2FNBA 4LMQE 4L4TA 5MERA 3NCEB 5KW9L 3HG1B 2A73A 3LRSA 4RRPA 5GGVL 5IFHL 5EU5A 1ONQB 2C9AA 3QUMA 4LEXL 4HKZA 3RWFA 1OAZH 3M17A 1CGSL 2M2DA 3WQ4A 5I2IB 5JA9A 4PJFE 4X4MA 4F37F 1A21A 3ZKXB 1IQWL 4MDOA 1D5XB 2Y1VA 4PJ5D 1NPUA 4GW4A 4I0PC 1I75A 3LQAH 4KJYB 4TQEL 1KXVA 4B9ZA 4AWEA 3LEXA 4DCQB 3DUHA 3HR5A 4U1LB 1FNSL 2R1YB 3UTSB 4UQAA 1EA9C 1MFAH 1SMDA 5KVGH 1U93B 4TVPH 1K8IB 5C08A 4M1DH 5DJAA 1Z2KA 3TBWA 2Y25A 1MEXL 1P9MC 2ENSA 5LA2A 5F93C 5EU5B 4MB5A 4HKZB 1KEGH 2AJUH 3CFDB 3U0PA 4P23D 1I1AD 4PJXF 4W7UA 4U0QB 5IV2B 4U31A 4KTYA 5E8DL 4RFOH 3MMEA 1DN0A 1FFRA 5IKCB 1FIEA 4QRRE 4ZFZB 3N9GL 4NO3B 4ZUVB 4BQ2A 4GW4B 3CUIA 4YHPB 5TQ2L 5CEZE 5HDOA 5HHMD 1J0HA 3NBNA 3TFKC 3KYMA 4PJFB 4ZS6D 4LSDA 5FGBC 1ZHNA 3HR5B 1RUKH 2W92A 5HGHA 4LDEB 1JWSB 4YN5A 3IETB 1AY1L 1OPGH 2NY4C 4PD4K 2CHNA 2D23A 4XP4H 5J56B 3QIBA 1XR8A 3KLSA 1RMFH 5GGTL 3QXDA 3WIHH 4KQ3L 3FRUB 3U0PB 2NY5H 3LZFL 3U30C 2HVMA 4C7FA 4YHMH 3W0KA 1GGBL 2V5MA 1S7WA 4O4YL 1PIGA 5BZDA 2X4SA 3ZM8A 3BESR 1IC7H 1FAKT 1MIEH 4E4PA 1I9EA 3PG2A 4H88L 1EO8H 1N26A 3PQYA 3ALFA 3T8XA 4R7NB 2XFYA 4GO8A 2HJKB 1CDGA 1ZHNB 3ULSA 2XIIA 1H09A 1A7OH 2GDVA 3SE4C 4JO3H 1WIPA 4QRRB 1QLRB 3IFOA 4X9YA 4A3YA 1XR8B 3A6BL 4NM4L 3WUFA 3GMQB 4PRIE 1OCQA 4DKFH 4HSQA 4KUZL 1CE1H 5I76B 1OARL 3EOAB 4MAUH 1G9MC 1YUHB 5BZDB 1E27A 4MAYA 1K6QL 3GSWA 1MHHA 4JKWA 4PGDA 2FIRT 1G7QA 1ZVSB 4R26L 3P40A 3LRHA 2F1AA 1J10A 5I19H 3D51A 1YEKH 3RRQA 5LGJB 1R3JA 1A5FH 5E99H 4PGBA 4WWKC 3OJVC 2QV4A 5KAQG 4WV1C 3VE0B 4DAGH 2XTJD 5DURD 4CBPA 1ZBKA 5JPNB 2PW2B 4RMWA 4NP4H 1S9WB 2VZUA 3QXAB 5DR5L 3V6BR 4NQXB 2MFNA 3RQ3A 4PY7A 4D6HA 5JQHC 4I1NB 1E5NA 3CFIC 4MAYB 4YEFA 4ZE5A 3W26A 2V2XA 4D6EA 1FG2B 4WEMB 3BN9C 2O26U 5INCA 4PGDB 5HVHC 4PRIB 3RTQC 1V8HA 2G2RB 4OD1H 1O5DT 5EULV 3SKNB 3FO2A 4FRWA 3QIUA 4W84A 1INDH 5EUOA 3C8KA 4UILL 2Z31D 1WF5A 3OKOB 1W8NA 5C0AD 1L7IH 3DROB 1RHHB 2EJ1A 1W72L 2CDFA 3EJUA 1ZBVA 3L1OH 4GIAA 5JO5B 1OSPH 3HZMB 3RY4A 1H2JA 3DGCR 5AZ2H 1UT9A 3HC3H 2Y6SD 4ZFOA 2V2XB 5D1ZD 1V0KA 1AQ0A 2BMKA 3CAFA 1MCEA 3WLWD 4JFHE 1RP9A 2H9GA 2ED8A 4L9LA 1JZ7A 4JB9H 3RAJL 5LQBL 4X4YA 4FQJH 1T4KA 3AUVA 3WFDH 2I9LA 4QXUL 3MUGA 4P2RE 4DOHE 1IEBB 4FMFA 1XGUA 4OCNC 3MRQB 3BSHA 4U1JA 1A7NH 2DKUA 4TRPL 2WBJB 4NM8L 3PZNA 3MNVA 4AY0A 2XQYG 4NRXA 3NABH 4YHYC 3MBEB 2IH1A 5JDJA 1FG9C 4JO1L 3QZWG 3VG9C 3HC0A 4OT1L 4WNQB 2BDNH 2DKSA 3DX3A 3GH7A 3SHSA 2CO7B 4HFWB 4A6YB 2OTUA 1I8IA 4FQ1H 4ZODA 3CTTA 5DJDA 4G8GA 4GXUM 1CYGA 1OT1A 1UXSB 4X6DA 4UCFA 1BFNA 1BGXH 2F74A 4F7CA 3OZOA 1QYGH 2C3VA 4PREB 3L2LA 4D72A 4UQ3A 3B43A 5E0FA 3AHXA 1N8ZA 4P2RB 1XCWA 4GUPA 4DOHB 2WBKA 3O2WL 2HAZA 1G9NH 1QFWL 1RZKL 1OQXA 5F72S 3OKMB 2A3CA 2GKIA 3D6GA 5AUMA 2AXJA 4ZOCA 3UTZA 4HQQH 4B9YA 5I79A 4BFIB 4NKIH 2EBNA 1FV1B 1OAXL 4PCSA 4JY5H 4NO5A 3X13A 1W1PA 4L4PA 4GRLC 4M43L 3IFNH 4J7RA 1J0ZA 1FGVH 4WHCA 2Q20A 5K9JL 4DN3L 5A95A 1URLA 4CD4A 3PWPA 2F74B 3CZLA 4LSRL 1WFUA 5FGRA 3A5VA 4PMZA 5IROA 4K3JH 3WELA 2OYLA 3KLHC 4X98B 2J7GA 3IJ7A 3OF6A 1E0OB 4LSUL 3MRGB 3MZTA 2J79A 3GNOA 3WCYA 5AUMB 1U58B 3VGDA 3VG0H 2A74B 1JGDB 2CRZA 1AHWC 1CLZL 4PJXE 2HVKB 5JW4M 1U30A 3TCLB 3S7GA 4WLCA 1JNNL 5FKAA 1A3QA 2YLLA 4PLKD 4XCNB 3W82A 3MLUH 4X99B 1RURH 1S9VA 5ALCH 3MRDA 4HD9A 3RZCD 5HGDA 1NL0L 5A3IC 4LGPB 4PJXA 3T4YB 3REVB 1Q9WA 3JWDC 5MP6H 2YOCA 3LMYA 2DDQH 5FA3A 2X40A 1QFOA 5AG9A 4KRPD 2EIZB 5C9KA 5JTWA 4AMCA 5AYUL 3MV8D 4RMUA 1GOGA 5JR1L 5FCZA 3QHFL 4ZXBA 2YPKB 2DH3A 2V7HB 1Q9LB 4TSAH 1VSCA 1M04A 1WZ1L 3LS4L 1MJ8L 4DK3A 3AMGA 1GJUA 3KXFE 2UVEA 1YY9C 1TQCC 1I7TB 2K7PA 4KZEH 4W4NA 4NN5C 5HGDB 2YXFA 4KMQA 4PJXB 3SBWA 1BEYL 1Q9WB 5D1ZB 2K7QA 2IPUK 5IBUG 5TPWH 1IGJA 3FL7A 4KH2A 3HC4L 4J3SA 2R29L 4NRZA 1A9BA 4KK5D 3LHPL 4ZXBB 1DDHB 5D7KD 3V5HB 2FO1A 5E94B 3DDFA 3W53A 2JJVA 4N0FA 4PJAF 1CXLA 3SJVD 1DANT 2EDNA 1MNUH 4NRRA 5E8OB 3MXWH 4D6JA 1SBSL 4NSKA 1HNGA 5I18L 2NX5E 2QBWA 2AEPL 5ICYA 3WENA 4HW6A 1CD0A 2IQ9L 3LEVH 2X70A 5GRYA 4AZBA 4JY6A 4JHAH 1JGUL 4LFHG 4AZIA 3KXFB 3BAWA 5E2UL 4HK0A 3VJ6A 3PNWA 1YEHH 3AM8A 3OXRA 1LD9B 1RFDL 3VFSB 2NW2A 2OQJB 3ARRA 5HHOD 5BS0D 4M4RA 3MX0A 5EZOH 4GMSH 1CG9A 2NMSA 3PV7A 2DT0A 3QULA 5I30H 1V0LA 1FAIL 4YIQB 5IBTL 1C91A 2WAGA 1QO3B 4AZCA 3EO1B 4LKXA 5A8MA 3SUTA 4N0FB 4MDIB 1CVSC 1FA2A 1NEZB 3RM9A 1QI3A 1MJUL 2ZXDA 1UZ1A 2XIBA 2JELH 1B0RA 3UC0H 5A2FA 1U8MA 2C7UB 3KPRD 3QBTB 5A2KH 4KTEL 3UYPA 5LKNA 1IGYA 1IEAA 3C5ZC 3ET9F 3QDMA 5CD3A 5D1XC 3S34H 3T2OA 3GXMA 4NRYA 4YPGA 4JQIH 2WWKT 2BSSB 2NX5B 1BD2E 3P0YH 3BJ91 5I8EA 3T1WA 1M71A 4GRWF 3RNQA 3A6OA 5LVEA 3PL6D 4ACYA 1SJHA 2HTKD 4IRJC 5AZEL 1EH9A 4LQFH 4YDVA 3RDTD 3V4UL 5JW5A 4J2XA 3HS0B 1UD5A 4XNYH 1EO7A 1BD2A 2DWDA 3MRNB 3ARED 3CPUA 1DZBA 4ODHL 1IEAB 3PP4L 3CDYA 3MV7E 3P77A 3O6AA 2A1WH 3S88L 5DD6B 5DI8B 2OI9B 3T0ED 4XNZC 1HKLL 1XT5A 2X7LA 5IG7A 4IHOB 4HU0A 1NBZB 2MWCA 2ZG2A 4QXTB 4XAKE 2G9HA 4MSWB 3U4BL 5FIPA 1I85C 3MODL 3QYCA 4KVCL 4HOXA 4MQXD 2WKGA 4Z76A 4RWHA 1U91B 5KVMC 2HP4A 2VLRE 3CVHA 4YDVB 1KYOK 4L8CA 1ZLWH 4AW7A 1BD2B 3RL1A 1S8DA 2IG2H 3VDBA 3KPNB 4OFIA 2W4XA 4NX0A 2V38A 4HUXA 3RX8A 1G0DA 1X4XA 3GSQB 1NCAH 1WZLA 1U6AL 2VLRA 1EMTH 4LPXA 4RGMB 2X7LB 3BE1H 1UVQA 1YEIL 3DIFB 4OLZL 4NQEE 4UAOB 4JPIB 5IG7B 5C07E 3RKDC 3QR3A 3VTRA 3TO4D 2XVLA 3CMJA 3MLVH 4HIXL 5C0FB 1OGSA 2D7OA 1GZPA 3QCUH 5T1KA 1R75A 3H9YA 1W0VA 3MV7B 3CUFA 3UERA 1JNLL 5TDOB 1CXFA 4WW1A 5DGQA 1C7SA 1KTLA 2NXZB 1DUYA 1JWMA 2VUYA 3QQ3B 4Y5VB 3CVHB 5C07A 3RI5K 2X4RB 5CIPA 1B30A 3RL1B 5EPMA 5ERWA 4XPAL 3MLYH 1JNJA 2PO6B 4JHWH 2MTPA 3E3QC 2ZJSH 2R9HD 3LS5H 5HYFA 1YDPB 3AMLA 3NCJL 1P53A 2NY6B 5E2JA 4L4OA 3PZVA 1ND0A 3QI9C 1JF6A 5EA0L 2XYLA 3L4VA 2EADA 2VKWA 1IGCL 3EOTH 2WNGA 4JPVH 1R5VB 2ZX5A 5E9AA 2WMGA 3AHTA 1GZPB 5T1KB 4WW1B 1IGFL 4P9HC 3APGA 3GJFK 4OFVA 4PR5B 5C07B 4NQEB 4LSVH 4URTB 4JHBA 3GRWA 1FOBA 2H26A 3KPQB 4PRWA 5EBWA 3MJ9H 1F8TL 1G9MH 2V5YA 1GH7A 2R4SL 3CX5J 3TLRA 1GCYA 4PCTA 5BV7L 4HMCA 1UYWH 3TJEH 3SDYL 4ENEC 3CPLA 1EHAA 5KS9F 4OIAA 1XCTA 3F7VA 3NH7H 4QCIB 4XB8A 4GKNA 2YBRA 5CMAA 3VW3H 2BY2A 3BPLB 1HHHB 1Y6NR 3STBA 4PJIA 1LEGA 4ONHB 3D0VB 4H25A 1KBGL 4YC2C 3I6LE 1NBYA 1AO7E 4LPCA 3IJYB 5DMJB 5HGAB 4PV8A 1WBXA 1JPTL 4HC1H 2YD8A 5DJ0B 4LIQL 5KZCD 3TZVB 2WC4A 4HZ8A 5KEZA 5CP3A 4XRCA 5EC2A 2H26B 3K1DA 2NLJB 4HG4J 1ZSDA 4I3GA 1F6LL 1ERNA 1AO7A 5EBGA 3D3VA 3JUZA 3KJ4C 1QNZH 1TMCB 4P2OC 3QDHA 1XMWA 5L0QB 1XCTB 3F7VB 4XPFH 1T2XA 2P5EA 3MCKA 3IANA 1RUAL 4U4BA 2VQUA 5FYKE 2DTMH 4MXQC 2VWEC 1BVZA 2AK4D 3BP4B 4OIIH 3RDTB 4H25B 2JJTC 2UUDH 1II4E 3QPXL 4XMKH 4FTVE 4JFWA 2CLVA 4JDZB 4P48A 4UQ2A 4Y16A 4JLRA 4YDJB 3RWHA 2IGFH 3FKUS 4LLMA 1NGXB 4WTZA 1CIDA 1GSMA 4D71A 2XA8L 1NARA 3UJTH 4QHMA 1KJVB 1ZSDB 3GMRA 3DMMD 1R34A 1NAMA 5F89B 3ARPA 4NZDA 1I8MB 4W89A 4FTVA 2FX9L 5A6MA 2ITDA 2YMXL 1AO7B 1KB5H 3WNPA 4KHXL 1MCIA 3QQ4B 4PJAE 4MWFA 4WY7L 2DIEA 1CIUA 1BREA 2ZPKH 3QFJD 5IW6B 1A3LH 3MV9A 3PIQA 1HKMA 5IUSA 1YNLL 3VCLA 3UPRA 1KNOB 3SDAD 5DMKA 4AY1A 3TGXA 5BJTB 2CERA 4Y16B 2A6KA 3WN5C 1LE9A 3ZHDA 2DI7A 4LLMB 1MLBA 3TT3H 4CN1A 4P7NA 4HIJA 4XXDA 3O4LA 5T3ZE 1F4AA 3D5HA 5C0BD 1T3FB 2PCPA 2DS4A 5INDA 4TOYH 5GS1A 4UQCA 5HDLA 4JFFA 3VFNA 5H35A 2EDJA 2YPLD 3TO4B 3VFUA 4XC1H 3WO4C 2YUXA 5IGXL 4F80A 2E6JA 5IHZB 5F6HI 2YDSA 1ZHKB 3GK8L 3PWVA 3PIQB 4G3YH 4DWSA 3I6KB 3HNVL 4IDJL 3VKKA 4B41A 3EBAA 2EH7L 5E9DA 5D1QD 1KLGA 4Y89A 4CL7A 1KOAA 4PJAB 5EBLB 1UFUA 3QEUA 4Y4FB 1YQVH 1MLBB 3F58H 1BPVA 1C5BL 1EOMA 3O6FB 4WUKL 3ZE2F 4GRWE 1R5WB 4NJ9L 4QO1A 3OKDA 1PS3A 3V7AE 5E8PA 3PZOA 2J7CA 5H35B 5DUPL 3AIUA 2F5BH 5D9PA 3AIVA 1DP0A 3AB0B 2AXFB 2DQHL 3EYFA 3CX2A 3ISWA 4JQVC 5CCKL 1XV8A 2AGJH 4R6UA 3TVMA 4GMTH 4OM1L 3WIFB 3L5JA 5KSAB 3EDFA 1JZ4A 2NZIA 5J1AB 2EC9T 4X6FB 1ADQA 1EGJH 3OKEA 4I2XB 5IHUH 4GXVL 4PV9B 1TA3B 1RI8A 4YBHA 2N7BA 1TJHL 3BZ4B 2VDPL 3HPLB 5KAQF 4JM2D 1E4KC 4KMTH 1GGTA 3ZL4H 3C2SA 3ZKND 15C8H 4LLUB 1U8OB 3B5TA 3MRMB 5HI5D 2CBJA 4E8CA 3VU2A 4IBLT 5SV3A 3KLLA 4UB0H 5D7JD 5CZVL 2W9DH 1YYMH 2NY1C 1CXKA 3NZ8A 1BX2A 4GRWB 3O9WD 1KR0A 2E7CA 3PDOA 4H8WH 5H94B 3A22A 3U6RA 3OAZH 1LO4H 3AY4C 3HE7D 1XF2A 4KTDH 1BFOA 3DETD 2WMHA 1PYWA 1BQLL 4F7EB 1H0IA 1MPAL 2J74A 2WC7A 1OWQA 2Z8SA 1MRFH 3BPNB 4LXFA 1C90A 4RFNB 4GAGL 4P5TA 3DV6A 1L0QA 2IPKB 1KXQE 4UIKH 4UINL 2YDQA 5BQ7A 1N4XL 1HJWA 3SKMA 2J6EA 4OCSL 2FZ3A 4EI5C 1M6OA 2WP3T 3PDOB 3RVWD 2RBLA 4IUGA 4OB5H 1U33A 1X5JA 2YKLL 5FUOH 4UIMA 1HH9B 3CLFL 1A64A 1ITCA 4Z0XB 5DMIL 3H0TA 2X2YA 3ULVL 1XGYH 1FYTA 1Z5LA 1QR1A 4WUUD 2AABH 1ZA6B 1YQ2A 1CFQB 4XCYB 4K94L 1U3ZA 3WFBL 1K4CA 4FFZH 4QRUA 1FJ1A 1CZ1A 2XWEA 1UENA 2E3VA 5TGBA 3QA3B 2V7NA 3AFLA 1ZS2A 4GXUN 3RWGA 5FO8A 4OBRA 4ETQB 1JPSH 4M9PA 5B38B 2FZ3B 2RGMA 5FOJA 1B4JL 1GOHA 1NCDH 5JXEA 1TVBA 3W38A 3X11A 4J6RH 1KJ2B 3DHMA 3T0VA 1D6VH 4PG2C 5F3HB 5KS9E 1ZT4B 2XM1A 2A3HA 4O2FB 2ARJA 2NY2D 2QQLH 3N1AA 4OGXL 4CJ1A 3PZIA 3NA9L 1JN6A 3IRZA 2H3NA 3RWEA 1TZHA 5DRWA 5F9WC 5F1SA 2V7NB 3W29A 3MA9L 2XM2A 1AGCA 1KEMH 3RWIA 5KS9A 5IMKA 3OMZA 4HT1L 4QF1A 4O02H 3R4DA 2FJHB 4XNXH 4WTXA 3RZWA 2GK1B 3RP1A 2IAMD 4R90H 2ADJB 3BIKA 3VGFA 1U8PB 2FRGP 3ZO9A 2QQKL 2DI9A 4J8RB 5DEGB 3S35L 4Y5XA 2IPTL 2BFVH 3VFOB 4XP5H 4YXHH 4NT6A 4PBWD 4X7FC 1F42A 5DJ2B 1MJ7L 4XAWL 1UCTA 3T04D 4AJ0A 5JW4N 1DQMH 1I7ZA 1PGRB 2OL3H 5D7IA 3RWEB 2D0FA 1UJ3A 5HI3C 1NJ9B 2WWDA 1SEQH 1BZQK 5F1IA 3RWIB 1EFXA 2VXSH 1OCWH 3DX7B 1IM3B 4QF1B 3VGGA 3BUTA 3F7RA 5H2BB 4OTXL 5FFLA 4NYLB 5CEZL 1AI1H 3MREB 3D39A 4BQ3A 2DICA 1I7UA 4K9EC 4MCYB 2FHCA 3OAUH 1MAJA 2D9QB 4M8VA 3STLA 3WNLA 4QT5B 1A3HA 1IT0A 1KCUH 4JN1H 4Y5XB 2EZ0C 43CAA 3QUYB 1DUZA 1L0YA 4NT6B 3NPSB 4YO0B 3MLXL 4ZQKB 5JBFA 4PSRA 1BF2A 4Y4KA 5D7JB 4NHUB 3WFCL 5M3WA 1NCNA 1MRDH 4S1RH 3C60A 1T20B 5BXSA 4WUUE 1W32A 2PTTA 2WVVA 5DT1H 4V2BA 1B2YA 5EIVA 1N0LA 3BH8B 5E4EC 2V2WB 4K2UL 2A3BA 1GIGL 1IARB 3CDGA 5ID1A 4PG9A 1D6EB 4L3AA 1NQ6A 5A16A 3F7YA 2MMXA 4MQ7A 3WN6A 2C5DC 3GIZH 3Q6FA 5HYJD 3VWKC 3PHSA 1NGWA 2BVPA 3MGAA 3BEVA 3P30L 3WHE0 5LA1A 1EEZA 4Y4KB 1A7PH 1GONA 3HRZA 3LN4A 4XXCA 3KLAA 4PP2A 1ESWA 1KTKE 4P2YA 2RCSL 1HWHB 1V7ML 3B2UD 3C60B 2HKHH 1MLCB 3FNDA 1B2WH 5DD5H 2HLAA 3SDXA 4JANA 4FQCH 4UQDA 5ACMA 4PG9B 3ZE2E 1P7QA 4GG8A 1KC5H 4DGVH 2ICEA 3N1PC 4WUUB 2IANA 4HUKB 3CO4A 3FZUD 4ZEPA 1TZGH 3HI1A 2IXUA 1FC2D 1NGWB 1RJYA 2EICA 2X9YA 4GFTB 3C5SB 3SDDC 1WCGA 4OD2A 5DTFA 3CUJA 3RPIA 1V6UA 3LN4B 4NZRL 3G9VA 4HWZA 1UWGL 2XSBA 3UEZA 1U2YA 1UD2A 3ARBA 1D9KA 5TE6L 4Z95L 5JQ6L 1R87A 2VSCA 5JORA 1P7QB 4M93C 3HE6A 2ICEB 4TSBL 3NYDA 5I1AB 1OB1A 1I1YA 4TUOB 1T6VN 2AERT 5F97E 3QUXD 1TQWA 1OAUL 2PYED 1MWAA 5TD4A 3G6JF 5DTFB 1N0XL 3DRTB 4FP8H 3GYCA 2YEZB 4XPBL 4MNJA 5CAYB 1JPGA 3UR7A 4KUCD 1CD8A 3L3GA 1IMHC 3SCRA 1P4LB 3EJPA 4NI3A 5H37G 2IAMB 4A6YL 4B15A 5D6CA 4P4KA 1FIGL 5F1NB 1D9KB 5EO1A 3UTPD 4KQ4L 4X0KA 1ZE3C 3GDBA 4HJJH 4EJ1C 2CIKB 4JRXE 1N6QL 5EOTA 3SCQA 3MRIB 5I1GL 3MFFB 3DURB 4XPTL 2GJPA 4NQDE 4Z8FL 3TN0A 4JVUA 4XMLL 3ME0A 5C0EA 5CBAB 4LCWA 1QI4A 4KXZH 4TXEA 1HHGB 1K2DA 4JO4L 5BZWA 4M3KB 3BRDA 5E2WH 1E0WA 3TBVB 4Z78A 3IDYC 4BZ1L 5DEFB 4PJ8A 4A3HA 1JPGB 1ZT1A 4NQDA 1LP9A 3N0PB 1ZEAH 1UEMA 2VMFA 3VWJD 4BCEA 2XZCL 2BVYA 4EUPH 4GLRH 4RMVA 3ULUD 1FN4A 4OD3H 1KTDA 3HTLX 3HUJF 4P4KB 3BLBA 3SURA 1WZMA 2IMNA 1WTLA 3QWRD 3PZUA 3DO3A 1UA6L 3JUYA 5CJQL 5EOTB 1CVRA 1ZLSL 2FBJL 1R3HA 4N8CH 4PGEA 4BA8A 3FT4A 3TN0B 3QO0B 1SYSA 1EXPA 3H9SA 4PTVA 4PMVA 4JFDE 4KFZC 3L4YA 5C0RL 5GHWH 4JRXB 3R8BB 4JFTA 1G6RA 1OP3H 1EFQA 1E6SM 2WHMA 4NQDB 1EAPA 3ALWA 1B6UA 4N68A 2B5IB 3MLWH 4JFDA 5E1AB 1O7AA 2F7PA 4KDVA 4MLSA 2CGRH 5KVEH 2X6MA 3NACH 5MEPB 1GQIA 3MBXL 5FF6B 1ZHBB 3BZFB 4H20H 4XGZB 3PXJA 1QNSA 4YHZL 3FT4B 3ARGB 1GHFL 5EFDA 1C8PA 3GXIA 2XPGB 4OAWB 2DLFL 2O5ZH 3IDIA 2OTWB 3JXAA 4FHBD 3DXAE 3W5NA 4GQ9H 1CI5A 4QWWC 3GUTA 2J1KA 4J3UA 1I7RA 1QFWI 3BMVA 3D85D 2FR4B 2GIYA 3BGFC 3QXTA 3W0WA 2A0LC 3EJTA 4JFDB 4FN0A 2GUOA 3QZWB 1FO0B 5D2NE 4ESKA 2WMPA 4CW1A 4MNQE 2DH2A 2F58H 4OOUA 2FIKB 4U0RC 4OLYH 35C8H 2BZDA 3SGDI 3F5LA 5CJXA 2Q8BH 2Y8KA 4MVBD 2CKBH 2AXGA 4NZTL 3RWCB 1WVZA 3OHXA 4RQQB 5D2NA 3RWJA 1L6ZA 2Q76A 4OLUH 1FHDA 3MXVL 5ADPH 4OM0L 4MDJB 1DFBL 3MCLH 3AIQA 1I7RB 1Q1JL 4PIRF 1I9RH 2A83B 3SDCB 5FK9B 2AK1L 4WHYH 3NTCL 5A2IH 1CD9B 4WU5B 2QSCH 2WSPA 4P9MH 2WK2A 3DXAB 5TH2A 5DJYB 4X8JA 4P3DB 4U1KA 2PXYB 3ARFB 4NOFA 4ZNEE 1GOMA 1KPUA 3MNZB 3EDJA 1NP2A 3O6KL 2JB5L 3G5ZB 4MQTB 1IRAY 5CJOL 3UG3A 3QOKA 2ICWB 2QQNH 2E7BA 3MACL 4JZNA 2I9TB 3DX4A 5E6ID 2B0SH 1P7KB 3N85H 4ZTOL 4LLWB 4W8BA 4MADA 1NUGA 2AXGB 2WCGA 3SE3A 4MNQB 5GNZA 3EJYD 5SWSE 4ZFGH 3DVFA 1E28B 1H8NA 3LSOA 5GSRA 5I2UA 3PTMA 1LO5A 4M81A 4EQ3A 2D31A 3DX6A 4TYUA 2APXA 2DQIL 4DUVA 1CDUA 4OFPA 5DJXA 4P5KB 4R97B 5FB8B 5TJWK 2NY3C 3HI5L 1N3NB 3QPQC 5F9OL 1T5XB 2J12B 4PTTB 1Q0YL 3BP6A 2F54E 1QEWB 4R9HA 3GKWL 2CCRA 1A4KB 3T3PF 3ZHKA 5IMMA 3LB6C 3VWJB 1E3ZA 1MFNA 4PPTA 3PV6A 2PN5A 3L9RB 3V5DA 2OZ4L 4ZUUA 3UJIL 5CFHA 3A4XA 3BT2H 4Y1AE 1ACYH 4GSDL 1DBBL 3DX6B 5CILL 4IMLA 2ORBL 1CK0H 5KSBA 5I1LA 1JGLH 2L4OA 4IMKA 4YHKL 3K2UH 3QFDA 3RCNA 3I6GA 5SWSB 4O2EA 3KYKL 2VDQL 1J5OL 2ZWLT 3H9HB 4W85A 1JFHA 2B39A 3CC1A 4Z2LA 4QYOB 3L5XL 2UYLB 4NC0B 1KJ3L 4PRNA 4NKDB 3O6LH 2EXWC 1XSJA 3IK2A 2XWTA 3JBG7 1JWUA 1XRVA 4JRWA 3EHBD 2FGLA 1KXVC 1YEEL 3C5JA 2FO4A 4HLZG 4YXLL 1L0XA 4KU1A 1FVEA 1JL8A 3GBML 3UJJL 3I75A 3WIIH 5IBUB 2F54B 3BIAX 4C54A 1VFAA 5HVFB 4KJQD 3U7VA 4ODSH 4EKXA 5A43C 1LWHA 1IAOB 1XF3A 3G6JE 4LLYA 1X7QB 5I9QC 4NUJA 3TCXA 5DK2A 4JEGB 1NFDF 5F1KC 4M61B 3QHOA 4Y1AB 2CK0H 4D9RE 3INUL 4YQXL 2W0FB 2P7TA 3CSPA 2QADB 1BBJA 3O2DA 3V8OA 3W2DL 4CGTA 2XKSA 4FZ8L 3HHRB 5C0NC 4M48L 3DBXB 2MPAH 4KV5F 4HWBA 2DLTA 3P4MA 4HGMA 4HKBB 3SE8H 1JTPA 3N17A 3ZYZA 5SWQA 3FN0H 2VE6A 5F88B 3QIBC 3E6FA 4AIUA 5IMLA 4O9HL 2QR0B 1DQQB 3FOLB 1DR9A 2EACA 1INQA 5DUML 2OCFD 2FDBP 5TF1H 2AJVH 2RGLA 1NM9A 3B9KB 8A3HA 3DUSA 2NY0D 3G6JB 3HUJE 3VIGA 1BBJB 3B83A 1K3IA 1J9CT 5DDHB 2DLGA 3V4VL 1RIVL 1XF4B 1AP2B 1QPPA 3TYFB 4DZBB 1VEPA 1OAQH 3KDMB 3OXSA 3ZTNH 3V6ZA 1BG9A 3LKSA 4K9EH 3WD4A 3BUYA 3EO9H 4LLDA 3LVEA 2HLFC 3CH8A 2YJQA 3D25A 2H2PC 4CCEA 4J27A 1BECA 3IDMA 1HXJA 4XCEA 3CMGA 5M03A 1QOXA 5CLTA 3EYOB 1RIHH 4WFED 2GJ6E 4MAYC 2ZWYA 2NW0A 1XGZA 4XBEL 1Q9OA 1LEKB 1DCLA 4NOBA 4AZHA 4YFLF 2EKSA 2OW6A 3QEQD 4WW2F 5KOVC 1D5BB 1C12A 2AI0H 2OMBA 2R56H 1UB6B 1PG7X 1EDTA 5GS0C 4YWGL 3V6ZB 3O2VL 3HUJB 2YWZA 3S36L 4NN7C 3AVEA 4P23A 5FYKU 1I1AA 4WI3A 1HN1A 3U9UA 4XPGL 1BBDL 2GHWB 3RGHA 1RUQH 2DD8H 2B20A 1JFXA 1T1ZA 3UTOA 2PUQT 3HMWL 1KN4L 4C4KT 1Z9MA 1G9EA 3DO7B 1IVLA 3K8KA 4HUWB 4XBGB 1DWGM 1OOAA 2EDTA 1CDBA 4MAZA 4TVPE 1AR2A 4XI5C 2O61A 4TUFA 1Q9OB 5GGSB 3CH1A 4Z7OE 1FPTH 4I77H 3AU1B 3NOIA 2UY4A 2IXVA 1MCHA 2BNRD 2I25N 2RB8A 4JFOB 2C3WA 4UTAL 4WKFA 2DJ4A 2GJ6B 3QIUC 1HHJA 2CITA 2ERJB 3WL9A 1YECL 1PSKH 2NXYC 5KVDH 1E6JL 2JIXD 1TITA 5GZOC 2JK5A 1TVDA 3H3BC 4XB7A 1E1FA 3EFDL 4YNYB 4AIZB 2GSGA 2ESVE 2OJZL 1KIRA 2J7BA 1YPZF 4HUNB 4LHUD 3L4UA 1ZVYA 3N1QC 4HZ6A 2AVGA 4HK3J 4L8DA 1WWWX 25C8L 4PYHA 4Z5RB 2J7EA 4L9LC 4YDIH 2XRAL 2FX8H 4NKQB 1WC7A 2JCCF 2VZ1A 5FUZH 3JWOL 4FFYH 4PMUA 5IEHA 1ED3A 3L3JB 3BSZH 1ECEA 5FYKL 4CU8A 4PRAB 4HCRH 1R5IA 4ORGA 5ESAA 2G5BA 1K6AA 2CHOA 5I6XC 2C1PA 2X2IA 4ZO8A 5C0CE 4PJ9B 5JIHA 1TQBC 4H26A 3NDZA 1AD0B 2GSGB 5DYOA 5GIRB 1X6LA 4AEHH 4MZ3A 3OQ3B 4UV4H 2FJFA 4OZGA 3ZDZF 4LPUA 4IPNB 4OOZA 3UTTE 4Q22A 1EJOH 5CZKA 3MA7B 4HTYA 2ESVB 2XYCA 2CEQA 4WFFE 4N0CD 3T3PE 4XX1G 4WU7A 3L3KA 1HYSC 1E4WL 1YJDL 4XZUA 5EOCL 3WD5L 4GG6F 1HQRB 4G8FA 1MQKH 3FMGL 1J1PL 1PW3A 5FGSA 5E5UB 3S5ZA 4MS8D 5DJCA 2JJSC 4F7PB 1B1YA 4L4VE 3MR9B 3MC0A 1V3MA 3JZ7A 3A47A 5T3ZL 4JAMB 1ZGLP 1N5AB 3B9DA 5DHYB 5LBSH 4Y5YA 5C0CB 3BH9A 1NDGA 1TFVA 3FQUA 2RGSA 5IB4A 2Z31A 5C0AA 1UWQA 5GGQH 1E4XL 4NO2B 4L4VA 3CHFA 3BAJA 1A02N 3HU7A 5CHNB 5I1IL 5C71A 2VXUL 5DS8B 3UAJD 3PJSA 4XZUB 2OSWA 3B8YA 3HRPA 4JFEE 1VBRA 6FABH 4AQOA 2WAHA 4NNXA 5IROC 3UTTB 3EDKA 3EZ8A 4JFPB 1M03A 4Y7EA 4OGYH 4PBGA 4H1LH 3IJSA 4M1GH 1MUJB 5GZND 1Q94A 4NQSA 1NC4A 4WI5A 3EMZA 4NIKB 1NFDE 1M7XA 1A0QL 2J4WH 2UY7A 1WEJH 5E4IA 1J01A 1VESA 5IB2B 1V02A 2AJYL 1NDGB 1A6UH 2OR7A 4YDKL 5KOMC 3TH2T 1Z3GL 2DQFA 4LSSL 3VXRE 1LF1A 3ZKSD 2B1AH 4L4VB 3QIWA 2B2XH 2DBLL 1BP3B 3N15A 1JFQL 1FFQA 4WFHE 1HDMB 4AZ6A 1VDGA 3QCVH 1MI5D 1IGTA 4HXBH 4I3SL 4NKMB 1RZFH 5GRJL 5SX5K 1GOQA 1NFIA 2BSTB 1M1SA 2OJEA 3CC5B 3NIFF 4KV5E 4HH8A 4HJGB 5I16A 2OLHA 4EVNB 3VXRA 4N0UA 1UWXK 2D7NA 3W9DB 4YR6A 4WJXA 5GJTL 2N7AA 3WNNA 3BUIA 1QKZH 4ZXBC 2HJLB 1KG0A 4JFEB 3ILQD 3G08B 3GB7A 1F6AB 4Q97A 3RGVD 1LDPH 2DQFB 1QD0A 3R1GL 1OTTD 1YYLH 4JY4A 4LOUC 3F5JA 4FABL 4XCCH 3HZVA 3KPTA 1NFDB 3VXUD 1TZIA 4CMMA 1IGTB 1MY5A 5HHVL 3SBWC 3VFWA 4G8IA 1NFIB 3N9KA 5CJBA 4UFJA 2LE9A 3LIZH 2H2SD 4LPTA 3TV3L 5IT2H 4W6YB 5AG8A 4PTWA 2V17H 4LAJH 5LWYL 2D9CA 4ZO7A 4MB3A 4CD5A 3ZE0F 1AFVL 1QRNA 3GB7B 2F5AL 5DT5A 5CZXC 3FY1A 1L9NA 4HIHA 2BV9A 4LK4A 1GL4B 1KJ2L 1BLIA 4KKLC 1GXEA 5A2JH 5I73C 1IAMA 3O8XD 3MRBB 3S5LG 3STZA 4KI5D 4ZFFA 5LCVH 2WHLA 1UR1A 1AH1A 3WH9A 2DQDH 2P45B 2FD6L 4UZUA 4UUJA 2DIAA 3O4OC 2I07A 4QOKD 4GQRA 2VURA 2EDQA 2A77H 2BY1A 2GCYB 1V3JA 4LSPH 4NZUL 4MDPA 1YN7A 1MCNA 1GZQB 3K4AA 3AM8C 1W2KT 3RVTC 3WMBA 4HPOH 5HOSA 1RU9H 2LFGA 5FCUH 4O5LH 2WM0A 1I3VA 3DUUB 1EEQA 1X5HA 2EDYA 3RZCA 3U7WL 2XWBB 4PRDA 5TFSL 3STZB 1EV2E 1E0XA 3EOBB 1H3VA 4JVPA 3L95B 3X17A 2C7FA 3HLAA 3PHQA 4AEIL 3FQRB 4UUJB 3MV8A 3IF1B 4MNLA 3J8F7 3KGRA 4NQVB 1KSRA 5DWUL 3HMXH 2D7TH 4WHYG 3DX0A 3VXME 4D9LH 2W61A 4OLWH 4MXWL 1A1NB 4KK9C 4WW2B 3HMCA 5IESL 3AFBA 4OLXL 5HBBA 3H42H 1BM3L 4F15B 1O7VA 3VXMA 4LCCB 2ED7A 5ANME 4F7MA 1JP5A 5CXPA 1YPZE 3LPWA 3NFNB 4LMQI 5LG1A 3RL2B 1HI6B 2AQ3A 3U4EB 2JCCE 1CU4L 3OJ2C 4JJ5B 2V9TA 2R0WL 1XIWD 4OF0A 1HL9A 4I0PD 2ZNXA 3UPAA 1T0MB 4Q2ZB 2QTEA 1OGTA 5SWZD 3SJVA 4PJ7F 2ZXAA 4DM2A 1KB9K 3AXLA 5C6TL 1NCBH 2O5YL 1JHLL 3NN8A 1P84K 4Q9RL 5FXCH 3MI6A 3Q1SH 4O58L 1ORQB 3WH5A 1IC5H 1TVPA 4J3TA 1TVNA 3ZDZE 3KVQA 4X5WA 2GITA 4LHJB 4AENA 2P4AB 4H5SB 5HHOA 3SCVA 3VRJA 2ZG1A 5ANMB 1YPZB 3QNXA 4XCFH 1UZ4A 4PTUA 1EO5A 2KL6A 4GG6E 5JPMA 5KBNC 3R06A 2JCCB 1NCWL 4FLRA 1ULVA 3VXUB 2WUBL 5D72H 2HFGL 2E4TA 1IC4L 4F57L 1EDQA 2R1WB 1JK8B 1GOWA 3D0LA 1U8QB 2VLMD 4LEOB 4GG6A 2NY7H 5EOCJ 3QUZD 1FE8L 5CINL 1JHKH 3LXCA 2EYRB 2GITB 2ZCKH 5MENE 4U1IA 3VRJB 1T2QL 5HI4C 3PL6A 3BHBA 1MCWW 2GJJA 4ODWA 2P24B 2BP3A 3WMSA 4YGAB 2IQAB 5JMRA 1NANI 2HWZH 4PMNA 4TSCH 1JV5B 1MHPL 4JPWL 4CVUA 2J8FA 1EHLL 3L5WB 3AREA 4QRQA 1RJLB 3BD4A 1UB5A 2A9ML 1J11A 3PWJA 1JAEA 4WFGE 3L3DB 3T0EA 3MOBL 4N9OB 2W60B 1UKTA 3TV8A 1CICD 4R3SB 3PUCA 5AD0B 1IFHL 3DV4A 4AYSA 1Y0LB 5ACZA 3HB3C 5I1CH 5C2UB 4G7VL 4U5IA 1LNUB 1E72M 1GC1C 4YXKH 5E2TL 3NIFE 3MLZL 4FFVD 3IGUA 2EYSA 2IFFH 1CZ8L 5MENB 5I3DA 1S3KH 3O3DB 4WWKD 3WH6A 2AAVA 4KHTH 1OGAD 1PG7H 4BUHA 2MJWA 2I27N 4P46D 1UADC 2LU4A 3UZQA 4IEFB 4RX4D 1IT9L 5DQDL 2X0YA 4YHIB 5ACZB 1B0WA 3BN9D 4OZIB 1OD0A 4ODUA 1E70M 2ATPA 4L1DA 3AS3A 2E9BA 3LMJH 4Y16C 4AYFA 2PR4H 4LASL 3AXIA 5ISZE 3FQTB 3L5IA 3FB5B 5DZNA 3T2NL 4PMOA 3HI6H 5KJRH 4FS0A 1TCRB 3FB7A 3C2AH 4X6CF 3PP3K 1Q6EA 3ZE0E 4TN9A 3SE9H 1HQ4B 1HJXA 3AGVA 3AYRA 4I0PB 3HCVA 5T3XH 5ISZA 1FH5H 4BH7A 4YBQC 5FYJD 1U8JA 1MXDA 1ISZA 2Z0BA 3O0RH 3MKKA 5JLZB 2EAEA 1FP9A 4G7YL 5ETUA 4F7TA 4NCC1 2KQMA 1NH6A 1OIFA 1FZOA 3BPCA 3BDYH 3S37L 3OPZH 5T1LD 2GI7A 1GHSA 5HHQA 2N4IA 1Y6KR 5IM7A 4JDTH 5DUBB 1XR9B 1OM3L 5EZIH 4E0RA 3ZKMC 4PP1C 1MAMH 5GS1C 1NMAL 1F6FB 3CUPB 4V2CB 1D5MB 4CNIB 4F37K 5ISZB 4BH7B 1GHRA 3AB0C 5IP4A 4LLVA 4PJGF 1H8SA 2AJSL 5D9SA 3LN9A 1HJVA 3WFLA 4HIEA 5GRUL 1FO0L 5ETUB 4R4FH 4F7TB 3HG5A 2NY4B 4DWSC 2J8GA 3WDPP 4HKXA 1KXTB 4PJDF 3BPCB 4PGJA 3C9NA 2Q3ZA 4E41D 2BVUA 4ZE4A 4OFYA 2XTKA 4WO4A 3WUWG 4X6BA 4UI2A 1ZWIA 4UQ9A 3Q0HA 5I1HH 4UMGA 3U30B 2C26A 3QXUA 1UR0A 4OQTH 2CLRA 3MGOB 3MJ9A 4PYSA 3VVGA 2DYPD 1Y18A 4LSTH 1UD8A 2DT3A 3GI8H 3O9NA 4JM4H 3TOPA 2Y07L 2PF6A 5JW3L 1A7QH 2MSPA 4KROD 2R4RH 2AK4A 1PZ5A 1XH3A 4HA3A 1JDAA 3GO1H 2P5WE 4MNGE 5D9SB 2D7PA 3VSUA 2LTQC 2R2CA 3KYOB 3TVMC 3WHXA 2E27H 2PKDA 4Z7VF 2R15A 1IC1A 4NHCH 4GW5B 4AD1A 2Y9RT 4RCAA 3D18A 4XP9L 2GK0A 3LQZA 5IB5A 4WO4B 3TA9A 4HF5L 3ESUF 1NUNB 1C08A 2BVQB 1ZWIB 5IFJA 1U0QA 5BO1L 4GRLD 4EBQL 2JJWA 1H5BA 3CFKA 1CBVH 5JBEA 2BVOA 2VDNH 3B9AA 1U2CA 3NFPB 5D8ZA 2HA1A 4PJ7E 1T1YA 4BELD 4LCYA 3NIYA 3QFJA 4RGNE 3FB6B 1S5IH 5C0DA 5FYLH 2VZVA 1T22B 5E08L 4Z2KA 1PZ5B 3VPLA 2VDOH 1DWHM 4ZUTB 1OSZB 4AG4H 1VRXA 3SDAA 4YHLL 2VLKD 4MA7H 5L7XH 3U36A 1I3GL 5JUEL 2X4UA 4AYGA 4XBPB 3A4AA 1WBYB 5LA0A 2NQCA 2GK0B 1WAAF 4NNPL 1OGAB 5C0BA 4OJFL 4WV1B 2VX5A 1C08B 1HHIB 2OXGA 1HJSA 4D0CB 2P5WB 4MNGB 3WY1A 4IOFD 1TR1A 3G5YA 5FL1A 2XXCB 4Z2GA 3LDBB 1BJ8A 2YPLA 3FT3A 3LH2L 3MRHA 4P5TC 3OGOE 4IJ3B 4LNRA 4JRYD 4NNYB 4OCWH 3VFRA 4UTBL 2FH8A 1KB5A 3GMLB 3VFVA 43C9A 5HVHB 5D96C 3KR3H 3RTQB 3OAYK 2DSKA 2ZOLA 1I8KA 1TMQA 2P42B 4XP1H 3CMOL 5D1QA 3VOCA 2WSKA 4JDVB 4OFDA 3PWLB 5J9PA 2YD3A 5EO9A 4PJ7B 2CSPA 4MD4B 2BSRA 2CDEA 4UFLA 1N59A 3CHEA 3MGTA 3SKJH 3P4NA 1MHCA 1YY9D 4WHTB 4ONFH 4H1LG 3MROA 2XG5A 2WW8A 4P3WA 1PY9A 2H6PA 3F6LA 4KKNA 3W24A 4F9PA 4X7TB 4AH2A 4LVHC 2OYPA 1DBKH 5JIIA 1X5KA 1KB5B 1RD6A 1H0DB 2YXMA 3I02A 3VFVB 2YFNA 3PBGA 5ILTL 1ETZB 2EH8H 2YZ8A 4U7MA 4UT6L 3FO1B 1TJIL 4Z6AT 5JXEC 5GGVH 5HVWA 5IFHH 4XZWA 1ORSA 3QO1B 4LEXH 2BCKB 3U0TB 2BSRB 1FZKB 1CGSH 5DC4B 4JM2A 4DZ8B 5HGBB 4W70A 4ZUWA 5BRPA 1HWGB 1QBML 3O3EA 2MQ0A 1PKOA 1PLGL 1RIUL 4TQEH 2VB5A 3BW9A 4YHNA 3VG9B 4RBPH 1GQLA 5L8JB 2ADFL 1Y7VA 4W88A 2IBBA 1R33A 2B4CH 4XT1C 1FNSH 4BYHA 3U57A 4NO0B 3HE7A 1TVHB 3CFCL 3GH4A 4D9QD 1GGUA 1MEXH 5IBLC 1B0GB 1JF5A 4RMSA 2AKRB 1EGJA 3NPSC 2DYPB 3QQ9C 2ZIDA 1BZ9B 4G8EB 3CXDH 5E8DH 2VXQH 3O3EB 4OF3A 3UO1H 1QSED 4GRMA 3BKMH 3N9GH 1UD4A 2ALWA 2R39A 1UJ3C 1NMCB 5TQ2H 1S7SB 1N7ML 1RK0B 2BXZA 2FEEL 5IB3A 4JPKH 3GSNB 3HPJB 5AY7A 1AY1H 3M1BA 2IPUG 1I3RB 2GY7B 4X6CE 3GFUA 4GRLB 3S3JA 1RH9A 1UWIA 2AOSA 5GGTH 5F9JA 2IMMA 1F4XL 3GSUA 1NLBL 1GGBH 4Y4KC 4GS7B 4O4YH 3KE0A 3MLRL 4G43B 3C60C 3WD1A 3EDDA 1WFNA 4YHOH 5E2VL 2YN5A 2DMBA 5GGVY 4JFXA 4OGAC 2RFXA 2YSSA 1HILB 1V3HA 1REIA 4V28A 3MUAA 5HYQA 1SZNA 5IEKA 3IDJA 3EYVB 4Z2IA 1T7ZA 2QSQA 3FRPG 1K9EA 1AHWB 1T7YA 3CCHA 1TUXA 3BAKA 3LQMA 3CVIL 2RHEA 3P11L 4LRNH 4U6TA 3W9EB 1CXIA 3A6BH 4NM4H 3CK0L 1YMMD 4M6OL 4KUZH 1OARH 4Q7NA 4PJGE 1QSFD 4M1CD 4WWID 4LGXA 4XXCC 4X6CB 1SY6H 3O6ML 2YL8A 5EB9A 1K6QH 4PJDE 2J78A 4QRPE 3I50L 3MYJA 4QRSA 4RRPG 1RZJC 4KVNL 2XN1A 4CDGC 3TBSA 1S7QB 4XNQA 4PJGA 1QNOA 2ITCA 4XB3A 4GO6B 3BWAA 3ZTJH 2J88H 4GKSA 4PJDA 3VH8A 4QRPA 1U92B 1RP8A 1TQCB 3OX8A 1OAZL 1JHTA 2DJUA 2BHUA 4X7SL 4AT6A 4DO5A 4NN5B 3JV6B 4PY8I 1AMYA 5AYQA 2Q86A 3A4WA 2IADA 3AHYA 4Z7VE 1R3LA 2BVTA 3QI9D 4MMZC 4BH8A 1JXKA 1MCQA 2IALA 4PJGB 1MFAL 3ARBC 1D9KC 4MA1C 2A9NL 5KVGL 1U8NA 1YA5A 4TVPL 3BC9A 4OLVL 1MVUB 3HE6C 3DECA 3KPOB 3WDIA 2HFTA 1KEGL 2AJUL 1FL6B 2XNAB 3PWNB 3S5YA 5KN5A 1W72H 3NCBB 4RFOL 1F90H 3B3IB 5C09D 5JBDA 4J28A 4GBXA 4RL3A 5ELIA 4BKLB 5GSVB 1F3DJ 1WAAE 2AV1A 4ENED 1UCBL 3P9MB 1HT6A 3PHOA 3RAJH 1H15A 3WXWL 4P4KC 1OPGL 1HTYA 1AGFB 2HMIC 5HYJA 4TOQA 4Z7VB 4Q58C 4XP4L 4PGCA 2F53E 1I9IL 4QRTA 3WIHL 1WAAA 4DUWA 4FQQB 4TRPH 5LXGL 3TN0C 1QSEB 2QHAA 4YHML 5E7BA 5D9OA 1N2RA 1T0OA 3C5ZB 3V4PL 1FZJA 1IC7L 2VERN 1MIEL 4BQ8A 1HJUA 5D1XB 4XVJL 2F53A 5K9KB 2OL3B 4PJ8C 4JO1H 1Z9SA 5C0IB 2D73A 4AD5A 4OT1H 5EU4B 3TBTA 3L7FA 3ECBA 1HXYA 1RPQA 2WIIA 1I85A 3KWWA 4K7FB 4J4PD 2DDXA 3AAZA 4DUXA 4JO3L 4IRJB 4DVRL 2M8XA 2NW3B 5A40E 4HS8L 1J0JA 5DQ9A 4DKFL 4CN6A 2GTWA 3ZO0A 1CE1L 1A14H 3T0WA 2XACC 3TT1L 4I18A 4Y19E 4MAUL 4ERSL 3A0OA 5IF0B 1CDJA 3O2WH 4DGIL 5AC4A 1RZKH 3WE6A 4OF5A 1ES0B 4K3DH 3TBTB 2VR4A 4QLKA 1QP1A 1WZKA 5I19L 3PZMA 1MCOL 1YEKL 3ZT5A 5HHNA 4XX1E 2F8OA 4G6JH 5IQ7H 1AVAA 4G6KL 1MW0A 4M43H 2W38A 3D2UA 3QUXA 4J3VA 5BVJB 4AISA 1HXKA 4OI8A 2PYEA 2J7LA 5K9JH 3KYNA 4DN3H 5I66A 2YBTA 3AS2A 2XKUA 4GZIA 4LSRH 3T77A 5CSZB 3U0WL 2XN2A 2WPGA 5IW1B 4QNPF 1CT8B 4W86A 3WXVH 5I1EH 2J7FA 3ALXA 1DWIM 3GI9L 5AYIA 2WUCH 5DQJA 2WVSA 3FOMA 4OD1L 1LDSA 1K4DA 3WKML 1SJEA 4LL9A 1CLZH 3U7YL 4Y19B 4K07A 4KAQL 4EN3A 1WCBB 2PWGA 1INDL 1U3HA 3RILA 1E4XI 4FMKA 2OSLB 2E7LA 2DRUA 4GOSA 1HVXA 3QNZB 2DQTL 3MRCA 3CDCA 3BZEA 4P2QD 1MYRA 1NL0H 3BYTA 5CJXC 1CS6A 4B0MM 4FZEL 4NRSA 3L1OL 3MRFA 2HVJB 2WW5A 1OSPL 1QLEH 5D2NC 3GNML 2QF8A 2CKRA 3FHQA 4LAQL 4PB0L 5AZ2L 3N1GC 5AYUH 1VB9A 3PN8A 5ICZA 5JR1H 1RUPH 3QHFH 3P73A 5JOPD 4Q0XL 4R96A 1K4DB 1FNLA 1WZ1H 2JB6A 3LS4H 4FQJL 4TTDD 4EN3B 1HX0A 1U3HB 3L3HA 1A1MA 4HOZA 1V7NH 2DQCH 2CQVA 4BJLA 5HJ3A 3OA5A 1NGZB 4JFQB 5B39A 2ZCHL 2VWEE 1BEYH 5D70L 1K85A 3B2VH 1W9PA 3MRFB 5JXAH 3VFPA 3VXQA 3SE3C 4B16A 3TA3A 3JTTB 2WV3A 1UKQA 3HC4H 4D8PA 5EOQH 5LGKA 4K8RC 3BLKA 1ZLUK 5FHAL 3LHPH 3H7BB 1JDDA 1M05B 2J8UF 4LSQH 5B3NA 4E8DA 2F9BT 3E6HB 4S1DD 4EUPA 4NFBA 5ACLA 4PJCF 4YC2B 4WVRA 3MRPA 2VISB 1P5UA 5D8WA 5K9OB 2FJGA 1SBSH 2IEPA 3QDJE 4HAGA 1XGPB 3KNBB 2AEPH 4N5ED 4KJPC 3SN6N 2Z93A 2VDRH 1W8OA 4M6MH 2J4GA 4JQXA 2IQ9H 5FM4A 2W62A 2D0GA 3SPVB 1ODZA 4MX7A 1JGUH 3KJ4B 3QISA 4GKOA 3KLKA 5E2UH 2OTPA 3D85A 4P2OB 1Z6JT 1WCQA 2J6EH 2GJZB 4PRPE 3S35X 4F2MB 4HV8B 1OTSC 1RFDH 5C92A 5IHLB 4R8WH 5I1DA 4HMDA 2XFXB 4DKDC 1CWYA 2QMJA 4NKIL 5FO9A 2Q6WA 4HLJA 1FAIH 4IMKC 4G9FE 1OQOA 2NTFB 4EI5D 3C87A 2Q8AL 3OKKB 1R8LA 1A6VH 1I1FA 3V6FA 2X4QA 1MJUH 1NGYA 1IQDB 5BRZE 3ILPB 3J7HA 4KPHH 2X1XR 1V05A 3HAEH 4YEEA 4RMRA 4DK6A 1KQYA 3WQ5A 1RHFA 1IL1A 4G9FA 3D69B 5DJ6A 1S78C 4MX7B 5C8JB 1MREL 3VNYA 4EANA 2OWWA 3MRRA 3WUZA 1VACB 4OV5B 1ZHLB 1ZGLM 3QDJB 5BRZA 3FQWB 3M46A 1H3PL 5E1HB 4UFMA 5GISH 3LN5A 3WL0A 3W11C 5I8CA 1ZT7A 5F44A 3WN5B 3Q3GB 3V4UH 5I5RA 4PRPB 2X4QB 5E6IA 3SGJA 3VFTA 3X12B 3FW6A 3SOBH 1OINA 4X7CC 1AC6A 2X05A 2Q3AA 5HPMA 4HX1A 2VAAB 4ODHH 4G9FB 1MFCL 3PP4H 5FV2A 3S5LB 5DJ6B 2CKBA 2VABA 3S88H 2A6DA 4G6ML 3WO4B 2PW1B 1IM9B 1BZ7B 5BRZB 1AXTL 2QKIB 1L7TH 3GGWB 3U4BH 1H49A 4HUVA 4RMQA 5FM5O 5CQ1A 3O41A 4XPHH 2F18A 1QX1A 2FGWL 7A3HA 1LMKA 1MVFA 2YA0A 5FAAA 3H9ZA 1NLDL 3QG6B 3VFTB 2ZOKB 4KZEL 1WP6A 3B6SB 3I2CL 1JNEA 1XD1A 2GY5A 4HX1B 1RSFA 4LF3B 1JNDA 5L2JA 1IZJA 2BRQA 7TAAA 2PBGA 3IFPA 1FFNB 2P8PB 3L4TA 1U6AH 4HP5A 3ZSTA 3L4ZA 3WFEL 4WI7A 5J89A 3TONA 3GSRA 4IIQA 1YEIH 3VXNB 3IT8D 2I5YL 2DLIA 4XP6H 1GJWA 4HIXH 4X4XA 3SUSA 2XWDA 4ZDHB 1JNLH 1F58H 1Q8MA 1UWEH 3X3FH 4ODXA 3IDXL 2BOCA 1A3RL 3GJEB 4WGVB 3FO9B 2R2EB 2PETA 1G7JA 1I4FB 4XPAH 5FGCB 2C1OA 2BNQE 4ELMA 3G6LA 1AIFA 2ILLA 5EIQA 3L4XA 4KKBD 1MHEB 1SMAA 3LEVL 2WC3A 3NDYA 3CFEB 4IRSD 4M24A 1MH5A 3WNOA 1MFEH 5JUVA 5EA0H 5DRZA 5A6KA 3GSVA 3D48R 3L6FB 1FFOB 1MY7A 3QDGE 3BFOA 1BLNA 1EVTC 4GMSL 1G6VK 4JFYB 2NY1B 2RIKA 1QSZA 3MNWA 4I4WA 5JNYB 2WNWA 4R2GD 5I30L 1E6NA 2ATKB 4CN4A 3DVNB 2F19L 1IGFH 2EE2A 4P23C 1I1AC 4QNPE 4LNVA 3QXWA 1HZHL 3UC0L 3C6LD 2XN0A 3BH4A 3GBEA 2SEBA 1F8TH 5HYSA 1E6OL 2R4SH 1JGEA 2VL5B 1QFWM 1IGML 3MJ7B 3GXDA 4ZS6C 3S34L 1RZJH 3LKOA 4M7LL 1P6WA 3SCMA 3HZKA 4HH9A 3LQAC 1RPKA 5IHRA 3QHZH 3P0YL 3GMOB 2BNQB 3IU4L 2J2ZA 3IXTB 3MRLA 3M6DA 3OZ9L 4AXNA 5CSYA 4EI5B 2V3FA 2LVEA 3F6IA 3NGBC 1KBGH 4WJ5A 4P4RB 3MLPA 2Y4SA 4NQCD 4V1DE 4XNYL 2PYFB 2J7DA 3QDGB 1EEUA 3IU3A 2Y2WA 3TPUB 2P48B 1NKOA 2Y24A 3CLWA 4A2LA 1T1WB 5D7LD 3WV0A 5FKPA 4V1DA 3PZGA 3MRKA 2DJSA 4S1QL 3VRLF 3RDKA 3HZKB 4NGHH 2F15A 4KI1A 1KCRL 4YUEL 3WMCA 1ODAA 3GH5A 5E6ZA 2GT9A 2ZUVA 3G5XB 3DYOA 3OLIA 4APQA 3GSOA 3O11A 1W2PA 2XKNB 4Y4HD 3OKLA 4W8AA 4YLQT 4QGYA 2AJ3B 2XA8H 3BXNA 2QMKA 3H6JA 2NY5C 3JTSA 4JKLA 2DEPA 2J8UE 4Z7UA 5F9WB 1NCAL 4PJEA 3UYRL 1FNAA 4V1DB 3QEQA 4KHXH 4PJCE 1KLUA 4YFEA 2F61A 4QHKI 4WY7H 1L8NA 3ZDYF 1BYDA 4UT7H 4AMKH 2J3SA 5HHXH 1BOGB 1YNTA 2Y06L 2XQYK 2Z9TA 3WBAA 2QPSA 4DN4H 1ZKAA 1GAFH 4FA8A 4RMTA 5EDXA 2XTJC 1G7LA 3ZT7A 2UWEA 1ZVHA 3DLQR 3U9PL 3MLYL 4JHWL 1Z32X 1H0GA 4PJBA 3LS5L 4KY1H 2EEBA 4G6FD 5GGRA 3OR6A 4Y2DD 1S9XA 1CGUA 2BNRA 3EOTL 4JPVL 2R0LL 3GK8H 2ZSVA 4Y5YC 1W0WB 4C83A 3EFFA 4MD0A 2J8UB 2NZ9C 2Z31C 3HNVH 3TNNA 1HVQA 1QWNA 2K3TA 2EH7H 3QUKA 4PJCB 1AGDA 2H1PH 3PTQA 3H7LA 2HT4C 1FNEB 2JALA 4L3ED 2LU7A 3T2PA 1EJ6A 5KTEL 2HT2D 3BVWA 1G9ML 3MJ9L 2J5LC 4WUKH 3BD5A 4NJ9H 2Z92A 2R23A 2DMCA 4NWTH 4LHUA 4JIEA 3GKZA 3T1FB 1YMHA 4XWGL 3TJEL 5GGRB 3W5MA 5DUPH 4G42B 1X3DA 2FHBA 2OS7A 4RAUB 4CVXB 3NH7L 4TX8A 1S9XB 3MV01 1F5WA 5E4EB 4TVCA 1RVFL 2DQHH 5CCKH 1BF8A 4JG1L 5E8NA 3VD4A 1FQ9C 4Z7NF 1Q9KA 3TNNB 4PJHA 1SQ2N 3QIWC 4HC1L 4MJ6B 4W68A 5F7DB 2VZOA 5H8DA 3VWKB 3D52A 4GXVH 3WUBA 4F3FA 1TJHH 2VDPH 5L2KD 5J6HB 3BQUD 5JHLH 3DYMA 4UOJA 2EPMX 1R47A 3QJHA 4J3OC 4GINA 1JUFA 3O3UN 3O2LA 3CHCA 1RZ7L 3FTGB 3T0DA 1BJ1H 2XZAH 1BFVL 4QWWD 2VLLB