1OT1A

Bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant d135a
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIAFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The fully conserved Asp residue in Conserved sequence region I of the alpha-amylase Family is crucial for the Catalytic Site Architecture and Activity
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
total genus 237
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot1A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot1A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ot1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ot1A01
2IPUG 2F8OA 2GAZB 2X9XA 3MRCB 3GMPB 5MI0B 2Z91A 4IHOB 1RUML 1YEKH 4BQ3A 5F6IC 3QDHA 3SQOL 1J1OH 3MODL 1NCAL 4LSQL 2MOVA 2VDKH 1ACYL 3NCJH 4N8PA 3HE6C 4O2CB 4YHIA 3TIEA 3RTQA 1WE5A 3F12B 5I8OH 1DFBL 1BFNA 5C0GA 1V6YA 2ILLA 3AMGA 1T1YA 4ODHL 5I15H 1UWIA 3TJHC 2XY2A 2R1WA 3UCRA 4KTEL 1CXFA 2X4RB 4NO0D 4GBXC 2WZPD 3WEXB 3WD4A 5GS2D 4G6ML 4HJ0C 2H3NB 3MXVL 3VXSA 1HHKB 3QXAA 4M43L 2A6KB 3TA3D 4XMLH 4U6TA 1QR4A 3D2UB 4CD4A 1NKRA 3BFOA 5CMAB 1V7ML 5I75C 2FD6L 2J62A 1T20A 4BQBA 5C07E 3LSOB 1YEFL 3VX1A 4XBEL 1FFOA 1UH4A 2V9RA 5J12B 1E4XH 3MRPB 4UQ3B 1QSED 3VXRE 2CR6A 4JG0H 2G8ZA 1V6VA 1CF8L 2DQFA 1V3LA 2H8PA 3QZWA 4NPYA 5CINL 5ECUA 4NKIH 1OT1A 1TVBA 5CZXD 4L8SC 3L6FA 5I75B 3T3MF 3HC4H 3NCYP 4KHTL 2FSEA 3V4PL 4HPGA 3DNKA 3N1PC 4HG4K 4TUOA 5GSRA 1W0WA 3BISA 2CLZA 3H3PL 4RWHA 4OAWB 4JM2D 1LEKA 4AZBA 5FA3B 4M82A 1BFTA 1XF3A 1HKIA 3VWKD 2WWMD 1AVAA 2WBJD 2F5AH 3SDCA 5C09D 4JFOB 1LK3H 2QQQA 4ACZA 4J8RB 5CWSB 3Q1SH 4I77L 2AK4A 3OGVA 1U6AL 4HBCL 4OCWL 1A6VH 4P7QA 4NZUH 3VNZA 1IJ9A 4DK3A 2BSSA 2QPUA 4QCEA 3QCVH 3BKCH 5HHOE 3QHFL 1NM9A 4KXZI 3EHBD 4YC2C 1KIRA 4PRAA 3EDFA 3ZJ7A 4A4AA 4OCXH 1ZOXA 3CC5B 5D7IA 5SX4I 2PWHA 4ZOCA 5DJ6B 2W62A 1UM6H 3TBTA 1KEGH 3AS2A 4UQDA 2VIRB 3QXTA 5AZEL 1PLGH 4FNTA 2NY3D 5HI5C 3T0AA 2WUBH 1ZANH 1ZLUH 3L3JB 4F15B 4JQVA 5JORA 3GSOA 3P0GB 4U1IB 1F90H 1QW8A 1TQUA 2DWEA 3KLKA 3TVMB 2L4OA 5F9WC 1QFUH 5BS0B 4JRYA 5C07D 4UNVA 1RK0B 3OR7B 4QRUA 4Y4HD 3VRLE 1TVHA 1ODZA 4BQ2A 4H8WC 1JWUA 4F37F 4PJGB 4RCAA 1T2XA 2VNCA 3EBAA 4MNHA 1BD2B 4QYOA 5ID1A 4RAVB 4XPHL 5EB8A 1D5XB 2DTSA 2QBWA 5EN2A 1VA9A 3SQOH 3WYRA 3GM0A 5MEOB 3LIZL 1CFQA 5BJTA 2BNRD 5C0GB 4YHNA 5DFVD 1B2WL 1SEBB 2OYKA 1V05A 2R0WL 5LAXA 4TYUA 4P9HL 3UP1A 1PY4A 3OKLA 3V52L 4TUFA 5AYIA 3WEOA 3B9KB 1N8ZB 5ABEA 3QO0A 1H0DA 4LX4A 4ZFFB 4NFBA 3NUKA 2HFFB 3MRIB 4OQTA 4L3ED 1T0PB 5K93A 3VWKB 1VEOA 5IVZA 3OAYH 3KPMB 1NGQL 5TDNB 2EH8H 2R29H 3OAYK 1OM3L 3RDTD 1IC5L 4H04A 2GDVA 5FIEA 3RIFK 4XP6H 3VMNA 4M1CC 4LHUD 5BV7L 3WKZA 4XRCA 2KZWA 4OZIF 1QSFE 1IC4H 4NKMB 4YQXH 1P4BL 4PYSA 5F7MC 2X1IA 3AHYA 4HPOH 1AP2A 4HF5L 1NAMB 3H9HA 5F7WC 4JFYA 3TA3C 5A94A 2BS9A 2HJKB 3GJFA 3S97C 3FCTB 2HTKC 4IRJC 4OLXL 2XWJA 3Q5OA 2HVJA 1B4JL 2Z1KA 1VFBB 2B31A 5I16A 3IF1A 5DC4B 5TGBB 4CDHA 3VRJB 1VGKB 3FRPA 5T3XH 4PGJA 1OW0A 1T83A 4OFPA 1EHNA 3MUGA 4PBVC 5I74C 4Y5YA 5C0JB 1EHXA 1BVLB 3RJDA 1HXYB 4S2SA 3STLA 3L2MA 3IDXH 3L3HA 3FQRB 4AG4H 1XGQB 4K9EL 4B7IA 2NX5B 2OJZH 5FA4B 3I6GB 1XR9A 5FUZL 1W9BM 1Q0YL 1KJVB 2SEBA 3T3PE 4JRYD 1YZZA 4OF5A 5BMFH 1A5FH 4JIEA 4FQLH 4N1CA 5TJWK 3TYFA 1D6EA 4JHAH 1OOAA 5IXEA 1UR0A 2ZCLL 4LSTH 5LGHH 5L0QB 4WO4D 4D0DB 2F58H 4FFWD 1SQ2N 2FX7L 1NJ9B 4LCYB 2YBRA 1E0XA 2IQAA 4UUJB 3MRFB 1BMGA 4XC3L 2C7UA 3OZPA 3U57A 1JL8A 5H2BB 2F7OA 1OAZL 3IDNA 4MA1B 4M24A 5ACMA 4LSRL 4MNHB 5E94A 3OPZH 2HMID 5JBFA 4ERSL 4KK6D 5C86A 2ZUUA 2R0ZL 4JG1H 5ESQA 3STBA 5GNYA 4BELD 1ND0B 2YPLE 3BMVA 4H1LB 4UV7L 1AKJA 3DRTA 3P0YH 4WWKC 1RURL 3WNKA 5KBNC 2J1KA 3THMH 1P7QB 1JF1A 1PD6A 5BO1H 4ZFGH 5T1LD 3VGDA 3RY6C 1JXKA 3OAUH 3N12A 4P2QD 2J8FA 3V5DA 3CUPB 1MUJB 3OIHA 3J8F7 2HKFH 3MLSH 5B3NA 4GQQA 5GISL 3MRBA 5A43C 1UG9A 5K9OA 5ICZA 2C3GA 3ARFC 4IRZL 2GJZB 4X98A 3HAEH 2A0LC 3RWDA 2BNRA 2VH5H 3FQUB 3D3AA 4NQTA 3UTSA 1QP1A 4OBRA 3L7EA 3DXAD 5ICYA 2BSSB 1U8LB 4PJ8C 3MGAA 4JFEA 4V1DA 3TT3H 1P5VA 3HRZA 1A2YA 2YL8A 1KUMA 4IPLA 4JAMA 2FHCA 3B83A 3D5HA 2CRIA 2YD2A 3QAZB 1UJTA 1GGBH 4Y2DA 5EA0L 3V7AE 1IBGL 1RZGA 1UQSA 2UZXB 1MAML 2WV3A 1BM3L 2YZ8A 3AGVA 4NQED 4OAWA 2YIHA 2F8XC 1L6ZA 1MFDL 1BHGA 1U8MB 1MCOH 4DO4A 3AYRA 4M1GL 3N1MC 4FNUA 1KEML 2X6MA 4KJWC 4EI6A 5KVEH 1D6VL 3GO1L 1MJJB 2VL5A 1GZJA 1LO4H 4O9HH 4X6BB 2EDKA 5AWNH 3RWEA 1KG0B 4YWGH 4RFEA 4P59H 3MO4A 2MKWA 3RVUC 5I1AB 1OP3K 2BERA 1PGRB 3JWOC 4X5WB 4ZAKD 1DHKA 2XWJB 3E6HA 1JYVA 1EV2E 1OAUL 4JY4A 5GGTA 3VTRA 3OF6A 1FH9A 3O4LE 4YDIL 1DBJH 1TXKA 4OCRL 4HZLA 4LDLB 3T65A 4JR9H 3S2CA 1MH5B 5ECJE 1S7TA 2FJHA 3T2PA 4E5XB 3KL0A 3QNYA 3TVMC 3ARED 3IJSA 4FFYH 4XP5L 2EXWC 3BP4B 4G9FD 4J7RA 2Z93B 3RPKA 3BLPX 4ODTL 1MELA 1OAYL 4S1SH 4BFIB 2F5BH 1KBGL 5B38A 5KS9F 4HUVA 2A0LD 3OZOA 5DD1H 3EO1A 2HKFL 1UYWL 5TQ0L 3VJ6A 1JGVH 1M03A 1JGEB 3MRJA 1JI2A 1UB6A 4PRHD 2IH1B 4MD4B 3MCLL 4OI7A 1HCFX 4K55A 3DSFH 4PRIE 1WVZA 3ZDXF 3IDMB 4Z76A 1TENA 3GMMB 1MWAL 3L9RA 3QJFA 4FG6D 5T1DL 2AOSA 4QYOB 3OG6B 4LSPL 1MQKL 2YD1A 4QEGA 5D5MA 1ZLWK 2ICWB 3ILPB 1HWWA 3F7YA 1WIOA 2GJRA 2DSUA 3KPRE 1C5DB 4ETQB 3TONA 3BEVA 1P6FA 3DO7B 5GZNC 4DZBB 1HSAA 2OWXA 1UVQB 5IW1A 1R24A 5LGHL 1X6LA 4QOKA 5BROA 5FKYA 3L3JA 3HR5A 2R0KL 5IW6B 4YFLI 1BP3B 1E4XI 4Z77B 1WZAA 2BVDA 1AGBB 4ZUWB 3VSVA 4NJAL 5I73C 3LRLA 3BAIA 4XCFH 1MIEL 3LKQA 3REWB 4FMFA 1FG9C 4OZIA 3OR6B 1H0IA 3OKMA 3FQWA 4N1EA 3MA9L 3L4VA 1EFXB 5BRZA 2XWEA 1YNKL 4L5FL 1F2XK 3V9FA 1WC7A 1IZKA 5KSAC 3G5XA 5IBLD 1DBAH 1A9BB 1GZPB 4NQDA 3RWCB 2EXOA 5FKPB 1S7XA 2PR4L 4I3SH 2IPUK 5D71H 1N3NB 2DD8L 4HCRA 2NR6C 4K71B 3QISA 4HIEB 3ETBF 4PRIB 5E5MA 2WHLA 1VGKA 2NSXA 1IC4L 3W37A 3HLAB 1C8YA 4YBHA 3GH4A 1LEKB 3BCFA 4P8XA 3SDAB 2OWCA 1BJ1J 1KJ3H 5I76A 4GUPB 5BXTA 4OZGB 1FL3B 1JWMB 1TA3A 4EVNA 2XZZA 3E8UH 4YK4C 4NN7B 3U82B 2Q6WA 1KT2A 3JVGC 5E8PB 4C4KO 3W9EA 2ZOLA 4AIXA 1G9MC 4OFVA 1BD2E 3IT8D 1QVBA 3FN3A 3L2LA 2JIEA 5E09A 5C0CB 1C90A 4TX6A 5I8EA 5C0BA 1WZKA 4PTUA 3S5YA 4PJ9A 3OA5A 1E1FA 1U8OA 3SE3C 1LEIA 3MSPA 3CLFH 1C91A 3WQ6A 3AIQA 3WLBB 2YMXL 4TOYH 4YDVB 4LPTA 4YPGB 2BZDA 4OUOA 4O2EA 4YHGA 5J1AB 5JW4R 5EO9A 5I8CB 4Y4KB 1GH7A 1KSRA 2BOCB 5GSVA 3CVIL 4EOWH 4ZAKA 3QOMA 5HHNB 1DANT 2QHRL 1EBPA 1AGBA 1FBIL 4ZUWA 1M53A 4AZ5A 4DW2L 3LB6D 3O4LA 3OXSA 3IXTA 2ICWI 3IXTB 2Y8VA 2DLHA 4Z2LA 4QOKB 5DK2B 4OTXL 3RWGB 4GRWF 2VUOA 2R2EA 3GHBH 2PO6C 2GJ6D 4JCLA 4K3HA 2YL9A 2EEBA 3VI4F 1Y6KR 4TVPL 4O2CA 2QQNL 4ZG1A 4PMNA 3VD9A 3FKUS 2WMIA 4D8PA 2XHYA 5IVXE 2IQ9H 4G43A 3GJFH 3TIDB 3Q3GA 4OCLC 3QHFH 5EO0B 1EAPB 3HNTL 3OGRA 4NBYB 5E8OB 4XXCC 4G6JL 5JQHC 3N85H 3HI5H 2D0GA 4MQXC 4ZUSA 4QXTA 4UAOC 3C6LD 3DVIA 4MJIE 3TBTB 1U6AH 4HBCH 3VE0A 4GIAA 4NN6B 4HTYA 3GFUA 1MHCA 4DWHA 5FGCE 1E6NA 1GHFH 4NP4L 4U1SA 3UBXA 1A64A 4BQ5A 4U5KA 4NC0B 3LS4H 5BRZD 1OF2B 2Q6WB 4JFQA 3T09A 5I1IL 1HJSA 2FJFA 2WINA 5BXFB 4MSWB 1D2KA 2WMFA 4L1DA 1FL3A 4MDIB 5JIHA 2NXYD 5SWQB 2C7UB 1R5VA 5GRYA 4H26A 4RA3A 4ZTOH 1J10A 2Z8SA 5E00B 2C3WA 1W1VA 1Z3GH 4ODWA 4DGIH 1VEMA 1NCDL 3ZMRA 1SHMA 4ZYKB 4KTDL 2HJLA 3GZAA 1QYGL 1E4WL 5DHVA 1BF2A 1T0NA 4NQVA 4MNQB 1IM9A 3IANA 1G0XA 4W8AA 3D69A 3WJLC 1NBZB 1A0QL 1DBKL 1IFHL 4AH2B 1SMDA 2AJSH 2FZ3B 3ARYA 2J6EL 1UR9A 2XRAL 3LRMA 2FLRT 1MHPL 5CBEA 4EN3D 4JKMA 4P46D 2DQGH 4RAHA 5SWSA 4F9PC 1E4IA 4BZ1H 4U1HA 1RQ5A 3MRMA 4HH9A 4XMLL 2PO6D 3GI8L 4LLMB 1MEXL 2UUDH 1QFWM 1E56A 3CUFA 4UFKA 3INUL 2J77A 5IM7B 3ULVD 5T1MB 3DC0A 1D5IH 4WGWB 1T0NB 1NCNA 3TN0B 3GTNA 2Q7NA 4QRRD 2VXQH 1P4IL 3M8OH 3MV9E 4N9GB 5CZVH 3WNOA 4ZDHA 2C3HA 3IU3A 4YWGL 4UDTA 3VWKC 4NQDD 3R06A 3QFDA 2F2HA 5ACZA 3ILPA 1GNXA 2X89A 4L8BB 1VGEL 4TVPE 2UWEB 5GRJL 2CMRH 2C7FA 1TQTA 5FUCC 4MJ6A 4BFGA 2OSYA 3OKLB 2BOCA 5GSVB 2B5IB 2W60B 4W84A 1RULH 4HZ7A 1HNYA 2A6IB 5BRZE 1EZVX 1MFBH 4YUEL 1INEL 5E03A 4QXTB 1LWJA 3OKDA 3VFVB 4QT5B 3GSWA 2A6DB 1ISXA 1NEUA 3GEWB 4YZFF 1INQB 2ARJB 4LYRA 2MQCA 1DBBL 3V2AR 1IGTB 1WZ1L 1N5YL 3WO3B 2JELL 1TPXC 4UT6L 1CD1A 2IBBA 3KPSD 3U9PL 5HD8C 1XV8A 1LQ0A 3CUGA 1RK0A 4PJ5E 1UKPA 3QEQB 4ISVB 5C7XL 4NNPL 4EK7A 1NAKL 1WP6A 3BAEL 4JY6A 4G5ZL 4JFPA 2CETA 1F4HA 3MUIA 3O6LL 4RZCA 4L3EA 5CEZH 1AD0A 4ONFH 1PSKH 5A8NA 3BYYA 3UZEA 1T03L 1VHPA 2NZ9C 2QMKA 1XEDA 2B1HH 4PTTB 2OSWA 1UA7A 4HPYH 1NDGA 3DYOA 5F1OB 4GQPH 2HRLA 5JO5B 5GZND 3EJZD 5JPNA 2VDOL 3SJVA 4JO4H 4E42A 2ZP0T 3MLWH 2DJ4A 3PV6B 1QBAA 1MIML 1O7DC 2CDGB 5CIPH 5J3HD 4PRIA 2P48B 3MBXL 4E41A 3U6RB 2J88H 3LRSA 1CFVH 4PJ5A 5CJOL 1DN2A 1MHEB 5TE6L 5D8JH 3BSHA 5FUCE 4MNGA 4LSRH 3SCVA 5IJVA 2X0YA 3UTTE 2BSED 3BAKA 4YDLC 3HE7B 3JZ7A 5CWSA 4NRRA 5B3JE 1BLNB 4F8XA 3G6JE 5MHSD 3OGOE 2BV9A 3SDCB 4O5LH 1PG7W 3QCUL 1CU4H 3H55A 4MWFB 1XR8A 3VDHA 1A7QH 4UILH 3ULSA 3BN9C 1WITA 3OB0H 3TOPA 5K9QG 3ARZA 3C5SB 5CP3A 5MENB 2X2IA 3TTQA 4JKWA 3HI1A 4U1LB 2N7AA 5ICYB 1CFVL 2GUYA 3T0ED 1C8XA 5JZ7C 2HTKD 4Q6YA 5LA2A 2R0LH 4FHBD 5HHPA 4HX1A 2CKBA 4RQQB 3SKNB 2AJ3A 1EUTA 2EEXA 3FHAA 1DN0B 2MWCA 4RE2A 3NIYA 4IM4A 2VVNA 4GBXB 3BSZH 4BSWB 3LRHA 1KELH 3TWCH 5M03A 2CXGA 3GH7A 4GMTL 4WW2F 3VWKA 1RD6A 1FL6A 4E0RA 2E7LA 4M7LH 2FEDD 1W9DM 5H37H 3IDMA 4PYHA 3CTTA 1N6QL 4PTVA 1NAKH 3FQWB 2X4QA 4QNPF 4PRHE 1N82A 2PB1A 2HJFA 2X1WL 3WIIH 3SE9H 3KLAB 1GCYA 5MEND 5KSBF 1NL0H 1N5YH 2MCPH 2PTUA 3I75A 4WHTB 3MUHL 5I9QB 4MA1C 5HYSB 4Y4HA 1B4RA 2YL5A 2BXYA 4V2XA 2H6PB 5D8WA 3W27A 1JNNL 3BUQA 4D3CL 1JTPA 4DUWA 4PJAF 25C8H 1KWGA 2O5YL 2VXSH 1YUHA 2VC9A 4P5KB 4WUUD 4WKFA 5ID0A 3VDCA 4LPYA 3GK8H 3EJYC 3KYAA 2EABA 1IKFL 2WMPA 4JZJA 2DJUA 3GJEB 1F3DH 5CSYA 1TVDA 3O2WL 4H20H 3LMJH 35C8L 3SDXE 4F3FB 1BLIA 3PTMA 5H35A 3EOBA 4XWOD 5FYKE 4R2GB 5T1LA 2MJWA 1J5OH 1I9IL 2Q87A 4NUJA 3QIBA 4PS4H 4MHHI 3TM6A 5HDRA 2QEJA 1QLRA 4CGTA 5I79A 1W32A 1X5IA 1XHGA 5KW9H 3QQ9C 1GZQB 3DX8B 4U1KA 2OTUA 4CW1B 1VFAA 5I1GL 4KRNA 1G7LA 4Q0XL 5DMKB 3BPCA 1EPFA 4RRPA 3RUGB 1CLVA 4U1LA 1XGYL 1ETZB 4PV8B 2JCCE 2HRPH 3ARGC 1MJUL 1DBAL 3BVUA 4EUPA 1C8PA 2E3ZA 5LYRA 1LD9A 3VFUB 4GKSA 4X6DB 1JFHA 1RH9A 3IDUA 5ITFB 4X8JA 4MHHG 1CDHA 4LSSL 1Q9LB 1TJGL 2CJUH 3AIWA 1G6RL 3LN5A 2ZUTA 3T0DA 1Q9WA 5LQBL 4Y5XC 5D5ME 4D6IA 4ZOEA 4OCNC 4PSPA 1E6OH 4O58L 3ECBB 1X4YA 4HBQA 2DDQH 4XMKL 3RQ3A 5C8JB 4MXQD 4J3UA 4WW1A 3HUJF 5IVXB 3MROA 3QUYC 4G8IB 4XP1L 5I1LB 1IM3A 5GRUH 1FA2A 2H8PB 4NPYB 2CLVB 3RGVB 2X9WA 3SDXB 3ZJ8A 4OZIB 1MQRA 5HYFA 4J12A 4EAMA 1QEWB 1QR1B 2FGZA 5CJXA 1A7PH 1KGCD 2RHEA 3HZYB 4NO2B 1AHWA 3WBAA 1KB9K 3MBEC 3S37H 4CMHB 1CWYA 2ENYA 2EDXA 4KHXH 4FZ8L 3BH9B 1T3FA 5ID1B 1UD6A 3WIHA 3C60A 1FVEA 2L7JA 1T80A 3KEHA 5GGVL 2W67A 1G9NL 3JTSB 2DRUA 1JMZA 5HTSA 5DJZA 4JAMB 3P73B 4KWUA 1B3JA 5HDLA 12E8H 2O5ZL 5C70A 1WDSA 1XF5A 2Z31D 3MC0A 3THCA 3W0WE 3KPMA 5TDNA 3TPUB 4G9DA 3BKML 1W3JA 1Q6EA 3GSUB 1A3QA 1E3XA 1BVKB 2ARJA 1E28A 1O7AA 3D0VA 4FXKB 3G04A 3UO1H 3IDNB 4PJBF 1G7HB 4WFFE 1LILA 3C6LB 2YD8A 2DEPA 4P7RA 1CDCA 5EU6B 1KXTB 5FK9A 1OB0A 1BQUA 1MCEA 1FFRA 2HT4C 4KTYA 1NSNH 3WL9A 2VXVH 3FQRA 3SCWA 4HOZA 1AGFA 4MJID 4PRPD 3LKOB 2XKUA 1ODAA 2GTWB 4OZIE 1NMCB 5BOPA 2XN1A 1DVFC 3GO1H 5TF1H 2XTJB 4Z0BL 1KR1A 5HGGS 2Y25A 2X5PA 4S1DC 5JPMA 3ZIZA 3RVUD 2GFBA 3SCSA 4BSVB 4M61B 4NIKB 4Z2JA 3AMCA 2OP4L 3VD4A 3WN6A 5CCKH 2XQYK 1FRGL 3AROA 4X4XB 2D7OA 3B6SB 3SCTA 1HNFA 4KKLD 5DGQA 4G8IA 1YNLH 2H2SC 1IM9D 1O7VA 4K94L 3QWRD 3QRGL 4XP4L 1BYAA 1TVNA 4TNVK 1XC6A 3CDFA 1EJOL 5I18L 1NFKA 2YOCA 2X4PA 4N0RA 5ERWA 1SBSL 3GMRB 5HPCA 2BX5A 2AJXL 4HWBA 1UD8A 1HI6A 4JZOB 1KQYA 3NSXA 4MS8D 2E6PA 2GEEA 1NP2A 4P7NA 3LPWA 4KXZH 5F8QC 1D9KC 5BV7B 2P44B 1K6AA 2AJSL 2YEZA 4HA3A 3EYFB 2W9DL 3QPXL 2VKXA 4U1MB 5SWQA 1BAFH 1QACA 3AFLA 5KOMC 3QHNA 4W85A 2V9TA 3WDRA 2I24N 4BZ2H 3NYDA 2YA1A 3PL6A 4PJGA 1BYCA 3PGFH 2Q86B 4QXGH 1OGSA 2I25N 3CZLA 1WWWX 2EE2A 1W9XA 1I1AD 4Z95H 4HXBL 2I9TB 1GGCH 1HHGA 1HL8A 3Q2CA 3RX7A 4Y2OA 3WMSA 2VB5A 1AY1L 4AL8L 4NQCE 4YN5A 1HJUA 3QIWC 4U0RC 3HC0A 2V2WA 3QIUA 4YDKL 4XVTL 4B9YA 2VKWA 2WM0A 3CFKA 3IRPX 3UTPE 3PGCA 2V38A 4RGMC 5HHQA 3MRHB 1JF5A 3QAZC 5D7IB 2ADGB 3HI5L 3OKOA 3WFDH 3EMQA 5CILH 4XNUH 3UAJD 2B7DT 3FRPG 5L6YL 2EO7A 1R87A 4CKQA 3PWPD 4MAZA 1B0RB 3PXHA 2Q3ZA 4KK5C 1AC6A 4QXGL 4PMVA 1FNFA 1Q0XH 2A9NL 5DD0H 1TVHB 5BZDA 2JIWA 2EDJA 1C3FA 1TR1A 4KK8D 3I3DA 4WI9A 5MENE 5IJKA 3ARDA 4U3HA 4XMPH 3MMDA 1I1CA 4PMRA 4BCEA 3FTGB 3UPCA 3HC0B 3QIUB 4UT7H 2PYEE 1ZJBA 3WHE0 4MS8C 3VXOA 4R26H 2VDQH 2XG9A 1QRNE 1MFEH 5F3BA 3MMEB 4L9DA 2DQXA 5ISZE 1SJEB 5GHWL 1XGPB 4JFHD 2AJXH 5CJQL 4FFYL 4XP5H 4NQUA 1R5WA 4YEFA 4HX1B 4YDJB 3GSXA 1ADQL 3U9UA 4OOZA 2V7HB 1S7UB 5TE4L 5EPMA 1VACB 2XT1B 5F88A 4E4PA 5A40E 4CCEA 1DBJL 3GIVA 4N90E 5AC5A 3GRWH 2BY0A 4M93C 3C08H 4PRHB 1MCJA 4EDWH 4P2RA 5C2BL 2Y5TA 1V3KA 1CCZA 3TCXA 1CXHA 4QO1A 5C0RH 3WFBH 2VQ1B 4B0MM 3LSOA 4YHMH 2FR4B 2P8MA 4FNSA 4W5ZA 3ZE0E 4ZO7A 5E99L 5IB1A 1IV8A 1WDQA 1ZS2A 1EEUA 5IB1B 1T2QL 4EI5B 2C8NA 4PV9A 2EDEA 1I8IB 1AIFA 3MBED 3RI5F 4U5IA 3PZUA 4MA8H 3AUVA 3SGDH 1LF1A 3BEWB 1U3HA 4M7ZC 1YEIH 3QQ4B 1UA6H 1CFTA 5K59E 2BFVH 4KKCD 5C0BE 1EXUA 4C7DA 5ANME 4CNIA 1G9EA 4AK1A 3LRSB 2R1WB 4OGXL 2IUZA 2JK5A 4F9DA 1UA3A 1E6QM 1G6RB 2J8OA 2XVLA 1O0VA 1J05A 3VMPA 3CMGA 1KCRL 3VXRD 2EJ1A 3CH8A 4CD8A 2E7BA 3X3GH 1QSFB 3T04D 1S7SB 4DFHA 1UR1A 3WEZA 4FQCL 4IDJH 3NABL 1QHOA 1HILA 1QRNB 1G7HA 4HUMB 3KPRD 5E2TH 1GJWA 3RILA 3GMPA 2ZX9A 5DD6A 4PJBA 3AB0C 3KL3A 3GNOA 5A3HA 3BKYL 3KPLA 2ZPKH 4ETYA 1GC1H 2WMIB 5K59F 2IAMC 3VW3L 1P69B 4F79A 3CXHJ 5TPWL 8FABB 1MIEH 3WY3A 5TFSH 43CAB 3NZ8A 4F57L 3VIFA 2IH3B 2R0KH 1NKOA 2IALB 3MLYH 2AEIT 1DDHB 4PRPE 1MFEL 1A6VL 3DSNA 5C09B 3TLRA 1WBXA 3UC0L 4KKAD 1RIVL 1AHWB 4HH8A 4NQDE 1A4KA 4K7PH 4WU7B 3OKDB 1TLKA 1CVRA 1TQCB 1VESA 3DMMC 2X1PA 4G80B 2FYVA 4OFYA 3UTSD 3W0KA 2JJTC 4R0LA 4GZEA 2X4UB 1A7PL 1BFVL 3EYQC 2YFOA 2P42B 3PNWB 3FQNA 4M7LT 3CZGA 1JPSL 2UY2A 1QQDB 3I6KA 1AI1H 1I1RA 1P7QD 4K3EH 4LCIL 4PRPA 2QF8A 2DM7A 4Q58C 3AHVA 4K7FA 4NWUH 3V6OC 4HJGB 4XNUL 1E4KA 4N42A 4L4OA 1TQCC 3DMMB 4P2QB 4WEMB 2CDEB 2YPLB 2ZCHL 3WH5A 2OI9B 1FDLL 3BZ4A 2QLYA 5CD5D 4A6YA 1KCSH 1S7TB 3D9AH 1QNSA 1AKJD 4MAYD 2QLVB 4GKSB 1ESWA 3U0TB 2AJYL 3T08A 4XGZA 1KTBA 1FORH 5MENA 2EXWD 2A1WH 1I3VA 4PJ9C 4AG4L 4MAYB 3W0WA 4NT6A 3OKKA 1UASA 4V1DE 4BQ4A 4P5TB 3QA3A 3A22A 1PKQA 2EE3A 5HI5D 4FFZL 1M01A 1BREA 2D4FA 1NC2D 4JB9H 2GTZA 3NN8A 5FGRA 2R2BB 5IG7A 2PKDA 3FN9A 2GCYB 4XP4H 2V5YA 1XIWD 1J8KA 4XCYB 1OQXA 6A3HA 3ARBC 4L4JA 4AMWA 2EAEA 3MV8D 1MLBA 5E1AB 1L7TH 1A6ZB 4NQDB 4PJGF 2EIDA 1FVDA 1T66D 4NRXA 4RISL 5J7CC 1I75A 2XXMB 4IRJB 1KIQA 4TNVF 5AWNL 1GVIA 2AAVA 4PY7B 1IAMA 2VDKL 2JF7A 5HY9A 2YPVH 5JW4Q 3MFFA 4WHYG 1CLOH 3CIQA 3W53A 4K8RH 4S3JA 2BSRB 1C5CH 2W63A 1NMAH 4AXNA 1SMOA 3P77B 4NZDA 5DO2D 3TO4B 2VLME 2A77H 3BGMA 1H15B 3I50H 5HGDB 4FNLH 1ZGLB 3S88L 4B3LA 2Z92B 3FMGH 4L1HA 4P4KA 4JRYB 5F7NC 3VE0B 1NBYA 3RJQB 4JDTH 4OM0L 1INDL 1CL7L 1JBJA 4Q6IA 4LLDA 5CCKL 4XZUA 1O7SA 1T66C 2QKIB 4LHUB 3WDQA 5ADPL 1QA9B 3WQ5A 2C4FT 1T0OA 2O9OA 4FTVE 4A2LA 5ITBH 5HPMA 3S36X 2AQ2A 1GYAA 3N11A 2F54A 2NW3B 4HFUH 1VENA 4KC3B 1UCBL 4F7MA 1VPOH 4GW5B 4XNZC 1QFUL 3L5WA 3QDGE 1MI5B 2P24A 2GT9B 4HFWB 5CXPA 2X44D 2P47B 4YHYC 3VA6A 3TBWA 2I26N 5FHBH 1GQKA 4QRPA 3HZKB 2YRLA 3BGMB 3HAEB 3L4WA 3TPKA 4KQ3H 1G0DA 4PP2A 1QBMH 5A6BA 2F18A 2V5CA 5I9QC 2X0HA 2DQCL 4JHZA 3WIHH 2DQDH 3O4LB 3C8KA 3UETA 4ZFGL 1YPZA 5BO1L 2B1AH 3VXNB 4U1MA 3WD1A 4P99A 4HUNB 2Z93A 4I9WE 1DUZB 4GAFB 1KWKA 3WXWL 3CLEL 1S7WA 4JANB 3P0VH 4BH8B 2R1YA 3DX4A 1OQOA 2Y7QA 4KK5D 2CYGA 2IANB 3B5TA 3TT1L 3VRLF 2D0HA 1I4FA 4X4MA 1G0CA 3Q6GH 1HINL 2RBLA 4WFEE 4N90D 1RK1A 1EDQA 5D7LB 3MCKB 3OKEA 4JPWL 1FH5H 1TG7A 2BNQB 1EJ6A 2F8QA 4KKBD 2RGMA 3N9GL 4UU9A 3FB8B 4JRXA 3DUSB 3U7YH 1TITA 5AY7A 5IROC 1RZKH 3GB7B 3GMOB 4NQCB 2PCPB 1KCUH 3PV6A 4L8SB 2PN5A 1U8QA 1PZ2A 4XVJH 5FUZH 1QI0A 1FO0L 2W07A 5DSCB 1SJEA 4JL2A 4FTVB 2BVUA 2F8VA 5DHVH 4M1CD 3GXTA 3MRRB 2DLTA 2UYLB 1PX4A 2IPTH 4W68A 1GCFA 1TJGH 2CJUL 4Z78A 3AMDA 4O2FA 3OHXA 1I4FB 3QR3A 3WN5C 3SDDA 2NY2B 3LQAL 4Y5XB 2AK4D 4P9MH 4HIEA 4U1GC 3W5MA 4G8FA 1YJDL 4J4PD 1R0AH 1FH5L 5EBMB 4P23A 1HWHB 4X7FC 2GW5A 1WUNT 2CK2A 4W81A 1ROWA 3QXUA 2CDFA 4LARH 5IB5B 4HS6B 1WGOA 3O3EB 1A6TA 3KDMB 2QSQA 5D70H 3BH8B 2CHOA 2ZG1A 1P84J 2WZHA 1P4LA 3BPOC 4NXKA 1S7RB 5F70A 4UT6H 1I9EA 5E0FA 4QCFA 1YY9D 3V7AG 1MW0A 4EDXA 1XZ0A 4PFEA 1KXVC 4YBQC 4AYGA 2DLIA 5MEOA 1DL7L 2DT3A 2V2WB 1FQ9C 1WBZA 4X7DC 1G7PB 1XH3B 5A8OA 2A6JA 4PTTA 4GI6A 1MJUH 4YHPB 1U93A 4TSBH 2APXA 4QY8B 4JREB 3TPUA 3NCFB 2AEWA 3SDCC 3W25A 1WSST 3CFCL 2IXUA 3QQ3B 4D3CH 4NQSA 3VIHA 1Z5LA 3HUJE 2HT2D 2G3NA 2K7PA 5DJZB 2R39A 4OCYH 5F1KC 2AS5M 4NWTL 4ELMF 4M5YH 4OGYH 5CJ5A 1TQBC 5EUKB 3NPSB 1OAXL 4AD4A 3D2UD 3WSUA 2OS7A 4ZUUA 1A1MA 4LNRA 2D7QA 5CLWA 3L3DA 3VGBA 4WHTA 1HILB 1CL7H 1CFSA 3L95A 4XB3A 2GYSA 3BD4A 1HJXA 3V8CA 1YEDA 2M8XA 4LAQL 1NGYB 2VRJA 1YHTA 1YJDH 3CO4A 4MJ6B 2F54E 3WJJC 3GI8H 1JHTA 1RI8A 4FFZH 3I6LE 4GQRA 1R3KA 4P46C 2X42A 3UTZA 4PMZA 2FZ3A 1FZKB 3AHTA 4U3XA 4P3DB 1NQBA 3MO1A 2X09A 2IPTL 2DKMA 1XGQA 2P43B 2P7TB 3HA0A 2WPGA 2OZ4A 5CEZD 1SM3L 1MHPH 2PTTA 5BZWB 3TV3L 3VKKA 3HB3C 1FORL 3T0XA 2AJ3B 4HUKB 5FYKU 1PYWA 4NDMA 2DI9A 3BDBA 4W88A 1XF3B 2OJEA 5T1KD 3QEHA 1NCUA 5E7FA 4X4XA 2QR0B 2NTFA 2DICA 4NRZA 1B88A 2VQ1A 1FAIL 4YX2H 2ITDB 3KR3L 4JVWA 5K9KB 1W2VA 1EH9A 4JQIL 1UGNA 3L3GB 1H3WM 4MSWA 1U3ZA 4APQA 4BZYA 3MV8E 2FL5B 3S5ZA 4YXHH 2C3VB 4M4RA 2FBOJ 1K5NB 1WCQA 4F7PA 4ODUA 4P5TD 2PCPA 3N1FC 4A6YB 2YD6A 1XGRA 3D50A 5J6HB 4Y1AB 5BWFA 3FZUD 3T4YB 5FDWA 1JYWA 5I1IH 3GI9L 4LCCB 1H3GA 3F7VA 2F15A 1BJ8A 1GHFL 1MVFA 1MIMH 4D94A 4MD5A 4JO3H 3HC4L 1I9JL 4DVBA 4MPKA 4DWSA 3MRQA 4QRRE 3U6RA 3ZDYF 1HF6A 3NCEB 1JJUA 1BVZA 1HEZA 4ORZC 4LFHG 5MERA 4F37K 4RGNB 4LCIH 1NLBH 4JPVL 3S8WA 4LSVH 3G04B 1RZIA 2R2HA 2B0SL 2BHUA 2YN5A 5K9QI 5BRPA 3T3ME 3UTSB 4YAQB 5J57B 2H1PL 3RWFA 3DO7A 1U58B 4OM0H 2VXUH 2IAMA 3RTQB 1C5DA 2VZUA 4K7PL 5IBUG 3ZTJH 4B5EA 2MPAH 3EJJX 2DQDL 3PZIA 4UOW0 5IEKA 2WCSA 4JO4L 3D3VB 3MRLA 1QI3A 2X4SB 4NZRH 1MUJA 3WFCL 3RWIB 3X12B 2W66A 4GKZA 2X4SA 4C7GA 3RL2A 5IESL 5C0AB 3WO4C 3QUYB 3QIBC 1NMAL 3MA7B 1I3RA 1SJHA 3NIDF 3WS3A 1S7SA 4XXDA 1MW2A 3EJUA 3TO4C 2YK1L 2OCFD 3R8QA 1BBJB 2YPVL 4KV5E 3HE6B 1AGDB 4AQOA 2BSTA 2V5TA 1MFNA 2DQJL 5HJ3B 5B4MC 5I1DA 1JNHA 3S98A 4Z8FL 5D1ZD 1SMAA 2O61A 1WZ1H 5BW7C 3BDYH 4PMYA 1E55A 1Q9OA 2IQAB 4UUJA 1GJUA 1W2KT 2FCBA 4ZS6D 2NW2A 3VFOB 4TPRL 2W65A 4WIWA 1XIWB 5D5MF 1I8KA 5E2UH 2FYYB 5JHDA 5FAAA 4GXUM 1BOGA 5F89B 1KJ3L 4ZFMA 1L7IH 3M6DA 1BZ7B 4L3EE 3CK0L 1Z9SA 2Y06L 3MI6A 4RL3A 4PJ7A 1KBBA 2WYSA 4JRYE 2P7TA 1ZT1A 4KKCC 1I1YA 1CLOL 3HUJA 3DHMA 3RVWD 2UWEE 3LMYA 1N59B 5ICXA 2HN7B 5MEPA 3MOBH 2GTZB 4UCFA 1A1NB 2Y23A 3WY4A 3FB6B 5IBLC 4CN1A 4X6CF 3BQUA 5CZVL 4PY8J 4WW2A 4CMMA 3TA9A 4OOUA 4JN2B 3EJZC 4M93B 2VL4A 4WUUB 1MI5E 3IDGB 3BWUC 2UZIH 1QOKA 1NCDH 3SIMA 4PJXA 1V6XA 1AO7E 4QHKJ 2JEPA 1HQ4A 4JB9L 1BBDH 2Z31C 4QP0A 3OGCB 4CAGA 4NI3A 1YY8A 2XTKA 2VAJA 1KLGB 2FH6A 2GJ6E 3U46A 5A8QA 2Z8WC 4OD1L 5LGJA 4GPNA 3DMMA 2W9EL 1FYTD 1MCBA 3JV6B 4K94C 2PTTB 4P5KA 5EU7E 4UNUA 1ISWA 4JJ5B 1FO0B 1R8LA 1YNTA 4E9LA 3MXWH 4D0BB 5HDQH 1V0KA 5FYLD 4ZFFA 4JKPH 4FN0A 1LP9B 2OTUB 4HC1H 4LNVA 5GRXG 3GXFA 4OLUL 3S96B 4GW4B 3SCRA 3BE1L 4HJ0D 2CKNA 3QHOA 1H8SA 4U1GB 3MX0A 1V3JA 1VCAA 3VWJA 1KPRA 4FQ2L 1B0GB 3KDMA 5D2NA 3U4EB 4LNRB 2GAZA 1ED3A 3GBML 4W7WA 3BP6A 3V5KA 4Z7WF 1LMKA 3MANA 2JJSC 3SEPA 4WJ5A 2GSGA 2UZYB 4JGJA 5F21B 2LQRA 1AQKH 4TN9A 3ZHKA 4HWBL 4MAUH 2PWDA 1OGAA 1F42A 2WXDM 5DRWB 1E6RA 3ALWA 2OQJB 1JGUL 4LPUA 4Q2ZA 5C08D 2FNBA 3TO4A 1U93B 1FVEB 5EOCH 1CR9L 5HYSA 2UYLA 2J7EA 3O2DH 4JLRA 5DEGA 3NA9L 4HOWA 4OV6F 5ALCL 5J3HC 3MRMB 1AD9A 2GY5A 5I8CA 5I2UA 2JK5B 5A6JA 3CPLB 5A3IC 5JW4N 3HRPA 5T5FL 4LRIA 1UQZA 5I78A 4LRNL 4YJZL 4E0RB 3LPGA 4UU9B 3PTQA 3NABH 3OG4B 3LEVH 1AGCA 4W93A 3BT2H 1RJCA 4HUXB 5DJDB 1CVSC 4NZTL 2DQJH 1FBIH 1G7QA 4R8WL 1IT9L 2RGLA 4RAUA 2ZUNA 1AXSA 1QLFB 4RRPG 4TTUA 1BOGB 5F89A 4PJGE 1D9KA 3DX7A 4I0PA 1ZXQA 2YKLL 1E6PA 4LU5L 4HGWB 1BWMA 1H2JA 2OZ4L 3GHEL 4X8JB 2RB8A 15C8L 1UM4H 3U30C 4FNPA 5CG0A 1L7IL 3HI1B 4X7EC 2HVJB 2MFNA 5IHZB 5FGSA 1ZA6B 3VRIB 5E2UL 1UQYA 1ZEAL 1I3GL 1RZ8A 5CSZB 4PRHA 2D20A 3IAPA 2YD9A 1T2QH 5LA0A 2MPAL 1FNEB 5BXPA 4ENED 4PJEB 3O6FD 3AHZA 3MREB 1XF4B 4HXAH 1BBJA 4YHML 3GUTB 1BLNA 1HK6A 3CD4A 5ELIA 5MHSE 4AWEA 1HDMB 3DLQR 4G9FA 5J1TC 5I3DA 3RUGE 4ZXBA 2F54B 4ZAKC 4Z7QF 3O9WA 3PWUB 3EUUA 4DZ8B 3O2VL 3EBVA 4XCFL 4D8PB 1J1PL 4JM4H 3SO5A 5L6YH 1CWVA 4FFVC 5IJKC 4G7YL 1TZ7A 2EIBA 4ZNEE 2VERN 2BP3A 5JUEL 1HHJA 4J2XA 3PABA 3T0EC 1H15A 2HP4A 4JLRB 2OLDA 4LGRB 4KMTH 4MQXD 4FNQA 1KN4L 3IFLL 3ZT6A 3O4OB 4LHUG 3T77A 1FGNL 1Q9KA 1RY7B 4X6DE 4DUXA 4FZEL 4J6RH 4U0RB 2C1OB 3U0WL 4Z7VB 1A7BA 2YUZA 5DJ0B 3MPCA 4HG4J 4QHNB 1PZ5B 3BESR 3ORJA 5KSAD 4OI8A 2HA1A 4LVOB 2VZ1A 4F7MB 1YY8B 1S9KC 2EZ0C 2BK8A 3IDYC 2WQRA 3M45A 3PGFL 2CIPA 5CILL 4PTUB 3W81A 3ZJ6A 1FJ1B 2XN9A 3TNMA 1DQJB 5IP4A 4PJ8A 3JWOH 4ZODA 2XNAA 2WMKA 1PG7X 4UAOB 4XTRC 1JF1B 3BXWA 3WMCA 1DQLH 3MUGB 4FQIL 1AY1H 5ESQB 4AL8H 3DHPA 2FIKB 3VIPA 2LU4A 5DD5L 3VJ6B 2FB4L 3AISA 1JV5A 3BOVA 1RPKA 5A16A 4OSUL 3W0WB 4JHBA 3FW6A 4HUVB 3PXJA 1VF8A 4LSPH 2ZG2A 2BSRA 2WUCL 3PG2A 4TSAH 3IU4L 3EYFA 5HHVL 5DUBB 1ORQB 2YFNA 4QXWA 4DN4L 3B9VA 4IMLB 4ZYKA 2JIXA 3A47A 5DMIH 4XRCB 2DQHL 1CL7I 4IMLA 2MHAB 4LQFH 3CZNA 1OGBA 1S9YA 4PGZA 2P5ED 3RVTC 5KW9L 4YQXL 4QRSB 2OM5A 3WELA 1KFWA 5AYUL 2A2QT 5DSCA 5JOPE 2VSDA 3RUGA 3D3VE 1M7IB 1U8QB 1A9EB 3ESVF 4PRWA 3NIGF 4GI8A 2NY0D 5DGRA 2F74A 5E4EB 4UOZA 1XCTB 4W8BA 2CO6B 1G1YA 2L7UA 1Q38A 3EOTH 5SV3A 4GO9A 3G6MA 1SEBA 1MLCA 1A6PA 5SX4H 1BQHG 3X17A 3ZOAA 5C8BB 2CLRB 2ESCA 3CFIC 2IBZX 3VXMD 4LOUC 1QVOB 1FAKT 1KPVA 3I6LD 3VD3A 4A2MA 1OTUD 4LAQH 5J0BA 4OZGF 5IQ9A 1B2WH 1QO3B 2UY6A 5EBWB 4FQXD 5T3ZH 3PWJB 4DKEL 5DZOA 4XPHH 2CKSA 3JV5A 1MFAH 2NT1A 4ZFOA 3VDBA 1ZS8B 1H8OA 2ZE0A 1C08B 5D9OA 4ORGB 2ICES 3DYPA 1I9IH 3CAFA 3D85A 3FRUA 4XVUD 1OGTA 4QTIL 3P4MA 3HG1B 1J0KA 3CGTA 2WVTA 4H1LH 1IKFH 1N8ZA 3VFPA 3RX8A 5FK9B 4UFMA 4WI7A 4APQD 3L4UA 3TBWB 4KK6C 3PL6D 4M1DH 3UJTH 5BOZG 1YEHL 1YQVL 2E27H 3VH8B 4S3KA 3OZ9L 4MA3B 3O6KL 4OCSL 5F93C 2XICA 1CICB 4HC1A 1FCGA 5C2UB 2XA3A 5KVMC 4LHUA 2CCRA 3UMTA 3PQYD 2GK1A 4MJ4A 1XF5B 3S37L 3ZKQD 3U83A 4J27A 1Z2KA 3DX0A 4AEFA 1REIA 3RL1B 3VXSD 1OGAE 4QHMB 1WT5A 4M81A 4G3YL 4PJ7E 2G3JA 2F53D 3QGVA 3B4NA 3ZYIA 2YUWA 4LSVL 4KK8C 2AKRA 4J1UB 3RWGA 3UO1L 4UTFA 4IRZH 3VI3F 3TBYB 3TN0A 1P7KA 3UEZA 3S36H 2JALA 5DJXB 4MXVF 1ZLVK 3A4XA 4PJXB 1A6WH 4G8GA 1UWUA 2CIIA 2C1PB 5ISZD 2Y24A 2EDBA 4WTXA 4G42B 5ACLA 3T0WA 1B3ZA 5D7JB 1MY7A 1HZHH 1KFAL 2OL3H 2VZ3A 2ZUMA 3CSYA 4GAJH 2ZSVB 4YHKH 1IGYA 4GKNB 3QUMH 5E5MB 4CNIB 3QXVA 1LP9E 3LQZB 2J3SA 5BZWA 1JZ6A 3GMRA 3QQ4A 2WB5A 3OPZL 1XR9B 2X1XR 3KPRB 1X5LA 1QKZH 3RRQA 4DO6A 1EFQA 4GG8B 4QHKI 4WVRA 5KANI 4G6AD 4GRLC 4PJIF 5D7IE 3UDWC 3RDKA 5DK0B 1JVKA 3LS5L 1FC1A 5CEZL 1TQWA 1AD9B 4MQSB 3T1WA 2ESVD 3VCLA 1OTUC 5JPNB 4XMKH 5JIKA 2DDQL 4BQ6A 5E9DA 1QSVA 5ETUB 1LLOA 2GFBB 2Y5TB 1B31A 1ZLUK 1K8DB 1RPQA 2VCCA 2EPNA 2VXTL 4U6HA 3SDAC 1V02A 1YC7A 3UBXB 1IC5H 5JXED 4Z7NE 3RZCD 2GKIA 5GS3A 3MV9A 1LO2L 1EHLL 4YHYB 1YQVH 1N3NA 3EO9H 4TRPL 4KQ3L 4JY5H 3CFKB 4JDZB 1RULL 3IJYB 4KTEH 3SO3C 1RJLB 2DAVA 1HIZA 5I71C 3MRBB 3MU7A 3MKKA 3VI4E 2B1HL 5IVZB 4X7SL 3RL2B 3V52H 5I8KL 4CVXA 4PGBB 3EYSH 4G8EB 1Q72L 4OUUB 3T4AB 4F3FA 3V0WL 1KIPB 4R0LB 3T3PF 4NHCL 4RMWA 4OFIA 4QHNA 4QLRA 5DVOA 5C7XH 4KRPD 3D39D 3OGSA 2EKSB 5FB8B 1P4IH 1K8IA 2YUXA 2D7PA 5I71B 5FUOH 4W5UA 3HG1A 3LQMA 3BUPA 5JXAH 3O2WH 4H20L 1IGML 4EUPH 4M8UA 3SGKA 1ZVSB 3TWCL 2FIRT 3WH9A 4PG9A 5B8CC 1CXIA 3EDJA 2ZXBA 1ZBWA 3WDPP 1I7RB 4UQ2A 5D93B 1Z5LB 4KUZL 2DWEB 4IRSC 1OSZA 3CDYA 1H11A 4RIRB 5EBWA 3U48A 4JRXE 1XCQA 2DQUH 3I02A 5D9NA 3SCQA 2W59A 3KHQA 5FFLA 1NL0L 1H09A 4Z6AT 2RFXB 3AS0A 1IL1B 4HH9B 2FX9H 4AIEA 2EDDA 2EDRA 3ROLB 5M17A 5DUPH 4CU8A 1QYGH 5A6BD 4MXVE 3V6OA 3RVTD 1ZWIB 3SCMD 1HYSC 1D5ZB 2NY6B 1BG4A 4NQEE 4NF7A 4E41E 4I77H 3PL6B 4QOKE 1GAFL 1HHIA 1T5XB 1LWRA 1YPZE 5EORH 4MJ5A 4APQB 4LBEB 4I5BA 2HLFC 3MOQA 1WAAF 4P9ML 2Q8BH 1ISVA 3IKCB 2XVGA 5HHVH 4QRSA 3PHSA 3WJLA 3TH2T 3NGBC 1JZ5A 2GITA 4BZ1L 2G3MA 4O4YH 3VCLB 3SE8L 5DEZA 2E5EA 1BZ7A 3HLAA 2RQ8A 5DHVB 5F6IB 4KQ4L 5FYLL 4H0IA 4NP4H 1WIUA 2WZIA 3QUML 4JZOA 4Q9QH 3WXVL 4LDOB 5ENWB 4HLJA 4CUCA 3OHXB 1JZ2A 3DROA 1E71M 1PAMA 1KCUL 1MREL 4GW1A 1UWXK 3OB0K 4YHOL 1FFQA 3WE6B 4Q6IC 1MW3A 1JV5B 2E9JA 5IHUL 5EZIL 3UYRH 1MREH 1RUQH 1GQLA 3J7HA 5KSBA 3ULVE 4Q74A 2X4UA 1C5BL 5ANMA 5CLTA 4R3SA 3VIMA 4ZD3L 1CLZH 3MJ8A 3WHE1 4LPCA 4JQVC 2OR7A 3BRDA 1I7ZA 3ZKMD 3BAEH 2Y2WA 3SOBL 2BNQA 4PSRA 2ATPA 3CMJA 3QUZD 1D5XA 4AY0A 1JHKH 4C55A 1RP9A 2A3EA 2JFEX 3PUCA 4NQXB 3RAJH 4HGKC 3VWJC 4ZE4A 3ZE2F 1HXKA 5AC4A 1FN4A 4MMZC 4R5EA 2R1YB 1AO7A 5FCSH 2XN9D 4B15A 3QP3A 5E24E 4F7TB 4LEXL 2YJQA 4Z2IA 3FQTB 4LHQB 2GK1B 3DWTA 5F9DC 2CMRL 3Q5TA 5I73B 5I77A 2VDMH 3PHOA 4HV8A 5JMRA 1CICA 3FN0L 1WBYB 3VWJB 4HK3J 3PZNA 1A7RH 2VX6A 2ZPKL 4XT1C 3CJJA 1RJZA 1V7MH 4NRYA 3BLBA 3NAAH 3QH3A 4NSKB 4QOKD 3QPQD 5FCUH 5HDBF 5SV4A 3MSGA 5K33A 4PJFA 2ADFL 5DJAA 3GSQB 1O5DT 2XFXA 4U6XB 3MROB 1UJ3B 3V6OE 2NX5E 4HIHB 1EVUA 4QRRB 4DW2H 1QA9A 1PZ3A 4F2MB 1FIEA 3WKMH 3INUH 5EWIH 4AZHA 3LV3A 3AFBA 3TH4T 3G5ZA 3BW9B 5F8RC 5FV1L 3SCMC 2AJVL 3K3QA 1BVLA 15C8H 1UM4L 4RGNC 3JTSA 1U92A 3BHBA 1ND0A 4WCYL 1I1WA 1DVFB 4E5XA 2ZJSL 3FFDA 2J5LC 1PKQB 3HNSH 4MNJA 4PMXA 1PPIA 3UTSE 3OKKB 4Z78B 1KPVB 3C5JB 1NCWH 2Y07L 3DX6A 4NZTH 1WO2A 3UTQA 1G7IB 1T21B 2CERA 2BNUB 1A0QH 2ERJC 2VLLB 1MHHA 4DOHB 2XIIA 4FLRA 4XV0A 2ORBH 5HYSG 5DJCB 4HULB 4LRNH 1VBUA 4MNQD 3HG1E 1EHLH 2QSVA 3V0AC 4NGHL 2QQLH 4L5FH 5TE7H 1ISYA 1QLFA 1LO2H 3GNPA 4KI5E 3DUSA 4YE4H 5BXSA 4O02H 3H7BB 3ZL4L 5A3ID 1LO5B 3QNXB 4Y4FD 5FECB 1OSPH 3O9WD 4JGUA 1FZKA 1JNDA 2XWDA 1ZHLA 1GONA 3SCOA 3S3SA 4M56A 4OSUH 5F96L 4NX0A 3EOBB 5DJ2B 2J4WH 2VR5A 1MFCH 1UD2A 5D7SL 1UQSB 2BVOB 1ITBB 1KULA 3VXQA 4FQPA 5IBTL 1Q6DA 1RHHA 1I7RA 2CRZA 3QIUC 3QYCA 3EKCA 3SCMB 2PR4H 4I3SL 5ITFA 3U30B 1OTSC 1YUHB 3O41B 4OM1H 3DDFA 3FZUC 2D0FA 1H3VA 1MJ8H 4D0CB 2VVSA 1IVLA 2W9LA 1N64H 4XP9L 1NAMA 1E70M 5D7LE 2JCCF 3PHOB 5IW6A 4ELMA 2EPKX 4LIQL 1RMFL 1S3KL 4ODVH 4W7UA 1CDBA 4OZFA 4NKDA 2C5DC 3RVVC 3SCNA 1G9NC 2EYTA 4TVPH 4ZPVB 7TAAA 4D9QE 3L5WB 4F8TA 1LG2A 1BFVH 2E7MA 1RUKL 3CNKA 4RGOL 2NPLX 5JHLH 1YECH 1FE8L 2X7LA 3HCVB 2D03H 4HIHA 1PQZB 1V3IA 3P4LA 2W9DH 3P9LA 2WW5A 4KVNH 2GVYA 1U0QA 5CIPB 4PGEA 1AQ0A 3MUZ1 2APTA 2EXYD 3WIFB 4EDXB 1ADQA 2W0PA 4ONHA 1ZJAA 4JZNB 4YZFE 3CIVA 4F57H 1WDPA 1ZGLA 5GJSL 5J12C 4KROD 1Y6NR 3PHAA 3D0VB 3AZTA 1VFOA 5GGTL 3LX9A 2B4CH 2VX4A 1CDGA 4MB3A 5ESVA 5EZOH 1BEYH 2JB6A 5I24A 4QRUB 5EOQH 1W3KA 4FQ1L 1EA9C 1R3HB 1XGZA 4DFIA 1YNLL 2MQ3A 4ACZB 5F6HJ 1JWSA 1IEAA 3A6BL 3JWDL 2IPKB 1UENA 3QI9C 4HXAL 4H7VA 5DRZA 4IEFB 1SY6H 3MLRL 1MCIA 2VUYA 5IQ7H 4L8DB 3AB0B 1UOKA 2QHRH 1V7NL 2EXYC 1EQCA 5FECA 2ZX7A 4C56A 4M9PA 3ZT5A 1P84K 3QULB 3L3HB 3EIFA 5DJ6A 4U1HB 2G60L 4POZC 3L6FB 4QWWC 3ROOB 3VU2A 3WENA 3MLUL 1S7UA 2AJVH 5HHPB 1SBSH 1DWGM 4AIUA 3ZYJA 3M17B 4MA8L 5A6MA 5DEFA 4JEGB 4NOBA 1KB5A 3OMZA 1EXUB 5HYJA 5MEPB 1MJJA 2MCG1 3IK2A 1ZV5A 5CSZA 4D6HA 2XTLA 4M61A 5JR1L 3FB5A 4P3WA 3BZEA 2BCKA 3BZDA 1KENH 3D6GA 3N1QC 4Y19E 3BPLC 5EO1A 2QQKH 4PBXA 4LASH 4JFWA 1ZKAA 4MQ7B 3BXNB 1MVYA 2JIXB 5T5FH 5C2BH 3AU1B 4PRNB 2UVFA 1DSFL 3RL1A 2FO4A 1FL5A 3OJDA 3V5HB 1U42A 1CXLA 4KKLC 4ZE5A 1X5AA 2CK0H 5TE4H 3UYOD 1Z6JT 1EEYA 4L29B 5D7JD 2VDML 3F62A 4WHCA 3S35H 4V2BA 2PC8A 2ID5A 1NEZG 3BUTA 3KPPB 3ZTNL 3RIAK 3U0PA 4FXGA 1EEZA 4TVUA 5HHOA 1E6SM 4PLKC 4F9LA 4GO8A 4JM2F 4MAUL 3IB4A 1BGXL 1YYML 4LQFL 2DIBA 5CPSA 3C2SA 4UT9L 2EO1A 1SJHB 3WS3B 4LLWA 3EMZA 2GSIB 1UWTA 1QI4A 2A73A 1XD0A 3GH5A 4Z2KA 3MNZB 5GGTH 3CFDB 5CSUA 2FX8H 4OB5H 4U7SA 4Z18A 5IFAH 3VILA 2JB5H 3GSUA 2YUVA 3U36A 4IJ3B 1ONQA 2NYYD 2EH7L 4XWOC 3MV8B 1YEGL 4WU5A 5J56B 5IT2L 3ECQA 2VCBA 1R46A 3P4OB 5T3XD 3BPLB 4UI2A 5GRUL 4JL1A 1X6NA 5JOEA 2J8GA 1C5BH 3DSFL 9CGTA 4I4WA 3K4AA 4TULL 3VH8G 4F7CB 1X44A 2VDRH 3C60B 4PJEE 2JJWA 3QHTC 4LLQA 4LFHD 4YXLH 1OD9A 3DOSA 1BYDA 2IWGA 3TBVA 2VCAA 1OWWA 4IMKA 2ATPB 4NO2A 5L2KB 3MUJA 5GGVH 4JQXC 1NCBH 2I07B 5AEAA 3THML 3WXVH 5I19L 5I30H 5I17B 3W6LA 5DYOB 2XWTB 1BFOA 4PJ7F 1XZ0B 2WBGA 3NFSL 4WWKA 1HEZB 5F7FA 3K46A 4LSSH 4O2EB 4GZIA 1IAIM 3C6LC 1PS3A 4K23H 5C07A 2JB5L 1HI6B 3ZZ1A 2ZWLT 4P5MB 4PGBA 4Z2GA 3ARPA 4YDLB 4P57B 3E3QE 4XI5D 4W89A 32C2A 1MWAH 4GG8A 3WE6A 4IS6B 2DKSA 3BZFB 1EAJA 3WDJA 3SKOB 2VJXA 1EO8H 2GCYA 4J8RA 5DHYA 2Q20A 4NQVB 4NYLB 2OX5A 4TTGA 4E2OA 5LGJB 4NC2B 2C4FU 1BAFL 5A95A 1MH5A 1UWQA 4MNLA 1PFCA 1AR2A 3O8XA 5GGRB 2UY7A 4NBZB 5AAWA 1MAKA 1OARH 2FL5A 1B3YA 4ODTH 2WANA 2HT3D 1H1NA 1X9QA 1D5BA 4XHJC 2BJMH 3NA4A 1K3IA 4YBQD 35C8H 4Q9RL 1V08A 4JFEE 4MDPA 1LNUB 4KUZH 2HVKA 4EJ1C 4MB4A 2HKHH 5FM4A 3ZHLA 3IETB 2V6HA 5D1ZB 2NNAB 1F6AB 4ZQKA 3RNKB 3MLZH 4FA8A 1B4JH 3CU1A 2ED7A 2VL5B 4JFXA 4HJGA 1IL1A 1CZ8H 2ZSWA 2UWFA 5KZ6A 2J5LB 3D25A 5T1KA 5GGUA 3T1FB 1Q94B 1A9BA 1GZPA 2CXKA 2WLYA 3LXBA 3MV9D 1UADC 4OLVH 4WWKD 4P59L 4MD0B 1EVTC 4CN4A 3SQBA 3DXAB 2YD5A 3TFKC 1KF9B 2FATL 4BFBD 5EU6A 2YKLH 5CEZE 2XA8L 1T0MA 5B8CA 1M7DB 4N1HB 2YRPA 4P2OA 1DWJM 1C7SA 1DQDH 2VISB 5EU5B 1OCWH 2OMNA 3AS1A 1MF2H 5E4IA 1KPUB 1F58H 5EBAA 3CFCH 2VE6A 2NXYB 4XX6A 5E2VL 4MB5A 4Q2ZB 4Q9BA 4F7CA 2O5YH 2VXSL 3HZKA 1TMQA 1HSAB 2XOTA 3AIRA 1CYGA 1SYSA 2IF7A 3IGAA 5DWUL 4KAQH 3MRDA 2JF1A 3F7YB 2DBLL 5F1IA 2H1PH 4OUUA 3T4AA 3NGBB 2R0ZH 3IFPA 1JFQH 4X83A 5HPMB 4J3SA 2DLGA 2NTSP 3LKNB 4LLVA 5IIEA 1YEEH 1GIGH 4TUJB 3D87B 4LARL 4OLEA 3ZYZA 1J1XL 3R0MA 3X3FL 4JPVH 2FBJH 3S96A 5C08B 5KZCD 3WQ4A 3RPIB 4R3SB 4CD7A 2K7QA 2D03L 3LQAH 1KJ2A 1OPGL 1TTGA 4PJAB 1MWAB 5HGAB 4HS6A 4WY7H 1RUKH 1XSIA 4HT1L 2E8YA 5E9DB 5ETUA 3TCLA 2N4IA 5DHXB 1CI5A 3NACH 1TMCB 4HKJA 1RVFH 3KAAA 2J88L 1HKLH 4JPIA 3JV6A 4R9HA 1UZ8B 4U1NA 3NCBB 2GJ6B 3GSRA 1KFAH 2OL3L 4OKVB 2ESVA 3F5WB 4PJDF 3VO0A 4OLUH 2W61A 3QQ9D 2P8PB 4K68A 3L5HA 4WHDA 4CVZA 1V0NA 1CQKA 3OL2A 1KC5H 2I5YL 5HDQL 1T1WB 4XP1H 5HYJD 4UQAA 5I8EB 1JK8B 2NLJA 3G5XB 4XBEH 3B8SA 4CMMB 5I1AA 1HINH 3STZA 5C0IA 1B3WA 1B0IA 3GMOA 1TVBB 3QZWG 5C0CD 3SCUA 4Y8DC 4OD1H 1DUYA 4IMKC 4F7PB 2EQDA 1GC1C 2Q7YA 2GJJA 1D5MA 3LDBC 4EI5C 5IOPA 5BV7H 3PWPE 1AQHA 4P3CH 4X80H 1QBLH 5KSUB 3O11B 4ACPA 3EDEA 1D5BB 1DBBH 1U2CA 1JUFB 2P1YA 1E4NA 2NY5L 3S4SB 4X99B 3VINA 2R29L 1AQMA 4GAYB 3ECBA 1VFFA 1ZAGA 5F7LB 2UZIL 1M71A 2FRGP 2B2XH 4HKBA 4QCIA 1R24B 3RKDC 3UJTL 3NFNB 4G7VL 4UZUA 5C08E 3TNNA 1CE6A 1ORSA 1J88A 5K9JL 1XGYH 1QI2A 4ATLA 4NKOA 1WB0A 4RDQG 1RJYB 2PXYB 4HCRL 5C0EA 2E6JA 5JQ6L 1T03H 1V02E 4Y88A 1NCWL 2OYPA 4M6MH 4XPAH 3MOBL 2QMJA 3NCJL 1WNOA 5L7XL 4PJIB 2Y36L 3AXLA 3PDOA 1VPOL 4NO3A 1KPRB 1BD2D 2K9UA 5CFHA 3KLHC 1CLYL 2VXQL 3UESA 5LA1A 1J0HA 1CGTA 2RGSA 2X70A 5IK3A 5E9DD 4FQHB 1J18A 1MI5A 1VDGA 2HH0H 5HYJE 3L95B 4FNRA 1HN1A 2PW1A 3C8DA 3S88H 2D31B 5E8OA 4BA8A 3ALXA 5F9JB 3X14A 3CUPA 1VAHA 1IGJA 3MOAL 2Y8KA 2ADFH 4GBXA 4JJ5A 2XKNB 5J9PA 1C5CL 3BN3B 4P7LA 2EYSB 3MJ7A 5IMKA 2P45B 4KDTA 3GXNA 1VGEH 2WBKA 5E95B 3ZDYE 5DJ8A 4XWGL 3KYKH 3U4BH 3FN0H 1JTOA 5FOBB 4PJ5D 5F7EH 3U36B 3P4NA 5EULV 1F97A 2V2XB 4AC1X 3D4ZA 3OXRB 3IDIB 4F15C 3F7QA 4D0CA 2O5XL 3NIGE 3UJIL 2VISA 5EU5A 1VJZA 3MJ9L 3CUJA 2HJFB 5DXWA 3QHMA 5ISZA 1D5MB 4FTVD 2C0HA 4GW4A 5A6LA 2UY5A 4NOFA 3CZJA 1FPTL 1XYFA 5J6GA 2A3HA 2DT0A 1X7QA 4TSAL 3O9WB 4Y4FA 3ZR5A 5L9DH 2GJXB 4URIA 2IAND 2B0SH 1ZA3B 1S5HA 2DMCA 3P30L 5JMOC 4JO1L 1RUPL 4XPGH 1N6UA 3MRKB 1OD0A 4Q7DA 3DROB 5T33L 2O9RA 3C5ZD 1CD8A 2XXCB 2CITA 3GNMH 3NCMA 1A1OA 2WWKT 4YXKH 5EO1B 4JY4B 2XZQH 3DX6B 3H9YA 2DB8A 5DVLA 3TFKD 4OT1L 1XR8B 2KL6A 4KDVA 1KJ2B 2EICA 4X9HA 3GIVB 1A3LL 1DUYB 3IYLW 4JVUA 3NACL 4NQCA 2KBGA 2D7TH 1NDMA 4XBPA 5L8JB 1F3JA 4EKXA 5C08A 3D85D 3WDIA 5JA9A 3B3IB 5L9DL 5GS0D 5EFDA 4NYLA 4X9IA 3PWLB 1FIGH 3CFJB 1BQLL 4HWEH 1AGCB 4KMTL 4GT7A 4P4RA 2ZZUT 1F6LL 3PZTA 4QRRA 4L8DA 4FQXA 3MJ9H 3MRNA 3X3FH 5CQ1A 1UFUA 4YXKL 4NQEB 4CL7A 4E41B 2F19L 4U6YA 1AXTH 3B5HA 3VH8A 4X6CE 5B39A 4WWKB 3PZMA 1AC0A 4PLJC 5JXEC 3OQ3B 1KGWA 1TE1A 4OLWL 3TV3H 2QQNH 1NC4D 1J1OL 3W39B 1GQIA 1J8HD 5ESVB 1A7NL 2IGFL 3VG0H 5C6TL 2MKLC 1GQJA 3C9NA 4YNYA 5C9JA 2VLKD 5E5UB 4ZUUB 4IOSD 4UTAL 1MFVA 3TO4D 1CBVH 4F33A 2BSTB 4ORGA 5HJ3A 2VLRA 5I1DB 5J89A 1MYRA 4WI8A 2ATKB 3RPIA 2FJGA 2DM3A 43CAA 4EUPG 3DV4B 3ARFB 4Z7QE 4XNZB 5I23A 5T3XE 5M94B 4WDIA 3LEYH 4MGXA 2P24B 4HFWA 5L2JB 3W6MA 2B8OT 4OD3H 1S9XA 4HP5A 1XGTB 1CE1L 3MRNB 3MRQB 3KPLB 4ML4A 2YPLD 4KJQC 5CJBA 3VIKA 1DQTA 1IGJB 2BOBA 2DSVA 1HH9B 1X4ZA 3H3BC 5E70A 1QVOA 5FA4A 3HS0B 5I1HL 5CJXC 2OZ4H 3GHEH 3VFVA 2YMXH 2PI6A 4RBPH 1ODUA 4MNKA 2GHWB 2YA2A 2XGIA 4EE9A 4PJDA 2W60A 4PJEF 1GOFA 1BAGA 3DBXA 1OCQA 3FB6A 3VXPA 2NY0C 3KPNA 1UEYA 3WHXA 1PIFA 2AEPL 3F7PC 2DSZA 3WFLA 2V7NB 4U1JB 2AXGB 3PDOB 5F1NB 1UWEL 1A3RL 3VVGA 5EBMA 4PJ8D 5CSBA 3GBDA 4ACYA 2NZ9D 2X4NA 1OD7A 43C9B 4X6FB 2J2ZA 1U3HD 2FJHB 5FYKL 1FYHB 4I0PD 5E8EB 5GS1A 1R3LB 4P4KC 1UXSB 3PDGA 1GJIA 4Y5VB 1E5JA 1I9RH 3HMXL 1JUFA 4PMDA 3RMEA 4FTVA 3WF2A 5FL1A 2VC2H 2XWBB 2NXZB 3HR6A 3VA2C 1MHEA 1QLEH 1N26A 2APFA 2J6EH 1G1CA 5JW3L 4R26L 3ZKXC 3FONB 4KPHH 1OP9A 2ITCB 1K3ZA 4HKZB 4JFZH 4QXUH 4RX4A 1FDLH 1RIHL 2XWTA 4XMPL 5L88H 1MWOA 4LF3A 1V0LA 1I3RB 4KTDH 5GZOC 3F6IA 3FCTA 5DA4A 1NEZB 4CMHC 5JTWA 4PJCB 5IF0A 4RAVA 1Z3GL 4DGIL 4CVZB 3FNDA 1HKLL 3VGEA 4CVUA 4ZTOL 2E0PA 3QOKA 3OX8B 5I19H 3QXDA 4GBXD 3WF3A 1AD0B 3LPPA 1S9XB 1HYRC 3O45A 4ZS7H 3UTPD 4EBQL 3VFOA 2DTML 5D7KD 1DZBA 3SE3A 4XH2B 5JLZB 2BNQE 2FJGB 3UBXI 1BZQK 4FFWC 1N0XL 4P23C 3T77B 1W9VA 1C7TA 1G7PA 1XH3A 3EYQD 5I1EH 4RFNC 2YD3A 4LLWB 3DBXB 4QHLA 1T4KB 2YDQA 1GGUA 3OV6A 1N7ML 1MCRA 1Q8MA 4KJQD 1JP5A 4QGYA 7CGTA 3PWPA 4JHWL 2CO7B 3IFLH 4D6GA 5DVNA 4NO3B 3JUGA 3CUIA 4WENB 2HLAA 5D9SB 4ALAH 3QI9D 2E40A 1K4DA 2VX5A 3F7VB 4G7YH 3F58H 3ZKNC 3D18A 1WKYA 2NQCA 4FQCH 1W8NA 4NN5B 3GMNA 4TTDC 2GIYA 2XI9A 1RU9H 5IR1A 1C92A 1D6VH 3OGCA 3WSQH 1X5ZA 3T65B 1NOFA 3TEUA 1DSFH 1MOEA 2JE8A 3WFEL 1AJ7H 1W72B 4PGCA 5GSRB 5ITBL 4WI6A 4EN3C 1V6UA 1JFQL 2NY3B 1JPST 1OVZA 2WIMA 5JNYB 3ZQ9A 5B39G 4OJFL 3SCMA 3BVXA 2HVMA 1W0YT 3K2MC 5B39B 1X5FA 2OI9C 4MXWH 1CZ8L 1OGAD 4DWSD 2R4RL 1GOGA 3QIUD 5DDHA 5E1AA 5DJDA 3T1FA 5FKPA 4AH2A 2LAGB 3BGFB 3MLUH 5DDHB 4IRSA 3RU8H 5D4QA 1I8IA 4TVCA 4Z0BH 1UWRA 4WW2C 1KEMH 1MQ8A 5DQJB 1FFPB 1WFOA 3WSQL 2AABH 4WFGE 4XCNA 1XGRB 5DO8A 5TGBA 3UCQA 1DEEA 2OXGA 3EYVB 3BKJL 4G6KH 4P5TA 1F11B 5GIRA 3RDTC 3A23A 3REVA 1BM3H 5GGSA 5CJ8A 2J7BA 2R15A 5EC1A 2G41A 4PUBL 1MVUB 3C5ZC 4KRPC 3AXIA 1XRVA 4N68A 3WCYA 1EO8L 1Y0LA 2BFGA 1A1OB 1UACH 2V7HA 3KYOA 4JZNA 1KJ2H 1R5WB 3WIFA 1EHAA 3VFMA 5F6HI 5E6YA 2D3NA 5DC9B 3FT2B 1K4DB 3CSPA 3KNBA 3WNPA 3NFPA 3EJQA 1WEJH 2W4XA 2P4AB 5DD5H 3FQNB 5D2NB 4S0SD 4WI5A 2HTLD 4NM8H 1EO5A 3MNWB 3QFJB 4KVNL 4D9RD 5FL0A 2ZCLH 4R4FL 3RWFB 7FABL 3EO0B 1AKJB 3DRTB 1T7ZA 2DTMH 3RZCA 3LKRB 4D6FA 1NUGA 3M07A 1YPZB 4P2OD 4RWYH 1I9JH 4AZCA 1G9NH 3HPJB 2EC9T 1HP4A 3HPJA 3HR5B 4Y1AE 1MJ7L 4UQCA 1QPPA 5HHNA 3GI9H 2YS4A 4HXBH 4GRLA 3UDWA 1H8NA 1FNLA 5HHQB 3DVGA 4WEUD 3VGAB 3NFNA 4ZTPL 4X9YA 5ESAA 3U7AA 3QXDB 1NGZB 5JORB 1HH6B 4NKQB 4RMUA 1WAAA 1ZHLB 3MCLH 3UC0H 2MMXA 3W11C 1A6ZA 1UKTA 1Q4NX 2CH8A 5C0BB 3QQNA 2YSSA 4JFDD 4Z76B 4FQLL 4WFFD 3HMXH 4R4FH 1KB5L 4PRDB 4R90H 4V1DD 1OP3H 1HXYA 4S2SB 3STLB 4KZDL 2Z8VC 1LVEA 3RBGA 3ILQC 3ULUF 3SKMB 4HWNA 5KG9A 3WNMA 5HOSA 3OWEA 4K3GA 1WCGA 2AQ3A 3MMWA 3TN0C 3SN6N 4JFFA 5B38B 3MGTB 4L29A 5I76B 1NCCL 4JR9L 3ARDC 4MX7B 5F7YC 2JIXD 1U8HA 3FQXB 1X5XA 3UTOA 1CE6B 2IC2A 5F97E 1U92B 2XZCH 5JOPD 3CDCA 3L3IB 1G7JA 3ES6A 2FR4A 1AE6L 3AIBA 2WC3A 2AW2A 5FM5O 4ZXLA 4PRPB 1S7XB 4IIQA 4MJIB 3LKPA 2HG5A 4P2RB 3VD7A 4H0HB 2E7CA 4W6WB 5A6SA 3L7EB 1ZSDB 4U3CA 4M9OA 4X5XA 1I7TA 4ZO6A 5FGCB 5GNXA 1ZTXL 2J25A 4WIQA 5KSBE 1OM3H 1X5YA 1OAQH 3HAEG 4OUEA 1FP5A 2WHKA 4R8WH 3QA3B 2GT9A 4YHNB 3N9KA 4X9GA 3VIIA 2AGJH 1PKQE 1LL4A 1L8NA 2C1PA 1FZMA 3R0NA 1NDGB 4H8UA 2GSJA 4GKZB 4P9HH 2J7DA 5I2IB 1OTTC 2R1XB 1DQQB 4ZUVA 4GKOA 5KSAA 3QUKA 3F5JA 4DOHE 4RIRA 4XZUB 3V4UH 3BO8B 3RPMA 2ZX8A 3D2UA 1CTOA 2Z31B 4UTBH 1GPOH 1R3HA 4YIQA 3QHZL 5DA0B 4WU5B 2K1MA 1HXMA 4LLYA 4WFHD 5CJQH 2WAHA 4JFEB 2YPKB 3D0LA 4CU6A 3AM8C 4JFTA 3P11L 3KWWA 1BPLB 1UCTA 2H9GA 1MRFL 1CTNA 3C9NB 4KY1L 6FABH 2HFEB 3VXMA 1KPUA 2D31A 4XPBL 3SUVA 4NUGH 4QRPB 2D1ZA 2V9QA 3OF6D 2YBRB 1IQWL 4WUUE 4QTHA 2A6IA 1ZHNB 3L1OL 3G9VA 3A6BH 3JWDH 2CSPA 1K4CA 2Q76A 5HGHB 1J01A 5IHSA 2IG2L 2CUMA 2N7BA 1UXWB 4UTAH 2F7QA 1CXKA 1LL7A 3RGVD 1HQRA 3IVKA 1UM6L 4FQ1H 2DM4A 3P0YL 2IALA 3QDAA 3D48R 4FZ8H 2DQEH 3GBNH 5DD3H 2DH2A 5HHMD 4GH7B 1N7MH 5F7HA 1FZOB 1ULVA 5E1HB 3RY4A 3SUUA 4YHOH 3PWJA 1TETH 2Z92A 4X6EB 4OM1L 3FY1A 2EECA 2V5MA 4OQ1A 3FQXA 4C59B 3QRFM 1CECA 4ELMB 3D52A 1C93A 2D3VA 1ZLSL 4LSTL 1YEFH 4XPGL 3A4WA 2XG5A 4MJ5B 2YXFA 1XGUB 5F96H 1I7ZB 4TUKL 3ZDXE 1AH1A 5D2LA 4C56D 4LGXA 4LCCC 4PJFE 5TE6H 3SKMA 1ZT4A 4Y16A 3DXAA 1YPZF 2F74B 3E0GA 4QGTA 4UIKL 5IROA 3QIBD 1FPTH 4HK3N 3ULVL 2PYED 4N0CD 4R2GD 3SDXF 1SYVA 1JAKA 3BVVA 4YHZH 1S5HB 4DEPB 4GLRH 3DPBA 32C2B 3ILQD 3BUDA 4KZEH 5H94A 1SZNA 5A2AA 1S7QA 4CN6A 1AHWC 5I1CH 5D1ZC 3KYMA 1BZ9B 2LAAA 3TZVC 4LQ1A 3CZEA 5C71A 3UTTD 1E6XM 5E9DE 1KTDA 1UCBH 3CC1A 4H5SA 3GMLB 1CDJA 2HJKA 3GJFB 3C5JA 4WNQB 3T0EA 1W1TA 2WMHA 4KVCL 5KEZA 1C12A 5DJXA 5CEXA 3TO2B 1FHLA 3BDXA 1AP2B 1A1MB 4S11A 5E08L 2EPMX 1VFAB 3SDYH 3RZCB 2ALWA 3CXDH 4XZBA 2BNJA 2YN3A 5F7KC 1RZKC 1X5GA 4YEEA 1INEH 2G2RA 3GK8L 5J9PB 5I1JH 4J4PA 4JFHE 1VJSA 2X4TB 4NHUB 4ODHH 1BIIA 3SDCD 5I15L 5I8OL 4XCEA 1MNUL 4CD6A 1AFVH 4I48A 4M29A 1DTUA 3IVKB 3PWPB 4N0YH 1Q72H 4J3TA 4OLYL 4UQEA 4R0LC 2AJUL 1HHHB 5A8MA 1JI1A 1N6VA 5GXBB 1DJSA 3ARFA 4XHQA 3PJSA 3KYOB 2EE6A 4F33B 5EN2B 3JXAA 1KLUA 3BC9A 2HFEA 3VXMB 3EO9L 2XFFA 3O3EA 2WC7A 2J74A 2R69H 2P5WB 5EC1B 4GQ9H 1EUUA 5JLZA 1FL5B 3O4OC 2EBNA 1AIFB 1E9LA 2BHZA 3BAXA 5EZLB 5AZEH 4DVRL 4CBPA 4YDVA 3SOBH 1DP0A 3WN5A 5MEQA 4OBSA 4RBPK 3WUWG 4YBLC 1BVNP 3EJSA 2V3DA 1NLBL 2VDPH 1KACB 3B9AA 4OFYD 1QFWH 3KPRA 3G5VB 1DBKH 1MSPA 4JDZA 2FSEB 5EZIH 1A7QL 4UILL 5AYQA 3H9SA 8CGTA 4Z2HA 4DKAA 3Q6FB 3ZKSD 4Z7WA 1RP8A 4XTRD 4S1RL 3GNML 1TZGH 1E27B 1HVQA 2ZOLB 1NOUA 1AI1L 4H25B 3TV8A 1U95A 4TQEL 1QFHA 4ZPTB 1FFNA 4XPTL 4HAFA 4X4ZA 3BVNA 1KN2L 3D69B 5D7LA 1R5IA 3S34H 4P46A 5D1QD 1YDPA 4W6YB 2ED8A 4O4YL 4ZXBD 3AU1A 4PRNA 2WKLA 5JOFB 1RUAL 1RZKL 5DLMH 1RZGB 1IEAB 1UZ6F 1WAWA 2X4OA 3O3BB 3N9GH 1U30A 1FZOA 5FF6A 4JQIH 3ARDD 1C1EL 1SEQH 2P5EB 3SCPA 4Z5RA 3P11H 4EXKA 5HYEA 1ITXA 2GK0A 1CDIA 4A3YA 5I66A 2P5WE 4U0QB 4BKLB 5MP6L 3KYNA 2WZEA 2OSLB 3BPOB 4L4TA 2IQ9L 3PJSB 1IQDB 4KGJA 4ONFL 3OKMB 4S1QL 3WUWB 2W0FB 3UAJC 3O9WC 4X4YB 4NRYB 4UIMB 3OAZH 4KQ4H 4G42A 4FQJL 4NNPH 3IJHB 4QF1B 4N0FA 1RV6X 2J75A 4TUJA 3IKKA 4UDUA 1PQZA 1EAPA 4LHJB 1DDHA 2JELH 4M3KB 3KWWB 3WFHA 1P2CA 2ICCA 4M43H 5D1QB 3BUIA 4A3HA 4RFOL 3TBYA 3T2OA 1HKMA 1XGTA 3H2WA 3IJ9A 3B5GA 4M8QA 4Y89A 5L2JA 2CUIA 5I1GH 1CENA 6FABL 4I0KA 1K9FA 2NY4D 3P73A 4MTVA 3BIKA 3O0RL 1UEMA 1AGFB 4H1LA 1TQBB 3VFTA 4K8RD 2APWA 3TTYA 1GIGL 1E40A 1NUNB 3WDHA 5IGXL 1YEIL 1U91B 2R1XA 4PYGA 4ZUVB 3NDZA 2WVSA 2PXYC 4AT6A 4PS4L 1IGIL 2VDLL 1ACYH 2G9HB 1R7AA 3OKNB 4UOQA 4M62L 3DXAE 4HW6A 4HK0A 4MLSA 2ITCA 1D6EB 3V4VH 1GORA 3G6AA 1KIPA 1GGTA 1MCKA 1F4AA 1MAJA 5KSBB 5C0RL 4YLQT 3K74B 4NN7C 4W86A 1A6TB 3QUXC 2EPLX 2EDYA 3A0OA 1KGCE 4PJDE 4FFVD 5FDYA 1XCXA 1VKXA 3CX5K 3IDJA 1UM5H 2JLLA 3OJDB 3QEGL 2FATH 3O3BA 3MJ6A 2EYTB 5FDWB 1OW0C 1T83C 5C1MB 4PN2A 5H8DA 4LVHB 3EDKA 2OWWA 3SY0A 4L4VA 3UG4A 2WCGA 1L9MA 4GAGH 1KTLB 4WTZG 1KT2B 4GAYA 3IS0X 4Z0XB 2XZCL 4POUB 5JBDA 4ZNEA 3TA3A 3MGTA 4U7MA 2WNWA 1IAKB 7A3HA 4Z0XA 2VABB 4WI2A 5EU6E 1W8OA 1DANU 4OIBA 3APGA 2H41A 4DCQB 4DUVA 4DAGH 3O6FB 4G7VH 3IU4H 4JY5L 3FO2A 2LVEA 2VZVA 1NMBL 3RWEB 4NO0A 1S9WA 3QUZC 4QRPE 3MA9H 3NFSH 1HOCB 1OSEA 5HI3C 4WW1B 3U7BA 1F4YH 3CXHK 4WUKH 1RVFL 3BZFA 1T1WA 1QQDA 3NIFF 1DQLL 3BRGC 1YMMA 4NJAH 2PETA 4ZO8A 4GXPA 4PJ7B 2GY7B 1LE9A 2HLFD 1NCTA 5C0BD 1XCQB 4Q22A 7FABH 1QI5A 3H53A 3QG7L 3VFGH 5D2LB 3O3AA 5IMLA 4JKLA 4J3WA 4E42B 4OLZH 1JGDA 1I7UB 4WI3A 2DMKA 1A4KB 4WU7A 4JHOA 3W26A 3L5IA 2G9HA 1I85C 4KKAC 4Z77A 1Z9MA 5A2IH 4OZ4A 2EDWA 2FWOB 3VXPB 3O9NA 1UWGL 2A83A 3UPRB 3MLTB 3U2SA 1KJ2L 4RZCB 2UY3A 5DJ8B 3A4AA 4GO6B 4JY6B 1GZQA 8FABA 3CZ8A 2Z31A 3AJ7A 3ULUH 4Q97A 3FJTA 1QPKA 2X4QB 3QG6A 4GAJL 4PREB 4HU0A 5D1XA 3VDAA 3RJXA 4NQSB 4RWYL 4DTGH 3W24A 3WIHL 3MNWA 4GINA 3O3DA 1TCMA 4ZFZB 3LH2H 3VFRB 4HPHA 3VPLA 3SBWA 5IWLA 1QUNA 3FAXA 3DIFA 3BP5A 1FYTB 1G94A 3S35L 1KTCA 5E7BA 3S3JA 1MF2L 2J8UB 4CADB 2G2RB 1ZMYA 3PWLA 4NM8L 5TH2A 4CU7A 2OYMA 1H5BA 1ZHNA 1BQCA 5ID0B 1UR2A 1FSKC 4LK4A 1I1AA 1T4KA 3EYUL 4HFUL 2OSLA 1E28B 3EO1B 3CHDA 3P77A 4DKEH 1RZ8B 3DUUB 4PJIA 3W39A 1WAAE 2EEAA 3HMCA 4M6NL 2EZ0D 1LHZA 1MVUA 4POZD 4BFIA 1ZA6A 3VRIA 3KPSB 3CH9A 3KWXA 1T22A 3HG5A 3RVXC 1UC6A 2PXYA 3PP3K 3I9GH 3DV6A 1HWGB 5FYJH 3AICA 4M1DL 1XIWC 4JM2C 2VLJE 3OX8A 2Z0BA 5CGYD 2AGJL 1OAKL 3PE9A 4WKHA 3BKJH 4IRSB 4XAWH 4Q9RH 3PZOA 1KCVL 3PWNB 1ZTXH 5IB2A 2EDHA 1QEWA 1XMWA 1GOHA 5KG9B