1OT1A

Bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant d135a
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIAFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The fully conserved Asp residue in Conserved sequence region I of the alpha-amylase Family is crucial for the Catalytic Site Architecture and Activity
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
total genus 237
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot1A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot1A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ot1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ot1A01
4MXWH 1RUQH 1GVYA 3PZMA 2WP3T 4M62L 4Y4HC 4KHXL 3CZNA 3C5SB 4PTXA 4M6ML 1QFHA 3SY0A 1FBIL 1UA3A 2XFXB 5I18L 1LQ0A 4X98A 4PBXA 4FFVD 1F4WH 3GKZA 2VDNH 5IFPA 4PP1D 2P8LB 4HS8L 3QO0B 5EZOL 3QEQE 5A8NA 2DQHH 2CRMA 3C5JA 4OQTA 2VWEE 1AKJA 4QTIL 1MFAL 5EOCH 2VSCA 2F53E 2FB4L 3UPCA 1M03A 1P9MC 1IZJA 3ARGA 3QCTH 3P73B 3T0WA 1DQJA 3U7BA 3EJUA 1P9MA 3KPLA 3GJEB 1NBVL 3WYRA 3DVIA 2NY6B 4KDVA 4DCQB 4U4BA 1ZT4A 4G9FD 4JRYB 2EDFA 3L3KB 4HUNB 3AY4C 2QHAA 5TE7L 4DZ8A 5C0DB 1RAMA 2CDEA 4CW1A 4R9HA 1CFBA 1YY9C 3LVEA 3UJJL 3WNKA 3BDYL 3E3QE 3PGCB 4V1DB 1ORQB 4LAQL 3MRJB 5HYJB 4LYPA 3O9WD 3CCHB 3HRPA 4Y4KD 4NQUA 3AREC 4NZRH 1ZA6A 2FATL 3VG9C 5B39G 3BCFA 2NYYC 4ONOA 5FYLE 4XP1L 2A77H 2GHWB 3PHOA 2VDOH 5GGSA 2ITCB 3DRTB 1BF8A 2G5RA 1D2KA 3NSNA 1A4KA 1OY3B 1BGXH 2GUOB 4ZAKB 3UO1H 2XVPA 5J8OA 3BKJH 4MJ6B 5E1AB 3VRIA 1JNNL 2E7BA 3OZ9H 5F96L 4JZJA 3RWGB 4E0RB 2UY5A 5C0CB 5AY7A 4ZDHA 5JZ7C 5FO8A 5DRZA 3BP4B 4K3JL 4KUCD 1T7VA 3CX2A 5FUZL 1P84K 1FPTH 2OM5A 5DJ6B 4Z8FL 5BJTA 3TV3L 3S34L 4CDGC 3PWPE 3OQ3B 3ZT5A 4JDTL 4JY4B 1ZVSB 1BHGA 3MGTA 4CMMA 5D9MA 3H9HA 1YEHH 1R3LB 5JPNB 1A47A 1TVHB 1OTSD 2OS7A 1FVDB 3W82A 1T5XA 3HMXA 3QEQD 3ECQA 4M5YL 2ZSVA 3CLFH 1NC2B 1V3KA 3VFOA 5T3XH 5D9SA 1RULL 1N6UA 3SIMA 3MX0A 4LLQA 5FB8B 2CIPA 3VXRB 5JLZA 1V5JA 1DQDH 5FKYA 5J6HA 2ZCKL 1FIEA 1CG9B 3T0BA 1NMBL 1I1WA 5E4EC 3WELA 2ZX8A 1QSFA 4U5IA 1RD6A 4CVXA 3K2UL 4RZCB 3U30B 2J12B 4LARL 1OAKH 3PABA 4H8WH 5IVXB 4GS7C 2IPTH 3EJRA 3SUUA 2ZUVA 1JGLL 1T2JA 5DQJA 3BZFA 4HXBH 4YR6A 4M3KB 2FGLA 1XCQB 4Y1AB 3MSGA 4A6YH 3GSUB 2BZDA 3JTSA 2W60B 4G6AC 5CIPA 1TJGL 3G5VA 1S9VB 4S1DD 5JW3L 2D9QB 2HN7A 3D39B 3I75B 1OGAE 4JFUA 1ZT1A 2X2HA 1UH3A 3DXAB 3BIBX 2XHYA 2EYRA 3TT1L 2XNAA 4P23C 1A5FH 2YD9A 1WGOA 1H41A 2TAAA 3O2LA 2X4OA 5DT7A 1U95B 5T1MB 4HJ0C 2VZSA 5DK2B 2GVYA 1UR4A 4LMQE 1W8OA 1RZ7L 3UMTA 1SBBA 2HAZA 3DXAE 3OR7B 1JGVH 5JHDA 2IQAA 4D71A 5BZDB 5JOEA 1XF4B 4OIBA 2W9EL 5DO8A 2G5BB 1UXSB 2Y25A 1AR1C 3GSRA 1MFBL 1UWTA 3MRFA 4LSUH 1IEAA 4GRWF 5F1SA 1FNAA 3WQ8A 1GPFA 4WI9A 4YJZL 1UKQA 4M43H 2QF8A 3CFKA 3A21A 5GNXA 5C3TA 4F9PA 2OSLA 1JXKA 2PYEB 3C6LA 5KSAD 5I8OH 5GRUH 4PCTA 3ARUA 5MERA 4BSVB 5E2VL 1BIIB 1FFOB 2OSWA 3GKWH 3PGDB 4W7VA 1AY1H 2VCCA 5KG9A 4LPUA 3N11A 3TP4A 4GKOA 4MMZC 4JRXD 4MAYB 2UWEE 2AI0H 2I26N 4MJIB 1P6FA 4D9RD 5FYJD 1HJXA 5ITBH 3CGTA 1OP3K 4EXKA 3MJ9H 3ZE0F 3SGEI 1MHHB 3O41A 3ARFD 2Q8AH 3G9AB 4JFDE 2QQNH 5EOCJ 4R5EA 1ZBCA 5F97E 1HHHB 4XP4H 3T8XA 4DW2H 1AQMA 1CU4L 1T20A 4LLYA 3CHCA 3QDJD 4MDJA 3B9AA 2IMMA 1E40A 4WJXA 3HKFA 5EBWB 2H8PB 3ORJA 2C3VB 3OWEA 3PQYE 4AT6B 1Z32X 3OR6B 3G6LA 3QFJE 5FYJL 3RDTB 4JM2A 3MZTA 4KQ4L 3SKOA 5C0FA 2YXMA 3BZ4B 3P2TA 2DIBA 2FO1A 1QSEA 4KKAD 1PG7H 2XICA 3S98A 4BQBA 1A2YB 4CAGA 5A94A 1YA5A 1UKPA 1FZJB 2W61A 4R8WL 4DTGL 4P2QA 2IXVA 5DJ0B 4TUJB 4P7QA 4YEFA 3RGVD 4MXVF 3EOYG 3RCNA 4GBXB 3FQNB 5DC9B 5E24E 4X99A 1FV1B 3FO1A 1J0JA 2YKLH 3MRNB 1U8MB 4HEME 4XNMA 3P0VH 5FDYA 4I4WB 1N4XL 3RZCC 4W5ZA 1SHMA 3KXFD 4BELD 3UBXG 3SE9L 1RJYA 4PGDB 3ARDC 3L5WB 3VFSB 2Z92A 3L9RB 4XWGH 2CBIA 4P9MH 2Q6WB 4DWSC 5K33A 1OLZA 1UWIA 2X4PB 2ZUUA 4MADA 4QNPF 4HPYH 1JP5A 1TJHH 1DDHB 5D2LA 4LCUB 1MJJB 2KZ1B 4DAGH 4XCNB 2XIIA 2HG5B 4DKEH 1ZJBA 4UBDD 5EU4A 1ZVYA 3G6DL 1MCDA 3V52H 2OI9B 4JFFB 4D6HA 3QULA 2YSSB 5CSZA 4J3OC 4X9IA 4YAQB 4FLRA 2CUHA 2DQUH 4RFNB 4BYHA 3S2CA 3KPMA 2GJZA 1OQXA 5IMOA 5DVNA 1XH3B 5HI3D 3U0TA 3SE4C 3OGOE 2A83A 1KYOJ 1ZA3A 4LHUD 2X4RB 3IDUA 4R2GB 4OD2B 4Z5RB 1UB6B 1H2JA 3DSFL 5GRVK 3C9NA 2H32H 2H3NA 2C4XA 2ARJB 1XHGA 4EQ3A 5C0BE 1XIWC 1QLEH 3AMGA 3JWDL 3FN0L 3HFMH 1LD9A 1BLNA 3I6KA 1QNPA 2WWKT 4UZGA 5E2UL 4PJ5B 1M7XA 4LQFL 3DECA 3BRGC 1CDYA 3FQXB 1WFUA 2DAVA 3NCFB 1XYFA 3LPWA 2H6PB 1FIGL 1B4RA 3CHEA 4XAKE 4HDIA 5D6CB 5A2BA 3NIFF 4AD2A 5ISZA 4TNWK 1T20B 1F6AB 4DGIH 2VQTA 1WKYA 1PZ3A 3EFDL 1OCQA 5E99L 2AJXL 2A73B 2P42B 1CICC 4NHCL 3KL0A 3VDAA 4L8SA 4TOYH 1R24A 4DO6A 2JF7A 2PB1A 4ODSH 4Y1AD 5FKAB 3X3FH 4HU8A 4L3EA 2V2WA 2Y24A 2J4WL 1OIFA 3ULUH 2JJTC 1NGQL 3BWUC 4OCRH 1RUQL 7A3HA 3MV11 4MJ2A 4F33A 5CGTA 2GJXA 2J7HA 4F9LC 3GI8L 5IUSA 4MQSB 4UMGA 3IJHA 5KTEH 2Y2WA 3RWEB 4UILL 4KK5D 4Y89A 2IEPA 5CZKA 2GSIA 3ZKND 1ETZA 5HGGS 1RURL 2IH1B 1UR0A 4KUCF 3RJQB 1EUTA 3QO1A 3G04B 3AXXA 5SX5K 4GXUM 4M48H 1ND0A 4W70A 3TO4D 4JE4B 1CXIA 1UXWB 4YC2C 5KSUA 5FHBL 2AAAA 1FC2D 3L95B 1JF6A 1B88A 3RJXA 3WO4C 1RK1B 4IM4A 1TVBA 3SCMD 1I7TA 2G75A 1XCQA 4Y1AA 3WH7A 5J57B 4R96B 1OTUC 2R1YA 3FO2A 4XV0A 3WNOA 2B1HL 3BH8B 3IU3B 3SKJH 3GO1L 4ZUUB 4DWHA 4AZ5A 3EDKA 2RAMA 4Z7WB 2F54D 4GXPA 4O02L 2DWDB 3EDDA 4WVRA 5H8DA 1LEGB 2BOCA 1RZKH 5D72L 1UYQA 4OFVA 3EOTL 2NQCA 1MQKL 2YPKA 3TESA 1X5XA 3WD0A 3UBXB 4QEGA 2BCKA 4LCIL 5C0CE 5JBEA 3W0KA 3K81A 2WBWB 2A9MH 1RHHB 4EZMA 1KCRH 3VI4F 3VXRD 2XRAH 4WENB 4N0CD 5ILTH 3U2SA 2NXZB 5JUVA 3VXUE 3NZHH 1HXYB 2VDQH 3JV6A 3VXPB 3D85D 2WC7A 1MHPL 4KTDH 2NCMA 3PGFL 5EPMA 1WT5C 1AGEA 4R4BA 2PTTA 3A0OA 2VDOL 3CFCH 2GT9B 1ZB5A 3VD4A 4JM4H 3AQUA 4P8WA 2YUXA 3RY4A 4GBXD 1MCPH 3ARZA 2BVEA 3E2HC 1FBIH 3OGCB 4G6KH 4KHTH 2VJXA 1FNSH 2WMPA 2ZCHL 1ADQA 3GSOB 5AWNL 4YX2L 4KKBC 3RWJA 5F7NC 1JF5A 1NL0L 3WUZA 2A83B 1U2HA 4XX1G 3S36H 1W91A 5I0DA 1G1YA 4NKIH 2NW2B 1KJ2L 1KB5H 1NLBH 3CLWA 5ISZE 4C7GA 4OZFG 5GGTL 1WDRA 5CQ1A 3MA7B 3QUKA 2J6EA 3EAKA 3FQRB 4PJCF 4U0QB 2BSTB 3PL6B 1CVSC 1AC0A 4WHTA 2IGFL 1T5XB 1FYTA 4IDJL 3ZHDA 2P49B 1G1CA 4KVNL 4LL9A 4JO4L 2Z93A 5F3HA 4MWFA 4P2OD 4O51A 2FDMA 4QTHA 4MAYD 1WCQA 3FAWA 1A7RL 3NCEB 4CRPA 5LA0A 5JOFB 2VQUA 1H3VA 1FL6B 4L4PA 1MCCA 3QUXD 4H7VA 3BHBA 2HRPH 3CFJB 4Y4FB 3K2UH 2E7MA 3PZUA 1CGVA 5D2NA 1W9UA 3KNBB 5HY9A 1OGGA 4A6YB 4H8WL 1DBBH 4P46D 4MQTB 1US2A 1FFRA 3ZKSD 4MNMA 1UZ8B 4PJXF 3LSOA 5FF6A 1FYHB 5MEOB 3LXBA 2R29L 3FN3A 3C8KB 2D3LA 2D0FA 1X1NA 2J88H 5C92A 2UY4A 4PG2C 1DSFH 4J7RA 4JPKL 1PFCA 3BE1H 3QSKB 4JHBA 2PTVA 3CC5A 3HNVL 3Q6GL 4QO1A 3G5ZB 1MFEH 2R69H 4AT6A 3THDA 1PBYA 2N56A 3M45A 4QRPE 1D6EA 1F4YL 3MV8A 4W7UA 4AZBA 4GSDH 2ICEA 1G0CA 1EOKA 1IGJA 2E9WA 3O3EB 2X4SB 4XB3A 4GKNB 5IWLA 1W2PA 4AG4H 3NUKA 3IS0X 5EIIA 2PXYC 5IG7A 2XZCL 4XPFL 4O9HL 5DGQA 3OF6A 1I8IA 4OZ4A 1CDCA 1HVQA 4R4NC 3FFCA 4Y4KA 4FTVD 4D6DA 3P4MB 4W87A 1V0NA 32C2B 2JF6A 2ENYA 3JV0A 3AIRA 3MUAA 4OB5H 5EORL 3PWNB 4NQDB 1US3A 5HGHB 3CIVA 3IU4L 4F7TA 3GZAA 1QNSA 1HNFA 1J87A 3OF6D 4LSUL 2HLFD 3C08L 2IQ9L 1DQDL 1AR1D 4NN7C 2R15A 3TA3D 3BKCL 4M82A 1EHLL 1LD9B 35C8L 1F4XH 4OZHE 3MRQA 2PO6B 1X5IA 1TENA 2HLAB 4M43L 5HDOA 1UA6H 5ADPL 5I75B 1QRNE 1RIVL 2A3AA 4W85A 3SE3C 3UJIH 1B6DA 1KCSH 2R0WH 3MBEB 4LRIA 1JPFA 4RIRB 5A16B 4C56B 3E3QC 2IPUG 5I9QC 3MLYH 1WAAE 3UG3A 3LS4H 4O4YH 4AIZA 1CENA 5F7UA 1U93A 4BQ3A 1X7QB 4LSPL 4PLKD 5EOQL 1D3CA 5DVKA 3VXNB 5HXMA 5L9DH 4UFKA 3IDYC 1W8NA 4G3YH 3B4NA 5D1QB 3QG6A 2NXYB 3VFSA 4EI5D 1OARL 3CCHA 1N0LA 2ZUQB 4S1QH 1R6VA 4N1EA 3TO2A 4GW4B 3QI9C 5JO5B 4PTTA 3AHZA 1SJHA 3VD5A 4ZUVA 1CFTA 3SKUD 3QXDB 4AYFA 4K3HA 5GSVA 5FKPA 2UY6A 4XNQA 1RPQA 5CP7A 1BGGA 3SOBL 1IGIH 3QYCA 1WZMA 1TZ7A 3KR3H 4C83B 1OB0A 1JFQH 4R90H 4D6JA 1U6AH 1WQVT 2PW1A 1AQKL 4W68A 3ZM8A 43CAB 1YY8A 3LEVH 4WUUA 5EZLB 1NFIA 1P7QB 2J6EH 5C0EA 2DPEA 3UTZA 1JVKA 1ZGLP 4WRLA 3VIIA 3AYRA 4UFIA 4NUJB 5EB9A 5IOPA 2XFRA 3TNMB 3Q5OA 4Y2DC 1FNEB 1XR9A 1NC4A 4Y88A 3QULB 4OGYL 4KJPC 2YRZA 3VFNA 3TCLA 1T21B 3VGAC 1L7TL 5C0AE 3EJSA 4GI6A 5BXSA 3C2SA 4WI8A 4L9DA 3AREA 3WDJA 3WEOA 4I0KA 4H8WC 4NZCA 3LKRA 1BWWA 1VBUA 3L3JA 3KLHD 2Y36H 3CAFA 5C08D 1X5GA 1E4JA 1SYVA 4PJEB 4UDTB 1R75A 1E28A 5DFWH 1MFDL 4ALAL 4Y19A 4JQXC 1N6VA 3TNNA 3VW3L 2KQMA 5GGUB 4PJCA 3ZYOA 3H53A 1XCWA 1C93A 4Y2DB 4ODXA 4M8QB 4N68A 1TNNA 5CSUA 1RHHA 3CBWA 5HTSA 4OZOA 1TR1A 3CZFB 3WKML 4OZIE 1JHKL 3AROA 4N0CC 5ID0A 3W0WE 5H35B 3K8LA 2F53A 2ZZUT 1PZUB 4U0RC 4I18A 3NA9L 4J27A 2VE6B 3VWKC 3UPAA 4B3KA 1NC2D 4X7CC 25C8H 5ABHA 5F72S 1W1PA 1PSKH 4MNQD 1K8IB 5DEFB 3S96A 4JGUA 1G7PB 1CDIA 3TYGH 4D9LL 2EDRA 5EFIB 4OF0A 5IJVA 4Q0XH 4HH8A 4OIAA 1G7MA 1E6SM 4XPAH 1UXWA 1VJSA 5BZWB 3HZ3A 1QKZH 3D5OF 4NI3A 1KPUA 1BFNA 2JJSA 1YEFL 5HDBF 3GDBA 3RWEA 3WXVL 2BERA 1YPZE 1NAMB 4WK9A 4LNVA 1OOAA 1OAQH 4GUPB 1JTTA 4MD5B 3LKQA 3DIFA 4EKJA 2H1PH 4PRHA 2EADA 4LCCA 1MWAL 3VWJC 4O5LH 3BDYH 2VISA 4HPYL 2NXZD 2GK2A 5AUMB 4XBPB 3HI1B 4AMCA 4LAQH 4N42A 5DD1H 3I9GH 4DGYL 3DPBA 4OCYL 1SEQL 3EYOA 4M7ZB 4LX4A 3GMPB 4UILH 5IB1B 3MRDA 3HE6C 2VXTL 1JGDA 3MRRB 3UC0L 1GAFH 5DZNA 2X5PA 1CDGA 1OT2A 1T2QH 1BFSA 4P57B 3W2DL 4UUJA 3RWDB 2WZIA 1A4JB 2BC4B 1X44A 2P46B 4X9GA 4FA8A 3ARGB 3VCLA 3U4BH 4LXFA 3V4UL 4LLVB 1A3QA 3OXSA 5F1IB 1IL1B 4WHYG 1L6ZA 5I1HL 5C0JB 3GGWB 2FWOA 2XQYG 1AGCB 2DTMH 1E0VA 1H3PH 4KXZI 4U1GB 2I60H 3VI3F 5KG9B 2WBJB 2V5YA 4KY1H 2F7QA 4AD3A 3ME0A 4NDMA 3HN3A 2QV4A 1HHJA 3K8KA 4KXZH 5EZIH 3VG0L 2CLRA 5A6AA 4ZO6A 4ZAKC 1A7PL 3DWTA 4EKXA 1G9MC 2HA1A 3O6FD 2PETA 4B53A 4RFOH 4KK8D 1OWRM 4BQ9A 1KB9K 1KLGB 1PKQA 1SMDA 5TH2A 4P59L 3V5DB 1HXKA 3GFUA 5CBAB 2DQGL 1GHFH 4FQJH 2ICWB 5T1DH 3R1GL 4WDIA 5JMRA 4ZUTA 3WUBA 4E2OA 2YHGA 2WK2A 3MLUH 3AIVA 2CLZA 3U36B 5C0ND 3WD4A 4KU1A 5DR5L 4LNRB 1J01A 1A0QL 3TBWA 2WPGA 3T77A 4YBQD 4P5TC 1DUYB 5M03A 5B38A 4UQ9A 2XV6B 2X9YA 3CJJA 4NO0D 1CFVL 3VSUA 3L1OH 2YBRB 4O51B 3WF1A 4M5ZH 3VFRA 1NOUA 5GRVL 1NBYA 2XA8L 3ZT6A 2PO6C 2GJ6A 5E6IA 4M7KL 1UM5H 1M05B 4FFZL 2E7CA 1E1FA 4P0DA 1XCTA 3ES6A 3KPSA 1IC5H 3M17B 1H0DA 4UU9A 4Q9RH 1NAKL 5T1KA 2EDDA 5ALCL 5D1ZA 5HYIA 3ULVF 1OSPH 1BD2B 1FVDA 4QRPD 4TVDA 1RP8A 1FNHA 5ICYB 2IBGA 5CEXB 3F4VA 1CICD 1EJ6A 2W0FB 2APBA 2ZSWB 1NC4B 2OTUA 3DARA 4F9JA 4LLDA 3VDBA 4PRPD 2X9WA 1KIPA 3ARPA 5FYJE 3AIBA 1V3IA 4D9RE 2D9CA 5D2LF 5C09B 5FOJA 4L4TB 4YQXL 2R2BA 4FFYH 1I3RB 4H0HB 3HG2A 5FYKH 4GKZB 1ZLWK 3QIWA 4PN2A 4RDQG 4YHML 4FNTA 5FCUH 1YC7A 5GNYA 2Y5EA 4QLJA 3G5ZA 2P5WB 3LN5A 1NUFA 5IMMB 1FH5L 2R2HB 4ZUSA 5A2KH 3D52A 1A14H 4PMRA 2C7FA 4JPIA 3FT2A 4UTAH 3VIJA 4MA8L 3CVHA 4QDMA 4D1IA 5J7CC 3VA6A 1FL5B 3QIWD 4KTDL 3VFVB 5A2LH 2FX7H 1FL3B 4O2EB 3ZDXF 4UV4H 3CFCL 2XKSA 4ZXBD 5JHLL 1LEKA 4Q74A 1S7SB 4O2FA 5ETUA 3W53A 2CRIA 5GGVH 5EUOE 3DX3A 2WUCL 1AI1L 1NCUA 4KKCC 2ZNXA 4EDWH 1KQYA 2BY3A 3B9KB 4JCMA 2VWEC 1K5NB 4QHUB 4GO9A 1RK0B 5IFHL 2DQHL 2QLVB 2XKNA 2HKHL 2DQCL 4FZEL 3WJJA 5T33H 5HYJD 1YY8B 4ZDHB 5I79A 3A23A 3LV3A 1FOBA 1MFCH 3Q3GA 3CU7A 1MHEA 4KJYB 1DVFC 4D0BB 1J10A 2B2XL 3HA0A 1LO3H 4F37K 2IAND 4WO4A 5DMYA 2GITB 3HZYA 3GZKA 3S8WA 4OB5L 3P0YH 3HG3A 4KZDH 3HPLB 4W93A 3C09C 2ITDB 4GRLD 4XP4L 4XPHL 4AL8H 5CJ5A 4IIQC 3LPFA 4F7TB 5I1EH 5A43C 5I76B 2AK4D 4EQ2A 3BVTA 1CE1H 1EEZA 1XGRA 2F5BL 3QRGL 4HF5H 4NO5A 3TEUA 4N8VA 2CERA 5M95B 1ND0B 2WBGA 1R5WA 4P5KA 3STBA 1MCFA 4YXKH 2FATH 1RIUH 4NQCA 4W5UA 4TUKL 1ZTXH 1QI3A 2AK1L 5D1XD 4JVPA 1WAWA 5GS1A 3FFDA 4X6CA 3PL6D 2A77L 1QR1A 4PJIA 4MYWB 1VADB 3REVA 3LMYA 1GGYA 1I8LC 3P30H 4MDIA 1NCAH 4M62H 3LS4L 3VFMB 1NQ6A 3GJEA 4ZTOH 3SDDB 4YHYB 2K1MA 5GISL 2Q7YA 1S5IH 3TF7C 2D3NA 5L2JB 5A8PA 1F4WL 1UYWL 4JN2B 5IBTL 1U9KA 1KJ3L 2FH6A 4U6VH 4S1QL 4Z8FH 5CEZE 4LSQH 3C8KA 2YL5A 5C0BD 3FB5A 4L3CA 1CL7H 2D24A 3QP3A 2ZUNA 4CDHA 2VIRB 3MYZA 1DBJH 4GT7A 4AW7A 5KS9B 3KPPA 3NJ3A 4Y5XB 4LCCB 3QI9A 3QHZL 3BCDA 3K7UA 3N1PC 3AISA 5MEQA 1JG9A 2RR3A 2D7OA 3VD9A 1MW1A 3WY4A 1IM3B 3CLFL 4MLIA 3QEHA 3AHXA 4ZUTB 1JHLH 1X3DA 4H5SA 3HUJE 1KXTB 2FBJL 3VFGH 1INQA 4RGNC 3TA3A 4QOKE 5KSBE 4JREB 4OJFH 4K3DH 5ID0B 5ECUA 3RDTD 4Z0XA 2XVLA 1ROWA 3UJJH 2MHAB 2C1OB 3L3OB 2VLLA 3QUML 4X6DF 5HJ3A 5L6YL 1G84A 3FN0H 3HFML 4J8RB 1ONQB 5J1SC 5CINH 1QNZL 3L5JA 1I7UB 3X3GL 2V9TA 1I4FA 2CUIA 4LHUB 5IB3B 1V6WA 2HFGH 2IPTL 3TVMD 2YSSA 5CSZB 5BOPA 4JPIB 3FMGL 3L4UA 1URLA 3LN9A 3A3HA 1KGCE 3VXSE 3EHBC 4NRZB 1BJ8A 5DS8A 1P69B 3ARBB 4NPYA 1U0QA 3HAEH 2F74A 4RA3A 3FT4B 5C07E 4BK4A 1OCWH 4GH7B 4G5ZH 3HE6B 2H2PD 1H09A 1DEEA 3AXLB 2OTUB 4PY7A 4MD5A 2F53D 4L4VB 2FJFA 2BFVL 4PJ9C 1QHPA 5DQ9B 4UNVA 3SCVA 1S7WA 1HE7A 3MUIA 1MYRA 3BKYL 4CD6A 4YHZH 2X89A 1ZT4B 4JRYA 1A1OB 2P5WE 1VFFA 4JFDD 4U05A 4J3WA 2XYCA 2H41A 3IETA 1GNXA 4TVUA 1DBAH 3X13A 1CFTB 2EIZA 4F7EA 2W9EH 1XF5B 2ZXAA 4NP4H 5J9PB 2IUZA 1HINH 2PF6A 2NTFB 3AY4A 3B2VL 1T2XA 2AJUH 6A3HA 7FABL 4ONGH 1CGTA 3PQYA 1MCJA 2J6EL 4LPYA 4PV9B 5CKGA 2QADD 1D5IH 5HYSB 4PJDE 4PJ9B 1UD5A 3EFFA 3RIAK 5KSAC 2NY4B 3JWDH 3NPSB 1UD3A 1HK6A 4RGNE 1BQSA 1BD2E 4NKMA 5IB4A 4C83A 2EKJA 4XPGL 2WSKA 3LQAC 1U8QB 5EC2A 4POYA 2JF1A 1B0GB 3ALFA 5KZ6A 1YMMB 5F70A 3P73A 3M17A 5IB5B 2VYRE 4MAVA 3BH9B 5BRZE 3OA5A 5GHWL 3ZE1F 2DH3A 3RBSA 3PL6C 5JIHA 1OGAB 1XSKA 4U2YA 5DJCB 4WNQB 3Q6FB 5FYJU 1E43A 4HPOL 4OLUH 1LE5B 4HWBA 2WVVA 3RVUD 5FO9B 4FMKA 4LCWB 3ETBF 3U48A 3RZCB 5GS2H 3QDJE 2B4CH 2ZUSA 3QIUD 5DEZA 4HBCH 3G6JF 3X3FL 4V2XA 3SY0B 2GTZA 1GC1C 4X7EC 4W84A 5CZXC 3RWJB 1NGQH 3HZMA 1ZA6B 5D7LE 3ULVD 3DBXB 3FONA 4PJEA 3QT2A 1S9XA 2F5AL 1II4E 1QSVA 5F1IA 3ZSSA 3BH8A 2QSQA 2QHLA 4ACZB 1AJ7H 4GLRH 4WEBL 3F62A 5HDLA 3UTTB 4UQCA 4XPTL 1BGAA 3EOAB 1HXMB 1Z6JT 3L3GB 1VKXA 3VGAB 2EDHA 2CGRL 4DZBB 2R9HD 4LRIC 5EZIL 3VG0H 4CKVX 3GH4A 1IV8A 4LLUB 3C5ZA 4P23B 4WW2A 4NXSA 2NX5D 5CD5C 3AZSA 2VKWA 3V6FB 3MBED 4QRRE 1QO3A 1S7QB 4IEFB 2EE2A 3PABB 4YBLC 4OTXH 3QIBC 4OZHB 3VGEA 4R4BB 4EEEA 2OL3A 2GKIA 4ZO7A 3VFPB 4L1HA 3BD4A 3FQWB 4PJDF 3BUQA 4UT7H 3GXDA 2DMCA 1H3WM 4YLQT 1NFDF 3JWOC 5FKAA 4GAJL 2W38A 1Y6NR 3ULVE 2A9ML 3JWNC 1P53A 1S7VA 1BFVH 1M71B 4IOIA 1S7UA 3QEGL 4GMSH 1T4KA 2DF3A 5MI0B 3C60A 5BRZA 2R1XA 3GBLA 4XBPA 5BV7B 1HSAA 3VIMA 3B5GA 4UT9H 1M4KA 4KRUA 3VU2A 3UCRA 3WIHL 4Z7QF 3I6GB 3NFPB 1EHXA 1IGFL 1AGFA 1RZ8A 3HAEB 1ED3B 1JZ2A 4WW1B 4PTWA 3DX4A 4HEPG 5FIPA 1YC8A 3NIFE 1MFEL 4PJ5A 1SBSH 4ZMAT 1MLCA 1JPST 5I1HH 3MMWA 2G3IA 1F42A 3W29A 4V2BA 3C60D 5HDRA 3EYPA 1U8MA 1KR0A 3CZKA 1DBKL 3BWAA 1JGIA 3GBNL 4NN7B 1JBJA 2D2OA 3RPIB 2ORBH 3S36X 3VH8B 3HZVB 4PPTA 4KK9D 3M07A 4NFBA 2HN7B 1ZS8B 4X0KB 2VVSA 3PNWA 5JXEA 1TQCC 3JUYA 5FL0A 4OCMC 4H04A 3WF2A 4AWEA 1YEIL 4JO3H 4PREA 4AJ0A 3HRZA 3NDYA 5E00B 4LLAA 3QUXB 5F1KC 3VXUA 2WMHA 3RWHA 5J3HD 3ELAT 1MLBB 1VENA 4Y0GA 3ZJ8A 4ODWA 2NPLX 3QPXL 5E08H 4L4VE 3UESA 5I9QB 1PVHA 2BX5A 1CFVH 1JUFB 1BYAA 3T0EE 1HXJA 1K9FA 5KSBF 2GK1B 3U0PB 5CEYB 2F1AA 4H25A 3U9PH 4N8PA 2CKNA 1QQDB 3DV4A 3D0LA 1DANU 3QDME 4PMXA 1BLNB 3I6KB 4LHJB 3UJIL 2C9AA 5T3ZE 3QFJB 1XMWA 1CLOH 2WKGA 3HZKA 4X9YA 1E73M 3LKNB 1QBMH 3BIKB 1JF1A 4KRTA 1CXKA 4IIQA 4KVCL 2IFFH 3R06B 3DSNA 3GO1H 5IEKB 2HVKA 1F4HA 3FT4A 1OWWA 4U1HB 4Z95L 4M7JH 5TGBA 1ODUA 5JQ6H 1MIEL 4FNSA 3T1FB 3UR8A 2O92A 4GKSA 2UWEB 3BQUA 1BZ9A 1ZEAL 3D9AH 5FYLD 1NEZG 4LCIH 5E2TL 4HS6A 3IDNA 1KIQA 3FO0L 4ELME 4HA1A 2PUQT 1R34A 4NNYA 2XRAL 4OF7A 1JPFB 4RIRA 5A16A 5HGAA 2UZXB 4IPNB 4AD5A 3W11C 4Q9CA 3WUWB 2AK1H 2V17H 1B2YA 4PB0H 3RVTD 4OQ1A 3TIDA 3SCMC 1N8ZA 3MRMB 4UTAL 4JQVA 3G6AA 2VXSH 4TUOA 3UBXI 1F6FB 1QA9B 3RZCA 2YMXL 5F8RC 1ZGLB 3FW6A 3ARTA 2AMGA 5L0QC 4M80A 4UV4L 3RPIA 1A3RL 4M61A 4BF7A 1FLTX 5HHVH 1D5XB 3QB7C 4ZFOB 1WISA 4D6GA 4CN1A 1R3HB 2ADFL 4P2QB 5KTEL 4PRIB 5DZOA 1C08A 2AJ3B 3QDGD 1FAIL 2A6KB 5LXGH 2XUCA 4MA7L 1BQHB 4P3WA 1DLFL 4V28A 1WBYB 2GY5A 2Q3AA 3NCMA 1S5HA 1DQMH 1U2YA 1SQ2N 4GAGH 4GG8A 3VDHA 1NANH 1REIA 5GSRA 2BY0A 2VLKA 4RFEB 4QWWC 4WY7L 2VERN 1W2KT 2E6QA 4P7LA 5EPMB 3MUGB 1J1OL 5HVWA 5EOTB 4ORGA 3NACL 5HHXL 3D39E 5C6TH 5E5MA 5CWSB 1XGTB 4U3HA 1CR9L 4HZLB 1IEHA 4P4KD 2BMKA 2EXWD 1MJ8L 5BW7A 3IAPA 2MOVA 5ISZB 1MJUH 4TN9A 2DQTL 3SGKA 1KB3A 1YMHB 1GHSA 4MXVE 2V5TA 3DROA 1PX8A 4L8SC 1KTLB 4K3EL 3DGGB 1R3JB 4U49A 3W37A 3FXYA 1BVZA 2YFOA 4Y5YA 3SOBH 2UV3A 4LOUD 3QIWC 4K7PH 1KBKA 2HFGL 4O2CA 1VKXB 1I1FB 3WN5C 3FOLA 3VINA 2DLHA 1WIPA 1J7VR 1RIHH 2BVQB 4MB3A 2NT0A 2DI9A 1NM9A 5FAAA 4YPJA 3D4ZA 1AMYA 3SCNA 4EI6B 1PBGA 5C7XL 1U92B 1UJ3C 3O3DB 1DVFB 2DLFH 4P3CH 4BJLA 4CMHC 4Q7DA 3UTTA 3G04A 5GGQL 3Q1SL 3L4TA 5CJBA 3IFNH 1KR1A 3L5XL 5J6HB 4MB4A 4EIGB 5GRUL 4L29B 4E42A 4PUDA 3QXTA 3UAJD 4F58L 3NVQA 3GKWL 3QFJA 4NZUH 1I9RH 4XVJH 1BX2A 3INUH 3LD8C 2R1YB 4PYSA 4UV7H 2XTJD 1DBJL 2DIAA 3GSQA 4Z7WE 2AVGA 3RWFB 3QH3B 4MXQD 5GIRA 2Q8XA 3X11B 4ZFGH 3TN0D 2Q8AL 1B0RA 4FXKB 2QHRL 3R06A 1ADQH 3EGSB 5AG9A 6FABL 2BVPB 4P5TA 1B30A 4XCNA 3QXWA 2FJGB 1HKIA 2XVGA 4Q58C 1IAMA 4XNMB 4KVNH 1GIGL 5DGRA 4TSCH 4UAOC 2R1XB 4HWNA 5T5FL 5CPTA 1OHQA 2VCAA 2UWEA 3BQUB 2XWDA 2GDVA 1T3FB 1QHZA 1OW0C 3DUUA 3OAZK 5D8WA 43C9A 3BQUD 1FCGA 4LIQL 1ORSA 4K8RH 1RP9A 3UCQA 3V0AC 2VAJA 3DYOA 1R33A 1JWSA 3KLSA 1KN2L 1YEJH 1UB6A 1E6JH 1JWUB 3KPSE 4W89A 3QJFA 5IQ9B 1YMMD 4R97C 1QRNB 2AV7B 1BTCA 1A7PH 4FQXB 4XBEL 2E9LA 4HULB 1U3HD 3ARWA 1TA3A 3D0VA 1C8PA 3HNVH 4HQQH 2VABA 1TZGH 4HG4J 2WVVB 1C5CH 4E8DA 3HE7D 2WAGA 2O5ZL 1FVEB 3LKOB 2VITB 3TBVA 2XM2A 4M1CC 2WNGA 3KYAA 5IHUL 1NWUA 2OI9C 4QHLA 1AH1A 2F74B 1RZGA 2IPUK 2EZ0C 3T1WA 3TWCH 4DKEL 1FO0L 1U3HA 5E00A 1HH9A 5DS8B 3VXUB 5JPMA 4IBLT 1CD0A 1ZLSH 2R0LL 3CDYA 4FQIL 2OSLB 2DQUL 4J4PA 1C16A 4WEBH 4O00A 5I2IB 1FSKB 1NP2A 5I1IL 1M71A 1LEIB 3GMMA 3LX9A 3D4YA 4LPCA 3UC0H 1GAFL 5C0BB 3FN9A 1IEBA 5H37G 1A9BB 3P3YA 4XZBA 4WFEE 1V3HA 1S7TB 1S7RA 3HE6D 4XP6L 4PJIF 4RGOL 1R46A 2EIZB 4F7EB 5EWIL 2A74A 5CHNB 3C8DA 3C2AH 3UETA 2J7FA 1VACB 1F6LL 1HYRC 3MJ7A 2LU7A 1MLCB 1XH0A 3BEWB 3T2OA 3W6LA 4PJFE 2CHOA 4FQLH 2QMJA 5D7IE 2R2EA 5H94A 3BZ4A 4OV6F 2P24A 4CBPA 5BMFH 4NKMB 3H6JA 3KPQB 5FDWB 1D6VL 2IMNA 2GSIB 3W4RA 3QEHB 4NQEE 1DWIM 1WK0A 4X7DC 3CLEL 1H1NA 2EECA 1J0HA 1A7QH 4C56E 1AP2B 1G0XA 3AHVA 4HJJH 4XC1L 1EAPB 5IBLD 5EFDA 3J7HA 3BSGA 3WKZA 4MNJA 2QQKL 1C12A 3QUZA 2NX5A 4GRLA 4N9GA 1GOIA 4LGXA 3MBXL 1J9CT 3CK0L 5I1DA 2D7NA 2EIBA 4WW1A 1CBGA 5IM7B 5D9NA 3SJVA 1KIQB 2ICCA 3HHRB 3OHXA 1JIBA 5CEZL 4U5KA 5JIWA 5ICXB 2QQQA 1JUFA 1NWRA 3DUSB 1FNGA 1R5IB 2HLFC 5BRQA 1NGYB 4M7KH 1FRGL 1IGIL 2GT9A 5BXTA 2R2BB 4Z2HA 5C0GA 2VURA 4IOSD 1PQZA 3V7MA 3QUXA 2CGRH 2BVPA 2VL4A 3QUZD 2APWA 3V6OA 3VA2C 3GXPA 2YC1A 2PCPB 3MXWL 3QXVA 2HTKD 4XVSL 4RDQF 4PGBB 3UTQA 3V79C 5GS0L 3QQ9D 3IYLW 4YWGL 5C86A 3DVGB 2CNCA 3FL7A 2X0HA 2MNUA 3GIVA 4KAQL 2ZOXA 3U4EB 2I5YL 5FUCE 3GXIA 3EOTH 3ZDZF 3QCTL 3CXDL 3SUVA 3QDAA 1KN4L 1MVUB 4K68A 4QHNA 3EBVA 3QPXH 1CE1L 1JMXA 4ZFFB 1XF5A 5DO2C 1OB1A 4RBPK 4TVSa 4FG6C 1BFVL 1R3LA 5JPNA 1XGUA 4L9LA 3PWJB 5GJSL 1FZKB 3BN9C 1DFBL 1GJWA 1K2DA 5I23A 3VXQA 5EFFA 1L8NA 5IXEA 4KZEH 4JO2H 4Y19D 3GMNA 4G42A 4EAMA 3V4UH 4QHLB 2J8OA 3WE6A 3HNTH 4WGWB 3RWCA 1UEMA 1Q1JH 1MQRA 5C08A 3D51A 3OKNB 4ELMF 4AY1A 1NDGB 1E5NA 2Q8BH 3MSPA 4FF5A 3O9WC 5KW9H 4PD4J 3WUWA 1F13A 4U1MA 1NL0H 2YL9A 3K3QA 3T0VA 2HP4A 1GZPA 1DBKH 3K4ZA 3H9SD 3STLA 2X7LB 4QRQB 1CL7L 5J11B 3QZWG 4GRWB 4RGNB 5D5ME 5IOPB 1E0XA 4V2CB 1OM3L 1YPZA 2J75A 2ZG3A 4QHKI 4U3AA 5CG0A 1OSZB 2VR9A 4I5BB 5C0IB 4PMVA 3MCG1 1TPXC 4S1DC 2D3VA 2PXYA 3ZKNC 2UYLB 2WWKO 5IW6A 5J6GA 3WH5A 4FFWC 4XCEA 2BC4A 4GW1B 4BKLB 5E4IA 1TNMA 4UIKH 3CSPA 4MD0A 3I3EA 3TONA 1ZS8A 5DMIH 5SX4H 5CUSH 4X4ME 2NY5H 2VC2L 1SEQH 4DOHB 2ZX9A 5CZVH 1NAML 5GGRY 2E6PA 3WUGA 4HV8B 4OKDA 1CWVA 5LXGL 1IAOB 1LP9E 4TUKH 3FKUS 3MLZL 3DUUB 3SO3B 1BQLH 3O0RL 3FMGH 5J13C 1FAKT 5BZDA 4KDWA 3KWXA 2X4QA 3QFDB 5DJDA 4HWEH 4C58B 3BGMA 4WTWA 4OZGF 4OBRA 4NOFA 4TTDC 3I50L 3NAAH 1HQRB 2NR6C 2H45A 3K1KC 1N3NB 5DUPL 3OX8A 1PPIA 1U3HC 4DVBB 5ICZA 4UZSA 1CLCA 4GSDL 1E4KA 1N6QH 2VDKL 3GMLA 4L4OA 2W0KA 4HCRA 1U58B 4PGCA 4EANA 5CJ8A 4WDIB 4HKXA 4FFYL 2CDEB 2YBRA 4KUZL 5BROA 1B4JL 3M46A 1ZSDA 2OXHA 1MI5B 1U8PB 3UDWA 4D6CA 5DD0H 4HOZA 2ED8A 3TBWB 3FQUA 3RVVD 3WMSA 2XSBA 3EO0B 3QUYC 5BS0D 1KXHA 3GTNA 4P2OC 3QHMA 1E3XA 3HI6H 3BT2H 4P5MB 2XPKA 4WCYH 1UT9A 4PG9A 4UNTA 2EXOA 4ZYKA 2V38A 3C5JB 5DR5H 5SV4A 1CQYA 1A6VH 3QO0A 2GK0B 4E41A 2AJYL 1BYBA 1DEDA 5E8OA 4KPHL 4NO2B 1PKQE 1CG9A 3UX9B 4ELMA 3CUFA 3W9EB 3RUGB 3REVB 2BS9A 4U1LA 1Q4NX 4S1SH 4B7LA 4W7WA 1QYGL 1U41A 1UM5L 2BNQD 4JPWH 4L4TA 2EC9T 5IFHH 2LE9A 3X3GH 4KJYA 3K0WA 3F6IA 5KANI 3TYFB 1HEZB 1IC5L 3OXSB 5J4MA 1QZ1A 2GTWA 4F58H 4N8CL 2CH8A 3CXHK 5EC1B 3D39D 3INUL 5HYEA 2V3EA 4MAUH 1DUZB 2Y5TB 3MGTB 3QG7H 4WW2F 4HPOH 3QEUB 4OLUL 2QSCL 5F7FA 4W86A 1KTRL 5KVGH 3OLDA 2OYKA 2YBTA 4PRHB 4JAMA 2A6IB 1MJ7L 5I8OL 5J9PA 1M6OA 1BM3L 4WUUB 5EZLA 2LQRA 5ESAB 4X6DB 4ZXBC 4H1LG 5E0FA 2W67A 3T04D 4JHOA 3MV01 4NO5B 5JW5A 5C8JB 4BH8B 2WWMD 3WHE1 1JTOA 4Y7EA 2EDTA 5D7JA 3FNDA 3EO1B 3OKMA 3W24A 1MFVA 4Y5XC 2NY2B 5EU6D 1WIOA 3MJ9L 4HIIA 5CJQH 3H9SA 4PMDA 4HFWB 5T1KD 1A4KB 2GUOA 4JHWL 5DJYA 4PJDA 4ZAKA 4GRWH 1AJ7L 1BP3B 3BGMB 4K3EH 1QR1B 3JV5A 2A1WL 2YPVH 1T1XB 4Q2ZA 4ZFFA 4AZGA 1D5BB 3GM8A 1GQIA 2XACC 4NC1C 5J1TC 5CAYB 2J78A 4KRLB 4Z78A 4NFCA 3BP4A 5DDHB 4PJHF 2QBWA 1U58A 1RZIB 4PGCB 4DOHE 3WJLC 1YN6A 3EUUA 1KCVL 4F15C 4N90D 4RWYH 4AEHL 2AGJL 3EYVA 4G43B 2CIIB 3NIDE 5I1AA 1F3JA 1S5IL 1T1YA 5A6LA 4Z2LA 1T03L 4UOW1 1LL7A 5IBTH 1P7QD 4PRNA 2WHJA 1ZT1B 3PDGA 4FNLH 2NY2C 2UUDK 5SWZD 4QXTA 5F9OH 4AMKL 3LRSA 4GBXA 3D18B 4QXGL 3NIGF 2X1QA 1MAKA 2P8MB 4MTVA 3O2DA 3C6SB 4UV7L 4P2OB 1KCUL 3AAZA 3HMWH 4WFFD 2OYPA 2X4UB 4QP0A 3NCJL 2EPNA 1FJ1B 1MY5A 4CVWA 1GGTA 1EAPA 1NDMB 2OZ4A 3V5HA 4OFIA 3FJTA 1C1EL 2XN9D 4JZ5A 3DX7B 1XEDA 3GMPA 2MCPL 4UQBA 1P1ZA 4MXQC 4Y4KB 4M81A 3OBAA 1QLRB 25C8L 2VUOA 4Q7NA 2DWEB 2FHFA 1QNZH 1B1YA 3MLXL 4IPLA 2OR7A 2V2TB 2BXYA 2AJZB 2F54E 1GC1H 3MACH 3LEYH 2Z8SA 2I27N 1KC5H 1FZKA 2R4RH 5JIKA 3NZ8B 3ISWA 1OD8A 5L2JA 2R2EB 1X4XA 3KYNB 1DBMH 4MQXC 1FYTE 3KXFB 2E3ZA 4PYHA 1T66D 1E27A 5T3XE 4IRJC 5ITFA 3RWHB 2RCSL 3V4PL 2FR4B 3K1DA 3CLEH 1ZK9A 2ESVD 1BVLA 2CIKB 3ZDYE 3CH1B 1NFDB 3MLPA 1E6XM 2DMKA 4X6DE 3TFKC 4WUUE 4OTXL 3MOAL 3D25B 3DV6A 4P4RA 2UY2A 1J8KA 4J1UA 3WH9A 4UINL 1UQSB 3V6OE 3ARDA 1MWAH 3PV7A 2GAZB 1I75A 1S9YA 2XYLA 2E8YA 4JKWA 2RQ8A 4OI8A 4OZHF 4WI3A 5E99H 1RK1A 2NY3D 3OXRA 3QWOB 2CEQA 4OCYH 1NP0A 1RZIA 2I07A 2XN1A 1QFWI 4LSRL 4A2MA 3BW9B 3TIEB 3BUBA 1U3HB 1BSIA 4L8SB 4JHAH 3OKEB 4MQ7B 1N5AB 1ONQA 5KEZA 2BNRA 7FABH 2KBGA 3OGSA 2DQFB 4I13B 5I66B 1ZHLA 5L8KB 2A9NL 1IBGL 1CT8A 2WWMC 4HC1L 3WIIH 1CICB 2E0PA 5F6HI 4KGJA 2EH7L 4HH9A 1FVCB 4M00A 5L6YH 4PJ5E 5GS1B 4OGXL 5JDSA 3BPNC 4K94L 1ZLUH 1OIMA 1EO8L 4Z95H 2PR4H 1JV5A 2DT2A 2GSJA 3N15A 1QW9A 2A3BA 1FO0A 1B31A 2Z1SA 3CUIA 4TSBH 5F7WC 1KN4H 2OWWA 4PR5B 2LVEA 4DVRL 2NXYC 4NSKA 1RFDL 2FBOJ 4IHOA 3RAJL 4F79A 3OV6A 4RE3A 1WZ1L 5DEFA 4R27A 2VRQA 4JFVA 3PIQB 2VO5A 3GI9L 1I1RA 3MRLB 2ZCLH 4XNYH 3I02A 4JL2A 4JKKA 2EPKX 2JKXA 3LRHA 4ZFOA 1BBDL 1UM4H 1QD0A 4GXVL 4OGAC 4ZOCA 2YD4A 4JDZB 1J5OL 1KPUB 4O58H 2F58H 1XGYH 3MNZB 1KCRL 2X7LA 4NQDD 3L7EA 5AD0B 1KEGL 3RVWD 2P5WA 3LN5B 4M5ZL 4PJXA 5DLMH 1W1TA 2LU3A 4GUPA 5HHVL 1IKFH 4NRXB 1MH5B 4EN3C 2YD1A 3DYMA 1BECA 4NRSA 1HIMH 1TQBC 5D6DA 3IT8D 5F88B 3ZJ7A 1UKTA 4ATLA 1NSNL 4NSBA 1KACB 4ZEPA 2J79A 1MRDL 4AZCA 2NLJA 4QF1B 1OAXH 1MFUA 3MBEC 5TDNB 3DJ9A 1F02I 5I6SA 3KXFE 3EJQA 4F57H 2PW2B 3EJYD 3H0TB 3W39A 4G6KL 4KHTL 2X4QB 1YNTA 4BZYA 3ZHLA 3W38A 1S9YB 1NBZA 1SYSB 3BESR 3DX7A 2JK5A 1WDQA 4FHBD 4NQXB 1I7TB 2YN3A 2QR0A 4TVPE 1KWGA 5D2NB 4QTIH 5F7HA 3ALPA 3S36L 2Q6WA 5FCZA 4YWGH 4OM1H 1GQKA 2AQ2A 1XSIA 4TSAH 1AD0A 4YQXH 3O8XA 4EVNB 4U1IA 4YO0B 4KDTC 3RX7A 5JQ6L 3CTTA 2JIWA 1Q0YL 3BIAX 3MR9A 1MRFH 2BP3A 2YZ1A 5D2NE 5BZWA 4FNQA 1TVPA 4KTEL 4K9EC 4L8BA 4U6XA 3U4EA 1QP1A 3LKPB 1BD2D 1KXQE 1XR8B 5HI4C 1QFUH 2B0SH 3MLWL 4UQEA 3L4ZA 3WY2A 2V6HA 1XYZA 2YKKA 5FUOH 4JDVA 1CEOA 3WNMA 4MNLA 1IAOA 1T0PB 3BJLA 1A7OL 3PHQA 2APFA 3QI9D 1EPFA 2CJUH 4ZOEA 5DQ9A 4PS4L 4HKBB 1K4DA 4IRZL 4LVOC 3TN0B 5K9KB 1FE8L 4XHJC 4LSTH 3DX9A 4DEPC 1VFBB 3N50A 4HXAH 4JPVH 4WU7A 5DDHA 4UFLA 4WSJA 3IETB 1OL0A 4P3CL 1UGNA 3MRCB 4WUKL 2X70B 3IDIB 5IEHB 4NN5B 3SCMB 3OAZH 3MODH 5DJAB 4UQAA 5KW9L 3MRPB 3SCPA 2SEBB 2DM7A 3MNVA 4MA7H 2X2JA 5CGYC 3RGHA 2NY3B 1OT1A 3QIUA 4Z7QE 1EV2E 4G42B 1GGCH 2NMSA 4NZUL 3UEQA 3MLTB 5BCAA 1INEH 4Z7VF 4NQVA 3H55A 3O6FB 3FCTB 4ELMB 3HE6A 2EDEA 1XF2B 2JEQA 3PL6A 1ETZB 2VX7A 5E09A 4WCYL 3WD5L 4Z7WF 4PJBB 3F5KA 2DTSA 3VXNA 2FX9L 5DRNA 4IOFC 3VWJA 4QCFA 4CVZB 2ZXQA 3GXNA 4MVBD 3MC0A 1A6VL 2W1NA 4R97B 4XX6A 3M8OL 2QMKA 3EFDH 1E72M 3IGUA 2YR3A 1OF2B 1YJDL 5DWUL 3UYPA 5F6IB 4M29A 1MJUL 3ZO9A 1FL6A 4Y4HB 2MWCA 1I4FB 1RULH 1EIBA 2C3HA 2FIKA 4ODSL 2VZOA 2ZICA 2PYED 5EBMA 4X7SL 4HW6A 4AIZB 1KN2H 3QO1B 4ZNEA 1N59B 5CP7B 4P4KB 4IISA 2CXGA 4MNHB 5KAQF 2MHAA 2VZ1A 4LASH 3T4YA 1R87A 4UAOB 1IGFH 1UUQA 4JFDA 3OKEA 3AM8A 1VFAA 1G6RB 4IRJB 3BKCH 4OGAD 1V02A 5ANMA 1PLGH 3CHFA 5DEGA 3PP3K 1DWAM 2VUYA 1BREA 3WFHB 5ADOH 2AXJA 3MRKB 5LVEA 4CD4A 2EC8A 4Y7MA 1YUHB 1E27B 1RSFA 2O5ZH 3S3JA 4RRPG 3HC3L 3UTSB 2VL5B 4AK1A 1BOGA 4J1UB 4XUYA 1YEKH 4NQEB 3KJ4B 1MVFA 1MCLA 2ORBL 4GAYA 5FM5M 1AQDB 1TCRB 3OZ9L 2GFTA 4G3YL 5LGJB 2KPNA 3O3BB 2OYLA 3CH9A 1OLLA 2DL9A 3MOBH 1I1CA 5FGSA 3FFCB 3HPJA 3CFJA 4Y4FA 1HCVA 2EQDA 2V17L 1MQKH 3V2AR 3T4AA 5HHPB 4OAWA 1Q6CA 4L3EE 4C54A 2NYYD 2D4FA 3MLSL 3OG6B 1RJLB 4JANA 4OJFL 4Z7UA 3S5YA 1A3LH 4Z7UE 3GHEH 2FEDC 3JVGA 3D2UA 3OKKA 3MMDA 4X5WA 5EG6C 4U6HA 4LVHC 1JRHH 1N2RA 1V3MA 2Y4SA 3THMH 2IALA 2AW2A 4LIQH 1V08A 4LKCB 4E41D 2BVOA 5SX4I 1JPTL 2P8PB 3KLLA 4NKQB 5I30L 2ZOKB 4JM4L 4X4YA 5A3HA 1XF3A 1HJQA 5B39B 1W9BM 1E6JL 2XY2A 3HG4A 1M1SA 5I24A 4RISH 1J86A 4U1JB 2DD8H 1BBJB 3ZHKA 2Y8VA 3O9WB 5IESL 5C1MB 2N1KA 2ZJSL 5EN2B 4PTUA 3GRWL 3P77B 2QEJA 2VXVL 2AS5M 1MJJA 2ITCA 3BGAA 3GEWB 3GMMB 4WUUD 5ITBL 2IH3B 3RY6A 4Y4HA 4FOMA 1MY7A 2DS4A 4JM2D 3THCA 3L7FA 3KPRD 1SJVA 3CVHH 4QTHB 3LD8B 1VACA 3MLRL 5HYJE 3UEZA 4QXWA 4ELKA 4N0UA 3KE0A 2A74B 5CHNA 5DFVD 5TFSH 1UWQA 1T1ZB 1VGKB 4HS3B 4DO5A 2DQXA 2HKFH 4HOWA 3VI4E 2L0DA 5K9QG 4HIEB 4XC3L 4ATWA 3S4SG 1S3KL 2D31B 1CD1A 5E94B 2CRZA 1A6UL 3PBGA 1K8DB 3MCKA 3OAYK 3LHPH 2G3MA 5HPMB 1UACL 2GYSA 3HE7C 4X99B 1FG2B 4PJGF 1Q0XL 3EO9H 3DMMB 1KJVA 4JFTA 3QJHA 1C91A 2YFNA 3VOCA 4ZTPL 1NFIB 1P7QA 5HHOE 1KCVH 2O9RA 5SX5H 1AQDA 3BAIA 4RAHA 5TF0A 1AD9B 1HILA 1YEDA 3IANA 2J88L 15C8H 1OAUL 4P2QE 1T5WA 1V8HA 1LO2H 4GKNA 5D5MF 3OAYH 3RVUC 2V3DA 3BE1L 1WTLA 1UZ6F 3CXDH 3U7AA 1JV5B 2DQDH 2ERJB 3RIFK 3RWFA 4GRLC 3BXWA 4LBEA 1SYVB 5I1JL 1CXHA 1CGSL 2L4OA 4U7KA 4KK5C 1RQ5A 1ZLUK 4LVEA 1EO7A 3PZTA 1OAQL 3F7VB 4PGJA 5ANMB 4YO0A 3VDCA 4RGMB 3D2UB 3OKKB 3V52L 2WKLA 3BLKA 4B3LA 4G7YL 4XNUH 3MJGX 4E8CA 3N9GL 1DVFD 3PUCA 3WJJC 1XR8A 1J1OH 2ADGB 1CIUA 1TXKA 1J8HE 3CFBB 1Q9KA 3OAUL 3CZJA 1Y7VA 3UYRL 3IXTB 3MXVL 3I9GL 3UPRA 1TTUA 43C9B 3AHTA 1H15A 4U1IB 1TUXA 4L3AA 5E8EA 3UTZB 1VPOH 4DEPB 3O11A 1BBJA 4PRHD 3L95A 2YXFA 4YHOH 3WKNA 1U8NA 4I18B 4K8RL 2CLVA 2YLAA 3V6ZA 2AQ1A 3D1MC 1U92A 4TVPD 1MQ8A 2UVFA 1R85A 1CBVL 2BVTA 3BEWA 3NFSL 2KZWA 1S7UB 2OR9H 1N64H 4PR5A 5LBSH 1JPSL 1MW0A 1RFDH 3O41B 1ACYL 4XT1C 4YGAB 4KY1L 3VSVA 1JF1B 4OLEA 2AEWA 3I6LD 4ZPVA 3ULVH 1ZBKA 1PD6A 4X7FC 4U6HB 4UFHA 2NY6C 2WAHA 5DJXA 4DUXA 3NZ8A 1P4BL 1BG4A 3GMOB 4WHDA 1RUAL 1WICA 4UINH 3IGAA 1IQDB 4LSPH 5JW4R 1BJ1J 1AC6A 4H25B 3LKSB 4M93B 3CDGA 1KFAH 2VC2H 3DXAA 4HK3N 3RGVA 3POHA 1V7ML 2AP2A 1CQKA 4HZ8A 4M6OL 2N7AA 3VFTA 4AMWA 4PRID 2P4AB 4QAWA 5FV2A 4JZNB 1G7IB 1HHIA 4LQ1A 4Y16D 4HT1H 1VCAA 1FNGB 3DUSA 4PJXE 1ZT7B 1WLHA 2X42A 3HUJF 3V8CA 3DGGA 3MMEB 2V3GA 2F54A 3RVVC 4MA1B 4HKXB 2OL3H 4ODUA 1BQHA 1GOMA 1A6WL 4YBHA 2J7GA 4X5LA 4PMYA 1AQKH 4PRIA 2HH0L 2DMBA 3BYTA 3MRKA 1GOFA 3CMGA 3HC4L 4ZAKD 4OM1L 2RGMA 3L5IA 3SKJL 4ERSH 5E9AA 3O2WL 4HJGB 4FLOA 3SBWC 1OSPL 2EACA 2W62A 5BMFL 5DTFB 4NM8H 3BPOB 1HH6B 3U0TB 4JB9L 3DX8A 1Y6KR 3DX9B 1IGTB 4P2CG 3LN4A 3MJ8B 1XD1A 5DI8B 3S5LA 4O2FB 5ETUB 1EEQA 1B0GA 3DHPA 2CJUL 3IDNB 4Z7NE 3VM7A 5ILTL 4ALAH 4IRZH 5I1GL 4L9LB 3TH3T 4D3CH 2CK0H 3RWIB 2VDQL 3T8XB 5T3ZH 1FE8H 3MLTA 2W4XA 2NZ9C 2X4PA 3WO4B 4PRBB 3L7EB 1G9NH 3LXCA 2R4SL 2I9TB 1EUUA 1JZ7A 4YX2H 2FR4A 4ODVH 3RL1A 3ALGA 1A2YA 5GGRB 2J47A 2FZ3A 4YFEA 2BVQA 1KIRB 3W0WD 1M7IA 4NNYB 4P9HL 2AXHA 3MMUA 5ESAA 4YHEA 4LKCA 1HKKA 5FGCB 2CPCA 4NCC1 4ZXOA 4YDIL 4PUEA 4UI2A 1GRWA 4YFLF 2P8LA 1D5ZB 2YOCA 2PW2A 1Z9MA 1M7DB 1AE6L 5F44A 1MW2A 4CU7A 4WJ5A 5I19H 5KVMC 2C1PB 2VDKH 4YDJB 4YXLH 5A3ID 3VRJB 3D9AL 2IBBA 4JO4H 1YECH 2ZIDA 1NCWL 1H5VA 3GSQB 3FFDB 4UB0L 2EPMX 1TA3B 2NY5C 4EI5B 4YZFE 4ZUWA 2BFGA 3FHQA 4Z78B 3MUGA 5C0AD 3AHYA 1I9EA 2Z0BA 3L3KA 2CBJA 4FMFA 4HUWB 3DI2B 1UENA 5J3HC 3WJLA 4WTZA 4ODUB 3SDAA 3FRUB 3PP4H 4F3FB 3TO4B 4AXNA 3MO1A 1NGXA 1I1AB 3CUPB 5FD0A 5KN5A 2X4OB 2BNQB 3ZYJA 3KLHC 1BVNP 1KTDB 1U8IA 2WZEA 2HISA 2EYRB 4ZUUA 1QVOA 4HUUA 1FG2A 1TQTA 1A6AA 1E4XH 2V7NA 1W9XA 4LGSB 1MLBA 5D5MB 1RMFL 5E4EB 3FOLB 4W4OC 1U93B 5BRPA 1U8NB 2G75B 1MEXH 5ESQA 3WQ6A 5I73B 3QEQA 4GKLA 2O9OA 1CYGA 1NCAL 5KVFL 4LHQB 2E9IA 4P7RA 3B43A 4QYOB 1KF9B 2JTDA 4MD4B 3DMMD 1CS6A 3H9SB 2JELL 3D69B 1F90L 3KS0J 3GSNB 4S0TD 5HDQH 1XV8A 1DWJM 1JD7A 3VRLE 4ZOAA 5FM5O 3OKOB 4J8RA 3UZEA 4LMQI 1CFNA 3P0GB 2H9GB 4D6EA 3NIGE 4LSQL 4KRPD 4JKMA 1LG2A 2O5YL 4XVUC 4HWUA 4NRXA 3F7VA 2Z31D 3FCTA 5GGTH 3NCJH 5JR1H 4NC0B 3MV9E 2JLLA 2FGWL 5CIPB 1HX0A 3GHEL 1R24B 4N0YL 5I8EB 3WIJA 1XF2A 3GSNL 3F7YB 5I16A 1NWTA 1A0QH 2DLIA 2IALB 1QFWH 1SEBA 5DQDL 2UWEF 3U7VA 5CJOH 1NFKA 3HG1D 3PV6A 1TZHB 1DFBH 1TFHA 2DB8A 5JHDB 2IPKA 3AAZB 1GGUA 5IM7A 4YDJA 2J4GA 3GH7A 1VEOA 4K2UL 5IB2B 3DYPA 2DN7A 3GNMH 1D9KA 5TDPB 4XX1E 2PXYB 5EBLA 5E7FA 1PLGL 3DUHA 4F7MA 4P5TD 1X5FA 2DLFL 2Q7YB 4RWYL 4Y4FD 3WFDL 4TUOB 3S6TA 1BF2A 5EOQH 4XRCA 4Q9RL 3KHQA 4QCIB 2X0YA 4U1SB 4O4YL 4JPKH 1OVZA 3T0XA 5C09E 4YE4L 2ATPA 3WUEA 1NOWA 3VTRA 1W9DM 1B4JH 4KQ3H 2BOBB 2CR6A 4FP8H 3WNLA 3S35H 4HUXA 4RMTA 2DLGA 4M6NL 2XG4A 3F5WA 2XN0A 2XIBA 3MRBA 2XY1A 3G08B 5E6ZA 1UR9A 2QHRH 4U1HA 1LE5A 1BQCA 4ODHH 4XCFL 3WQWA 4Z7OF 5HHOA 1OSEA 4TTDD 1DJSA 2ZNWA 3G6JB 1KOAA 2YN5A 2YWYA 2J5LB 1HSBB 3TPUA 3VRLF 5DJ2B 2JJVA 3NFNA 3P4NB 1G6VK 3GSXA 2W07A 3LEVL 4MJ6A 1KEMH 5DFTA 1EZVY 3KS0H 3PZQA 3JWOL 4DN3H 1V3JA 3MUJA 4P9HC 3BMVA 5FYKE 5C0CA 5HHMD 3AIWA 4LHUG 1Z2KA 4C7FA 2NY0C 1KB5A 1O5DT 3MV7B 1TMCB 3VIOA 1FHGA 4POUB 2EDYA 3DETC 4J3UA 5B22A 2Q87A 2EH8L 5EU5A 3LRMA 3HI5L 4N8CH 3POCA 3WBAA 2HT3D 3Q2CA 2OJEB 3DVGA 4HWEL 3LH2L 1PS3A 3I2CH 4FNPA 3VWJB 1TIUA 1WITA 4M02A 4HG4K 1RIVH 4LCYA 3CMOL 3MJ8A 5F7EL 2J77A 3WF3A 1BM3H 1U8HA 3P77A 2A2QT 4EUPB 5IMLB 4HIHA 2VRAA 5BXPA 2N4IA 1OAZH 5D71L 1VB9A 2F58L 5TDOA 2FJFB 1GOKA 1KEGH 5HHQA 1T1XA 3B9KD 5IVXA 1DR9A 2G41A 5DYOB 1R5IA 3VXOB 4HWBL 3MGOA 4CVXB 3SUSA 5A8QA 1QOKA 2ZXDA 5EZJB 3RX5A 3K4AA 3RGVB 1WNOA 1UEYA 2B5IC 1UWRA 1GOQA 3QUZB 2R23A 8FABA 3S88H 4M03A 1CBVH 2VLME 1KSRA 4Z0BH 1I9IH 1TVNA 1MWAB 2MMXA 1WFTA 5IMOB 1X5HA 5E9DE 1U6AL 4KI5E 1XD0A 4KKBD 2ICWJ 1NJ9A 4X7TB 1MF2L 3ULVL 3IVKA 1W32A 3F7YA 2FYYA 3WXVH 3T09A 3AXHA 5E8DL 3O6KH 4OKVB 5JOPD 2Y9RT 3CNKA 4JG1H 2Z31C 3BAKA 4I9WD 3WCYA 5DUML 1W0YT 3SCWA 4TYUA 1HZHL 1UADC 2HJFA 1AFVH 1LG1A 1L7TH 4AC1X 5DJ2A 2IAMD 3B83A 3MUZ1 1G6RH 2XZZA 1XGUB 2FYVA 3IU3A 3AS1A 4Y5YC 2DIEA 3VFWA 5ACZA 1BFTA 4HFWA 5HYFA 4XXDB 1I7UA 3BPLB 1VFOA 4NKDA 1NGXB 4AYSA 3BZDA 4ATDA 1CD9B 5KN5B 3QDGE 3UTQB 5JXAL 1Z3GH 5DSCB 3OTTA 4HUVB 4S3KA 4R26H 3TO4A 4KV5E 2VRJA 5EA0H 3APGA 2UWFA 5CEZH 4GI8A 3A6OA 4JRXA 2AEQH 3SPVB 4Y4HD 1TLKA 3ROLA 5HBBA 5KS9F 2NSXA 3W25A 1E4LA 3VIKA 2JJUA 4IUGA 1KC5L 2CCRA 3EOAA 3CO4A 1X6NA 3QR2A 3RVXD 3ZYIA 4PSRA 4GRMA 2WMKA 4JN1H 4EUPA 2UZYB 4DM2A 4PP1C 1BYDA 1MHHA 3MXWH 4RSVA 3AREB 3NMEA 3QQNA 1CDJA 3TFKD 1ISXA 5IIEB 2CK2A 3EYFA 1B2WL 4XVSH 3PHQB 1N7ML 1LO4L 2V7HA 2CD0A 4LEXH 2Y1VA 4FQJL 1I9JL 2DQGH 4JG0H 3NDZA 1EH9A 2VT0A 1U42A 2E7LA 2CHNA 5D1XC 3UP1A 4P2RD 4HAFA 2GJ6D 1NCBL 3FT2B 1C7TA 4WO4C 5D7LB 2FZ3B 2VX4A 3UTOA 3WEXA 2X4UA 5F89B 1NDGA 2BVYA 4RGMC 2V5DA 4FQHB 2J7BA 4W4OA 4DJMA 3AS0A 2IADA 1IC4L 2GIYA 3SCMA 2CETA 4NBXB 4JFDB 4LSRH 2EEBA 5H94B 3MV9D 3QISA 4ODTH 4CADA 2H1PL 4AYGA 2AAVA 2ESVB 1MPAH 1KCLA 5T3ZD 2DM2A 4S1RL 5D1ZB 3CH8A 4JY4A 4XAWH 4AQOA 2ED7A 4JO2L 1QR4A 1HI6A 2CYGA 4G8IA 1TQCB 1IGML 1ZWIA 1T7XA 4PV9A 4X4XB 1WWWX 2DLEA 4R4FL 5SWZA 2D7TH 1U8IB 4NQCE 1HTYA 1A7BA 1UWGL 1D5BA 2NZ9D 1I7ZA 3HCVA 5A2CA 5IF0B 2Y06L 1W0WB 2EEXA 1BJMA 1P7KB 5FO9A 1JYNA 1C90A 5KVDH 4F3FA 4WWKC 4JFED 2EXYD 3AU1B 3MV7A 1CGYA 5JTWA 5LKNA 1S7TA 1GUVA 3BI9X 1S9WB 2BNQA 3HZKB 4K7PX 5DJCA 5AZ2H 4ZO8A 3V7AG 1YQVH 2Z8VC 5EU3A 1WZ1H 3QDMA 1LP9F 3TTYA 1QNQA 4GBXC 5FYKL 1W0VA 1UOKA 4YXHL 4XVTL 5D4QA 1W1VA 4WLCA 1UM4L 4HUXB 4LEOB 5DJ8B 3U82B 3IVKB 5DD3H 4V1DA 4QNPE 5D7JB 1U8HB 5L88L 5HYQA 3S97C 3FQNA 2PC8A 5DTFA 3DX6A 4OZIF 3SDAC 1F11A 2ZOKA 2FCBA 5T1DL 3OJDA 1H8SA 1JFHA 2B8OT 4M8QA 4QGYA 1BJ1H 1I7RA 4P8UA 3HNSL 1NGPH 1IAIH 2NXZC 3SO3C 5E8NA 1ZE3C 4R6UA 3CMJA 4JFWA 2OJZL 3F7PC 3SDDA 1RUKL 4ENED 1JNJA 3RY6C 5BVJA 5CEYA 1Q72L 5KVEL 5E0CA 4JHAL 1UWUA 2HKHH 2DT0A 4YHKL 2J25A 5BQ7A 1RJZA 1E3ZA 4APQC 5IESH 4GQRA 3V5KB 4RE4A 3T4AB 4OT1H 3SEPA 4ZOBA 2Q7NA 5F1OB 2LV4A 1MFCL 4BFEA 5GGRA 3I02B 3ESVF 3LPOA 1O7AA 5EBLB 3H9HB 4HS8H 2IADB 4I3SL 3BZEB 1KENL 3LDBC 3FFCD 3RY5A 4WFGE 2O5YH 4PY8J 1IT9L 1NCCH 1PQZB 3HC3H 2P44B 3CDGB 3RWCB 2XPGA 1EEZB 5LGHL 4KUZH 5SWQA 3HJEA 2EKSB 1DN2A 2XQBH 4F7PB 1IM9D 3LKQB 1DTUA 4IRSC 1F4AA 4KGLA 5CJXA 2P43B 4LNRA 2VLRD 2VLRB 4QRRB 4QRRD 4NJ9H 4M56A 4RL3A 1JYXA 3RIKA 3D25A 3P4LA 1OTTD 3Q5YA 2V7HB 3BT2L 1HSAB 4F2MA 2NLJB 1AR2A 4QF1A 4U6TA 4BCEA 2AJVH 4RMSA 3VPLA 4PJ8A 1IRAY 3BH4A 4HTYA 4Z6AT 2ZCKH 5ACZB 3GJFA 5JOPE 5I74B 3W5MA 2B4CC 4QHNB 3TIDB 4B9YA 1UD4A 2GUYA 3NABL 3GSXB 5DLML 3PHSA 3TGXA 5ABEA 3TIEA 3GMRB 5HGBB 4PSPA 3LEXA 2WMGA 3EOBA 2XN9A 3DX2A 5I71C 1FGNH 2AOSA 5BW7C 2VLMD 3ZE2E 1BG9A 4PB9L 8A3HA 1ES0A 2FD6L 3WEMA 1WBZA 1W3KA 2QQLL 1CZ8H 5CD3B 4NIKB 3BVVA 3OLEA 5D5MA 2X09A 3RI5K 2OTWB 2WUCH 3C5ZC 4WW2C 4CU6A 3RP1A 3VIHA 4HUUB 3DV6B 1T83A 5HDQL 3BEVB 3IJSA 4QRSB 3QUMB 1VFMA 1NFDA 2VDLH 4G7YH 5DVMA 4BSWB 5IKCA 4JLRB 3BPOC 2NY7L 4NUJA 3FY1A 2WVUA 5CFHA 1HJWA 2CQVA 1W1YA 3QJHB 3LRSB 4OZIA 1JWSB 1NLDH 2G9HB 2H9GA 2FBJH 4HLZG 3HMXH 4IMLB 1WCGA 2BMKB 4CD7A 2GSGB 2DM3A 2JJWA 4JHWH 4Y5VA 2X70A 3IDIA 4J28A 3L4YA 4PGEB 4AISA 4LCYB 1O7DC 4JY6A 2L7JA 5LAXA 4Q97A 3KLKA 1PIFA 5IMLA 3EGSA 2NY0B 3I6LE 2IANA 4WO4D 4YGVB 2X2IA 1T80A 1WVZA 4HS6B 4APQB 3ALXA 4JO1H 2VE6A 2ZKHH 2YA2A 3BH9A 2EDKA 3ULSA 3N1QC 4G6AD 1Q6GA 1FL3A 4ZS7H 5IEKA 4XMPL 2WBKA 5EN2A 3JSSA 2OSYA 2OWXA 3IXTA 3RHWF 4LSDA 1E4KC 3KWWB 5HVFB 2VZ3A 3T0DA 1B3ZA 1LHZA 4BQ5A 4CCDA 4PRHE 4AEEA 2P1YA 1C5CL 5CXPA 4JREC 3L5HA 3SQOL 1G7MB 1QHOA 4FP8L 3ZE2F 1UKOA 2GJRA 1HN1A 1T1ZA 1VGKA 4HS3A 4X6EB 5ALBL 5IROA 2A3EA 3BVXA 4GW4A 2FYYB 4P5TB 4P2RB 1K9EA 4ODHL 4XCFH 1T22A 3OAUH 1Q9LA 4LCWE 1JAKA 3MRBB 4HD9A 1GOGA 3D48R 4U1GC 1V6VA 4B50A 5BXFA 4R4ND 4IOFD 4NWTH 1SM3H 4H41A 1YHTA 4DO4A 1FL5A 3F6LA 3THML 5H35A 1I8IB 3O9WA 4NQEA 1UFUA 3ZR6A 3WNPA 4HZAA 4J4PD 4LSVL 4JG1L 4RISL 1AKJB 5C0GB 3FB8A 5HHOD 2YK1H 5IQ9A 1FDLH 4NQDA 2PWFA 3DVFA 4XWGL 3RTQC 3KYOA 1CNVA 4GKZA 1L9NA 4ZNEE 2CPUA 2VLJB 1FGVH 3MMEA 4PRWA 2BK8A 4P48A 1HWHB 1EEYA 2HVJB 3W5NA 3AUVA 2W0PA 1YYLH 2XJ7A 5JUEH 4HAGA 2GTWB 4K3GA 4G43A 4UQ3A 4TQEL 1QBBA 4IJ3C 5GNZA 1QFOA 4LAJH 2HKFL 4Y16B 3ULVC 4I3GA 1GYAA 3NACH 5TJWK 5HHXH 3NBNA 2ZUXA 4N8VB 2PWDA 1MCNA 4ONFL 5C8BB 4OUUA 2QQNL 2W65B 5K9JH 1EFXB 1XGQB 5I1KH 2I9LA 2HFTA 2WXDM 4L9LC 2ADIA 4QY8A 4AM0A 1L6XA 2OXGA 4X6CB 1A9EB 4Z2GA 1I8KB 4L29A 2VZVA 3L3HB 4G8GA 4NUGH 4D1JA 1XZ0B 3TZVA 4H26A 1K6QL 5KZCD 5C0RH 4Z76B 2R0ZH 4NZTH 1FRGH 5E95B 2OL3L 1H8NA 3BUYB 4NWUH 1F8TL 3BC9A 1A4JA 4YHLL 1EO8H 1CECA 1ZHBB 5EFIA 5BV7L 1CLZL 3JBG7 4KROC 1Q9OA 4OIIH 3V6BR 3HU7A 3T4YB 2X05A 4NQSA 5J12C 1YY9D 2HTLD 4TSBL 1NANI 3QIUB 1KLFA 3H3PH 4ZPTA 5IVZA 1D5IL 2WHMA 3BKML 2AJXH 4OFDA 1RZGB 3PWVA 3WS3B 1CGSH 4HKZB 4UT7L 4NM8L 1YNKL 1CLVA 3KEHA 4WFHE 4MJIE 2DBLL 2ADGA 4TPRH 2BSRB 4D0DA 4PJBA 3QHFL 3L5XH 1HHJB 4ORZC 1P4IL 1G6RL 2J1KA 1NJ9B 4X7TA 4H1LA 1GOHA 3VKKA 2UZIH 5IROC 2NT1A 5A6SA 2MQ3A 4E5XA 2E9JA 3NIDF 1Q94B 1K8DA 3MCKB 3QAZC 4LF3B 2MJWA 4IRJD 3PDOB 1QRNA 4UT9L 3STLB 3VMOA 2FJHB 5T3ZL 4PJ9D 1L0QA 2VABB 4JQIL 4OD1L 4OLXL 4M48L 1UD6A 3ARYA 1NGYA 3J8F7 1U3JA 2P5EE 5FHBH 1GIGH 3NN8A 4V27A 4TVPH 3GUTA 3MNWA 5F9JA 1OAXL 1SJXA 5K9KA 7TAAA 4LPVA 3V5HB 2AEPH 3N1MC 4JM2F 1VFAB 4IRJA 1HCFX 4GW1A 5AZ2L 4F80A 1PGRB 4PJHE 1KULA 4MS8D 1YEJL 1J1XL 3B9KA 3S37H 4UQ2B 2ZOLB 4CVZA 4URIA 3KJ4C 4D6IA 4JO3L 5T1KB 3ABZA 1F2XK 4PMOA 4MNQA 5HYSA 4D8PA 2BCKB 2PYEE 4D0CA 5EOCL 1HKLH 1Q0YH 4PV8A 1ZU8A 1EO5A 3RUGF 4BQ4A 1NCWH 1YZZA 4OF6A 4PLNC 3IDYB 2R39A 3WFBL 5E5RB 5KSAA 2XTLA 5C07A 2JB5L 2EC9U 4OLZH 1Q6FA 3BN9D 3QFDA 5INDB 4QYOA 1U91B 5LYRA 4QRPA 1HYSC 3UZVB 2WIIA 2Y23A 4V1DE 1XIWB 1Z5LB 4G6FB 5D9PA 1HKJA 3HR5B 2WINA 2VCBA 3ZZ1A 3IFOA 4PJHB 5MENE 3CZEA 2V2WB 1NUDA 2VQ1B 3JV4B 5D1QC 3O4OC 4J4PC 1K2DB 3H7BA 4TOQA 1NGWB 1IKNC 3N1AA 3T0AA 1YEGL 5E5UB 3WEZA 2ZCHH 5E6IB 3PQYB 2IANB 2BVOB 2GJPA 3JTSB 3MLZH 5DRNB 5A69A 2D7TL 2WW8A 1J9YA 3HC4H 5I15L 1EX0A 4PJ9A 4JY5L 1HKMA 4X4YB 1C8QA 4KK6D 4QT5B 1MIEH 1L7IH 4PLOB 4UNIA 1FZOB 3LB6C 4PJBE 1A9EA 4RA0C 1HQ4A 4M7LT 4AD0A 4DWSB 1WFNA 4HH9B 3FB8B 4XMKL 4ZFOL 4GW5A 4HX1A 5HGBA 2A73A 1KIPB 3DHUA 3HAEA 1T5WB 1RZKL 5D72H 1TQUA 4YXHH 2JIEA 5J89A 1D6VH 4PJ7A 4L3EB 3E6HA 3IJYB 3TLRA 4MB5A 1RZFL 5I8KH 4MDOA 1NH6A 2WZPD 4CN4A 12E8L 1SMAA 1MREH 3GBMH 4MQXD 3ROOA 1U8JA 1A7QL 1TMQA 3ZJKA 3LS5H 4UBDC 4UQ3B 4K9EL 1IEAB 4QFUA 1G01A 1UCBH 4POZC 3FONB 1TFVA 4JFFA 3QUMA 1IM3A 5TF1H 4EN3A 3A67L 2CBUA 2X10A 1A3RH 3RUGE 2IH1A 1G9EA 2EH8H 3PNWB 1PKQB 5F71A 3Q6GH 4F9DA 2AXFA 5I18H 2LTQB 3HI5H 3RKDD 4NO3A 4JVUA 1CTNA 3U46B 3OJVC 5INCB 1R5VB 4X6CE 4QY8B 1DL7H 1I1AC 3WENA 4HIJA 4YDIH 3MGAA 2A0LD 4X5XB 3T77B 1UD8A 2ARJA 4LPTA 5T1LB 1AGFB 4H26B 2YL6A 1XH2A 3O81A 1B90A 5IFJB 1ODZA 5E2VH 3DVNB 1H3GA 3SDDC 4O9HH 2WBJC 2QSVA 4V1DD 1FZMA 5C6TL 1GPOL 1YEKL 3O2WH 3VFMA 4BSJA 1DDHA 3MRGA 5JNYB 1AGBB 5ANME 5DVLA 1NBVH 5LJYH 2Q20A 3IFPB 3SURA 4QOKD 2VQ1A 5D6CA 5E6ID 3SDXB 1LE9A 2AERT 4NQDE 3SGDH 3RDTA 3SKOB 5C0FB 5CKAA 5J56B 3WDHA 3BAWA 1QSFE 3CSBA 4HMDA 4XHQA 2RIKA 2VLJE 3I85A 3UPRB 5FHAL 3E6FB 5F7MC 5IW3A 3MV7D 3CFBA 2XTJB 2HLAA 1FP9A 4IMKC 5HHMB 2YEZA 2EKSA 5CMAA 3FRPG 5T1LD 3QOMA 3KDMB 1GZJA 3R4DA 2LFGA 2Q1EA 4PV8B 3HUJA 4D9QD 4PJCB 1QEWA 3WH6A 2P8MA 4OF3A 5C71A 1I1YA 4U3CA 4ZS7L 5J1AB 4I5BA 5C0IA 2CRYA 3ZKXC 1KIUA 5DT1H 5TDOB 4M8UA 4A6YA 4JFFD 3SKMA 1F3DH 5DFAA 3PWPA 4HKJB 5ENWB 3TN0A 3VI3E 1I8MA 4PJ7B 1QQDA 5F96H 1M53A 4OLVH 2CDFA 5KZCB 1QLRA 1T04B 1OTTC 4JFEB 4U6YB 2GJZB 3EJZD 1TJHL 2W92A 3TV3H 5DJXB 4FQXD 5F93C 1GVIA 3ZJ6A 4OCXL 4XI5C 3BQUC 4DAGL 4AG4L 3N06B 2A3CA 3VWKA 4AMKH 3WNNA 4YHNB 4P2RA 4XPFH 3ROLB 4OJYA 3WFHA 4YXLL 4TTUA 4HMCA 1ZHKA 4WFHD 4D0CB 3NYDA 1RUMH 1BWMA 4K07A 5EA0L 4U0RB 4WFFE 3WFCH 5CILL 1S7RB 1WBYA 5AYIA 1UJ3B 4XBGB 3L5WA 4AMXA 1I1AD 2IANE 1KXTA 3VWKD 4W6XB 5FL1A 5C0EB 3DHJA 4NF7A 3MV9B 5DD6B 2ZWYA 1AHWB 3RWIA 2EO1A 3CDFA 1TDQA 3BWAB 2JIXA 3EW3B 4R7DB 3WY1A 3IFOB 1EDGA 1ZANL 4JFEE 4K23L 4YHIB 4R96A 2GAZA 4G7VH 1P1ZB 4Y16A 3EKCA 4YPGB 1ZBWA 2F9BT 2Z91A 1DUZA 2Y5TA 3WFDH 4NM4H 1P2CB 1T0MB 1T6VN 4WTXA 3CVHB 5MENA 4JKPH 2A3HA 3AFBA 15C8L 1OAUH 4ZENA 1DBML 4X5WB 2R0WL 3RTQB 4U33A 2I9LB 5JUEL 1NCBH 1T7WA 1S7XA 2A6DA 2ADJA 1TZGL 5E70A 1TJGH 3MA7A 4JFZL 1I8KA 4G8FB 3A4WA 1BZ9B 4MNQB 1EGJL 1XGTA 1ZLVK 2RGSA 4NC2B 3P9LB 1GQJA 1GOWA 1ZLSL 1FFQA 5DHVB 5JXEC 3G5YB 3TT1H 2F8XC 3NSMA 3N9GH 3OHXB 1UWXH 4N5EC 4YUEL 3V8OA 5FK9B 8CGTA 1G7HB 4MVBC 2GK0A 3NA9H 1OPGL 4LVOB 5E56A 1NCDL 1KGXA 5EC1A 3W81A 4YNYB 1SEBB 1EJOH 3QWQB 4LRNL 4TULH 1EAJA 5IW1A 4O2CB 2DH2A 1TVBB 5I1LB 2GJJA 4XZUA 1J1PH 3O4LD 4MCYA 5DJZA 4YHOL 3DO7B 4NT6A 1F45A 4NSKB 4NWTL 2AKRB 3IB4A 4D6FA 2VIRA 4LLWA 2FO4B 1MFBH 4CMMB 4PMNA 4UIMB 1X5ZA 4X6BA 1TTGA 5KVDL 4I2XA 5D93B 2QV2A 4FQLL 2YD7A 4ETYA 1EZVX 4W8AA 4JANB 1A3HA 5D7JC 4E5XB 2X89D 2OLHA 3QNXB 4PJAE 5C0AB 3VH8G 1CL7I 4PTTB 4K2UH 3TA3B 2PR4L 4NQED 5JLZB 2D22A 1F97A 5IFTA 1MIMH 3WHE0 1CXEA 4X98B 1U8OB 2WQ8A 2HT4D 4Q2ZB 4BH8A 2B39A 3BISA 5L2KE 1KPRA 4OI9A 4DGYH 3O3EA 3HS0A 5D9OA 2ED9A 2AJSH 4PTUB 3ARDB 3MBXH 3IDMB 4L1DA 1KTBA 2I07B 4UNUA 1CLYH 2NR6D 4YR6B 2DYPB 2IFGA 5SWSD 3JVGC 3WKMH 4DW2L 5DHYA 1RUKH 2IXUA 3QDHA 2E9MA 32C2A 1D5XA 1EEUA 3PGCA 1E56A 4FTVA 5KVEH 3CUPA 5F3BA 5K93A 1OAYL 1IC7H 4DQOH 2AXFB 2FWOB 4PGZA 2P5EB 4RNRA 5E2JA 1NSNH 1XGQA 5H2BA 3LMJL 4Z7UF 1ZHKB 1SVCP 1X9QA 3SN6N 3ZE0E 4Z18A 4AIOA 3E8UL 4LSSH 3B2UD 1UWGH 3VG9B 4OCWL 2G2RB 1QI4A 1KJ2H 1NLBL 4IS6B 1DN0A 2YPLB 1ZBVA 4P7NA 1F3RB 3EZ8A 4GRWE 5E8NB 5KSVA 5BV7H 4Z2JA 3VXSA 2GDUA 2Z93B 1HKLL 1PJ9A 1XGPB 4G80A 1EGZA 3VWJD 4G6JH 1QKZL 4UFJA 1WWAX 1T03H 2R0KL 4RBPH 3WLWD 3OXRB 1HL8A 3B8YA 5DQJB 4TPRL 1LF1A 2XZQH 3GH5A 4YPGA 3U0WH 2EJ1A 1M7IB 3LKNA 3GMNB 1UZ1A 1A7RH 2B5IB 3MREA 4OSUH 2BJML 1D9KC 2WZHA 3WL1A 2XN9B 1A64A 5BS0E 1HYSD 1UHVA 1EQCA 3SCSA 4L8CA 3MRPA 4B7IA 2ZUYA 4KI1A 3UTPD 4XNQB 3FHAA 3RKPA