1OT2A

Bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant d135n
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIINFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The fully conserved Asp residue in Conserved sequence region I of the alpha-amylase Family is crucial for the Catalytic Site Architecture and Activity
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
total genus 235
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot2A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ot2A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ot2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ot2A01
5A16A 2WNWA 4YHIB 5LCVH 4MA7H 3W9EB 3ULVD 5FKYA 1FGVL 2P24A 5ADPL 3JXAA 3O6FD 3QDJE 2XPGA 2HVMA 2FX7H 4Z9KB 2DGAA 2WP3O 4GBXA 4OJFH 4I0PB 5EU6E 1RZ8A 4W68A 2PW2A 2A3BA 5J11B 1CECA 2GCYB 3KPSE 1S7WB 2AVGA 4QRQA 4HXAH 5ADOH 1ZBKA 3O4LE 1KFWA 4MCZB 5ESVB 3LHPH 3EYPA 4K07A 3FOLB 4PJCA 4GLRH 1S7XA 2ADFL 1ZOXA 4NQEE 4B41A 5D5ME 4F80A 4LGPB 3TVMD 1WZ1L 3FN9A 5JXAH 1U92A 3G08B 1MCWM 2F53D 3W0WA 1ZSDB 3DO7B 3TBWA 5MEND 2CDEA 3OGCA 3DUSB 1RJYB 1FNSH 4JAWA 1DWGM 2V2XA 4J3XA 3DX9A 4KJPD 3U2SB 3TNNB 3VJ6B 1UJ3B 4GO9A 2GJZB 2VIRA 4KZEL 3GSVB 2GAZA 2Z92B 5GZOC 1F3RB 1Z32X 2IC2A 1U3HD 2J78A 4PJBB 1E40A 3FB5B 3QIBD 5T3ZL 3QQ9D 4M8UA 4EANA 3HMWL 4QY8A 4WDIA 4O2EA 3WF1A 2NY5C 3MV8E 4N0UB 1V05A 3V8OA 4MNQE 3UTQA 1FL6A 1WFUA 1RUKL 3DWTA 2Z0BA 4KDTA 5EBMA 1FZMA 4KKCD 1A4KA 4JFYB 4YC2C 1IM9D 1S7UB 2F5AH 2YLLA 1A2YA 2OTUB 5FV2A 3PWUA 4ZDHB 1FG2B 5KW9L 3UC0H 2HA1A 1GW1A 4LLMA 3WXWL 3GO1H 2ZXAA 4WRLA 3SCSA 1I9RH 2J6EL 4E41D 3DVFA 4YDLC 3U4BH 1OGAA 1UXSA 4K3EH 2XZCH 3MJ8B 2BVPA 3WMBA 3D18B 3MJ7B 4QTIL 3CUGA 2Z8RA 1VADA 3HI1B 4W5ZA 3IXTB 3ALGA 1DBMH 4RGMC 2VCAA 1IT0A 1A7OH 2XIIA 1FIGH 2BY3A 5IB3B 5KSBB 1BVNP 3D4ZA 3L2MA 3F58L 4UT7L 4OD1L 2Z91B 2CKBL 1A7RL 1FL3A 4MVBC 4E0RB 3VNYA 5EC1A 3OX8A 5JXEA 2DQCH 2J7CA 2QSCH 1K4CB 4AD0A 1KEML 1YN7A 3EO9L 3TPUA 2B39A 3JBG7 1PG7W 1FQ9C 3NA4A 4EDWL 4X6DE 4H0IA 4HS3A 2FX8H 4LPUA 1HJQA 3QCVL 3KLAB 4U6XB 5HHQA 1YJDH 4M6NL 2H32A 4HH9B 1Q6GA 5C71A 2E7MA 2GJ6B 1QVOB 3MUAA 4DN3L 3GM8A 1PX8A 2CR3A 3KJ4B 2VYRE 2J7EA 3C5ZD 2K7QA 3U4AA 3LB6C 3FRPG 3TA3D 2M26A 5I16B 1CICB 5FA4B 3BUPA 5HVWA 1KIQB 1OCWL 4LMQE 4Y4KC 1Q94B 4PY7A 4PJDA 2F7OA 3C6LD 2R0LH 2B7DT 1RK0A 2D73A 4DVBB 3LMJL 4PJ7F 4AZ5A 3CSYA 1CDCA 1GOGA 4G7VH 1Y6MR 5IMLA 1Z0NA 4G5ZH 3QFDB 1WDSA 3TFKC 3L9RB 1TNMA 3S36L 1DJSA 5T3ZE 1I1AC 3KXFA 3NFNA 4OIFA 5IW6A 3BESR 2HFTA 2HWZL 1UCTA 4IJ3C 3EO9H 2WMJA 3GK8H 5JW3H 2NTSP 4OZHB 4AZGA 5AWNL 3MYJA 1G6RL 1CF8L 2NX5B 5KEZA 2DT0A 4LYQA 1FO0B 1S7QB 2J8FA 3LKOA 3MV9A 4U6YA 1IGCL 2CKBH 3PZVA 1EMTL 4GKSB 5EOCH 1JTOA 4FXKA 1OAKH 1CDHA 4WI9A 3TBVB 1S46A 4MS8C 4PBXA 1UQSA 1JL8A 3NCYS 2DYPB 2ZSWB 4QHUA 4FZEL 5ABEA 2GVYA 1GXEA 3DX0A 5JHDB 4YDJA 5DYOA 4N1HB 2CUMA 1KCSH 2AJ3A 1BIIA 2MWCA 5IGXH 4XP6L 3LZFH 1H3GA 3AYRA 2XZAL 3P11L 3U79A 1FFOB 4KAQL 5IMKA 3GO1L 5HYJD 1J0KA 2AJYL 4YHZL 5MENE 4JDTH 4PMQA 3WD2A 5DD1L 5TGBB 5CBEB 5EO0A 5T1LB 3ARVA 3QDME 3VH8B 3W24A 4OB5H 2YRPA 2ZUNA 4Q58C 2ZOLA 4JFZH 3C5SA 1S8DB 1E5JA 4Z95L 3NIDE 3IGAA 1FVCA 3GJFH 3DHPA 2W66A 2NCMA 1RURH 5JBEA 15C8L 2AK4A 4GXUM 2EC9U 4NKIH 5CWSA 4GH7B 4KTEH 3RU8H 5CSBA 5GGRA 4JRYD 4M1CD 3L3OB 4UOJA 3VWJA 3MUJA 3P4NB 5FA3B 3ZKXB 3L3DA 5SWSB 5L0QC 2FX7L 4OAWA 3UEQA 5HVHC 1HH9B 1A22B 1V02A 4IRJA 4PMRA 3QXTA 1FP5A 1NCDH 3LN4B 3I50H 1HHJA 5DFWH 2NZ9D 3SGKC 2O5XL 4F33A 4CD5A 1G9MH 2O26U 5HI4C 3CSYB 3K2UH 2BFGA 5EZOL 3DIFA 3BPNC 3GSRB 1DBKH 1NAML 2OWXA 5L8JB 4R0LC 5IFJA 2IPKB 3QHZL 1R0AH 3ULUC 5JUEH 4XCNB 1QLEH 3QCTL 3IFOA 2XWDA 2B20A 2X4QA 3L5WA 1B3WA 2M2DA 4P2OB 2OR8A 1JZ8A 2Z4QB 1CGWA 4FZ8H 4ZS6C 2CJUL 3DXAD 5CJBA 1EQCA 1MFDL 1A1MA 1LG2A 2B4CL 2P46B 4Z76B 5KSAD 4ZFGL 2KQMA 3RIFK 2J7FA 1CG9A 2EKSA 1F4WL 5F89A 4FQHB 3TWCH 3D0LB 2XTJE 2PB1A 2C1OB 4PJIA 5FEBA 5D7IB 3ECBA 4M48H 3Q2CA 3LRHA 1UWUA 1VFUA 1YNLH 5D1XD 1DQQB 2Q8BL 4F7TB 1AGFA 5D72L 5IBLD 2HVKA 5J6GB 4L9LB 4R4NC 2VLJA 4UDTB 3ZE1E 5HHXL 3POCA 3H53A 2FR4A 4OLVL 4RMRA 1HILB 1K4DA 2CPCA 1T7VA 5GZND 5JPMB 2BMKA 4OZFB 3ARDD 4LCUA 2KZ1B 2I26N 1ZEAH 3V4PL 1I3GH 1U6AL 3EMCA 3KPRB 2EXOA 5KVGH 4OGAD 2WZHA 5GGTL 3APGA 4NKOB 1AO7E 4LHJB 1GC1H 1VACB 2Y9RT 3OX8B 1LEIA 3UBXA 2HTKD 1QKZL 5FDYA 2BRRL 1I3RA 5JW5A 4PMVA 1LE9B 1WICA 3UP1A 5JXEC 2J4WH 4AL8H 3I6GA 1TFVA 3QUZB 2BNUA 1WBYB 3DTXB 3OHXA 4X99B 3ZHKA 4PMOA 4J2XA 1J8HE 2D31B 4DKEL 1QFOA 4ZQKA 3OMZA 1UWGL 4P5MA 4Q0XL 2CDFA 4OI8A 4M62H 4NC2B 1CD1B 1G9NL 2W9EL 2XHYA 1H41A 3FZUC 1CDUA 1IT9H 4TN9A 3SO3C 5CD3A 5CCKH 1HJXA 4WY7H 1JNHB 1QFWM 1UR8A 1S9VA 2J8OA 2NY7H 3TJHC 3CHDA 4ZNCD 1F3JB 3BGMA 5DTFB 1VKXA 5D7JC 4MA3A 1N0XH 4G9DB 4JE4B 5F88A 3SIMA 5CPTA 1IC4L 4NNXA 1REIA 5MENB 2OMNA 4QEGA 4JREB 4N5EC 4BK5A 3ARGC 2YL9A 2AXGA 1N4XH 3EJTA 4XNQA 3UZVB 1AQKL 2F5BH 2ESVB 2HT2C 2XA8L 4IBLT 4PUDA 4O9HL 2VJXA 3G04A 4K23H 3Q5YA 1CLCA 3BMVA 4M62L 4PRIA 5AZ2L 5BXSA 3VE0B 5EBLB 4P5TC 3S88H 2X44D 3QIUC 3WXVL 3EJZD 4LIQH 3V0VB 1KTLA 4YHPA 4L4TE 4F9DA 2NY4C 4NSKB 4AL8L 3AREB 3QXDB 1DEDA 5DRNA 3VGFA 1ZHKB 2A2QT 3MRRA 1LLOA 3KPPB 2CK2A 3FO1B 1LO0L 3UXFA 1JYXA 1AFVL 1KEGL 3KAAA 3ARZA 4D9QE 1I85A 5C09B 4H8WL 3MRNA 1Q8MA 4PJEA 5TDNA 4NOBA 2BNQB 1G7IA 2VNCA 4XXDA 2EH7H 4R2GD 4C7GA 2DPEA 1YECL 3GSQA 4C59B 3RKDD 2F74B 1I8KA 3K4AA 3H9HA 3MBEC 2GIYA 2VL5B 1ISZA 4PFEA 5GS1B 1SYVB 5HXMA 2EACA 3ARPA 1L7TL 2R9HC 4HWNA 1CI5A 4PRHD 4IHOA 3DO3A 4FFZL 1IGTB 4NPYA 4WHCA 2DMKA 2C0HA 4S1DD 1E6XM 4N8VB 4JKLA 2P4AB 1SMAA 2DN7A 1ODAA 4YHEA 1T83C 2WQ8A 3L7EA 2ZUUA 4KKBC 1KWGA 4KDWA 4W70A 2Z35B 4U0QB 2VDRH 3KYMB 5ETUA 4L3ED 1IMHC 2APXA 2Q6WB 4JO1H 2YBUA 1QLEL 3QCTH 2E0PA 2R0ZH 2FHFA 1TPXC 4WCYH 1AC6A 2V5YA 1U8JA 2YPVH 5IKCA 4AEHL 8FABA 4KJQD 2R9HD 2UWFA 1TZHB 3FO9A 1F2XK 2A9ML 3OAUH 3OQ3B 3SKOB 2P5WA 3VFSB 1TTGA 4S1SL 5A2LH 5DJYB 1TG7A 1YPZB 4ZSOA 4PD4J 1SBSH 2UVFA 4HJ0C 1VGKA 2V9TA 5KW9H 4UB0H 5D4YA 3RL1A 2XUCA 3V6ZA 2LE9A 2PWFA 1UVQA 1L8NA 1X5AA 4JFOB 4RCAA 2IGFH 3FRPA 1PBYA 4JG1L 4NP4L 4KMTL 5F9WC 4GQ9H 1QI4A 3MODH 5D1QA 1VFAB 4G43A 4HUUA 3GMPA 1G0XA 4FQXB 1I7ZA 5CJOH 3H9SA 4EN3A 4PRPE 5EFFA 1JDDA 5TFSH 2MHAB 4IM8A 5EFIB 3O9WD 3SQOL 1QSFA 5DGRA 5A6MA 5GGSB 4F9PA 5IT2L 1A6PA 4H0HB 3EMZA 5AG9A 5F7FA 2ZIDA 1JGIA 4ONHA 5HPCA 1ZB5A 1DEEA 1UM4L 4BSVB 3VFGH 5B4MD 4B53A 1MREL 1T80A 1JI2A 3PDDA 4RMVA 3SUWA 3WELA 3VTRA 3UDWC 1BQCA 5CJ8A 1NAKH 4XMKL 3MLRL 4PG9A 3NN8B 1B1YA 1EAPA 3RGVA 2X6MA 4HWUA 3HI5H 5F1SA 1XYFA 3TO4A 4QYOB 3W27A 4NZUH 5D9MA 1PAMA 4NNYB 1CFNA 2EDQA 2VLKA 1DFBH 3A6BL 1UFUA 5BOZG 1F4YL 1GCFA 1B3YA 3OG6B 1KB5L 2HVJA 1XF5A 3ES6A 1QI0A 4DM1A 5A2AA 3QJHA 4PRAA 4NKDB 4ZOCA 4Q9QL 3CC1A 5E94B 4XVSH 3BPLB 3GMLB 5GJTL 1CCZA 3B9VA 5KSAC 3VXMD 2VXQH 2VZOA 1U8OA 3GYCA 5DRZB 1EHXA 4F58H 3U9PL 5IQ9B 1BFOA 1MAKA 3QEQB 4YHPB 1K8DB 1BGAA 1JHKL 2ORBH 2X4OA 3GK8L 2OL3L 5DR5H 4YHNB 1CR9L 1R5VA 4Q7DA 5IOPB 2P8MB 5DJCB 5TE6L 1CE6A 3D87B 3ZYOA 4Q97A 1KENH 4WTXA 3MLRH 3H3BC 4KJQC 2F8XC 3DRTA 5TJWK 4P2QE 3UYRH 1TFHA 3CXHJ 3KXFD 3NACL 4K7PY 1FSKC 2A77H 3UTTB 5DHVA 3VW3L 4W8LA 1GZPA 3GSUB 1SM3H 4BQBA 4KHTH 2EEAA 3P4MB 3U7WL 4XB3A 3DRTB 2VLJE 4I0KA 1FFNA 4JFDE 4WHTB 5DDHB 3RBSA 5JR1H 5KSVB 2EABA 4HC1H 2W38A 3QUYD 3SKMA 1A64A 1MLBA 2NR6D 2X4RA 4FQCH 3VO0A 4NQDA 3RU8L 2XKSA 1T04A 4DW2H 1U36A 4I48B 3P9MA 4DGVL 4F7EA 1EVUA 1U8OB 2N56A 1R5IB 4YN5A 1JWMB 5GHWL 1WBZA 4DN3H 2APWA 1T66D 4U3AA 1BBJA 5E8NB 3Q6GL 4TVCA 1E72M 4JFEA 3RVWD 2CO7B 4XTRC 4X99A 1PLGH 5BS0B 4YHGA 4XPBH 3FB6A 4LP5A 5DD1H 2I9TB 4ORZC 5T3XH 1NP0A 3GSOA 2Z31B 4GS7B 4N8CL 1OTUD 1ZVYA 2H6PA 4LVHB 4MNQA 3T0WA 2NQCA 1JFQH 3C60D 5E2TL 1Z2KA 2VQTA 5C0EB 4KK9C 5DEFB 1MHCB 5J89A 3MRLA 2SEBB 2VDML 2WINA 2A83B 2ZPKL 2JLLA 4NN6B 5ACMA 3AXIA 1FRGH 1E4MM 1JGLH 2A83A 3OR7A 5LGHH 2HT2D 6FABH 1R86A 4PIRF 3G6AB 4ZUVB 5L8LB 5CG0A 1HQRA 5EULV 3LMYA 5EFIA 4KKCC 4RL3A 4GZIA 1JF1A 3SE8H 1IVLA 3VXUB 3L95B 3PL6B 4PMDA 1MFNA 2WHLA 4ODBD 2VDNL 1LEKB 3LRSB 4S1QL 4DFIA 4NN7B 1AR1C 4NN5C 4D9RE 3NIGF 4KZDH 3T1FA 1X5FA 1QVBA 1MAMH 4U5KA 1NAMB 1RV6X 4WHDA 3VI4F 1E27B 3NPSC 2EH7L 1CWVA 3NZHH 4L4TA 3MRHB 4XVTL 1EXUB 4WSKA 3OKDA 2D03H 5BRZA 1WF5A 4LSRL 3BH4A 1KJVA 2F9BT 1YQVH 1BLNB 1HDMB 2IMMA 3E0GA 4MADA 3BAIA 3AQUA 3RWFA 5HHNA 1AI1L 1RP9A 5EU5A 3L4TA 1BD2D 1A3LL 3D0VB 3PQYE 5HYQB 2FWOA 3BKCH 1ADQA 5EZJB 4IRJB 3TBSA 4M24A 1UD6A 5KS9A 1GZPB 1A6WH 4OF8A 1OARL 2UY5A 2CIIA 4UV7H 1GSMA 4LAQL 5C9JA 3ZL4L 3AIVA 1LDSA 4MXWL 3V5DB 1PFCA 1KCRL 2B5IB 4UQDA 3D3AA 4TQEL 4EI5B 1OPGL 3SCQA 3RNKB 1QWNA 5MHSE 4XPFH 5C0AA 1HKIA 2GYSA 4KRPD 3C60A 1VPOH 2ZUYA 2E7LC 4PN2A 5ALBL 5E8PB 1BFOB 3QEQA 3X14A 3LKQB 3F5LA 3G5ZB 3FJTA 4OZGA 4H8UA 4LBEB 4RGNB 4MDPA 4WV1C 2QSTA 3O3EA 1N0XL 2CUIA 1MCSA 1QI3A 4UCFA 5IIEA 4EXKA 4GI8A 3MRBB 4HBCL 4DEPB 4OF0A 3ARGA 5L88L 4LQFH 3PZTA 1U8PA 1J88A 2OQJA 3RWEB 3BMWA 3UTPE 5EN2A 2CO6B 1NBVH 2GTWB 4FN0A 1UR1A 3PHAA 3HRPA 3VX0A 5DVKA 3TN0A 2D3NA 5GGQH 4HV8B 1JUFB 5L9DH 2F2HA 2Z8WC 3WFHA 2ZX6A 3LSOA 3MV9E 3WEXA 3HUJE 5E5RB 5ECUA 5D71H 1WIPA 3TYFA 1MLCB 4H20H 4RAVA 1FPTL 4JY5L 2V17H 2FLBT 3C08H 2LTQB 3U7YH 3UYPA 1DVFC 4NO2A 1MRCL 4J3TA 1E0WA 5D2NC 3K2MC 1FH8A 2WMGA 1BJMA 5C1MB 2PF6A 1QSFB 4D2NA 4FA8A 3O0RL 4GG6E 4C56A 2EAEA 4TULL 1T89C 4LYPA 1XH3A 4DKDC 4ZUSB 4X7TB 5I6SA 5DHXB 4PV9B 4Z77A 2YR3A 4AMWA 1INDL 4OLEA 4Y1AD 4GW4B 5JMOC 3RL2A 1AGEB 1VKXB 1ZE3C 6TAAA 3AMDA 1UQYA 2F1AA 4TX8A 1CD8A 4Z77B 3VG9B 1UGNA 1FNSL 3HRZB 4O02H 5EORH 1I1FB 5J11C 3RM8A 4H1LG 4ATWA 5DJYA 4XCCL 4W81A 3W4RA 2EDEA 3DUHA 2VOTA 4OCWH 4CVZA 4PTMA 3WE6A 4NKMB 3DVIA 2JIXA 2QEJA 2YN5A 2BJMH 3L3KA 3FO0H 2ITCB 4HLZG 3U36A 3MRJB 4POZC 3IS0X 4RFOH 4XP4L 5EO1B 1CQYA 3U48A 4HKJB 4LLWA 3N85L 5FAAA 4L8DB 2ALWA 2DQGH 3D3VD 5C7XH 1M4KA 1MFEL 2XM1A 1MFCL 2WWMD 4TOYH 1MWAB 1G6VK 3F62A 1FCCA 1LO2H 4JM2A 3RY6C 3IKKA 4K8RC 1BG4A 4LDEB 4JG1H 3FQWB 2ZX5A 1EQPA 3VGAC 1GGIL 3PV6B 4M61B 1NGQL 3OB8A 4OQ1A 5GS0H 2J7DA 5IDIA 1EFXB 1S5IH 2O61B 1W8OA 1NWSA 2JB6A 4TTDD 1R3KB 1B88A 3O9WB 1KBGH 5HI5D 4ONFH 1EUUA 2GI7A 3BVWA 1UYWH 5JIKA 3FOMB 4QDMA 5HNNA 2VISA 3F12B 3WDHA 4PV8A 2ZCHH 3MLTA 4X4ME 2C1PA 1NOFA 5IB3A 3PWPD 4YC2B 1EEZA 4BQCA 2XM2A 4XXCC 1RHFA 2E4TA 1TITA 4ZUWA 4KVCH 1E6OH 2DS4A 5FYLE 3F5KA 4OBSA 2DL9A 2C3GA 3GJFA 4NJ9H 4NQDE 5ALCH 3AVEA 3OKNA 4QXWA 4HX1A 2X4QB 1RH9A 3AC0A 3ALFA 3VU2A 4AZCB 2DTSA 1OARH 4KKNA 4X6DB 4FRWA 4UFKA 3DVGA 1RZFH 4GUPB 4JQIH 1A3LH 3WHXA 4OLUH 3FTGB 4MWFA 1TMQA 3WFLA 4NCC1 3JUZA 4HKBB 1QRND 3CDYA 5FB8B 2HMIC 1KIRB 2DQJL 4F2MA 1QSVA 3HE6A 5A6AA 5KOMC 3OR6A 3PJSB 3QZWA 3EJYD 5B22A 1RK1A 3RX7A 3VFTB 1OAQH 3QRGH 1FYTD 4P9MH 1KEGH 1TETH 4TNVK 2YMXL 1VF8A 3HPJA 4NO5A 5IMOA 4OTXH 4WU7B 4Y1AE 5ERWB 2XWJB 3JUYA 4XX1G 3VDCA 1U8KB 3A6CH 3MRQB 4JB9L 3TESA 5FO8B 4L1HA 4AY1A 3Q6FB 1ULVA 4OGXH 4JZOB 4HKJA 4LLWB 1DBBH 3IF1B 3RWGA 3W6LA 5DMGC 3L3JA 5E5MA 1KYOJ 4MLIA 3FONB 4GG8B 3X17A 1CK0L 2E7BA 4PRDA 3KPQB 3INUL 1JWUB 3L1OH 5B8CC 2J88L 5GPRA 2CDFB 1E1EA 4Q2ZA 4PMZA 2X89A 2GTZB 3FB7B 4YUEH 1QUNA 5DJ0A 3T2NH 3F65A 5L6YH 3IF1A 4RRPA 4KKLC 1QP1A 3MV8B 3RWGB 4Z7OE 3Q48A 3AI0A 2R0LL 3CLEH 4U6VL 4GRWF 1MCFA 3OTTA 3WH5A 4QHMB 5IP4A 3H55A 3WL9A 3OGRA 2R2HB 1KB9K 4WU5B 3BC9A 1V5JA 3C2AH 3V0WL 1KN2L 1N82A 4JIEA 3CGTA 1KGCE 3VXMA 3NA9H 1FV1B 1OW0C 4DKFH 5HYSB 5EU7C 4R3SB 2QQLL 4JHOA 3VA6A 3E2HB 4NQCB 1YHTA 1C5BL 1FNEA 1YJDL 1A6ZB 4UDUB 4BZ2H 4F7TA 1YA5A 5CGYC 4EBQH 2F61A 3MREA 5CEYB 3BEVA 4O2CB 4FFWC 2EDWA 4DGYH 4I18C 1JI1A 4P9HC 4RAVB 4DGIH 1T4KB 5IW6B 4M81A 3PQYB 1BHGA 5ABFB 5KZ6A 2X4TB 2V17L 4JFDD 1FJ1B 1PEWA 3VVGA 3ARBD 4DZ8A 3BZ4B 1S7VA 2XY1A 1BJ1H 4NC1C 2JIEA 3AYSA 2EYRA 2GKIA 3MRGA 3MV7D 3TIEA 3OPZH 4D0CA 1UD4A 3CDGA 3PNWB 4OZGE 1F6AA 1I3GL 1U6AH 4PJ7B 3CHFA 5FM5O 1J5OH 4M7LH 1VIWA 1J9CT 3CUHA 4MJ6B 1QW9A 3WD5H 1UD3A 2DDQL 2FIRT 4P0DA 3UO1H 2R0KL 3QGVA 4JHAH 1U2CA 2ZJSL 1JZ6A 4H2CA 4OV5A 4G8GA 3TBTB 5D8WA 3U1SL 5DMIL 1MCLA 2VXTH 1HJUA 4CGTA 1CFTB 1OGAD 4YLQT 1JGVL 2X9YA 2VXQL 5EIQA 2X1IA 2P45B 1QEWA 1Q72L 2YPKB 4MNQD 4ZXBD 1RVFL 3HUJA 4OFIA 4S1DC 4NZJA 2B2XH 3BPCB 5GQBA 2HTLC 1EDQA 3G6LA 2FYYB 1V7MH 1I75A 3ZKXC 4PGDA 4Y16B 1KG0A 4X5XA 3W5NA 5JOFB 4OLWL 2DWEB 3N9GL 2ZNXA 4O5LH 1CPUA 3FOMA 2DQEH 1RJLA 1QFWL 3X13A 5FYKU 1OQXA 3D9AL 3AIWA 4P59H 4NQXB 1BYBA 3DGGB 1OOAA 4F57H 1R3KA 1WCBB 4XVTH 3BWAA 1MCPH 3WH7A 4XNYL 5HGDA 4QHLB 4A2LA 3AHXA 1NEZA 5HYJE 4QHUB 5HPOA 2Y5EA 2HFGL 3TA3A 3WDRA 4CU7A 2PO6D 1H5BC 2X05A 4QLKA 4U6HB 3BP6A 4JRXE 1OCQA 4ELKA 3DROB 1HQRB 3O2VH 3ULSA 4G8FA 1TJHL 2IGFL 5IVXB 5F72S 3WFBH 4ERSH 4Z95H 2JF7A 3C6LA 5DEGB 1CS6A 1JZ3A 2K3TA 1SVCP 3MRPA 3OKEB 4S0SD 4A6YL 4M43H 5FD0A 3MACH 2CXKA 3QUKB 1HDMA 5EBWB 5E2VH 2RJMA 5ITBL 2B0SH 4EUPB 2VDMH 1T20A 1TVPA 5I2IA 5FOOA 4UQ2A 3BVUA 1U42A 5LKNA 4NQED 3WN5C 8CGTA 4I4WA 2EDKA 1AGEA 3FQRA 1NAMA 2JELL 5GRUH 4FZEH 3IS1X 1ZT1B 3F7RA 1IC7L 4X4XA 5I1HH 4AEIH 5C0JA 1A5FH 3IJSA 4OCNC 4X9IA 4Y5YA 4LCWA 3EYVB 1NUDA 4L3EA 1LK2A 4JFTA 2YWZA 4JPKH 1IGCH 4OV6F 3MR9A 4ODSL 4HPOH 1AD0B 4W8BA 3ARQA 4J8RB 4P4KD 8A3HA 2VLMD 4HAFA 4PJDF 3VFMA 4F7EB 1RZJC 4I48A 5EU4A 5I76A 3P77A 4U1MB 2N1KA 3A0OA 4OZFG 2G8ZA 4NSBA 4NO2B 4PGEB 4XZUA 2GK1B 4D6DA 4HUKB 4D1IA 1RZ8B 1BM3L 2EE6A 4KUCD 4WUUB 1MCHA 5C07D 2K1MA 5CKGA 5DDHA 5LQBL 5IFHL 5GS1A 3V52H 5E00B 4AM0B 3U30C 4P48A 4LVNC 4OSUH 1QNPA 1IM3B 2PYED 1GPFA 4PGZA 2AJVL 5F7DA 2W65A 1MVFA 2H6PB 5C8BB 3RVTD 1SM3L 2QKIA 4NNPL 4U7SA 2Z1SA 4D6EA 1G7IB 4M82A 2AERT 1NFDA 1XGYH 4JDVB 3RGVC 5IESL 2ZX9A 3ARGB 2P1YA 2DD8H 5IIEB 3A3HA 3SCVA 3MRRB 3S97C 2CEQA 1NBZA 1ZT4A 4M1CC 5FYKD 1CIDA 1HNFA 4LIQL 2DKMA 4OGYH 1ZA3B 3VFOB 4P5TB 4GMSL 5LXGL 5I79A 4NHCH 3T77B 5AYBA 3WHE1 5GS2D 2XZQL 4K23L 3L4VA 1JRHL 4HWZB 3QI9D 2NY4B 1N7ML 3K4ZA 2F5BL 5I71B 3AREC 3HG1B 3BQUA 3QCVH 1YEGL 2IAMD 2V38A 1YPZE 2LAGB 1LEKA 1CLZL 2CXGA 4YGVA 3RGVD 2WBGA 4JPVH 5I1HL 1F8TL 1ZHNA 3C5ZC 4E4PA 2JELH 2DWDB 4XRCA 5B39A 3D6GA 1B3XA 3OZ9H 3TO2A 4OI9A 1MI5E 4UQ9A 4XP5L 1EX0A 1UA6L 3TT1H 3WLBA 2D22A 4O2FB 4NFBA 4X4YB 4B0MM 5HHNB 1RZJL 4WI5A 5H37H 4X5WB 5TQ0L 2E7LA 5F7WC 3VFGL 2GK2A 5C0EA 5EUOB 4GG6F 4U1HA 3V4VH 1N2RA 5FOBA 4F3FA 2VLKE 2NR6C 1CLOL 1T6WA 4NRXA 1AQHA 4L4TB 4TYUA 3VI3E 4D0DA 3QQ4A 4XNMB 5CIPB 2XQYK 3ES6B 2FD6L 2XFXA 5CBAA 4EZMA 2H1PL 5A8MA 4G6AC 3MUY1 1S78C 4R4ND 5CBAB 2BRRH 2GJ6D 4W5UA 4LCYA 3WD4A 4EUPG 1JVKA 4JFEB 2Z31D 1HKMA 1TPXB 1F13A 4XNMA 1UVQB 5DD0H 5JW5B 3ILPA 3UBXB 2AJUH 5D8JL 3E3QC 3IDYC 5ESVA 3HR5A 2ID5A 2R4SH 3WN5A 1US3A 4X0NA 2D3LA 5C6PB 1GL4B 3HMWH 4WEBL 4MB5A 5M7QA 2X4SA 4P2QA 4NRSA 3TGXA 4PJCF 1BZ9B 4O2FA 1P6WA 4ONOA 2VLJB 3QJFA 4HQQH 1CGTA 5HYEA 4O00A 2DM2A 2FRGP 1DLFH 2VQ1A 4PLKC 2NLJA 2WM0A 5CP7B 1GPOL 2IBZY 3QXUA 4IIQA 5JO5A 2VX4A 5D7IA 5A8OA 1T22A 3CU1A 4JO1L 4JQVA 3BIKB 2D7TL 2D0GA 2X4PA 3RO8A 4HWBA 5DZNA 4W93A 3BVVA 3N1PC 3RM4A 1W0VB 2GUYA 2X2YA 3TH2T 4YX2H 2V9RA 1XGTA 1JP5A 3BW9A 5K93A 1US2A 4GAYA 4LQ1A 5E8NA 5HGHA 1ZA6B 4HK3J 2YL6A 4OCYH 4D8PB 3STLA 4U1GB 3T65A 2GY5A 1RPKA 3U1SH 3UJJH 3VIMA 1L6ZA 4IM4A 3SKJH 3UTSE 4B16A 4YFEA 3B6SA 5E1AB 2IANE 1TNNA 5BZDA 1KLGB 3QJHB 2BRQA 4PRAB 2W07A 2O93L 4OCXH 5F3BA 1DZBA 2DWEA 4YWGH 1T5WB 4CNIA 2DJUA 2VLME 4OZGF 3RZWA 2A38A 2XQYG 4LSSH 1RSFA 4QRRD 1L7IH 4PJFB 3RCNA 2Z93B 4LSTL 3E8UL 3FO1A 1A7BA 4WFGD 4UQEA 3ARSA 4JFQB 3ILQD 4JANB 3CFKA 4LIQE 4U6TA 2CGRL 2H26B 5GSVA 2LU4A 3O11A 3MFGB 2V5RA 3BPLC 3GMOB 5KSAB 4JHZA 4FLQA 4UT6L 3MX0A 4DWSA 4NGHH 3RJXA 5EU4B 3VINA 1XCQA 3SE4A 4MTVA 2WBJD 1K3ZA 4NWTH 3G5XA 4P2QD 5C6TL 3MR9B 1RP8A 1P4BL 1P84J 3GXNA 5IM7B 4JDTL 1O7VA 5CBEA 3H9SB 2Q7YA 4PJHF 3QISA 3WY4A 3PP4L 4WTWA 1PG7H 3K8KA 4WWKB 2F1BA 1N6VA 3QUMA 4MQSB 3B2VL 1XIWD 3AZTA 3EO0B 4EQ3A 3KPRD 4O58L 2ADGA 3DSFL 3H8NA 3WNMA 1K8IB 3WEZA 2BSED 3ZE1F 2BV9A 3N18A 1HHHA 4WGVB 5CD3B 2AMGA 1EMTH 5EOCL 2QPUA 3U6RB 2UV3A 1TQUA 2R0WL 4FMFA 4PRBB 2NZ9C 2NMSA 3U9UB 3DOSA 2DSUA 5HI4D 4X6CB 2VXSL 3RAJH 2ZUSA 3O4LD 5E8DH 2WKLA 3KL0A 3VIIA 2BC4B 4V2CB 2I25N 1MFEH 4PYSA 3SEPA 1RFDL 1EO5A 4G9FA 3GBDA 1CD9B 1CXEA 5HYSA 3EFDL 1QR1A 2R2CA 1SVZA 1WFNA 5TE7L 3PTKA 1WZKA 3W9DA 1R47A 4LVHC 4JKWA 4POYA 4CD8A 3BAWA 3SDAB 2AEPL 5ISZE 3WD3A 1RPQA 3VDAA 5A40E 5DJ0B 2YL8A 5D1XC 2DQDH 3GKZA 2V5MA 4ZSOB 2X2HA 4J27A 1CZ8L 3SGJA 5F96L 2EE3A 2N4IA 4QLLA 1B2YA 2HFEA 3DNKA 3IFNL 4XHQA 3MRNB 3QNZB 1NFKA 3VMPA 1M6OB 4BH8A 4I5BA 4M6NH 1DWIM 2GFTA 5DXWA 4AT6B 4A3HA 5FK9B 4OCXL 2OJZL 2R39A 4GRWE 1JTPA 4GXPA 3VWKD 4RMQA 3OA5A 1LWJA 1DQJA 3PJSA 4Y4FB 5DLML 5HHOE 4Z2KA 3OKOB 3IDMA 3C9NB 3MV7E 25C8H 4K7PL 1IGTA 4NPYB 4PREB 4TRPH 1C8PA 3SCTA 2DQCL 4F33B 2DMBA 4PTTA 1SJHB 2UZIL 4I3RH 4PPTA 1TQVA 2BVOA 2ESVA 3FTGA 2VL5A 4ISVB 2A73A 4Q9CA 1HEZA 2XOTA 1ND0A 1R3HA 2DQUL 1FL5A 1JG9A 3PL6D 5EC2B 3MBXL 3S36X 4KWUA 3PWPA 2VXVL 2D0HA 4TSBL 2OSXA 4IRSC 5TQ2H 1FGNL 4PJ7A 5FA3A 4U2ZA 4BF7A 1FH5L 4BUHA 1IAII 1T83A 2PYEB 5HGAB 1KTDB 2BVPB 4C4KO 4EI5C 5HHPA 3MUGA 4KI5F 5BZWB 2I07A 4HP5A 3GHBL 2ED8A 4JY4A 2IPKA 2R4SL 4G8EB 3TCLA 4LGXA 1AKJD 4O2CA 4AD5A 1VHPA 4Y4HC 1X7QB 2DQHL 5JW4M 2DTMH 2D2OA 5E8EA 3BPOB 3QUXC 4WV1B 5I30H 2NNAB 1UB5B 2VT0A 2ARJQ 3FCTA 3FFCD 3A67H 2DLGA 3QEGH 3WJLA 4UV7L 2RGSA 5I74B 4R4BB 1OTTD 4HXBH 2CRMA 1KXHA 3MRIB 5FYKH 3DX4A 3HG1D 4QCEA 4PRWA 1I8MA 1S9KC 4Z7NE 2C26A 4AYFA 4HMEA 2FBOJ 2PTVA 1CL7I 4PJXA 1NWRA 1RI8A 4OZ4A 3AIQA 3NGBB 4GXVL 4UDTA 3RKDC 5ILTH 1J7VR 1GZJA 3LKOB 3MV9B 4U6YB 3CX5J 3FHAA 3QIUA 2XVLA 4F37K 3RWDA 3JV6A 3JV4B 1ITCA 3BAJA 3HAEH 3ECBB 1NGWB 4KJWC 5BVJA 1OTUC 5F70A 3EOAA 1QI2A 3SDXE 5D2NB 4PRDB 1ZLUK 3GSXA 3TBYB 2WQRA 1U8QB 4H26B 3THMH 3L3JB 4P8WA 1R24B 4H20L 5TE4L 2XG9A 1LGVA 5HDBE 4FFYL 1A6UL 2EDOA 2DH3A 1W1PA 1ZANL 3OLEA 4HEPG 1NL0H 4DWHA 5HBBA 3BSHA 3IFOB 3MJ9A 4LYRA 1ZKAA 3PDGA 1BX2A 1SEBA 4QNPF 4NHCL 5I1DB 1FC1A 1YYMH 1HIMH 4GKZA 2L4OA 5H8DA 3NCOA 5A8PA 3B2UD 2V7NB 1JD7A 5FB8A 2AP2A 1JF6A 5DWUL 3F7QA 1CICA 1R3IL 1RMFH 1Y7VA 4UQAA 4LEOB 3IETA 3MOBH 2P7TA 1H0IA 3FT2B 4W87A 3QDMD 4ZPTB 1V3KA 5SWZA 3ZDYF 1XZ0A 3A47A 3K1KC 4LLDB 1JPFB 1FO0L 1UZ8B 1AQMA 5ID0A 2HT4D 3ARBB 3L3OA 5DD3L 3VWJB 1WV7T 2DSWA 2X40A 3SDDD 4YIQA 5E56A 4UBDD 4RISH 2GTWA 5I19L 3GMNA 5LQBH 3DYMA 3HG4A 1X5GA 3ZDZE 5KVFL 3VGAB 3OKOA 4KKAD 4GKZB 2VDKH 1C8QA 2CRZA 3FT4A 1J8HB 1JN6A 1XR9B 2GITB 3ZJ7A 5E0QA 1HF6A 1OTTC 2BOCB 2X2JA 3C5SB 3BAEH 2A0LC 2GK0B 1BFSA 3SDYL 2ARJA 4HC1L 2ADIA 4Z7NF 3V7MA 5KBNC 1MVYA 1Q9WA 4LLUA 2WC4A 2VZTA 2X4NA 3LKQA 4KK6D 3PABA 1QNQA 5DFTA 3ZO9A 3DV6A 2D7OA 3T0ED 1JE6A 4R8WH 4NC1E 1DBML 4BFEA 1I9JL 2OR9L 4TNWF 4YHMH 2PNDA 3O2WL 4ZYKB 4JG0H 4QRUA 4GRLC 3S4SA 1FZOB 5IBTH 1SHMA 2DJSA 1JV5A 1UQSB 5CEXB 3F8UB 4NO3A 2XTJB 3MPCA 3SDCC 4OQTA 3ORJA 3TIDB 2QADB 4GZJA 5JW4R 3QWRD 1UG6A 4ZS7L 3IDNB 1B0RA 3STZA 3HCVA 2JJSC 5EBAA 2VDQL 2ZUTA 1EVTC 2VI0A 3EOBB 3MO1A 3D0VA 2ITCA 4PLNC 4GAJL 3V6OE 1QA9A 1D5BB 2JEPA 5DJAB 4N0UA 1QR1B 4HUVB 1FNHA 2DKSA 1UWIA 5TGBA 3UJTH 5JIHA 4RFEA 4OZIE 1GGTA 4XBEH 1HXYA 4YDKL 4QXGL 3WBDA 3CCHA 4CN4A 2QQKL 5ISZA 4G6AD 2WUBH 1JZ5A 3LXBA 4YHML 5BWFA 3HZYB 4Q6IB 3O45B 1F11B 2KQNA 3DI2B 4WFHE 1IAKA 4M1GL 4XPAH 5DZLA 3U57A 1YY9C 2WVVB 4P2RD 2CRYA 3HC0B 3OKLA 1V6XA 3ZM8A 1ZLWH 4RX4A 3TBVA 1KTDA 1K8IA 1MF2H 5HHMB 5JPNB 3NSNA 5C0BB 4IRSA 4UNUA 5C2UB 4Z7VF 4F7MA 1RUPH 3DXAB 3BUIA 3SQOH 3MNZB 1BMGA 1FL6B 3DHJA 4GOSA 2NY1B 1ODUA 4MNLA 4DGVH 2ZUXA 1IGIH 3V95A 1XF4A 5D1ZC 2PW2B 3I85A 2BY2A 4TVSa 4JRXB 1MRDH 4QRPB 3GBLA 2H9GA 2F58L 3V4UH 1EPFA 4XTRD 3RZCC 1LO4L 5DQDL 5HJ3B 1E0VA 1JGUH 3OKYA 2J8HA 2DQHH 1NMCC 5KVDL 5K9KB 4LSQL 1JPSL 1PYWB 5BXTA 3EO1A 1S7RA 1Q72H 4PJ8C 4PTWA 2IPTL 2O9PA 4PG2C 2ESVE 2VRAA 4D1JA 4JAMA 4RAUA 1HWWA 1DLHA 4KVNL 4HCRH 4FXGA 4JANA 4NZDA 5F8RC 5CD5D 4OLWH 5E8OB 5MEPB 1EHLH 4L8CB 1OM3H 4QCIB 4G9FD 4PJ7E 4OIAA 2IQ9L 2Y06H 2A3HA 2APTA 5EUKB 2HISA 1UACL 3RPMA 3HNSH 3IJHA 2Q1EA 3CVIL 5C07B 1D5IH 4PRNB 3G5YA 1RIUH 1GHSA 4NRYB 4NZTL 1A6AB 1XGQA 1Y18A 4IRZL 2IXUA 5GNXA 2X10A 1WVZA 3HI6L 1RUML 2DLTA 4HS3B 4L4VD 4TPRH 5HGHB 1UKSA 1AGDA 5DLMH 2J79A 3BUYB 3HMCA 4IOFC 1BBDH 3HE7B 1W1VA 3ULVH 2Y6SC 1NUNB 2OJZH 2HLFC 4Y5XA 3CLFH 1KSRA 5K9QI 2FBJH 2IMNA 4TUOB 2BVUA 7FABH 2VLLB 3KPOB 3PZGA 4LP4A 3N04A 4K71C 5EOQH 1GJWA 3V6FB 1HINL 5HD8D 5H94B 1Y0LB 2G5BB 5F7EL 1G7MA 4KHXL 1J0JA 1IEBB 5CP7A 1HKKA 2A6KA 2NXYD 3QXVA 5EOTB 4KI5D 2X9XA 1BECA 1SYSA 3U2SA 5IB2A 4WLCA 2KDGA 1OBAA 2W5FA 1H0GA 1UR2A 3G5VB 2DQTL 5C2BL 1ACYL 5JHLH 3T08A 2C3HA 5B38A 4D3CL 4KY1H 4DGIL 3WMCA 4ZD3L 1YEKL 3LS5H 4PJIE 5CGTA 4WI6A 1BGGA 1L9NA 3KPSA 1WPCA 1ZGLB 3SHSA 5JMRA 1DWFM 2R23A 4OCSL 5DHYA 1R7AA 1FZMB 2J7HA 4QRQB 4J4PA 3O2DA 1A9EB 2D4DA 3L3HA 1GONA 1RIVL 5F1IB 2XFXB 3GSNH 4O2EB 4ZO6A 4S1SH 3UDWA 1H8OA 1Z3GH 2HG5A 2PKDA 4X9FA 5JIIA 3M46A 1KIPA 3CPLB 5L2JA 5J12C 5IBUB 4AIZB 2MHAA 3V6FA 1EOKA 1DQTA 5D9PA 2VXVH 1UJ3A 1L0PA 4F9PC 4L8SA 5MP6L 2V2XB 1AKJA 2G5RA 1X6LA 3ARDC 1Z6JT 2WNGA 3WNNA 1ITBB 5D2NE 4CVWA 3LRLA 3EOYG 1DCLA 1H5BB 2IFFH 2J7GA 3HUJF 1JXKA 3TV3H 4Y5YC 1LVEA 4JFHD 4P23B 4B5EA 1AIFB 1U92B 4GO6B 4NWUL 3U5YA 2EDJA 4M93C 1HVQA 25C8L 4AENB 5ANMB 4LNRA 1YPZA 5JA8B 1AXTL 4GMTL 4HJ0D 1IFHH 3NZ8A 2ZXBA 3F7VA 4UQ3A 1ZWIB 2DM3A 5FL0A 1NMBL 3QA3A 1YECH 5DQJB 5D8ZA 2W63A 3S9DB 2DF3A 5I24A 2NW0A 3V4PH 2ZOKB 2ATKB 3MMDA 4HU0A 2XPKA 4Z7UE 4ZFMA 3SCPA 4TSCH 1I1RA 4QCIA 3CZJA 4YDIL 3U4EA 1J1XL 1T0NB 2HRPH 3UZQA 3L7EB 1E4KA 3GMRB 3LB6D 4YXLH 4TUOA 1S7SB 4YXHL 4JAMB 3K0WA 1W0VA 3RWIB 3BSGA 2FHCA 5BQ7A 1TA3A 3GMRA 1MWAL 2YC1A 3DX8A 1JXJA 2YLAA 4M6MH 4MXQC 2DEPA 4BFIA 3IGUA 2FECI 1XYZA 3WQVA 5DI8B 1DWJM 2VLRA 5B4MC 2YSSA 1F4HA 1I7UA 4J6RL 3BXWA 4GMTH 5D93C 3U30B 1DSFH 2XIDA 5ENWB 3LX9A 3OIHA 4LVNB 5ICZB 5KANG 3UJJL 3MRCB 4GRWH 5FUOH 4S3KA 5D7SL 5EA0H 3LKNA 5DHYB 3O41A 5L8KB 2XN2A 2RFXB 3GXFA 4G8GD 2IANB 3PXJA 3ILPB 4OM0L 3VI4E 2FH6A 2XG5A 3MRKA 3QYCA 3WUEA 2Y25A 3LQMA 3LEXA 2BVEA 4S2SA 3QO1A 3WFEH 1K85A 3WIFA 4YX2L 4K2UH 4OCRL 5EU6B 4IDJL 3U0WL 4QWWD 5FKAB 3IFPB 1V6WA 3NUKA 4Y5VB 2WHKA 1RZKL 1F11A 2CH8A 2Z8SA 3SDDA 4XPGL 1GGIH 3WS3A 2Y8VA 4QXTA 2ARWA 2V7HA 4ONHB 5DJ6A 3DSFH 3Q5OA 3P2TA 3SCMB 4BA8A 3WKML 3O6KH 2A6KB 1IZJA 1TMCB 1ZLUH 4APQC 3NTCH 5KSUB 3HAEB 2WW8A 4JFHE 2DQGL 4LPYA 2FGWL 4UIMA 5FM5M 1X5ZA 1A02N 4X4YA 3QNXA 4AZ7A 5FDWB 1BEYL 2COQA 5DT1L 2FB4L 1I7RA 3EOBA 1BFNA 3V5HA 5LA1A 3ELAT 2R23B 4MA3B 3T0EE 4ONGL 5FDWA 1MW1A 4J28A 1IE5A 3BP6B 2FSEA 3RL1B 2YDSA 2IBBA 3X12B 3MRMB 4G3YH 1D3CA 3DXAE 3JWOH 5I1GH 4GKNA 1FPTH 4JY5H 4WUKH 2VDPH 1FNGA 2GJRA 3GIZH 2Y07H 3C8DA 4LHUB 3B5TA 4CVXA 2PO6A 2QHRH 4UAOB 4LVEA 4XPTH 1T21B 2VURA 2W91A 3DTXA 1LWHA 3GBML 1HXYB 3D48R 1OD8A 2G5BA 2WKGA 1GQJA 4L8CA 5K9OB 2CJUH 5I1EH 3MJ9H 2AJZB 1EXPA 1E28B 1J05A 4EVNB 4I3SH 2H2SC 2W60A 4KH2A 3MLZL 1TQBC 1G1YA 4ZFOL 2FGZA 4AMXA 1EGJH 1NFIA 2DOCA 5LA2A 1NDMB 1BSIA 5E5UB 1B0RB 2BMKB 1NBQA 4OZFA 1E71M 2AW2A 2K7PA 3AY4A 1F8TH 3RWHA 1MI5B 4KK8C 2WBKA 2V3EA 1KJMA 3JWDC 4JGMA 1LD9A 4L4TD 3H9HB 3WYRA 1QSED 2QQNH 4AM0A 3CZ8A 3HUJB 1I8KB 4HJJL 2QL1A 3PHOA 1UD2A 4P5KA 3ZL4H 4XAWL 1MCRA 1JF5A 1HZHL 1OB1B 3OAYH 5HHME 4Z7WF 3L2LA 3I6LD 1U8HB 3P77B 3VIKA 2OI9B 1XCXA 5DC4B 1BD2A 1MPAH 4YQXH 1NMAL 3AICA 1S7SA 4MMXC 2ZZUT 4LK4A 3IDIA 5ABDE 3F7PC 3CC5A 3GH5A 5SX5H 5ELIA 2APVA 1UR4A 5E8OA 1MJUH 4WEUD 2CYGA 4AW7A 4OFPA 5IESH 4KUZH 1RY7B 2I5YL 3AFLA 3DX6A 1MHEA 4YBLC 4YDIH 4PB0H 3GNMH 4X8JA 3U7BA 1E4WL 3LEVH 4U1GC 5KVDH 4ZXBC 5T33L 1FH7A 4I4WB 3PDOA 4FFWD 2A3AA 1DUYA 2P8PA 4OLYL 2JCCF 4RNRA 2X70A 4HS8L 4XNQB 5A2BA 3X3GH 1ZS8B 4IDLA 2CSPA 4MDIA 4X80L 3CAFA 3ZDXF 4DUVA 2XQBH 5DJZB 2UYLA 4MA8L 1EBPA 1Q9KA 4LRNH 5SV4A 1MFVA 1MXGA 1KB9J 4PJFE 1IKNC 2VXUL 1PPIA 2HKHL 3TV3L 3NPZB 4YDLB 5L2KA 1OGSA 4U6HA 1U0QA 4NFCA 3RY5A 4LSRH 2V2WA 3O3AA 4QRUB 1UA6H 4FLRA 4XP5H 3MNWB 4F9JA 2VC9A 2YPLB 2VL4A 4WW2F 4Y8AA 2D7QA 4HPHA 3AB0C 3VFNA 1P2CB 2CIKB 5FGBA 5ISZB 5LGJA 1VERA 5ACZA 1K6QH 3FFCB 3MROB 1CXFA 5ITFB 1R24A 5I17A 1P9MC 1LEGA 1H15A 2ZWYA 3LH2H 5IG7A 1X7QA 4K8RL 1Z5LA 12E8H 5T33H 3T0BA 3ZJKA 3WFBL 4UOZA 5E9DA 1J8HA 2GITA 4OD3L 4RQQA 4V1DE 1E56A 5FYJE 1XR8A 1YEKH 2A6DA 5A2JH 1A14L 5EZIH 3QEHB 4HF5H 1PVHA 2FZ3A 2IGTA 1WWWX 5E2TH 4YIQB 4C57C 1YMME 1LP9F 4FQQA 1HKFA 1YUHA 1IILE 3H7BB 4KTDH 4S10A 4N8CH 3GXTA 1EZVX 3KPLA 3PHQA 3SE9H 1P84K 4AQ1B 2C1OA 4PJIB 3FFDB 2NSXA 1XCWA 5CLWA 1G1CA 2P7TB 2G60L 3KR3H 3WS6A 2Y24A 3MTRA 4KJWD 5EIVA 3D9AH 1U93B 3MLUH 3WFZA 2OMBA 2R56L 4N1CA 5E6ID 1I1AA 4UFHA 2YDRA 3N9GH 3HZ3A 5KS9F 4Y4FA 3TCLB 1E6RA 1KPVA 1ETZA 4G6MH 5D6CA 4X83A 3QUML 4KKAC 3QIBC 4S11A 2EEDA 3SDAC 3LKPA 1DL7L 3P30L 5J7CC 4L5FH 1EFXD 5CJXC 2KZWA 4AXNA 1I1AB 3MUIA 1QLRA 5D1XB 1FE8H 4OD1H 1WIOA 4Y4KA 4JFPA 3NFSH 3UR8A 1D7FA 3P0GB 4IJ3B 1G7PB 2WCAA 3C09C 3QDJD 3QULA 1FVEB 4ZPVA 4ZG1A 4YO0B 3WSQH 2JIWA 5MEOB 1DFBL 2NZIA 5GS0D 1KB3A 5GRUL 5EC2A 3T0EC 2VXTL 1H5VA 2OK0H 1V6YA 4PJXE 5SWSA 5HDBF 1FL5B 1KNOA 3H7BA 4ZTPH 4P9HL 3S4SG 3EMQA 5J06A 5I1CL 2XZCL 3RTQD 5GGSY 1XAUA 4WVRA 3H6JA 2JCCA 2JB6B 1OW0A 2O5ZL 2V7NA 4AQOA 1SJXA 1A8JH 4NQDD 1MCOL 2VB5A 3MCLH 1P4IL 4Y4FC 2QQQA 4P4KC 4R7NA 1M04A 1G7JB 5BMFL 5AC5A 5CUSH 1Z5LB 2ENSA 2L7UA 4JY6B 5FK9A 4QRRA 1QLFA 3BVNB 3O6ML 3QR3A 4FFYH 2ITDA 4B7LA 5DO2D 5I8OL 5FGCE 3DYPA 3SKNB 4NO0D 1JIBA 3OG4B 4WKHA 4YDVA 1CBGA 2VX7A 2WIMA 4U1LA 2W4XA 1WK0A 4IISA 3T0EA 3VX1A 4WV1A 3FB7A 3UMTA 3MODL 4WNQA 3KPRE 2E40A 1UH3A 1OAYH 3QG7L 4XPGH 1OAUH 3K3QA 3QXWA 5SX5K 1ZHLA 1IAKB 2VLRD 4P4RB 5C08E 2CPUA 5L2KB 2F54B 2ADGB 5HHVL 1T3FA 5L0QB 4U33A 4ZO8A 5EBMB 3WUZA 4OFDA 4W6YB 3TONA 3QNXB 5EU7E 4XBEL 1CTOA 4KDTC 3A67L 3OR6B 3IJYB 1E6NA 4HD9A 2J8UF 3MXWH 1TVHA 2VDRL 3NFNB 3QQ9C 5L6YL 1C93A 5I74C 5KSUA 4GRMB 3PBGA 1HHKA 4U1JA 2NNAA 4HUMB 5ADPH 1G9EA 1M7IB 5BXFB 4LVOC 3TNNA 2CKBB 1FP9A 2YK1H 3IDMB 4HWBH 4YAQB 2EO9A 5F9OH 3UPAA 4H04A 3MSPA 4GW1B 4AD3A 1RK0B 4AZCA 2DLFL 1D5MB 3FQXB 1CDYA 3G08A 3NGBC 4ZOEA 4HX1B 3WNOA 4CCCA 3LEXB 2L7JA 1NPUA 3NMEA 2NXZD 4HCRA 4NIKB 1JPGB 2Z93A 4RBPH 4CMMA 1CFVL 2G3NA 3ZOAA 3D5HA 1J5OL 3O6LH 4YBHA 1OGTA 1CLXA 1CN4A 4Z2JA 4H8WH 1OSPH 1DQMH 2HT4C 1MQKH 1X5IA 3GKWL 3MRBA 3WJLC 3Q1SH 4HEME 4X7SH 1AHWA 4Y19A 3SOBL 1NGYB 4L9LC 1C1EL 5KTEH 4ODHL 1KCUH 4LBEA 3QUXA 3KLAA 4U6XA 4PJBF 4LRNL 1LK3L 2LFGA 1U8LB 1W72H 1FLRL 5IEHA 4PJ5B 1A1NA 4AG4H 1L7TH 5BQ7B 4PJIF 4HS8H 4KU1A 2N7BA 4UU9A 3ESUF 1BGXL 1ZMYA 3FFCE 2IFFL 2CLZB 3QCUH 1KNOB 2BNRA 1FL3B 3WUWB 4MQXC 3GMMB 4G9FB 1ZVSB 4F37F 4LF3A 3FXYA 1NGXB 2VE6A 1MFBH 4PJFA 1HHGA 1NCCH 3M1BA 4TUKH 4IOIA 2HN7A 3W2DL 1WUNT 4YBQC 4EOWH 4MJIA 3WO3B 5F7YC 1INQB 2OS7A 1JK8B 1H3PL 5EIIB 3A23A 4QHNB 3SO3B 2VSCA 2X4SB 3ARBC 3D18A 4P2QB 4JZJB 1O5DT 3U6RA 1EJOL 1N5AB 4MNGB 3K46A 4KK9D 5D7JB 4ZXBA 4PP1C 1A1OB 2YD3A 1IC5H 4L4VA 4P2CG 2WMPA 1HI6B 3BOVA 1ORSA 2DKUA 4AC1X 4D6JA 5HPMB 3ET9F 3RL2B 4ODUB 2ATPA 4JVUA 4NRZA 1NL0L 3RY4A 1I7RB 2FL5A 4NUGH 3U7VA 4JFFD 3P9LA 5CFHA 1LO3L 1ZGLP 1A7PH 3KPNB 2YZ8A 2EDDA 1HK6A 4YBQD 1F42A 4KY1L 2RB8A 1EGJA 2VABB 2DMCA 1JF1B 3UTOA 1FORH 3DV4A 5D2NA 1XH3B 1Q6EA 1WDPA 4NRXB 1WWAX 3G5XB 4RFOL 2OYPA 2V2TB 2VXSH 4V1DA 4Y1AA 4TUKL 2VUYA 3W0WD 1F6FB 2A6IB 2PW1B 5IHSA 5TF0A 3PWNA 3WS3B 1HINH 1SEQH 3QUXD 2BSRB 3L5JA 3N1QC 3VRIA 1IT9L 2CR6A 3O11B 1XR8B 1FCGA 3KLDA 3MYZA 1C12A 1JGDB 2QADC 3O8XA 4S2SB 4XRCB 2IG2L 4LDLB 4ACPA 3BHBA 4GXUN 5J1AB 4XV0A 1KXTB 1VEPA 3U0PB 1INDH 4WUUE 3EOTH 4U1SB 1YMMD 1CDIA 3E3QE 1AD9B 1BG9A 1ERNA 5D96B 1QG3A 5LGJB 4P7RA 1P9MA 3LQZB 3OZPA 1B3JA 5GS1C 1MFDH 3WIIH 4JM2D 4D0DB 1Q0YH 5KVGL 4BELD 1P5VA 2WLYA 3MLXH 4MX7B 3WF0A 2HTKC 3VSTA 4M1DH 4YHIA 4UT9L 4WSJA 3BX7C 5TH2B 4H1LB 4XNZC 5DJXB 5C0AB 2P8LA 4CJ1A 1DQLL 1EZVY 4NBXB 3WN6A 1VSCA 3GRWL 3HFMH 1KWKA 5FV1L 1GHFH 3DETC 1YC7A 2EEBA 3QUYB 3GXDA 4FQJL 3HS0A 1ZJAA 4LU5L 1RZKC 5CSYA 1XH2A 4AMCA 2I27N 3HZVB 1GHRA 5TQ2L 4ALAH 2VAAA 2NY1C 4IPNB 3SUUA 2EDBA 3MBXH 1IKFL 4WO4D 2BSTA 2YD9A 4FZ8L 4PJAA 5E00A 3R1GH 3GH4A 1J8HD 2YFNA 3QJFB 3CSGA 2OXHA 3NZ8B 5T1MB 3M8OH 3RZCB 3S34L 3VFWB 3VWKC 3ZTNH 5JUEL 2C7FA 4JJ5B 4JR9H 5EUKA 3GI8H 5L7XL 4AZ6A 1IGYA 1TJIH 4HFWB 2E3ZA 4AENA 1C92A 4M3JA 1MCCA 2CK0L 1NBZB 3ULUD 2QHAA 3ALPA 4XVJH 4MMZC 3G6JA 4J6RH 3EYVA 3W28A 3B8YA 4OB5L 5SWZD 2QHLA 1XGPA 1BD2B 5KJRL 2ED9A 4ELME 5I1LB 2VLKB 5A8QA 2UWEB 3WY3A 1TCRB 3MCKB 4B3LA 3QXAB 2ZICA 1WIUA 4B3KA 4XP6H 3V6OC 5E0CA 1I1AD 4OKDA 1XSKA 5DS8A 5K9JH 4UQ2B 2ZCKH 2BSSB 1EGZA 3AAZB 1ADQL 4NKIL 2FEEL 1AI1H 2V5CA 1UM5L 4WFED 3B3IA 4BSVA 2CHNA 3POHA 1BQLL 3CFBA 4YZFF 2TAAA 1AQDA 4PYGA 1M05B 1F2QA 5JDSA 5HYFA 2H2PD 2BY0A 3VRJA 2Q86B 2PXYB 1MAML 2VAJA 5IXEA 2BHZA 3NIYA 2EIEA 1H9VA 4FXLA 1VCAA 2F8QA 3U7YL 5JOPD 5JIPA 4LCYB 3MCKA 1TQWA 4XNUL 2WP3T 5SWSD 3MS8A 3UTSB 3QDGD 3LS4H 5HGDB 4JG0L 3RDTC 2BCKA 1A7PL 4NQSA 3KS0H 1OWQA 2AJXL 3EYOA 4WO4A 3T77A 1VRXA 4W7VA 4R8WL 3V4VL 1NKRA 5C0GB 2GJXB 3NAAH 1CDBA 3VDHA 4RFEB 2XN9B 3LIZH 5E24E 4GKLA 4LPXA 4Z8FH 4LQFL 3QUKA 5TF1L 3SJVD 4FNPA 4HBCH 4ZUTB 2Q3AA 1OB0A 2VX6A 3VD9A 3D2UD 2OCFD 1F4XH 1KPRB 1WFOA 3EKCA 3QIWA 3OF6D 4XVUC 3MU7A 1QFUH 3LN5A 2DT2A 1T1YB 2BSTB 3GSNA 4PJAB 3VXRB 1IGMH 4X9HA 2AJSL 3O2DH 4JPVL 3VOCA 3JTTA 3DMMD 1W2KT 4NO3B 3BUBA 4JN2B 5ESQB 1FFPA 3B83A 1EBAA 1G9NC 3TA3B 5CAYB 3REWA 4TSAL 4M56A 4FNLH 1GQKA 1GJUA 4KROC 1YJDC 3E6FA 5J12B 4OGYL 1JAEA 1WZMA 4ZD3H 5I76B 5CHNB 3S5ZA 5IQ9A 3UYOD 1KN4H 4LCWE 1FLRH 2FNBA 3WLWD 3ARDB 3HC4H 5M03A 1A4JB 4ZFZA 3TTSA 3MRKB 5DWUH 1WT5A 5EZIL 1DLHB 4QRSB 1F45A 1KUMA 4G80B 1VESA 4Z6AT 4A3YA 1A7RH 2Z31C 4GS7C 4JGUA 3D85D 2FHBA 3FRUB 6CGTA 4XBGA 3ARRA 4M93B 5F7EH 1QSZA 2XFYA 1AGCB 1NFDB 2A77L 4E42A 3CDFA 3A21A 1T5WA 5F1OB 4CNIB 4EIGB 5A94A 1QACA 2X0HA 1AXSA 4BQ3A 1NCNA 3VGBA 1UZ6E 1S7VB 1ZHKA 1T7XA 5CGMA 5D70L 5ANME 4GSDL 1QSEA 2ERJB 4JPIB 5GZOD 2D0FA 3QOKA 3HNTH 1BQHG 2NTFA 3CFCL 4DN4L 4QRPA 1UA7A 2WIIA 4QRTB 5A6SA 3QB7C 4JO2H 4DUXA 3GEWB 4PLKD 1NGPH 2J77A 3UAJC 2D20A 4LMQI 1JHKH 5I66A 1C5DB 4M8VA 1HSAB 3MLSH 4U31A 3GNOA 5JZ7C 4KQ3H 4Y1AB 4QNPE 3DXAA 1IEAA 4LCIL 4AISA 3EDJA 4WJ5A 4ZAKA 5T1DL 1AD0A 2AXGB 3NCYP 4NN7C 4NN5B 3AM8A 3ULUL 2OSWA 2AI0L 1I7ZB 3D50A 2C5DC 3TYGL 3AUVA 2R1YA 4MQ7B 3CDGB 4QTIH 3SPVB 4OKVA 2DM4A 4KI5E 1OAZL 3EDDA 4YPGB 4WF7A 3VIPA 1AO7B 3D1MC 4EI5D 4BQ5A 2B0SL 3IAPA 1CBVL 1DN0B 5FUZH 1E4LA 5H2BA 3CFDA 3QEGL 3UC0L 1LO5A 2BNQE 2UY2A 4KXZI 5C09E 5AAMA 3KDMB 1S9WA 1RJLB 3QZWG 5DUMH 4JZJA 3L7FA 1OGAE 3UROR 1Z0MA 2BZDA 4IRJC 4OCMC 1YEFH 5IK3A 2EQDA 2WMKA 4GI6A 1N6QH 3CXDL 1H5BA 3MA9H 5IVZA 3KLHC 3IDNA 3KNBA 3ULSB 1BREA 1KACB 4FQCL 2RAMA 1KJ2A 2P48B 3FQUB 4Y5VC 2VDLH 1C5CL 3HPJB 4Y19D 1VFOA 5I8OH 4XPHH 1I8MB 3RJYA 4J1UA 4Q9RH 4K94L 3GBNL 1HXMA 3RVUC 5HVFB 3SCMC 3RJQB 2VWEC 4F2MB 5HSFA 1P1ZB 4RGNC 3BH9A 1DWHM 4XPAL 3GH7A 4MWFB 2X4NB 3UETA 3UEZA 3PZ9A 1WE5A 1Q9WB 4D9LL 4NQXA 2MMXA 2AS5M 4KRNA 4BSJA 2CERA 2YA0A 3R4DA 1CDJA 4OT1L 3UCQA 2ICWI 5B21A 3UBXG 4Z7UB 2W9DL 5ADOL 2A6JB 5I8EB 2MPAH 4BSWA 5F3HA 9CGTA 1NQBA 5DJ8A 1W72B 3TYGH 4JHWH 1ORQA 4HKZA 4M7KL 5HGBA 1GGBL 4YE4H 3QH3B 3ULUH 3RWCB 5IEKA 3CZFA 5IB2B 3D25A 2B1HH 4NO5B 2CIPA 1W9UA 1EEZB 1M7DB 1GOQA 1DVFB 4YXKL 3VFOA 4OQTH 1QFHA 4NQEA 4AD1A 4JM2F 3TLRA 1KTLB 2RGMA 3OXSB 4C7FA 3AU1B 3N17A 4PRIB 4D9QD 1UCBL 2A73B 2E6JA 3CFCH 4LEOA 1J1XH 3RIAF 3K80A 3FT3A 1CGXA 3N1FC 1OY3B 3WHXB 1NLBL 1HN1A 4GUPA 4M8QB 2QR0B 2G60H 4ACZB 5I8CB 3CTTA 4WFHD 5IVNA 3HNVH 5IB5B 5FYKE 1E73M 3TNMB 4KRMB 3TJEH 3FAWA 5DT1H 2OZ4A 4W4OC 3VG9C 1LO0H 5DC0A 1U3HC 3WL9B 1Y6KR 2G3IA 3I02A 5IFHH 4AEFA 1MCNA 1OLLA 5IVZB 1C90A 3EIFA 4RZCB 2EECA 1FYTE 4XC1L 2CHOA 5ABFA 4YFLF 3CUJA 4F15C 4PS4H 5GGVL 5AYIA 1KELH 2OI9C 1XC6A 1LE5B 1WNOA 3PN8A 5IF0A 2EZ0C 4DVRL 3QPQC 3W11C 5E5MB 3LKRA 1YMMA 4U1LB 4TX6A 1FFOA 1X5KA 3EYFB 1G7HB 2YKKA 3I6GB 4DK6A 5E2WH 1BZ7A 4D6HA 3IAQA 1EJOH 2XKNB 2XT1B 1PYWA 4YBLB 1ISXA 3EDEA 1IC4H 4P57A 3VXQB 4WTZA 2PN5A 5ID1A 5J4MA 5I2IB 3TNMA 1F4XL 3VXSE 2XN9E 4K3DH 2EC9T 3QI9A 5MI0B 2R2HA 3O9WC 2D4FA 1GH7A 2Q3ZA 1HYSD 4P7QA 4Y4KD 3BH8B 4QHMA 2HYMA 2VITA 4MGXA 1EAJA 4F9LC 4JL2A 4JO4L 5HYJA 4DCQA 4EKJA 3F5JA 1L0YA 2QV2A 3VIOA 1FHLA 2ESCA 1XF3B 4OM1L 3D52A 3L4YA 4LOUC 4ODXA 5DJDA 5F93C 3AZRA 1ZV5A 5H35A 2AAAA 5GGVH 2XGIA 3CMOL 1GOOA 3RHWF 1E4XL 3GXMA 3EGSB 4XI5D 3CZGA 1UWTA 3KXFB 1MIEH 3DBXA 2H45A 2I60L 2VRJA 1G7PA 3BT2L 3PGDA 1B0WA 1JHLL 4YJZL 3EYQD 3MRQA 1C1EH 4Q6IA 3ZTJH 3CVHL 2NXYB 4AIOA 5EOCJ 3AJ7A 3FRUA 4UIKH 3OKKA 4MDJB 3NCJL 3WQ8A 1JPTH 2Y8KA 5CZVH 5ICXA 5F7LB 1U3YA 4XP1H 3MC0A 3D3VE 1Q6DA 3AMCA 1Q9LA 4YWGL 3H42H 3ZR6A 2E6QA 2NYYC 1WKYA 1ADQH 3PWJB 4N8PA 3BT2H 2ZE0A 5CPQA 4NXKA 4AG4L 2FX9L 2XN9D 2PYFA 4TPRL 1DANT 1A7NL 3W39A 3G6DH 2DRUA 3G6MA 3BFOA 3TWCL 1LNUB 1QBLH 1I3UA 4IRZH 4Z18A 3S88L 3OLIA 35C8L 1V7ML 1G6RA 2WAGA 4R27A 1EEUA 3ARFB 2B1HL 1NQ6A 1KJ3H 1WLHA 3FMGH 3W5MA 1KJ2B 1H3WM 4M7KH 1NC4B 4A6YA 4LLVA 1CFVH 3KNBB 4MVBD 1MHPH 1FG9C 1URLA 2QSVA 1P4LA 3BIAX 3BZDA 4JFVA 3U36B 4U49A 4V27A 4I1NB 4LLUB 5F3BB 4PTUB 5T5FL 3MLZH 3WE6B 2KPNA 1P7HL 2GT9A 3G9AB 1NFDE 3GJEB 1Q9LB 3WENA 5AYUH 2PR4H 5LA0A 1KBGL 1GIGH 5ICXB 4LGSB 3CFIC 1NP2A 4S3JA 2GSJA 4PUBH 5BRZB 3RGHA 5MEQB 2EEXA 1W9PA 2RIKA 1BVZA 4Y88A 3IXTA 3BAYA 1F90L 3QIBB 3R8QA 4NCC2 3FQTB 1U30A 4J3VA 2CBUA 4Q0XH 2BFVL 2VTFA 3LS5L 1C5CH 3QHMA 1JYVA 3MNWA 4PJ9C 1JHLH 2Y72A 5C7XL 2MCPL 3E2HC 4KTEL 4LLDA 2F7RA 4XGZB 2N7AA 1ACYH 1ZTXH 2PXYA 2J4WL 2R1WB 4P7LA 2R1XB 5I1GL 4G3YL 4RA3A 4XHJD 4XXCA 1T1WB 4OIIL 2F54E 2NY6D 3G6AA 1IEAB 4ODXB 5DJDB 1AXIB 4M1DL 4W6XB 1QHZA 1CLOH 2BJML 1BIHA 1HKLL 3EFFA 3RPIB 2AGJH 5C0CD 1MCBA 4ONGH 4LLYA 4M6OH 1Q9KB 4X6CA 3ZJ8A 3D39A 4TUJB 3RNQA 3DDGA 5TQ0H 2AQ2A 3S37L 2WZIA 4FHBD 3BJLA 4KRPC 3V79C 4TXEA 2XA3A 5F1NB 3AY4C 3QDAA 1I1FA 5I1DA 2OWWA 5C70A 4FFVC 2IALA 1U3HA 1WQVT 1EXUA 1YMHB 2VC2L 3RA7L 5LAXA 5HDOA 3OSKA 3P0YL 3KYKL 1KXVC 4DO4A 3QIBA 4NC0B 2VZ3A 3QWQB 3EO0A 4XWOD 1BPVA 3C87A 3BN3B 1FN4A 4PV9A 3WSQL 4D9RD 5BS0A 3Q3GB 5KG9B 3GZKA 2BNRD 1P6AB 2G9HA 4Q2ZB 3PZUA 4PJDB 5CIPA 1OP9A 1S9YA 1KIQA 1CU4H 1R87A 5KSBF 1NGWA 4XZWA 1NSNH 5J1SC 4ZUVA 3FONA 1K5NB 1XCQB 1MRCH 3GM0A 3JV4A 1BPLB 1OT2A 4LSPH 4PB9L 5FXCH 3T8XB 1N3NB 4FFVD 4NQDB 1QOXA 1W2VA 5I8KH 4HZ6A 1A3QA 1C5DA 1OAXH 5I1CH 2WINB 3C8HA 1KC5H 3CIVA 1DSFL 2YEZA 5FYJL 5JHDD 1GNXA 1B2WL 3OXRB 4PJAF 1WZAA 4KPHL 4Y16C 3V5KB 4K8RD 3VRLF 1QQDB 2QR0A 2YXFA 1D6VH 3O4LA 3ZSSA 5C0DB 1CLVA 4K9EH 4K3JH 4NOFA 4YGVB 1AGCA 4M9PA 2DL2A 5IWLA 5JQ6L 3BKJH 3SDYH 1KYOK 3PWJA 2NW3A 1J05B 4L5FL 2F19L 2JK5A 1FNLA 5IOPA 1GOWA 3NH7H 1I9IL 4P3CH 4FG6D 3QUMH 4YHNA 4HF5L 4ELMA 4JQIL 2YBRA 4NT6B 3D39D 4R6UA 1NUGA 4EI6B 1R8LA 2P5EB 1OPGH 2JK5B 3UPRA 3O6FC 4MXWH 3AXHA 1NH6A 4EI5A 1FNGB 2CBIA 2JF1A 3UTSA 4NGHL 2WV3A 4ODVL 2C8NA 3PL6A 1K6QL 4N1EA 1AC0A 3PTMA 1JDAA 1JCKA 5C9JB 4WIWA 4P2RB 2VISB 1VFBB 3PWUB 1QQDA 5E1HB 5AD0A 2CIIB 1J11A 5J8OA 3OXRA 1JFHA 5FECA 2F53B 3AHYA 5B39G 2OSYA 1OF2B 1S9XA 4OT1H 1FHDA 2ZKHH 2HJFB 4W4NA 4UFIA 1DVFD 4BH7A 5JZ7D 2VITB 5E4IA 1HP5A 1DQML 4LSTH 1KTCA 4BZ1L 3H9SE 1HT6A 1D9KD 5MP6H 3WN5B 1BLNA 2IADB 3QT2A 5GGSA 1NGQH 5GS0L 3UX9B 3SCMA 1A0QH 5E08H 3HPLA 2Y2WA 4K94H 1UM6H 5A3HA 2VZUA 4OUUA 3DX9B 5I23A 3GSOB 4WW2B 3K8LA 4B7IA 5TE4H 2ESVD 1IM9B 4X98B 3MBED 3VMOA 4X4XB 3WXWH 1XGPB 4PRIE 3LKRB 1PKQB 1CXKA 4WW2A 2A3EA 1RAMA 5HHOD 5IF0B 4FQXD 5HPMA 2Q86A 3OBAA 4PCTA 1C8XA 4G7VL 5DUBA 3KDMA 1CLYL 1I1XA 1M05A 1D9KC 3IU4L 4MZ3A 4JGJA 1NCAH 2AXHA 4ZE4A 4HGKC 5H2BB 5IHUL 1A7QH 5JORB 5ICZA 1U8IA 2GCYA 1ONQB 2ZKHL 5J3HD 3SKMB 3KLHD 1AVAA 3VIFA 4H8HA 3C6LB 1XF1A 3AAZA 1U8MA 5IVXA 2VDKL 2Q6WA 2BSSA 3I9GH 3OGOE 3VFRA 2VMFA 3KYMA 4ODVH 4PMUA 2Z31A 5B3NA 5E99L 3ZE0E 43C9B 2MFNA 1PSKL 3WKNA 1D6EB 3ZE2F 4PEEA 5D8JH 5CJ5A 4M03A 3Q6GH 3FQTA 1ZVHA 4TTDC 4URTB 4JFOA 5I66B 3QHFH 2ADFH 4PJ5A 1IAIM 3PUCA 5D7JD 5LBSL 1RZGB 3UG4A 3KL5A 4HFWA 1IGYB 1DVFA 1KEMH 3ZTNL 3AMGA 5I71C 5DSCA 1MYRA 3WFHB 2HP4A 2ZNWA 1VB9A 3T3MF 2O92A 2GT9B 2R0KH 1CICD 1RIUL 1SY6A 4UOW0 3QH3A 2E9MA 5IJKA 1MEXL 4KKBD 1CFBA 4UZSA 3BISA 1D5IL 3C5ZB 4Z8FL 5IHZB 1G5AA 4PGDB 5FYJD 4LLVB 5C08D 1MCOH 2AAVA 4LPTA 1B2WH 2Q7YB 4KDVA 4ZSOE 1FVDA 1IQWL 5D96C 5DRNB 3S96B 3AREA 3ARDA 3BYTA 1D5MA 3FQXA 4E41E 1G6RB 3QUYA 5D9SB 3CHEA 2NY4D 3AS2A 4G42B 4K7PH 3V0VA 1SMDA 3UTPD 1BP3B 1EGJL 3VXSB 5GJSH 4XPFL 2AV7A 1R5WA 1Q0YL 2E6PA 4XNZB 4XVSL 1JPSH 4FNLL 3RDTA 4XAKE 4BZ2L 2FB4H 4WI7A 4GW5B 5ILTL 1KB5H 3SJVE 1LK2B 1JMXA 4LASH 3UTZB 1J8KA 4LCWB 4LARH 1XF5B 5MENA 2BNQA 2CKRA 4DKFL 3EZJB 5C0ND 5C09A 1LL7A 4X6CE 3QDMA 3H9ZA 1E0OB 2W0LA 3CK0L 1BJ8A 3DECA 2C4FT 1I9IH 4P3CL 1PX3A 5DJ2B 1QRNA 4RE2A 1XHGA 1ONQA 1ES0B 1YMHA 4P4RA 5C0BD 5BZDB 3MLUL 4GINA 2AK4E 1B6DA 1ZHLB 1YPZF 1A7QL 5EBWA 1LDPL 2BERA 2DICA 3VWKB 2AEPH 1KB5A 1CD1A 3MRHA 4QFUA 3VIJA 4NNPH 1W9XA 3N9KA 2PBOA 4XVJL 5DURB 5E9AA 1ZHBB 4UFLA 2X4UB 1HWGB 3EFDH 3WMSA 3KZSA 5CILH 3RFZC 4ETYA 3NIGE 5EU3B 5KSBE 1G7MB 5D7SH 5EA0L 2XVKA 5IROA 1BAGA 4HIHB 2GY7B 1XD0A 5EU6D 3BVNA 1T22B 1KULA 5I8KL 3VRJB 3QI9B 1JNJA 4CKQA 5FUCE 3L3IA 3EJSA 1VACA 3T3ME 3MRDA 1NEZB 4NNXB 1V6UA 4R7NB 2HTLD 2X89D 4P57B 2E8ZA 3P73B 4M7JH 3OR7B 1CU4L 4GAJH 4XC3H 1J18A 2XKNA 4ALAL 2GJPA 5KS9E 2WCGA 3BZEB 2XICA 2V6HA 1OF2A 1SYVA 3T0XA 2AEQH 2AXJA 2YPLE 4Z0XB 3ZYIA 2NT1A 1LE5A 1UR9A 4MYWB 4Z2LA 3VM7A 3QHOA 3BGAA 4MNQB 3RIFF 1TZHA 1AXSB 3RA7H 4GG8A 2VH5H 2QMKA 4JCMA 4GAGH 3H7LA 1NBYA 1MFBL 3JVGC 4TSCL 1QSEE 2PXYC 2J8UE 4ACYA 2I9LB 2JB5H 3MLVL 2GJJA 5CINL 4TUFA 4GJTB 1F02I 1VGEL 3L6FB 4NM8L 2Y5TA 3HPLB 3MRFA 5F97E 1RD6A 4EI6A 3RDTB 1QBLL 4NT6A 3ZMRA 4KVCL 5F6HI 3S6TA 2AV7B 4Z5RA 3WJJC 1FHGA 1KJ2H 5TDOB 2ZP0T 1TJIL 1BJ1J 2VH5L 4QOKD 2ZCHL 2IH3B 1CFTA 2FO1A 5IEHB 1X4ZA 3G04B 4L9LA 3S34H 1S9XB 3TZVC 1HXKA 5FCZA 4GRMA 4M4RA 3GHEH 4XAKD 3S35X 3MLWH 1FBIL 2A0LD 3O4LB 2O9OA 3MXVL 1FVDB 4GIAA 2FDMA 3T0AA 4XC3L 1KR0A 3DHUA 3HZVA 4NQEB 1CG9B 2EKSB 2X1PA 4P59L 2WWCA 3SDCA 2GEEA 1RUAH 1CE6B 1CVSC 3SKJL 3TIEB 5IJVB 4JPWL 4ZUTA 2X1XR 1DUZB 1RFDH 5C0BE 5DD6B 1I8IB 3L5WB 1F5WA 1MPAL 4YQXL 5C86A 4NSKA 1A21A 3N85H 4OCYL 1GOKA 4KROB 1B9ZA 2OL3H 4HIEA 5AZEL 2Q76B 4HUXB 4ODTL 3F12A 5J56B 4JO3L 1XCTB 1UASA 1N8ZB 1NSNL 2IQAB 1NOWA 1U95B 4QHKJ 2ZWLT 3LQZA 4OCWL 4Y8DC 4F9LA 1JYNA 4R97B 1X1NA 3O9WA 3LN4A 1OTSD 35C8H 4CADB 4M5YL 3OJMB 4YGAB 1CGUA 3CXHK 4EXPX 4OCLC 1I3RB 4TVDA 3ETBF 4Z2IA 1HXMB 4HK3N 3VDBA 4BQ2A 1MQPA 5IQ7L 2X7LB 5DQ9B 4J1UB 1QA9B 4O51B 4D6GA 2YUXA 4ZUUB 2V2WB 3O3AB 4MDOA 4HS6B 3T3PE 4L8DA 4MXQD 2PWHA 1Q38A 1G7HA 3NABH 5IVXE 4KRUA 2AJUL 5DUPH 3EBVA 4V1DB 4OOZA 4OZHA 3PE9A 3UTSD 3QDGB 1SMOA 3BN9D 3LPPA 1BBDL 1S9YB 3ZO0A 3AS0A 5IQ7H 2X1OA 3HZKA 2Y36H 1EDTA 4UUJB 5EH1A 3DX7A 4HZ8A 1C8YA 1PKQA 2UZYB 5C2BH 1WWCA 1AJ7L 3U0TB 2FL5B 1DUYB 3D3VA 4YDVB 4Z2GA 1RJCA 5GRWA 2J8GA 5HGGS 4Q6YA 5IB4A 2XWJA 4UTFA 1E6SM 1MQKL 3GKWH 4PG2A 5LAXB 3BDBA 4RMUA 1EV2E 1VEMA 1LEIB 1L0QA 3HNSL 4MQ7A 3PWVB 4PJBE 4MJ4A 2PI6A 4J3SA 1HVXA 3QIUD 1YYLL 5DHVH 1Q94A 4PY7B 1WDQA 5C3TA 4UBDC 4LCUB 5IBUG 1GIGL 5AEAA 1NCWL 1EHLL 3DMMB 3MUHL 3OKMA 1U8JB 5IKCB 1R75A 3HG3A 2UWEF 2NX5A 1HHGB 3ALWA 4O4YL 4RSVA 2DQXA 3AU1A 4ZOBA 1Q4NX 5ETUB 1BQHB 3MA7B 1DQDH 5DMKA 4XNXL 1FE8L 1JGUL 3IETB 5CKAA 2R69H 1MJ8H 1PSKH 1AO7D 4LHUD 5CSUA 1OD9A 1ZK9A 4HG4J 1YEHL 1KELL 1NM9A 4Z7UF 5J13C 2P5EA 4JFED 4ZUWB 4IMKC 4Y2DC 1KCVH 4Y4HB 3D2UA 4C54A 1DBBL 3N12A 3BPOC 3QUXB 1BX2B 1G9MC 5E95B 1V3LA 1RUAL 4RMTA 1U41A 4NZRL 1MF2L 1B4JL 5T1KD 3TJEL 1H0DA 1Z9SA 1NCAL 2BDNH 3N1AA 2VLJD 5CHNA 3L5XL 3U83A 1O7SA 2UY3A 3I3BA 4NYLA 1KG0B 3LAFA 1BIIB 1I3VA 1Q1JL 2PO6B 3O6LL 5J6HA 1TQCC 1JPGA 4KTDL 5I0DA 3MLWL 5ABHA 3KPPA 3MJ8A 4OAWB 3FQWA 3DI3B 1YUHB 2JJTA 3MNVA 2ZSWA 1C12B 1JGDA 3W25A 1FFPB 4OFVA 3GXIA 1BQHA 5GZNC 2OTUA 1LNUA 2CRIA 2L0DA 4GKSA 4OZ4B 4TVPH 4R26L 5CWSB 4PJXB 3H54A 2MSPA 2UY6A 4WI2A 2AK4B 3VXNB 3T8XA 4HPOL 1KPRA 3QIWB 4FLSA 2Q8AH 2MJWA 4OV5B 4FABL 4FQ1L 4NQVB 3QUZD 4AH2A 3BH8A 3MCLL 1JGLL 4JO4H 1AQKH 3OJVC 3FB5A 1EFQA 3ZQ9A 1W9DM 3F6LA 3OB0H 1AGBA 3ARYA 4RNRB 3LPWA 4GAGL 1G84A 1KBBA 3OKKB 1OAZH 5C0GA 4GKOA 2LAAA 3LCYA 3ULUE 5E8EB 1NGZA 3JWOC 3SDDB 3RY6A 3WNKA 3SPVA 3S8WA 3CFJA 1T0MB 3IFPA 4DZ8B 1U3HB 4WK9A 2YPLA 5D7JA 4HOZA 2A9NL 3CMJA 4XPBL 3QO1B 3N06B 4WY7L 5F1NA 2HKHH 1NJ9B 4QTHA 1VJZA 5FA4A 2XZQH 3IRZA 4F15B 4CN1A 4XUYA 4ZQKB 4HPYL 4R2GC 1PZ5B 2X09A 1JK8A 4H25A 1AQDB 2Z8VC 1MCEA 4RZCA 2XNAB 1ZLVK 3IVKB 4XC1H 5I1IH 5L2KE 3SKNA 3RIKA 2GJ6A 2R1XA 1AQ0A 3JZ7A 4OF7A 3T3PF 1FNAA 1XT5A 3MRLB 4XGZA 3S36H 4OLYH 3WEOA 4JY6A 4QRRB 4JFDA 3MA9L 1ZS8A 2I24N 2CD0A 2FDBP 3BKJL 2R56H 3T04D 4NKOA 2WZEA 5BXRA 3W9EA 3ZT5A 3WHE0 1I1YA 2UVEA 3EJUA 3QEQD 3U7WH 4FQLL 5IHBA 4C83B 4AEEA 2D24A 1G0YR 3AS3A 4PB0L 3EJZC 5FHAL 5IFTA 4PREA 1G94A 4RX4D 3SE9L 2BDNL 4KQ4L 1YN6B 1LDPH 3MANA 4O02L 4R4FL 3FB6B 3PGCA 4JRYA 3MV8A 5C6WH 1T89A 2VX5A 5FYJH 4F8QA 1XF2B 2HH0H 4X4ZA 5FFLA 1TJGL 3P4OB 1BM3H 2W61A 3GJEA 4DAGL 5K9OA 4P3DB 4N68A 4DZBB 2YDQA 1IQWH 2IPUG 4FQHA 2ZOKA 1D5XA 1RHHB 2AABH 4DOHE 4W7UA 4H88L 4L3AA 3SGJC 4LRIA 3VFWA 3KWWB 5FYJU 5IJVA 5EPMB 1MJ8L 1U8KA 4LPWA 4GRLB 3WDJA 4Q7NA 1DBAH 4P49A 2VQUA 3MGTA 3SDCB 2ZOXA 4XH2A 2YRZA 3CLFL 4W8AA 3T0VA 4DK3A 1GGBH 4GQRA 4V2XA 2XIBA 1QFPA 1JGVH 2NXYC 5D6CB 1CQKA 3QZWB 4W4OA 2EDTA 1V7NH 1PS3A 5I73C 4HHAA 2D7PA 3QBTB 2P42B 3HI5L 3DPBA 5BXFA 4RFNB 5A69A 1OL0A 2Q20A