1OT4A

Solution structure of cu(ii)-copc from pseudomonas syringae
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Strategy for the NMR Characterization of Type II Copper(II) Proteins: the Case of the Copper Trafficking Protein CopC from Pseudomonas Syringae.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Metal binding protein
molecule keywords Copper resistance protein C
total genus 7
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ot4A00
1LYQA 1XEUA 2OMZA 2WQWA 4CC4A 4CC4C 2OMWA 2Y5QA 2OMXA 3BCFA 2UZXA 2C9RA 2UZYA 3BZ5A 2RA1A 2WQUA 1H6TA 2WQVA 2OMTA 1M42A 2C9QA 4CILA 3BCDA 1O6TA 2OMVA 3FAXA 5ICUA 2OMYA 4AQ1A 1NM4A 3BC9A 1O6SA 1H6UA 1IX2A 3FAWA 1O6VA 2YA1A 1M9SA 1OT4A 2C9PA 2OMUA 2WQXA 4AW4A
chains in the Genus database with same CATH superfamily
1T0MB 4RESB 1VB9A 5IMOB 4NP9A 4Z6AT 4EN3D 3SPVA 1ERNA 4PTUA 3MLVH 4AGMA 4GXVH 5IEHA 5AVUB 1UD6A 4JFFB 3J7HA 4OT1H 1PMYA 4HWEH 2R29L 2NNAB 4AKPA 1SOXA 3OLIA 4P59H 2VDPB 1Z9MA 5KZCB 1ZLDA 4LEXL 2X6VA 5KG9A 4WEEA 2ILLA 3C60B 1GY2A 3X11B 3L3IA 4KV5F 4Y19B 3BN9C 5EWIL 3WJMB 1Q0YH 4NJ9L 1MFCH 2J72A 1DO5A 4I2XB 1SMDA 1QD0A 3P9LA 4Y1AD 2WO4A 1H5BB 4JCMA 3UTTD 2VLRB 1NGWB 2YUZA 1E7VA 4LCYB 5CEYA 2GUOA 1JWMB 4ZYKA 1MRFL 4GLRH 1K4CA 4GUCA 3PP3H 2B1AH 5TGBB 3FQYA 4WI8A 5H2BB 2GBUA 4JKMA 4J3OF 5LGHL 2YWZA 1KWKA 1MY5A 4PY7B 3SGDI 3ZSTA 2DM2A 5AAMC 3RGVA 4I7ZC 2BNQA 4OJEH 4F3FB 5J0BA 1CGVA 3OZLA 4H40A 3NSYA 4XXCA 5GZNA 1Y6KR 4O4YL 3NGBC 3IU3A 1RUKH 3HS8A 2EDBA 1QSFB 5I75B 1P69B 2JCWA 1OIOA 3K3QA 4M3HA 4NYLB 1WBXA 3U6RA 5C0JA 5D2LB 1X7QB 2QBWA 2FEEL 3O4LA 1L9QA 5EF0A 2GSGB 3ZTCC 1MCOL 1FP5A 1BP3B 3K6DA 4ZFGH 2XPYA 2ICEB 3JWNE 2RGSA 3H56A 3TA3C 1OD9A 1HSAB 4RDQF 3E7JA 2PW2A 4OZHF 4JR9H 1UQSA 5I0XA 4V1DA 4ZD3H 3CGTA 4OTXL 3BVNA 1OGAB 3CXHK 1IGFL 3I6KB 2Y7QA 1IAIH 1PG7H 4F15B 1JHKL 2OZ4A 2ISDA 4BJLA 4M8QA 5EO9A 2CALA 3BZEB 4RMSA 4TUOB 1AZNA 1KN2L 4Y2DB 4AQEB 5HJ3A 3U9PH 2AK1L 3IMWA 5T5FA 5FHAL 4TNWK 1IARB 2Z92B 4QHNA 2CKBB 3KDPB 4HV8A 1R24B 3EBAA 4E36A 4IGBB 3WELA 1IMHC 4MLIA 4NNXA 4ONHB 3WJMA 1TZ8A 1TQVA 2Q3ZA 4KOCA 4ELKB 4LSRH 1YNTA 4OLXH 4QJ4B 2JH2A 1HXMB 4FYTA 3VM5A 3QUZB 3HS0A 3PUUA 1P9MA 4C56B 1F42A 1U4EA 4LPVA 4N2CA 5SWZA 4C58B 4ANXA 1C16B 1OAKH 1YEJL 3WLBA 2BS9A 1UOLA 5JIMA 4PTUB 3BAKA 2XWCA 3BAJA 2I85A 2BY0A 3QNYB 1QLEH 1UB5A 3RAJH 3ECBA 2X1OA 4LNVA 3H9HB 2OBGA 4E68A 2OXHB 1G7IB 4K3EH 1OSEA 4QRUB 5FYKU 3QDGE 1FAIL 1JWSA 4BFFA 1AE6L 1KBKA 3VDCA 2FLRT 4M9PA 4KFMA 2Y2YA 1IBGH 1N0XH 5D1QB 4QRQB 5I1LB 2G4EA 3BQUD 2D7TH 5L88L 5J1SC 1HYRC 4OZFG 4GQ9H 3Q05A 3KW8A 3RTQB 2YGPA 5LDSA 1R3LA 3BI9X 4LCWD 4YDIL 3ARDB 1SXAA 4TN9A 4GFXA 4MA7L 2L7JA 2M8XA 3QWQB 4OBRA 4UNTA 1HESA 1WAAF 1DUYA 3PWLA 1QFWM 1DQMH 4H88H 3UPAA 2BSTA 1KJMA 4PJCB 4OF3A 3OAWA 3HS0B 1LWHA 3ESVF 1E9OA 5KVFL 1UWFA 2Y36L 3RPIB 1LLAA 1SFHA 3ULUC 5LNGA 3N55A 4NRYA 2QVKA 2DD8L 2VSCA 3CFQA 2C3VB 4O9HL 3QDJA 5HGBA 4DZ8B 1E2WA 5TK2A 1GS8A 5DFVD 4MJID 2VLLA 2IADB 1DQJA 4E9WA 2O6FA 2QQNH 3H9SE 3M45A 4TM9A 5DHXB 5E03A 1E9QA 2P24B 2YEVB 4Z7QE 3OJDA 3T0WA 2J6EL 4NUGH 2IPUG 4Y1AE 4M7ZB 1X5KA 1I7RB 4EEEA 2ZUTA 3ZDZF 3DXAE 2VDRH 1E4HA 3NN8A 4GXUN 5C6TL 1NJ9B 2X53A 1MFEH 1OARL 4XC3L 2FUTA 1DVFA 2ZX6A 3L2LA 5A7EA 1VGKA 5F89A 5J11C 3UDWA 5C3LD 1TVHA 1DTUA 3MX0A 4QRFA 5ADOL 4JRFA 4P4KD 4KMTH 5DWUH 4NDMA 5G4NA 2EDXA 4LKXB 2IAND 3QZNA 4MJHA 5TPWH 3RVUC 3U0TA 3ZOAA 4JN2B 5CXPA 5BRZB 1XGUB 1HYSD 1XAKA 2DKUA 3HC4L 2DPKA 4G1EB 2BERA 4W93A 2C3WA 3ARDD 3PWNA 5DUMH 3WKML 1F4YL 3RL1B 2YHGA 4EZKA 4ZFOA 1CFNA 1EHKB 2IXQA 2XWRA 3LRSA 5E7BA 5CFAA 1KELH 4GKSA 2OL3B 2UZXB 4FNQA 3GQFA 4OCNC 1R19A 1ODUA 1G7PB 4YHNA 2JK5A 2BNRA 1NGQH 2AF2A 4NOBA 4AKOA 1NCWL 2QPDB 3H55A 5AL0A 1MG3C 2KL6A 5DZVA 3DGDA 3L9EA 4XNUH 4NKMB 4FKHA 3JV4B 5I1LA 1A7RL 1Q9WA 2H1XA 3BXNB 1TO5A 4JDZB 4IRJB 2L8AA 3ARSA 3LB6D 4FG6C 1PDKA 2BS8A 1GL4B 3HN8A 4GRMA 4ZUVB 5LN4A 4AYFA 2PP7A 1TU2A 1TQBC 2XZQH 4BWUA 1UYWL 3KGTA 3NN8B 1NGWA 4WI4A 3QEGH 4BFIB 1SYSB 4KFZC 4QRRE 3ELAT 5FCUH 3U79A 1BPLB 4WU5A 2X10A 3RVTC 1FBIL 2DQEL 1ORSA 1DANT 3WKNA 4PVBA 1EMTL 3P11L 2EXWC 1OF2A 2GUYA 1FRGH 2HT3D 1KCKA 5IEKB 1VACA 1WP6A 1CIDA 2AV1A 2ENPA 1LDPL 2YPKB 4O02L 5DJDB 4C4BA 3UMNA 3QIUC 5H94A 4LASH 3WHE1 5DVKA 4EUPG 2JKIS 3D39D 3L9RA 2Z6FA 4PLOB 1CK0L 3SQBB 4QYAA 2A6JB 5HVWA 3SPVB 1NBYB 1UJ3C 3DOIA 5ENWB 4HG4K 1D5ZA 1TIUA 1PU0A 3SCMA 3GS0A 4JPVL 1X9RA 4K3DL 1BF2A 4JVUA 1RHHB 2TAAA 1Y7VA 5T1KB 3AS2A 3OKEA 4WI0B 3SBWC 1PD1A 4YXKL 3T2PA 3O3DA 3QJSB 2BX5A 2HRHA 2UWEE 1J10A 3MBWA 5SX4H 3NYKA 3OKKB 4NQVA 3RA7L 4P2RD 5F44A 4LU5L 1XZ0A 4JLRB 4LSRL 4OLXL 2FDBP 4OLEA 2QGDA 5FFOA 1T22A 4K73A 2XWDA 3T8XB 3K2UL 3IGLA 1D7BA 1LO0L 1IC4H 2EDMA 3GRWL 2X4PB 5TQ0L 4KUZL 3S9DB 2XN9A 4QLRA 5DQDL 3EOTL 2W95A 3OZ9H 1AGDA 4X4XA 4IBTA 1II4E 4G9FA 5F7AA 3RZCA 4JFWA 3MZTA 3WMPA 2X7LB 3HIZA 4OZGF 1CN4A 5GJSH 3V52H 4FAAB 3K6SB 3BSHA 4HPHA 3LIZA 1K5NA 1F4HA 1P5UC 1F0LA 3II3A 2NX5A 4NC1C 2DEXX 1NFIB 4M7LT 3JZ7A 4Q9QH 5E9AA 4R96B 4JDVA 1N59A 3GSQB 1SQMA 4YSOA 2ZSWA 3BDYH 2OPCA 4UILH 1FORH 1X7QA 4WGWB 3WIIH 1MZYA 3FH5A 1IFGA 2V2WA 4HGWA 2VC2H 2VQ1A 2W60B 5DI8B 3EO0A 3QXAA 2DEYX 3IKCB 3ALPA 2WZ5A 5HYJB 5L9DL 2HCZX 1BZ8A 2Y07L 4ENZA 5C86A 1FG2B 4AEIL 5A43C 5DJCA 4JHUA 1LWJA 1P4IL 3DJ9A 2QMKA 4KC3B 4AJYV 4JM2C 1DO6A 3VCLB 3IMSA 3VXTB 1YMMA 1W72H 5KBKA 1ZD6A 2YEQA 4QXGL 1OCWH 2JKTM 4ES8A 1MREH 2ZKHL 5L0QC 5ESQB 1H3PL 3WE6B 3NIGE 5DJ6A 1MKFA 2AABH 1QBBA 4G80A 4L8SA 4PJEB 4YX2L 4GRMB 3HG0A 5JIDA 3SJVA 4LGSB 3X1GA 2BW5A 1WWCA 2IWKA 2RFXB 1V55B 2P44B 5MP6H 1G94A 2PWEA 4PSPA 3HKZA 4K7PH 1OT4A 3SDDA 4PJ9A 4OVVA 1UCBL 3A47A 3T3MF 4PM1A 3V0AC 1LO2H 2FBJH 3PWJA 1HCFX 3LH8A 3DSFH 4FEIA 3BLBA 4XE5B 2IXQB 1JV2A 3IGUA 3ZTJH 5CUSH 4IKKA 5BRPA 4DOHB 1YYCA 1YECL 3NJKA 5E99L 1XBRA 4K7PX 4DEWA 2HFEB 4GEJA 1NMAH 5EIIB 1FFPB 4PRIB 3PAVA 4NQCB 2DOCA 2JXMB 3BQUA 3TH2T 5C09E 1T6VN 3V5KB 2HUEA 1U42A 2BMKB 4NRZA 1SLVA 3PDDA 2IGLA 1RUPL 2D3NA 2UXTA 3E6FB 3KEHA 4P2OB 4UF7C 1DN2A 4FFWD 4NLAA 4Y4FA 1JNNL 2YAFA 4U7SA 3QQ9D 1Z9SB 3G5WA 3FF7A 4KPHL 4WNJA 1IIKA 2VNCA 5FDWB 2VSDA 1YMHA 4NI3A 2ZCKH 3D2TA 5FYKL 15C8L 5EOTB 3REVB 4OAWB 3ZTNH 1INDH 2CG9X 4FLOA 5CJ5A 4EE2A 4D9RE 5JIHA 1TJHL 4A2MA 1E4XI 2B9BA 2CGYA 3NPSC 5CP3H 1KBGH 4OB5H 4H1LA 3VGHA 3X17A 1WBYA 2EDFA 1X5XA 3HCVB 3FO9A 3UO1H 5LJYH 3MQIA 2WK2A 4K9EH 4R5VA 3IPEA 1XGPB 3EHBB 5K93A 4YWGH 2XWTB 4P49A 3VI3A 3HZKB 4LLUB 3TONA 4JL2A 3N2JA 3QRGL 5IEHB 2B3RA 2L7QA 5CLXA 5HDRA 2XXFA 4QR7A 2XXGA 2GTWA 1QUNB 1YEHH 1KTJA 3OKNB 5I0DA 2JJVA 5AAMA 4Y16A 2RALA 3B6SB 4RBPH 1MRDH 3KYNB 1T3FA 3RHWK 2N0MA 2IANA 1M6OB 1P9MC 1KGXA 1TQBB 4AJWA 4GAGH 4JHWL 4QWWD 4G71B 4TLTA 4EN2A 2Q7AA 4WHYG 1E0OB 4G8EB 4GSRA 1BD2E 5DEFB 1DJHA 1LVEA 2VC2L 2GHWB 3B2UD 2XCMC 5DLML 2J12B 2YGVA 3WTXA 2R15A 4UQCA 1B88A 2UVEA 3GYRA 4WENB 4KHTH 3V79C 1RHFA 4AUJA 3FB5A 4CNIB 3ERXA 3H2WA 4X99A 4L4TE 4PJAA 3C8KB 1I4FB 3MCYA 5CJXA 1M05B 2SEBB 1ZA6B 3ARFC 3DYPA 4QHMB 4AM0B 4E2OA 5CP7B 3QRFM 3BC9A 2CO7A 1C8QA 1F4WH 4FXGC 1WUNT 3ZMEA 4OZHB 3QWOA 4GMSH 3I6GA 3N40F 4HULB 1YAIA 4APQD 2OMUA 3QUMB 3EBGA 1SHSA 4WTZA 2KQMA 4LU5H 5I8EA 5CMAA 3CU7A 2FE0A 2Y69B 1NAMH 3QULA 4IBYA 2XRAL 1O9VA 1N19A 3D85A 5FFLA 4KUZH 3CUPA 4AYMC 3D07A 3QEUA 3VD9A 1YNTF 1X5HA 3WL9A 3F7LA 1RFDH 1XQ4A 1E4KC 1NWPA 1ZXQA 1G84A 1AAJA 4MJ5B 4FZ8L 4EIUA 3SHSA 4OCRH 1EX0A 4RMTA 5AKSA 2OP4H 1ZTMA 3V7AG 4CSPA 3JUZA 1AO7B 2I9TB 3FB6A 4HYTB 1A65A 2MQCA 5FV1L 3TYGL 3GHBH 4U3HA 1ET5A 2Z8WC 4Z3HA 1D5BB 4AC2A 3IFPA 4GO8A 1H0DA 5KVDL 1U8CB 4DGYH 1NCNA 1XCQA 1WE5A 1C08B 1R17A 3ZE1B 3JWDC 2HJFB 2ZXCA 4TUKL 3S5LB 4Z7NE 1H5BA 1FNLA 1Y18B 3S3SA 3V0IA 1BWMA 1BAGA 4JHVA 1P5UB 1KB5H 3EJYC 1ACCA 1QA9A 1BEYH 4WI5A 2VIRA 5T33L 4NERA 2DQHL 1WCBA 4LEOB 1YEEH 3T6ZA 2FX9L 5AVZB 3LEXA 5AW4B 4L8SC 1AO7A 4FE9A 5ITBL 1GR7A 5KAQG 1SM3L 3ZKXB 4H8UA 2VXQA 4WY7L 2D0HA 3QCTL 5KYUA 1TTGA 15C8H 1AIFB 1KTCA 3FQXB 3HB3D 4N22A 3P2BA 5K39B 3QDMD 1O9ZA 1FZJA 5I71B 2X05A 4MMXB 4M5ZH 4R83A 3MLTB 1JHKH 2O26U 3EO9H 4FMKA 4GUPB 5EBWB 3DOHA 4YN3A 2NX5E 2F54B 5C0JB 2PP9A 2X89A 5F9AC 2WKLA 4MA3B 3S96B 2X2UA 5C08D 1ZGLP 5HDBF 3S35L 3KYAA 4ODTL 5CLYA 3FB7B 4XVUC 3S3PA 3FO1B 2DM4A 2VW4A 2ZCHH 1FHNA 2ZP9A 1BMZA 3QS2A 5F7MC 3V4LA 1D9KB 2C7FA 1LO2L 4CC4C 4ZFZB 1DQDH 2HMIC 1NWOA 2MPAH 4KKCD 4Y4FC 2XNAB 3SDAB 3ARGA 1A6VH 3TPKA 1M57B 4GNKB 4NOFA 3K1DA 3GRWA 3KDMA 1BVNT 4TQ8A 1INEL 1ZLVH 2YKLL 5EDXA 3B2XA 5A40E 4Z0XA 3JV4A 1OT2A 3DTXB 2PR4L 3GXDA 1U91B 5DCCA 3A3YB 4JK0D 2X4QB 2XKUA 1JWUB 3BPCA 4GP8B 3NEXA 4ZUSA 4XTRC 2Y72A 4ZUTA 1CLYH 4JRXB 5DMYA 5HGGS 4HPOH 1OAUL 4IGBD 1XH3A 2QQLH 4P57A 3OJ2C 4HXBH 4MQTB 1NLBL 5ERWA 2P5ED 2QL1A 1U8PB 2P5WB 3KLSA 3IAGC 1W8NA 1HWWA 1FNSL 2B3IA 3GINA 4YDZA 4G8GD 1FFNA 1QLEL 3QSKB 1NGYB 1GC1H 2GCYA 1LWRA 3V4PA 4HF5H 1G6RA 3MBEA 1J0KA 4X4ZA 1FQ9C 4OJFL 3WNOA 5GRXG 5DJDA 1TPXB 4HUUA 1WISA 2JE8A 1ZT1B 5DC9B 5DT1H 4Y4KC 2NZ9D 3KZ8A 1BA9A 5SWSA 1B3JA 5CJOL 4Y7MA 4DUXA 2IJ0C 4NENA 3VSVA 3I84A 1CT8A 4G8IB 5IHLB 2WQWA 3IFLH 5FCSH 4R26H 2DYPD 1PJ9A 2PYED 2D7TL 4QRTA 1E4KA 5L88H 3UYPB 3ZYOA 4PV9A 1VFBB 1H3UA 2YXVA 3NRQA 1M7DA 4HZLA 1E2ZA 1I8IA 4YDVA 1DEEA 4I1NB 2HX9A 5B22A 2AK1H 2IH1B 2NRDA 1H0DB 3D4YA 4FG6D 2KMWA 3O3AB 4XMPH 1AOHA 2DMHA 2PPAA 1NM4A 4AKQA 2ZOUA 3WTVA 1INQB 4F80A 4UDTA 2PKDA 4ALAL 3TJHC 1FNHA 4R7XA 4XMUA 5CJXC 3ESPA 4AJVA 4PRIA 3JTSB 1IC5H 4K8RL 4ZUUB 4L3CA 4ZTPH 1KEGL 1EO7A 2F53E 1K6QL 1UC6A 3CXDH 1A4AA 5JHAA 2GBTA 1S6NA 1MRCL 1ZOXA 3FZUD 3PWLB 4FXKA 3IFOA 4Z7QF 5JUEH 2F8VA 1T5WA 1ZJAA 2NCMA 4KTYA 3HE6A 2IAMD 3DSNB 1S9XB 5GZOD 5AYUH 4XCFL 4OZHA 5EN2B 3WD5H 1JZ3A 1MHHB 4PGEA 4MS6A 2CJUH 2Q76B 1AZBA 3INOA 3VGBA 1NUFA 2HFGH 3IDNA 4WW2A 3CC5A 2WCPA 2AQQA 3BH8B 1U2YA 3IJYB 1WC7B 2LV4A 4PJEF 1E5AA 4N0UE 1U3YA 5CEZL 2IG2H 1G7LB 4R0LA 1WH0A 5CZXC 1BBJA 3VI4A 1X9QA 4BA8A 1EAQA 4QEGA 2F9BT 4YUEL 4X83A 2AXFB 1ZTXE 2XKNA 1KYOJ 5DRZA 5CZVL 3QHFL 5DLLA 3LRGA 5ACZB 2OMTB 3FRUA 4C56A 2EYTB 3DOSB 1QQDA 2XTJE 3PQYE 2WWNA 4G6FD 4OGQC 4YVUA 4D8OA 5GZOC 5I6XC 4M1CD 5KW9H 3EYOB 3SZKC 3C09B 5JHLH 3O8XC 3HZKA 4LLUA 1J0ZA 4KMLB 1A4JB 4GOSA 2Z4QB 3MLWL 5B1JA 5D55A 1MH5B 3EH3B 1TTBA 3UTTE 3O6KL 3T65A 4QRPE 4KO6A 3BP7B 5BMFH 1FE8H 4FA6A 1JPFB 3MUHL 3L3KB 4W6XB 1JGVH 2ARJA 2A9NL 3P3SA 4WY7H 1KN4H 1Y0LB 4GKOA 1A6WL 4UT9A 1PZ5B 4LO9A 3WEBA 4B0MB 3BP6B 3V55A 1XMWA 3KDMB 3OHMB 1KYDA 2WANA 4GSQA 5IBLC 4QRPA 1I1AC 3G5XA 1UXLA 3EO1B 1MJUL 3P11H 3SDXA 2EYRB 4S0HA 5CJQL 1BFVH 3RI5F 2OMBA 2R0LL 4P23B 4LLQA 5SWSD 4L9LB 2C9AA 2WVVB 4ZX3A 4NAMA 3D85D 4XPBH 4ZFQA 4WTZG 3EIFA 2PETA 3Q6GH 5EU5B 3DSNA 4YHKH 3GKZA 3I2CH 1KLFA 1U2HA 4LK4A 5GSRA 1MCLA 3GMNA 4H7VA 4ZOEA 3VMOA 4DQOL 2BLFA 3HC2A 2O5XL 2VISA 3D39E 4W9DC 3IETA 5SX5H 1HQ4A 1IC4L 1J8HD 3GRWH 4U33A 2R2BA 2G3XA 3B2UC 5SWZB 3Q8EA 5SWSE 9PCYA 3RFZB 3GHPA 4TV3A 1IGIH 5HI3C 2BZ7A 3UFIA 4DW2L 2DLGA 3S2AA 1O9WA 3L3HB 3F7RA 1ZJBA 3BPNC 3LD8B 5GSVB 3L9YA 1ASOA 2IQ9L 4GAJL 4M93C 4AYID 1CD9B 2BVPB 2IGTA 2PO6C 1I3UA 2ZKWA 2BVTA 5CINH 3HE7C 4F58L 3HS0C 4WU5B 4AQZA 5ISZB 5A2KH 3DROB 3NJLA 3ROOA 1E90A 1IBZA 2KZKA 3APMA 5FYKD 5CZRA 3M86A 4IIZA 2XXMB 5HYSG 4UANA 1J86A 1RUML 1X6LA 3RL2B 4POYA 3KM1A 4PIRF 1AP2A 2A9MH 1MNUL 3PXHA 2VDOB 3Q9QA 5LB1A 3LZFH 3WNIA 3AQXA 3VAEA 2GC4C 2XVGA 5DJ0B 4OW6A 3BDYL 2UX7A 3A22A 1CDCA 4RAUA 1VEMA 1ZAGA 1NCAL 5GHWH 4MJ5A 5TF1H 4HX1A 3CFIC 4RFNB 1DZBA 3RIFK 3PWUB 2NLJA 3KW7A 5I17B 2VR5A 2PO6B 4L1DA 1OCRB 1FVCA 3MRIB 2UZXA 2WLYA 3GSRB 4HCGA 2P8PB 2VISB 4UQ3A 4WK0B 2R2BB 1JNNH 4K3GA 4NJAL 4H44C 3FQ4A 4OFQA 4JGNA 4JPVH 3EDDA 1W72L 1F90L 1AXTH 3FAXA 4GIOA 3EOBB 3DXAA 3ZE0E 4F7MB 4ZW3A 3KLQA 2BSRA 2VMJA 4PPTA 3TZVA 4JN2A 3IU3B 4L9LA 4G9DA 3TVMD 1ZT4B 4MA1B 3W5NA 2WJ7A 1S8DB 1RPUA 3VXRE 1P7QD 3VWJB 2OS7A 3WFHB 1HI6A 3HAEG 3U7YL 5E08H 1V7MH 3DX8B 2KZWA 2N0KA 4TTGA 5EB9A 3DECA 3DO7A 1KBPA 2R1XB 5GGSB 4YDLB 5JW5B 1IFHL 4X8JB 5F7BA 3MRCA 5I0VA 3V6OA 3DRTB 4J3VA 1KXVA 3S88L 1NCGA 2CWRA 3DA0A 1ZGLA 4TLKA 4YHOL 5AW0B 5IK3B 3UJIH 1EJFA 4ZW8A 2Y1VA 3NZSA 4HSQA 1FZOB 3QNXA 1UD5A 5BO0D 1Q9OB 5D6CB 4W1TA 5KYWB 3UZVA 3D25B 1J8KA 1RULH 1WWBX 3GGWB 3OKDB 1HNYA 3HLKA 5EORL 2W0KA 4KK9D 3IGAB 1WFJA 1RZKL 3H85A 4KXCA 4XWGL 5F6IC 2CE6A 4W9FC 3SOBH 4JFDA 1P4LA 4N2NA 4UTAL 1EZSA 3V4VL 2Y2TA 3O2WH 4N2DA 5FUOH 3VSTA 3WS6A 3QDGD 4LIQL 1GGCL 2B5IB 4FL4C 3F7KA 3JWDH 5I26A 5L2KE 2UY7A 4NQSB 3MRBA 2NY7L 2D8KA 4GRLD 4XC1L 5HJBA 1BIHA 2GITB 1ECYA 5HDQL 3F12A 4FXKC 3SKNB 4R4FL 4HZAA 4Z0BL 5I19H 4PS4H 4PG9B 3NH7L 1S7SB 3QQ4A 5HHQB 2FB4L 1F41A 4WO4A 4B5EA 4X8JA 3WNMA 1EDQA 3C87A 3OF6D 5EHFA 1L5GB 1OPGH 3L4ZA 3FN3A 3DX8A 4BZ1H 3QZBA 4J8RB 4TTDC 4KTGA 4EI0A 1L0YA 4QO1B 3CFJA 2ZUVA 1S9YA 1WTGT 4NO2B 3HMXA 4GYBA 1J5CA 3GSWB 4OZGB 2HFTA 4XAWH 4LSPL 2ED9A 3AU1A 3CHSA 3MYJA 1QLFB 1IGYB 4DP0X 3IS0X 2Y6SD 4U6XB 3REWA 1AOZA 3LPPA 3P0VL 5GZOA 3QR2A 3GKWL 4XPHL 4N0FB 1IFRA 3FQWA 5HHOE 1G7HA 1NICA 2QFRA 4JHAH 3HNTL 1FFQA 1VEOA 2EDHA 3BW9A 2XQ0A 2NXYC 3CZSA 3OD3A 3WG7B 4FOMA 1IEBA 3SKMA 1NIEA 3EH1A 4A04A 1ICTA 1A22B 1A14H 2ICCA 3S2CA 4ELMB 2ZP8A 4O02A 4POZD 5ICUA 2H0PA 1AD9B 2G2PA 3NP3A 4WEBH 3LNEA 4JFPB 1YLBB 1QUPA 1GJWA 3H7LA 3O2VL 5KVEL 2MRYA 5E2UL 3VXUB 1MFDH 3VNZA 2CA3A 3WY4A 1KCBA 5D6DA 5F9OL 2WXMA 5KSUB 4MKTA 2MQGA 4P0DA 4EI6A 4WO4B 2OQJB 1FL5B 3R4DA 2J44A 5ANHA 2NXYB 5J6SA 5I6KA 5FGBC 5HI4C 4YWGL 4GQ9L 1FV1B 5I66B 5SWQB 4PGBB 4JB9H 2BY3A 1IC7H 1CGTA 3OQ3B 1OP5H 2P52A 3FDWA 4AG4H 4JM2B 1I1AD 1NL0L 4JRXD 5E8PB 4CMMB 3S35H 2LU7A 2CCWA 4HHWA 1BECA 1ZLSH 2UY7B 1S46A 3CSYA 3A6OA 5J9PB 3QJTB 4QNPF 4LOUD 5GS1A 2ADFL 1CC3A 1R5VB 3O6LH 2YSTA 1EFXA 4PRDA 4A37A 5HYFA 4HETA 1N2RB 3FTZA 1MAKA 1RKRA 5M7QA 2K3HA 5FB8A 4E5XG 1KPRA 1BVLB 3VD4A 3NVQA 4DK6A 1NEZA 2AHIA 5BUPA 3EJZC 4L4TA 4M1GH 4GW5B 1DN0B 4N0UA 4NZTL 1DCLA 4KHTL 3LPOA 1OOWA 1M7UA 3CNKA 1AQ8A 3L6FA 5JXEC 4BH8A 1HINL 2IDUA 4G9FB 2JV6A 3VXRD 1R1CA 4FTVB 3QA3A 2XT1B 4KWUA 5LHDA 1JL8A 4RAVB 1G6RL 2WLZA 5I8OL 3BN3B 4R4ND 5FM5O 3SQOL 1U3ZA 5DS1A 3JTTB 3MCLH 3IS1X 5FDWA 3WY3A 3SDXE 1L9OA 5E4OA 5G4MA 4X7SL 3EJJX 4ZFZA 4NN5B 4J39A 1AH1A 5E5MA 5B7MA 2XNAA 3SDAA 5CGMA 1LEGA 3U4KA 4NO5A 5I19L 4L3FA 4LPWA 4RNRB 1F18A 4GMSL 4TKWA 2BSRB 3TZVB 3SPIA 4ZXBA 43CAB 5IESL 3EDEA 2WC7A 1J18A 3EBIA 1QPKA 3ECWA 1A4JA 5BV7H 3DUSA 1RSYA 5K33A 4RFEA 5EZIH 1X6NA 2XVLA 1D9KC 1CFBA 4R2GD 3O2DL 2H5UA 2PXYC 1A7QL 2FZ3A 2YD3A 4N3TA 2MJWA 2CHXA 2C9QA 2Z8SA 3CFUA 4GG8A 4XMLH 4ZDHA 3T1FA 4JO4H 3PLYA 4IBZA 2XKNB 4GW4B 5CGYC 5AUMB 2RCSL 1AQDB 4QHUA 1TZHA 1SLXA 2V5YA 3E3QC 3H8NA 3D30A 1NIAA 1EV2E 5HPMB 1G9MC 1DFBL 3H42H 4NRXB 2QZ5A 4FTVD 5I66A 4WWID 4Y16C 5JHDB 3S5LA 2EEDA 3UROR 4OD1H 4DPBX 2B15A 3ZSSA 3MNVB 3O6FB 3JTBA 4QTIL 2APXA 1NDGA 2FEDD 1SYSA 1VFUA 4HALA 5AKRA 5D5MF 1PLGH 4U1HA 3PHSA 6TAAA 5KSBE 3BIAX 1UA3A 2H3NB 5LBGA 1NIBA 3LN9A 1PAMA 5TD4A 3VI3E 3UERA 5D96C 5E0QA 4FTVE 2EUVA 1THAA 1MDAA 1XSIA 2F58L 5DFVC 8CGTA 1L9RA 2VZSA 1KCSH 3HI5H 2PWHA 4LMQI 2HVKB 3GI8L 4LPCA 1UA7A 3PABB 2EIKB 1W2KT 1JZEA 5DK2B 3MFGB 2HLEB 3ZT5A 1AQKL 1S7QB 3SGJA 3QBTB 8FABB 2X9ZA 5DZPA 5GGQL 1KB9K 5JIIA 4Y19E 4JY5H 5ITFA 5ITFB 5I8CB 1P7HL 4JO3H 4MQXC 1CYGA 4PJDE 1SZNA 2NXZD 1CFTA 1OWWA 1OT1A 3KXFA 4DESA 4A6YH 1ZLSL 4ZSOA 3QWOB 4YPJA 1H3WM 2GY7B 2WQ8A 4OZFH 1NOFA 2VQ4A 3MNZA 4U1GC 5T1LB 5H35A 1TVHB 3MX0B 3DV4B 3U7AA 7PAZA 1LO3L 3PXLA 4PUBH 1BQHB 3KJ4B 3BGAA 5D1QD 3JWNC 2J5LC 4JM4H 1CI5A 4ZTOH 3VFSA 3ZPDA 2F74B 1LE9A 2LTQB 5BZWB 5MENE 5FIEA 5EDSA 4NQDB 4U1JA 4WFHE 1K72A 3BAEL 1AHKA 5CO1A 3QA3B 2GG1A 4X6CA 5TDPA 3ARED 1M2VA 1QI3A 2FWOB 3O6FA 4L3ED 2F15A 3UC0L 2VLRA 4X6BA 5JUEL 2OSYA 2DM3A 3MGAA 5EEWA 4PV8B 1W9XA 4E41A 4JANA 3OJDB 2VW7A 4EI5D 3CXDL 3QFJA 4M5TA 3SQOH 2XZAH 1B4LA 2EYSA 3C60A 3X11A 2YQBA 3FCBA 1G6RB 1ZHKB 2I60H 1CB4A 2P45B 5K9JL 4ENEC 3GMOB 3BKJH 3MLRH 3QC5X 4M6ML 5E6IB 3MKGA 3RIFF 4NJ9H 1I9IL 4TLUA 2D2OA 4G8FB 1W6WA 3IBEA 5CLWA 3KLHD 4IQHA 3Q2WA 4L0YA 4HS3B 1BOYA 4OGZA 5C0BE 5HYJD 2ODHA 3I75A 3EGSA 3ARFB 2BPBA 5G4OA 5FKPA 1H6UA 1QEWB 5CKAA 3KYOB 4U0QB 7FABH 3BIKB 2GABA 3VJ6B 4XWOD 1YEDA 2BCMA 1BYOA 2NXZB 5F6HJ 2WLNA 3AREC 4OF6A 4F37K 5C9JA 2GBVA 1GYAA 1NGZA 4O5LL 3GMLA 1K2DA 1IVTA 2QKSA 1YMHB 3APNA 1XH0A 2LOEA 3AY4A 4PWIA 4MNQD 4ODXB 5KJ4A 3HG3A 4GSXA 5D7LB 2AK4B 3PDOA 3MXWL 4H8HA 3VRIB 4K3JL 2RQ8A 2VLJA 5IHZB 2XTLA 5HPOA 5LGJB 4K7PL 3P30L 3MRGA 1MXDA 5E6UB 5MENB 2GJ6E 1CICB 3QUGA 4M3JA 3T0DA 2NXZC 4IJ3B 5IBUB 3QQDB 5FYJH 3RWCA 3AB0C 4AW7A 2ZD0A 4BUHA 4JFOB 1U3NA 2AW2A 4MX7B 4I77L 4FZEH 3LIZH 5DQ9A 3CFTA 3FUHA 3UTOA 3L48A 4K55A 3SBQA 3HZ3A 1G5AA 4MAYB 2NTSP 2FHCA 3RWIB 2AFNA 2A9AA 1IBGL 1N0XL 4UDTB 1V3MA 4N2GA 3MRKA 2VN5A 1OTUD 3ULUE 2ZXDA 2V5TA 3KPRA 5DVOA 2QV4A 2VRAA 4NFCA 2XU9A 4OIBA 4EOWL 4CKVX 3O3UN 1I8IB 4YDVB 2XQBL 3U4AA 1CS6A 2ESVB 1ZT7A 4LGPB 2CUMA 5JPNA 3HOGA 4X80L 2OK0L 4A39A 5AVRB 1VSCA 2QVIA 3V0GA 1NCDH 3DJZA 5DTFB 1JF1A 2G75A 5DMJB 1BOGB 5IQOA 1A9BA 1N4XH 2AKRB 4S1QL 5KTEL 2WBJD 4Z3EA 1SVCP 4K4KA 2F7PA 1BLNB 5KSAC 2WXNA 1A3LH 25C8L 1X5IA 1RERA 1XGRB 3TEYA 4M93B 2GSGA 1IGIL 4C47A 2DJ4A 1BJ1H 5D7SL 1Q90A 3DGGB 2Y7NA 1TFHA 3MODH 4U1NA 3V5HA 3PNWB 4JQVC 1GHFH 1PZ3A 3V0FA 3WFZA 5D2NE 4Q2ZB 3NIDF 3WSQH 4BEIA 3BT2H 4K5LA 4CVZA 2ZX7A 4XMZA 2EKSA 4P2RB 3IYLW 3HFML 2O6PA 3NFPA 5JQ6H 3U7WH 2Q8BH 5JPMB 1SHMA 1T4KB 1OB0A 1KJ3H 1DVSA 2IWGA 2J8UF 2XX0A 2HPTA 3WHXA 1KULA 3V4VA 3VNYA 3C8DA 3MV01 5EBLB 5HHOA 2EYRA 4UM9B 3BT0A 1S7RB 4NEHB 3BDXA 3WEMA 2VABB 3A67H 5BZDB 3DV6B 1HI6B 2R39A 5I8KH 2GUOB 1S5HA 2A77H 2GT9B 4H1LG 4P4KB 4OFVA 1UM6L 2RHEA 5IQ7L 4MMZA 1CLOH 3STLB 4LSQL 3ULVF 1GCYA 1NCCH 3QEHA 3MSPA 1WZLA 5E4EC 1TDQA 3O9WA 4F7TA 2E27L 2X89D 5ALCH 1N10A 4ZOCA 2YMTA 3U7YH 5KG9B 1U8LB 4P5TB 2G3NA 2J71A 3W57A 3HVDA 1K85A 1U8QB 3TBSB 1EFXD 5CGTA 1MCIA 1A7NL 1JP5A 5AAWC 4JGJA 3GZKA 3IE4A 4KQ4H 4RGOL 4QRAA 4CC1A 3S7GA 1E5UI 2D3VA 5CCHE 2FSEB 2OKMA 2Y7SA 4R6UA 3CLWA 4GAYA 4BUQA 4DN3H 3MRNA 2Z1PA 1MUJA 4R9HA 1RJZB 1R24A 2UXVA 1MNUH 1HNFA 2E76C 4L8BA 4I0CC 4PJ7F 2P7TB 4ZW5A 4BFNA 3D2UD 4PS8A 4JKNA 5DZAA 5CN2A 3VH8G 4WFED 4L18A 2C34A 2VABA 5BZDA 2ZPKH 4ILDA 4R90H 2YO3A 1F6AA 4UM9A 3NQIA 3OTTA 4AY0A 3IDYB 1IRAY 2EDQA 3NQKA 4FTVA 1LE5A 5FF6B 5A2CA 1BQ5A 2OTUA 3ARGC 4DVBB 1F3JB 4IHOB 2K8QA 4I48B 4AGQA 1T1WA 2YMXL 4R7VA 5DGRA 3MV9A 2OK0H 5DSCA 3TV3H 1L9PA 2X6UA 3FO2B 4FXKB 1ML0A 2FCBA 5KANG 6PAZA 4HGMA 1PZBA 2XWXA 3QUXC 4N5UA 5E6ZA 3EH2A 2Q3XA 2PCFB 1W91A 4HQQH 1MFDL 3C6LD 2KS0A 3FBQA 1F00I 4RGNB 4NQCD 2J1KA 2GFBA 4EN3A 4XRCA 4XRCB 3TIDB 4AV0A 5HGDA 1NAML 3CE1A 4GKZB 3DX0A 1SUJA 2AJXL 3DGGA 3DPBA 2BP0B 4L2LA 3RGVC 4C57C 4KAQH 4ZMNA 5HBBA 3EJUA 4RISL 4FFVC 1QPXA 5DQJA 4J3WA 2VH5H 1XIWB 2GK2A 4P05A 3GMPA 1BZ7A 4XODA 3UJJH 1JGUL 2LAGB 1HSBA 1NCOA 3CVHB 1BCIA 2WVSA 1Z9NA 1JGDA 4LSVH 3BVVA 1UUNA 2E7MA 2VDNB 1QAWA 1EGJL 1RULL 2ERJB 3BPLC 5CCKH 1JRHH 3UBHA 2QVMA 2GEQA 4PGDA 1FL5A 2R2EA 4TNEA 3FHEA 4AYBA 5C0GA 1I85A 2RTTA 4BKLB 3QUMH 2J88H 4W4OC 5FO7A 4MBOA 3MMEB 3DBXB 4Y2OB 3UAAA 1PIFA 3GMMA 2IADA 5FOBB 3L08A 2D31B 1RURL 4NC0B 1FH2A 2A83B 5HY9A 5DVNA 1AD9A 1KYOK 2XVBA 5GGUB 3S3DB 1NC4D 2B7DT 2MTPA 4HJGB 4IOSD 1FFNB 5C0AD 4BBWA 1A5FH 4FFVD 2AJYL 2PABA 1JHLL 3JV6B 2C4FT 3GXTA 1TJIH 1UXWB 4NM8L 4S1SH 1WT5C 2LHAA 4X0KA 1N9PA 3FUJA 5IP4A 4FJ6A 5ESAA 1B0WA 1D5RA 4Q56A 1PZCA 4PYHA 4WWKC 3F3HA 4EDXA 2IAAC 5T5FH 1LMIA 4HHAA 4QHKI 2MQ3A 4XCNB 2X4QA 3W0WD 4KK5D 4BWTA 5JIQA 3QAQA 5AB1A 2A4ZA 3PDOB 3IXTB 1HOEA 4JE4B 5LCVA 1N0LB 3COOA 1T04B 2FIKA 4S1RH 5FUZL 3OV6A 2OM5A 3BH8A 4QO1A 5BV7L 4YHYB 3LKRB 2GPZA 5LKNA 3ARGD 2RA1A 1NL0H 2HKFH 3INUL 4X7CC 1NGZB 2X9YA 3QO1A 4HP5A 3JTTA 5EIQA 1JAEA 1A6VL 2FX8L 1TNMA 4M61A 4LVEA 2DEWX 4NNYB 1WHPA 1GJUA 3HPLB 3UZEA 4EJ1C 3IGFA 1AQHA 1YG9A 1ORQA 3ULAB 1S9XA 1X9UA 1DVXA 3GBDA 2COQA 4AEHH 1AD0A 1T1YB 3WTSA 3T6QC 1NFAA 4CU7A 2ENSA 3BEVA 1AS7A 1DDHB 1XF3B 5TJWK 2DIJA 3P0GB 3UGXA 3JWNH 2EDTA 2ZSVB 3C6EA 1DFBH 3OB0H 3OJMB 3IN2A 4NQSA 5GGRY 3QZLA 1NIDA 4N2MA 3ATDA 4DSYA 2HLFC 4KTEL 3JV6A 1R3KB 2JKJA 5AG8A 1GZHC 5G5DA 4K94L 4D0DA 4P8QA 3LKOA 4O2FA 4LCWA 4CVUA 1A21A 3Q6FA 2FGZA 4ONHA 3SYQA 3CFNA 5JOFA 3U2IA 3C5SA 3BKYL 5FYLE 2YUXA 2DI7A 1I7UA 1ORSB 2WB1A 3MV7B 4LIQE 1DSWA 5B39G 5FAAA 3SDXF 4NBZB 3MMEA 4TNVK 2ENQA 4WTQA 2HA1A 4BQ6A 4XVTH 1ZVHA 4JPKH 1L7TH 4PP2B 4M8UA 5DS8A 1DBMH 4GFTB 5TDPB 2UXGA 1RZIB 3U1SH 4BQCA 1SN0A 4HG4J 1A1NA 3C9NA 4FQLL 3DRTA 1PG7L 1CR9L 1SJHB 2XYCA 4LAQL 4UMSA 3D08A 2BY2A 4HAFA 4R7NA 1N5AB 1A8JH 3SPCA 4CBZA 2W0FA 2AJUH 2J2ZB 3FB6B 2TSAA 4F33A 4P9HC 1RUKL 1WZ1L 4XN2A 2LU4A 5AVSB 2W8CA 1J8HA 2H41A 5EPMA 3S37X 1B0GA 2WWKO 5BUAA 1C12B 2VSMB 4HEME 4YNYA 3X3GL 1VFAA 2NYZA 4EN3B 1RUAL 1MCEA 4OLUL 4OKDA 3V9FA 2IFGA 3UPCA 5BQDA 4Y0GA 5ESQA 5D8JL 4OLVL 5IBTH 3IN0A 1LMKA 4DAGH 4ZTPL 1K3ZA 2QADD 1P6WA 2E6JA 4M1GL 4ELMF 3OPZL 1H8LA 5BRZA 4PRIE 3TBVA 5JZ7D 4JPWL 5GRYA 4KGJA 4K23L 1TNNA 4JHZA 4D0BB 2O61B 3ML8A 4XCEA 4QHMA 4AW4A 1VGKB 1WITA 3VXMD 4JJOA 4Z7AA 2XZAL 2A6DB 3CFKB 2UZYA 4TXVB 1CDBA 4IK7A 5PCYA 1FAIH 4HUCA 1ID2A 3F64A 4LVHB 3BKJL 2NXYD 2VLKA 1Z3RA 1QOKA 2IGFH 4LLWB 5T3XH 1B4JL 4Z7VA 2XI9A 2K8MA 4ZFOL 5IIEB 3QUXB 3FO1A 3LRLA 3KAAA 4ONFL 2VLJE 4PYGA 5DUJA 1T80A 4RGNC 1GIGL 3PV6A 1CICD 2ITCB 2FVNA 2HLFD 3LZRA 3W0WE 1T1ZA 3ARFA 3M8OH 4O2FB 1ZE3C 4GG8B 5C07A 1IBDA 4RWYL 5IW3A 4WO4C 5AYQA 3EFFB 2OSLB 3N0PB 1MI5D 4OCSH 4AVIA 2GJZA 2N1KA 1FZJB 2Q2LA 1R47A 4KVPA 4C56D 4CJ1A 3TWYA 2DQMA 4BZ1A 3TBSA 3NIFF 5I1KL 1GXEA 1NMAL 2Y5TB 3UADA 1I85C 4TULL 1MIMH 2JKNA 1C8PA 3L7FB 4B27A 3L3GB 3VFVA 4MBRA 4N6RB 1ET7A 3VFPB 4ANUA 5I0WA 2N1TE 4IBQA 1I1FA 1BD2B 1XCWA 1BHGA 3TA3B 4Z3JA 3P3UA 1OM3H 3TEUA 3U4EA 1EBAA 1U21A 1TYJA 1U92A 2ZWSA 3MRQA 2UZYB 3W56A 3O6MH 5DUPH 1TQTA 4DEPB 4PJAE 1NC2A 5EU6D 4U3XA 1IKFH 5DJ2B 2A9ML 4K9EC 3VFUB 4OV5B 1WFMA 4KKLC 2OTWA 3FC8A 5I6LA 5CF3A 3NIDB 2VN6A 3NAAH 1IM9B 4NQCA 3F8UB 2NPLX 5I1IH 5AOLA 3GIVB 4ODTH 5INCB 3K7UA 5HHNA 4OQ1A 4F57L 1YDPA 2X70B 2KERA 4R3SA 1GSKA 4FQQB 2B2XL 3HI6H 5CD5D 2P3YA 3PWJB 3MLTA 5J5EA 1J0JA 1IBYA 4KKPA 4OZIE 4KRPC 2P8LA 1AXTL 2JFCA 1AIFA 4MRCA 4AL8C 4MCZB 1RIVH 1Z5YD 1XFPA 1XX9C 4UIMA 2AXFA 3WJLA 2XG5A 4F8QA 1HX0A 2G75B 3NT0A 1LYQA 3V0WH 4PJEA 1FV1A 3UTPE 3BUPA 4ZTOL 2XA3A 3KCPB 3G6JF 5I15H 4L2YA 1HTYA 2H32H 5LBSA 3RBGA 3L8QA 1ZPLA 1UYWH 1XF1A 5B1KA 4JRXE 3QNZA 4U2YA 3MNWA 3ESNA 2J25A 1J0HA 3WIFB 1ZT7B 1NAKL 3IFPB 4H0LC 4GKNA 1BAWA 4XAKE 4LVNB 2CIIB 1S5IH 1RUMH 3O0RL 2KZBA 1KFGA 4PVMA 2CBOA 1GW6A 3MV7A 3GXUB 4MAYA 4GLRI 4Y4HD 4MYWB 3QDJB 2X4SA 3ZDXB 3DPBB 4QRBA 2R2HB 3TBCA 2OMYB 5IQNA 1CGSH 3HS9A 3IT8D 1I3RB 3O3BB 3HG5A 3KLHC 2AXWA 4HIJB 35C8L 4FG2A 1LP9B 2GIMA 3BEWB 1T4WA 3NUKA 3N5AA 4MA1C 3SGEH 1BJ8A 3N43B 1Y1DA 3DVGB 1XAUA 2P80A 3Q44A 3ZMRA 4CVWA 5E9DA 3BSGA 3GLZA 1IAKA 5CD5C 1G9EA 1S3KH 4OLYL 4IS6A 3HRZC 2KYIA 3NCJL 3C5JA 4ZS6D 2OR7A 5KJRL 5LXGL 3TJPA 2YSSA 1E5CA 1XCXA 1LEGB 2YLHA 3MA9L 4P5MA 2A7BA 1WTLA 2V7NA 5I1KH 2AK4A 1FGNH 3BN9D 4YGVA 2ITDA 1UOKA 4NZUH 3RI5K 2XJLA 1I8AA 4CKQA 2DKMA 3K72B 3UBXA 3MR9A 3RWHA 5INDB 4UDUA 1TQCC 5JA8B 4UTBH 4AZ8B 3F7VA 5IV2B 1VKXA 3DVNA 4PRHA 1THCA 4U31A 4F91B 3EGDB 5JR1L 2HAZA 1ITBB 4FZEL 3OKEB 4N28A 5I1GH 1CBVL 3ZKSD 2I32A 4GAYB 1D5XA 5IFAH 1AIZA 3RNQA 1CDIA 5F3FA 5TQ2H 2WOYA 3T2QA 2E86A 3JT2A 4JZJA 4KROC 5AFAA 4LL1A 3G5ZB 4EKXA 2DV6A 2NY1B 5KVEE 5FB8B 1NZRA 1UM4H 1G4RA 2HG0A 2ZUWA 2YD8A 4WLCA 3S3JA 4DETA 1E67A 5IJVB 1L0PA 2WGXA 5FA4B 1F3DJ 2A83A 5T3XL 4JMNA 5C70A 3ENEA 3FU9A 3QWRD 1TITA 2ICWJ 4X5PA 2XTJC 2V2TA 2QSQA 4PJXE 1PKQB 4IRZA 1Q94B 2CJ3A 3O8XA 3ZRSA 5FLVA 4DGIH 2IDQA 4LVHC 3IRPX 3CDGA 4I5BB 4JG0L 1RZFH 2EIDA 1T6WA 2YKLH 1A1MB 2I26N 4GUOA 3LKSB 5EUOB 4X0NA 3LRHA 4PRNB 3KCPA 4XX5A 3FUMA 5DZOA 1J9RA 1J05A 3VXSA 4AH2B 4AC4A 4GAFB 3LEVL 3LXUX 1OAUH 1BXVA 1QBML 3QW9A 3OAZK 3ZHNA 3LPFA 5GS2H 3RWFA 1G43A 3O6KH 4ZQTA 5E8NA 3HE6B 3TTYA 4NBYB 2JCCA 3BSZH 4PB9H 4WW2C 3UPRA 3BESR 5B39B 1GSMA 4YFDB 4XTRD 4ZPTA 1F4XH 2VZ3A 4MD5A 5AYUL 4APQA 4YNYB 5IFHL 4H20L 1FBIH 2DQEH 3BW9B 4FXTA 2LLLA 3KVQA 4UT9L 2PCFA 2CJUL 3GPEA 5L8JB 1JXGA 1L3WA 4CSZA 2H0FA 5FM4A 4LKXA 1HWHB 5DJ0A 3FTWA 3PHOA 5T1MB 3FT3B 3SDDD 2EDNA 1M71B 2VJ8A 4RAUB 1SFDA 1E6JL 2E56A 3RZCB 2DICA 5DHVH 2Y6SC 1P5UA 3ROLB 1XD0A 4UB0H 3FBKA 3FUIA 3WFCL 1B4RA 1LNUA 4XNDA 4FRWA 4PY8I 3RKDD 1ND0B 3L4UA 3MUJA 3QR0A 3OR6B 4FHBD 1ZIAA 1E28B 2QFPA 4I5BA 4OFYA 1B2WL 1UWYA 1XB8A 2ORBH 1AZUA 4KXAA 1HZHH 1OCWL 1RZGA 2F19L 3VI4E 5IB3A 3HG1D 3MRKB 1R5IB 2WLHA 5IESH 5F9JA 5IJDC 2FBOJ 1A47A 2EO9A 4N2AA 4UOQA 3QUYA 3FT3A 2Y5TA 1C1EL 1DJYA 3QJVB 1ILSA 4YZFE 5EZIL 3KH3A 3RWJB 3EHBD 5D5ME 4ZOAA 3U6XA 5C0AB 1SDDA 2AQPA 4GP5B 5IHWA 2W1NA 4PJCA 4PJBB 5CCKL 2VDOL 3S5YA 1KSRA 1HQ4B 5GSRB 4QF1B 4RWHA 4XPAL 5EZLB 5LAPA 3UPRB 4J8QA 5T3ZD 1NAKH 3ZE2F 5IQMA 1YEHL 5E2VH 4Z5RA 3U6XS 1OF2B 5FYJU 3NJMA 2HVBA 4JM0A 1Z7JA 4G59C 4XNMA 2R56H 4LLQB 5D2NC 5E2TH 5BO1L 3X14A 5A6IA 1BFSA 3FONB 4R4BA 4YDKH 1AFVL 2R1YB 3H4FA 1CICC 3AWFA 4NIKB 4MSWA 3VDAA 1KCRH 5LBVA 4X99B 1L6XA 4OCWL 4PVLA 1L6PA 4NPKA 5FYLL 2K6WA 1A64A 4OVUA 4RAVA 3PQYA 3V4PH 3NCBB 5IB4B 5JO5B 4HUVB 5ELIA 1A6TB 3F84A 2IG2L 4AOFA 3K0WA 3W38A 4B3EA 4EDWL 1CDGA 5F1IB 2FT6A 3LV3A 5GGTA 4X7SH 5D7IA 1KNOB 1KCSL 1S3KL 2AQ1A 1A5FL 2A1WL 5HHPA 1T1XB 3QXUA 1DLFL 3KWUA 1SYVB 4AUUA 3LD8C 4HGKC 1FI8C 3RU8L 4UBDC 3SDCD 4JZJC 1W72A 2ADGA 2P5WD 4GW5A 5F7DB 3TVMC 4AYSA 3O41A 4JQXA 3A24A 2ENJA 3HZMA 2FYYB 3GXPA 1ET8A 5GGTH 4JY6A 3CPUA 1OHQA 5E2WL 2H9GA 3FQTB 4Q52A 4KKBC 2AEPH 4QUOA 4HIJA 3WMQA 3BO8A 4JPKL 4UQ3B 1MI5A 5I6PA 2PO6A 4YE4L 1EHNA 3ZHFA 1R9FA 3TYFB 3SPHA 5JQIB 4G8GB 1P1ZA 2J6EA 5BMFL 4PV8A 3WS6C 4E41B 5IEKA 1XD1A 2NQ3A 4RMBA 3QQ9C 4AX3A 1U3HD 1MI5E 3DSFL 1WZKA 2I9LA 2KUTA 5BQ7B 3O3EB 4M7JL 2AQ2A 4WW1A 2CRIA 2VLKD 1U6AH 4U1LA 4N1EA 3G9AB 2L7EA 3HN3A 2HJFA 2CR6A 4PP2A 5AKTA 5IMLA 4UTAH 3GJEB 2XWJA 2FHBA 2X12A 1CFVH 3DLQR 2H0JA 3M6DA 4YHZH 4ESKA 1N12A 3QYNA 5I1DB 1G9NH 2B1HH 2IC2A 4S1SL 3V6ZA 2BC4A 1O6SA 4NM8H 1U58B 4XE0A 5T33H 4Y4KB 5FECA 3DYOA 2C4FU 3KM2A 2Y22A 1T03L 3K6IA 4Y5XB 2I60L 3FOLB 1DHKA 1Z3GL 4ETQB 1BXXA 2VO8A 5IB1B 4Z7UB 4KNSA 2WUCL 5F7YC 2VCOA 3TPUB 5F7FA 4HLZG 3ZR6A 3D69B 3WJJC 2H26B 1MCRA 5INCA 5C0NC 5E08L 2CK0L 4R84A 5KUMA 5C0CE 3WFBL 3OAUH 2W81C 3ZL1A 3EJSA 1WZ1H 5IB5A 1V3LA 5EO0B 2CSPA 4LDLB 4PY7A 3D0VB 4FZ8H 5K59F 1P7KA 4XMVA 1CGWA 4J3OD 5EU6A 1O75A 4KO9A 1ZPUA 4Z7VF 4P2AA 1DANU 3TT1H 3FCSA 4KDVA 1BW8A 1JZGA 5AWNL 1GYVA 4G70B 4J6RH 1S7SA 4LCCB 5J3HC 5HHQA 4NENB 4R97C 3RVXD 5T3ZE 2I07B 3CFEB 4P04A 5HPMA 3GBLA 4KTEH 4LL9A 1P53A 3VFGL 3ZYZA 4PV1C 4YSTA 1MXGA 1JD7A 2NY6D 2NOYA 5DR5L 1UZ6E 5F96L 2AAVA 3CDYA 1XL4A 3ZL2A 4YLQT 2VXTH 3QWRA 4JFYB 3MRDB 1QUNA 2VR6A 2YC1A 3DX3A 1L6ZA 5CILL 3UAJC 3PHQA 3UTSD 3V95A 4C8XA 4F2MB 2OSLA 4DTGH 3ZL4L 3K80A 3FK3A 2AJSH 3LQAL 4I18C 1AS8A 1JGEB 4KUCD 2XRAH 3UABA 4CILA 4B9JA 1F90H 4LHUA 5KWYC 3MUY1 5FWRA 1RL1A 2JCCE 5DRZB 2CLVB 3QO0B 3PJNA 4KK9C 3HCVA 1SVZA 2JI2A 1KEMH 4GSUA 4HJJL 4N90E 3MJ8B 1Q9LB 4KJYB 5HVGB 1YNKH 4UAOC 4XVSH 4RA0C 2SODB 4XVTL 3WIHH 2XQBH 1EZLA 4DK5A 1BG1A 4PRHB 2IGFL 1AGEB 3VXMB 4MJIB 2J1WA 1Z9OA 3T3PB 2X4UA 5B3SB 1IVLA 4PIBA 3S37H 4L5FL 4P3CH 3E8UL 4IOIA 3VB9A 3Q5TA 3WS3A 1IGJB 3NRFA 2Q6WB 4PJ8D 1CXIA 4H0GA 2OJZL 1O7VA 4UNIA 1CUOA 3GKWH 1MSPA 3TO4B 2YFOA 3C08H 2CHDA 4JFEB 4TUKH 4XNUL 4NQVB 4U1KA 1QASA 3VRJB 5ES4B 2EUWA 5T1LA 1EANA 4NRZB 4ATWA 4GPVA 2ICWB 3CZFB 3UIZA 1KPUA 2GI7A 2F54A 4JPWH 4XGZB 2RMNA 1J1XH 4ZQKA 4F9PA 2J6EH 4NUGL 5FPIA 1N3NA 2YPVH 2W65A 4X4YA 5LGKA 3KBEA 1ETA1 5D8JH 3D8MA 3D3VA 4ANWA 1PZUB 1E4XH 3BPLB 4FG4A 4QT5A 4X6DF 4C83A 3CSYB 5IFJB 2G60H 4MFHA 1XGYH 2BIPA 4O51A 2R1WA 4LNRA 4ELKA 3LMJH 5HDQH 2K9FB 2VJXA 3F65A 4XP4H 2EIZB 1M7XA 2WNWA 3KPQB 3TNMA 4AQ8C 1HXKA 1L3NA 4KMTL 5DWUL 1Z2KA 3MBXH 5I76B 1F6FB 1MHEB 4I9XA 2HKHH 1GGBH 3CVBA 3MOBH 2F0CA 1TUPA 3MRLB 5DA4A 1KGCE 3GBNL 2DQFA 3QZWG 3F62A 4KVNL 2N7SA 1FVDB 3GJEA 3FH7A 1LK3H 1UA6L 3NAAL 4LCYA 3UZQB 2OZ4L 3FCGA 1SXNA 3WDHA 1H9DA 5T5NG 2IBZX 1RZ7L 5HD8D 1WG3A 4PRHE 4WWKB 4EAEA 3MRNB 3S6CA 4NQEA 5DJZA 4PJGB 3BPNB 2X1XR 5AUMA 5I1CH 1AG0A 4KZDL 2X3AA 4NLHA 3PGCA 1T7XA 3J2PA 4YQXL 3CTTA 3V6FB 1A3LL 1SY6A 3NJGA 3DRQA 1E7UA 2QDVA 2QR0B 3IJ9A 3QYCA 1MVFA 3LSOA 4W9HC 5C0IB 1SY6L 3TL5A 2UV3A 2H9GB 3RB7A 4BD4A 2PTUA 1OTTC 2GIXA 2DI9A 1YDPB 2X70A 4NUPA 3EYSH 4PR5A 5DF0A 2E7LA 1KLFB 1RLBA 4HF5L 4JFZL 4TL4A 1FYTB 3BMWA 3MJ9H 1WGOA 1R3JB 4H8WL 5DJ8B 3RIKA 4YFEA 4Z77B 5DEGA 2C9PA 5CILH 4FYRA 3F7YA 3MTXA 2A9DA 4FNLL 5A3IC 5F9OH 4PRBA 2VXSL 1OAXH 3TO4A 4OIIL 3GO1L 5TQ2L 3G5XB 3VFUA 3HRZB 1I9RL 3SDXB 1JN6A 3FFCB 2OULB 5DHYB 3U83A 2QJDA 3A5VA 3DJTA 5EC1A 3TN0C 3T8XA 3WFEL 1YEFH 4N2OA 3R1GH 5E1GA 4IBVA 4QHPA 3M1OA 3OC8A 2YS4A 1AR1D 3KYOA 2H1LM 4I2XE 4XPTH 2Z9TA 4BFRA 3O11A 1A7QH 2DIAA 3GFUA 4G6AC 3H6AA 3FTUA 4ZS7L 4PWHA 3BJ91 1T3FB 4N2FA 1M1SA 1QSEB 3P4MB 4X5LA 3RA7H 4DP8X 4HK3N 5JW4M 4DP6X 3EF7A 3SE6A 2A9BA 5EUKA 2X44D 3F01A 4DNLA 5D7KD 1LEIB 2WMPA 4PMEA 3MLWH 5TF0A 3G5ZA 3NMEA 5CJ8A 1WBYB 4FQ1L 1DDHA 1BLNA 1XF3A 2W92A 4ODSH 3S0PA 5DD3H 1T5XA 3BAIA 3DBXA 4Y2OA 2NUTA 2BVUA 5KVFE 3LEXB 2ZWKA 1N8ZB 5E8PA 3K74B 5ACMA 2VN7A 5C0DA 3EGDA 1JVOA 5HYQA 4ZAKA 4X98B 5GGRA 4L1TA 2ZX5A 2YFNA 3QIUA 4BINA 2R4RH 2KLTA 1P84J 1B6UA 4YSPA 1ETZB 1YZZA 2C8NA 2IQAA 1TQWA 3UP1A 1SDAB 2BIOA 3RDJA 5G55A 2HPOA 2EIJB 4PREA 3IF1A 4KJWD 1D6EB 1BJ1J 4JDZA 3LN4A 1BG9A 4P5TD 3TM6A 1P4UA 4HWNA 1JV5A 4X6FA 3T2OA 1UZ8A 1YVLA 1EDHA 4EPSA 4KVNH 4NO0A 1IAOA 4J3BA 3MLZH 2IIJA 3PHOB 4ELMA 2R0LH 3WNPA 1BM3H 3ULSA 2PP8A 5TF1L 5IROD 3K1KC 4K5OA 4PJHB 4K0OA 3GS7A 4G42A 1EEQA 1L7IH 1JNLH 2XWZA 3LQZB 1A6AA 4HQQL 1WAEA 2WSKA 4TRPL 4HZ1A 1NFDB 1ZMYA 5I5JA 1EHAA 3O3BA 5HJGA 1SF3A 1T6BX 3K71A 1S7TB 3CHOA 3BLKA 1U8MB 3I50L 4ONGL 4WHDA 5K9QI 5KYXB 6CGTA 3LN4B 1AJ7H 4ELDA 2G0KA 4OD1L 5CINL 4LLDB 4S1RL 1DEDA 3MTRA 3H1ZA 4OCLC 3ZHKA 4HZLB 4XI5D 1S3RA 4Y2DC 2OSWA 3QIUB 5D2LE 1K2DB 1ZHLB 2RACA 1EH9A 5I28A 3QXTA 2ICES 3U9WA 5B1JC 2HJKA 4Y4FD 2CR0A 1JGLL 4V1DB 3O3EA 4G6JL 2CBTA 4FQXC 1MG2C 3CPLB 2BIMA 3VFRB 1HHJA 1BXUA 1X4YA 1M6OA 2CXGA 3NPZB 2KHAA 2VQ1B 5DLMH 3T4AC 1KXVC 1J0YA 4XHJD 2J8UB 4UQDA 1BVKB 3OXRB 1LK2B 4RMWA 1YEFL 5FA4A 2H2SC 1X4ZA 3DX1A 5EU3A 4D0DB 3VM7A 4W9EC 5I6NA 1O7SA 4LEEA 3VTTA 2XC8A 3P2TA 3THMH 1ULVA 4WUUB 4KXZI 3ZHDA 2AXGA 2WWMC 1DQML 1TF4A 1TCRB 2CDGB 3NIFB 4DVRH 5K69A 1PW3A 3HUJE 3TZVC 3NA4A 3CH8A 3P3TA 2DQ6A 4JPIA 4X8GA 2BHUA 3D18A 3SPJA 3QDMA 5BVJA 1F45A 4PWJA 2VDNH 4LVOB 3D25A 1AD0B 1T1YA 5AOZA 3N1GC 4I9WD 4R7LA 4YQXH 3GLDA 3L17A 3AS3A 5F3HA 4XT1C 4G6KL 4NKQB 4M4PA 3GBEA 1TMQA 5EMYA 1IEAB 3UBXB 1MCDA 3ILDA 4JO5A 5CGYD 1Q8MA 1HDMB 3I9GH 5J57B 1E6OH 3BSZL 4PB9L 4MZIA 4Y4FB 4LKCB 2F5AH 3ABKB 5D7LD 5C08E 5SX4I 3BGFC 4AJ0A 4KRPB 3PGDB 4RFNC 5D1XE 2W0LA 3S4SG 2DQJH 3UTZB 4Z7QB 4OBSA 2WKGA 5EFIA 1D3CA 1RJZA 2Y7LA 5GRVL 2WXLA 5DEJA 3B9EA 2E7HA 2H0EA 3K6FA 1PTZA 2X6CA 3HBPA 3D4ZA 3DXAB 2VXSH 1WPCA 5EIIA 1FDLL 1RK0A 4XPHH 3EYOA 4XH2A 4M6AA 4HWBL 5E1AB 1PX8A 3WLBB 1KB5A 2Z31C 4OCWH 1SJXA 3HC3L 3QJRB 4N9GB 4Y4HB 1XIWD 2CMRH 3QDGB 2Y4SA 5F70A 2EDDA 1KB5L 4JVPA 1PZSA 1JMZA 2EEBA 3RWJA 3B7SA 3KPOA 5D96B 4IIQA 2NLJB 4LBEB 4NHCL 1HEHC 4X7TA 4R4NC 2VIRB 4XP5H 2DWTA 4XB7A 4GUQA 1QX1A 3QCUL 3N6YA 4FQJL 3STLA 2DTMH 2H3NA 2VUKA 3D33A 5AOMA 1DP0A 4TRPH 1T03H 4HIQA 4MTMA 3KWWB 3PWPE 4APXA 4P9HH 4AK1A 2GJJA 3HUJB 4I85A 4F5CE 5F8QC 1KXQA 1MQKH 1RK1B 1W0VA 2DQFB 3OMZA 4ZTEA 4OM0H 1FFTB 5FR3A 1NMBH 1LM8V 5KUKA 3ROLA 2ZCLL 1RFDL 5E94B 2A9CA 1AMXA 1T7YA 2EUZA 3OQRA 4HJTA 4ACPA 1HSBB 2YRBA 2QKIC 2PXYD 4XCEB 3V52L 3MV8D 1MW3A 2WBKA 1WJ3A 2I9TA 2OL3L 2PW1A 3NFPB 2EDLA 5E2VL 3V0HA 2BNRB 4M7JH 4KHXH 4N26A 1CGUA 1R33A 2RBLA 3TYGH 4DZBB 5ICZA 1CE1H 1FCCA 1R4XA 5C08B 4ZPTB 4PW9A 1KB5B 5CHNA 1BZOA 1PLBA 3PL6D 3MOQA 3O4LE 4V2BA 3SDYL 4K2UL 3BISA 5EC2A 4U6VL 3SY0A 1JV5B 3AFLA 2VSKB 3SEPA 4BE5A 3G3LA 4UIKL 4FLHA 2OX5A 1S9YB 2PYFA 3GSNB 1F3JA 4DVBA 3IDIB 3GIZH 4NUMA 3FTGB 3UIYA 3WEOA 4DGUA 5DR5H 2FGWL 2WLIB 2X40A 5DTFA 3BD4A 4KQ3H 1DLFH 3TESA 3OX8A 3Q9PA 4ORZC 1ID5I 4RQQB 5IBUG 1XCTB 2YD0A 4CW1B 1P7BA 1QI4A 4GG6E 4BELD 1KXTA 1Z0NA 3J07A 1NCJA 4KK5C 4RVBA 4G8EA 2MOQA 1ZHNB 3RDTA 1SUHA 4MA8L 3FFCD 4F7EA 1H3XA 3X13A 4P3DA 1HQRB 1LDSA 2B14A 3AREB 1QRNB 5IM7A 2OW6A 5D7SH 1Q1JL 3WLWD 1IC0A 1OE1A 2W9LA 2RD0A 4KKQA 3P0VH 5C07D 1QLRB 3AVEA 4C4KT 4BKTC 2WD0A 1JZ2A 2E4FA 1MRFH 2E7CA 2LTQC 2P80D 4OD3L 3O2DH 4L8CA 2BDNH 1RMFL 2GJRA 2HVJA 3QIWC 4QXTA 4ZOBA 4BK5C 1UHVA 1URZA 3DHPA 4P5TA 1YECH 2N4IA 1JZHA 1HH6A 3MHZA 3X12B 4OF5A 4JG1H 2AITA 3UZVB 3VA2C 5JYMA 5JW4N 3QORA 5FK9A 3F6IA 3UG5A 1TSHA 4O4YH 3G08B 3OR7B 4YFLF 3GDBA 1P6FA 4PGBA 4LASL 2FWOA 1I7TB 4QRQA 4QYOB 1KT2A 2HT3C 2AJ3A 3ECVA 3VG0H 4HBCL 2GT9A 1NFKA 5L2KD 3VQ1C 2UX6A 3BHBA 3IBOA 5INDA 2VN3A 4HCRA 4KKRA 3I02A 3ZQWA 1HJBC 2MPVA 5C0CD 5CD3A 4OF8A 3N41B 4KJPC 3E2HC 3O2VH 5EC2B 2QSCL 3HR6A 3WY1A 5I5MA 1AG6A 2HFEA 1NFDA 1B9KA 2XZZA 1MFBL 2EECA 3DX9B 4NWTH 1IM3D 3EJZD 3LSOB 5C0IA 3I85A 3OZ9L 4P2QE 4GG6B 1LP9A 2WXHA 2OV0A 1H6TA 2VH5L 3P4OA 3T4AA 4NGHL 5G2NA 1RZJC 3ULUH 4BGDA 4DUVA 3GBNH 1AGFA 1IC7L 2QDWA 3D5OF 3TT3H 4MAYD 3WIHL 5I0YA 3RWDA 5F1SA 4HJEA 4R7DA 4Y4KA 3OHXC 1IBHA 3B5TA 4M7LL 4P9MH 1GMIA 1P5VB 5JTWA 1YYML 4XOCA 1GGIH 4LPUA 3WBDA 3MBEC 4YHLL 2C9UA 3NSXA 4OFIA 4F7EB 5L4IA 5C3IA 5K1JA 3PS6A 4UOZA 1J1XL 1E2VA 1BMWA 2XWJB 1LO3H 1KXTB 2CO4A 3EKCA 3HBQA 3HUJA 1HINH 5KW9L 1Y6MR 3MROB 4IRSB 5GGVL 3QXWA 3HC3H 1S4IA 1E4XL 3MRLA 4FGMA 1U3HB 5IMLB 2DYRB 3RWGB 4YBQC 2WTRA 3RVVD 3VCLA 2WLIA 3SQRA 4CBPA 1MRCH 3EG9B 3AGVA 3M1BB 2YRPA 2NR6A 2QKIA 4X7TB 5H4ZA 3BKMH 5FYJD 3MNZB 2V5SA 4TS6A 4FQIL 1A25A 2ZKHH 3GXFA 5A6MA 4S0SD 5DZJA 3A6CL 3X1BA 1XF4A 2XFGB 4MD5B 2CKBL 3SYPA 2C9RA 4U0RC 3FQTA 1M7IA 3MLRL 1XR8A 4W9GC 5D2LA 3DO3A 4HEPG 3HRPA 4HLZH 2I25N 4HS6A 3FFDB 5H8DA 4NAQA 1KGIA 1AQKH 1GGBL 3RWEA 1R5WA 2CR3A 3IJ8A 3NCYP 2E9IA 2XPGB 4AVKA 4M4RB 5AVTB 2UZIH 2CGRH 3W37A 3ASOB 4YSCA 2SEBA 3T1WA 3LY6A 3SE4A 4W9ZA 4HJSA 3BVWA 1M1XB 4LZKA 2O30A 5AW8B 3LN5A 3LKSA 5EUOA 3ES6B 2VL5A 4ODXA 3GS4A 3TV8A 2YR3A 2X0VA 2RCSH 4DW2H 3F04A 2J88L 1ONQB 4O9HH 3X14B 3NSCA 2X6AA 3OKOB 3KS0H 4JBSA 3ZN6A 3H9SD 1ACXA 2W80C 3FB7A 2OLDA 4QHLA 1IX2A 3B7UX 4LARH 5C0RH 4QHKJ 4XX1G 2X87A 5ADPH 1I8MB 1VGEH 4FLRA 5IWLC 2D03L 4YSDA 3U36B 2OJEA 1JGEA 1R0AL 5HGAB 1N2RA 4JR9L 4POZC 2EDKA 4H25B 1WAPA 3NFSL 5ESAB 1CGXA 2QQKH 3HR5B 1EVUA 1I9IH 4ZW7A 5C6TH 2IH8A 1SGKA 4MMXA 1JHTB 4P3WA 3IJSB 1MCPL 2CU9A 5F1NB 1JPSL 1BFVL 3BLPX 3IRZA 4KI1A 5IMKB 1ZRUA 3L5HA 1I7ZA 3OLGA 1FNEA 4ADJA 1BZ9B 1DBJH 4QHLB 3F7VB 4HEPA 4U1SA 5JIPA 4F93B 4OCRL 3I9IA 3TBTA 4BCXA 5L6YL 3LHAA 2FO8A 2IFFL 1ND0A 4FQ2L 2Y36H 3S5ZA 5B1BB 1KIQA 4BFIA 1ES0A 1IB5A 1F02I 5DJAA 4M8RA 3QIBB 1QSZA 2IBGA 3F6JA 4G43B 1UZGA 3BFOA 3LN5B 2BINA 5MEQA 3ECUA 1S7XA 1U93A 3CSGA 4FULA 5FV2A 3NSJA 1IC1A 4GIAA 4IS6B 3V5KA 3S98A 1ZVSB 4X6DB 3VB8A 2HG5B 2DF3A 2TRHA 3PUCA 4PJ7B 2DMKA 4XNAA 3LEVH 2XPGA 5IF0B 4L3EB 5DO2C 4ONOA 3SE9H 4WDIA 3HNSL 4W70A 1NLBH 4YJZL 3ZGIA 1REIA 1CFTB 2Q20A 3OXSA 5A2AA 4ZFOB 2FJSA 2R0KH 1KF9B 1JPEA 3I6LD 4Z7NB 4BCZA 2X3CA 5K9JH 3LJ3A 3CV5A 2BIIA 1QR4A 2VR8A 3NP4A 2B08A 3MV9D 4H20H 1OARH 4XC3H 4DFIA 4WSJA 4M1CC 5B3JF 1ITCA 5IBLD 1VEPA 5J6HB 1ZVSA 4X6DA 4FQCH 4JFFE 4M6NH 2JMRA 3CPLA 4ZODA 4HCFA 1T0NA 4OIIH 5IW1A 3TEZA 4GRLC 4MKMA 2OMXA 4AMKL 5DZ9A 5BVPH 1E6JH 1OQXA 1T2QH 4FQLH 4A6YA 3RWGA 4ONFH 4PV9B 5B7EA 3F7QA 5DJAB 4WI9A 2F54E 4O5LH 1I8KA 4AQAB 2EO7A 5IJKA 4EDWH 4UOW1 3GJFB 4KK6C 5I8KL 4A66A 3Q13A 4GY4A 3UCQA 1Q94A 2WNGA 2JELH 2MNWA 3H4HA 2GITA 3QUZC 4QRRD 2CD0A 2VLLB 2Z31D 3DUHA 4MCZA 2J6WA 4PJ8B 1DBKH 1ZLEA 5MEND 2WHVA 4LHUB 2V2WB 1J1OH 3S34H 5HI3D 1NANI 4ZNCD 3KPMB 5HHXL 5TE6H 3QEGL 4F5CA 2MNUA 2EZ0C 2ZOLB 1M42A 3SPGA 2WVTA 4HLEA 3UAFA 4ZAKC 2YQ2A 4H25A 4NQXB 4ZMAT 3K6SA 2QSTA 5DHVB 5I30L 3L5XH 4F8OA 2R69L 2J57A 1JMXA 5D7IB 3O0LA 1D5XB 5ILTH 3D4CA 5HD8C 1HEJC 2DQJL 3DNKA 2P5WE 4AIEA 3AACA 4RFOH 3AW5A 4PJIF 1A1OA 4OCYL 2VZVA 5D72L 2Z1KA 1OGAD 1GRWA 1XSJA 4FG0A 2Y3AA 2NZ9C 5CKGA 1TZAA 3A67L 2CM5A 3K2KA 2ITDB 4MNHB 1EHLH 4JW3A 4FABH 5DUML 3RZCD 1NCIA 3ZDYB 1NCUA 1KPVA 4DVRL 2F7RA 2JCCF 4EQ2A 3ZE2B 2WLMA 1TSRA 1VFOA 2OW7A 3A4EA 1SJEA 3X2QB 3Q5OA 5C0DB 4OFPA 1HT6A 1ODAA 3SYOA 1MPAH 3EZ8A 4YR6A 1OGAE 3DVGA 3AZUA 4PBDA 4AVJA 4ZO6A 1OP9A 1TQSA 2XFXA 3JV0A 4MQXD 1X4XA 1HH6B 3X12A 3B5GA 5E1HB 3EGXA 1RUQL 2NZIA 5IGXH 1XO8A 1MF2H 4HH9A 1KJ2B 2PLTA 5T1KD 5BNXD 1RIUH 5JOPE 4DPAX 4XBEH 2FO4B 4YDMA 3OC5A 3KPMA 3NFNB 2F5AL 1EK3A 1TTAA 4XXWC 5D1QC 2M1KA 3R7RA 1CMOA 3OKMA 3BGFB 4DF9A 5DQDH 1AJ7L 2BC4B 4JAMB 1MAML 2WIIB 3QH3B 1DUZA 4XP6L 43C9A 2G9KA 3M7OA 4GKNB 1XH2A 5BZXA 3R19A 3GBML 3EFDH 4XNYL 3EG9A 4HPYL 3UTPD 1SJMA 1BIIA 3EOYG 4ZT1A 5F7EH 3T4YB 2AGJH 2DBLH 4JE0A 3WIIL 2R2EB 4XCFH 4XNQA 2WXRA 2ZXQA 5C2BH 4NQDA 4TVPE 4U1JB 1CE6A 1HILA 1D5BA 3EOAB 1MCPH 3CH1B 5E99H 2APTA 1U8OA 3U0WL 2F58H 1KJ3L 1M71A 3FOMB 1NQBA 2F7QA 1FNGB 4ZS6C 1BGXL 2R4SH 4XXDB 3GMPB 1QRND 1D5MB 2ITFA 3G6DH 3MFFA 4KBPA 4CL7A 3SKJH 1LO5B 2A4CA 1YJDH 4XX1E 1UKQA 1CWVA 3FUFA 4R7DB 2PCPA 2GCYB 2WZ0A 2NY1D 5E4AA 5D1QE 4AL8H 2ZE0A 1MFAL 1GY1A 1HEZB 1F8TH 3ZE2E 2FQFA 5IW6B 3B34A 3K2UH 4NS0A 2W91A 4TQHA 3B5HA 5KJRH 1INDL 3AQYA 3JYBA 5LXGH 1CGYA 3DX9A 5EEZA 1HL9A 2YBRA 3DIVA 4KQ4L 2A74B 2AABL 2NT0A 4HJJH 4N85A 3Q7JA 2ZONA 4GS7C 5LN8A 3U82B 2P26A 3WMSA 2ED7A 3GM0A 4P23A 1J8SA 4DUWA 4C4KO 2P47B 2GI0A 5ALBH 2JTDA 3KPSB 5C0CA 2XTJB 2C1PA 3PQYB 2YD2A 3H7BA 5B21A 4A7GF 3VI3F 1JRHL 4U1HB 5DMIH 2VW6A 5TGBA 3U4EB 1BIIB 2EADA 4QLWA 2BZCA 2CUAA 2ARJB 1A6WH 3GUFA 1HIML 4UINL 2VDKB 4FLQA 5F6HI 4U6HB 4HOWA 4XO5A 4S2SA 3S4SA 3Q3GB 2EDYA 1QTYT 4UT7H 3DO4A 5FGCB 1EEZB 3GSUA 3Q8BA 5DK3A 3P2DA 3TC9A 3KPQA 3TNMB 1FO0B 3G5YB 3EGSB 3AM8A 3QUML 4JGUA 5AYTA 1T0PB 4W9LC 2F8IA 3P4LA 1XTMA 4RH4A 4UV7H 2EEFA 2CMRL 3FU7A 4XPBL 4QT5B 1C5BL 4OV6F 2B20A 2BSTB 2ZKYA 4FMVA 4FQHA 4ADIA 4OZFB 5AW7B 5L8LB 3HR5A 4HSAC 3D48R 4YSQA 1T5KA 4BHUA 4HKBA 1RK0B 4OQTL 2C7UB 1K4DA 5HVFB 1TTUA 3OLDA 3QEHB 4JPSA 4KPHH 4P2YA 1JHLH 4TNGA 3O9WB 4F7TB 2FEEI 5EWIH 4IK6A 2J73A 4S2SB 4LQFL 4QTHA 3ZIMA 5F71A 8PAZA 2EUXA 4LCCA 5FGRA 1ZHNA 3RDTB 1JPGA 2FD6H 3OKOA 4DCQB 2DJMA 3QPQD 3IJYA 4KRNA 1ACYL 3DVFA 3MCKB 1CVRA 5CLZA 4HIEB 2DLTA 4GP4B 4XVSL 4YXLL 3W3BA 3D50A 1UA6H 3VG9C 3LKNA 2ETWA 2A2QT 4EI5C 4CUCA 3QHTC 2W07B 3TA3D 1UH2A 2MHAA 2V6HA 4D3CL 1PZ5A 1DBAH 2R9HC 3OHXA 2AVFA 4YOKA 4EUPA 5JPMA 1WWAX 3LNFA 5E9DB 3ARQA 1KTBA 2XSKA 3HTLX 2HLAB 1PZDA 3I9PA 5ICXA 5I1AB 2QHRL 5EZOL 5A6LA 2D7PA 1F5WA 2AVGA 1FFRA 4YPGA 1ECZA 2Y7OA 4Y9CA 3B37A 2WQUA 5J12B 3B9KD 3QZOA 4CMHC 2EH8L 5GQBA 3V4VH 2FECI 2UVFA 4PVNA 3D1MC 3JTSA 4RBPK 3L1OL 3BYTA 4KUCF 4LVNC 3K8LA 4POUB 3OPZH 2ZCKL 5FYKH 3J27A 3E2HB 1QABA 2WAHA 1I53A 1FYTD 1CXEA 2RAMA 5AZ2H 5IKCA 1CFMA 1JF1B 1UEYA 3KD4A 3QS3A 3OM3B 4DQOH 1XF2B 1OAXL 3SJVE 2OMWA 4NWTL 1WHOA 4PRNA 4G11A 4JRWA 1ZEAH 3TA4D 3W39A 5DJ6B 3MBXL 4ZMWA 3LHPH 4AENA 4AXWA 2ZYIA 4L4VD 2Y7QB 1CE6B 1HILB 1X5JA 3OAZH 2P5PA 4S10A 5FW6A 2APVA 4YDJA 4MJ6A 3MJWA 5I73C 3ZE0B 2XY2A 2UWEB 1OANA 2W9EL 5E1IA 3W9DA 1AKJB 3KPRB 4PW3A 4GAJH 5J1AA 1QHOA 2BDNL 1TOXA 2PYFB 3GSNA 3QP3A 1MAMH 3V0VB 4B9YA 1YYMH 3KYNA 2JIXA 5JYLA 4C54A 3Q6FB 3CDZA 3OB0K 2OP4L 1PQZA 3RTQC 5JOFB 3MBEB 2X4TB 3TT3L 2FT7A 1U3JA 3JYCA 4OY9A 4TUJB 4XOBA 5EUKB 5GS0H 5HSFA 5I1CL 3TIEA 3QISA 1OGTB 1A6AB 4M43L 5AVXB 3SD2A 1W0WA 4NFDA 4Y4HA 4PRPE 1I9JH 3TPUA 4JZJB 4NYLA 3LNDA 5F7DA 4XMKH 3HC0B 3PHAA 3SOBL 4BGLA 3FO9B 4J1UA 3C60D 4WUKL 1UT9A 3MREA 4X2UA 4I48A 3B7TA 5IHZA 4L4VB 1X5MA 3X1FA 3Q8CA 5K1VA 2Y5QA 4W6WB 3GNMH 3V6ZB 4FERA 4DGWC 3GSWA 1JTOA 3WEAA 1F6LL 5I1JH 1Z9SA 3QUHA 5D1XC 1YO4A 3E1ZA 3IU4H 1JWSB 2WBWB 5JQHC 5AVVB 3VXSD 5FX3A 3GO1H 3LS4H 4DCQA 3KLAB 1PKOA 1BDYA 2CUIA 4BFJA 3TFKC 5EU7C 4G8IA 1CT8B 4NGHH 4TL5A 1PG7W 3VFPA 4EBQH 1KBBA 3I75B 1SHXA 3NZ8A 4W9KC 4BKSC 2K9UA 3QUYC 1AC0A 1QEWA 3IXAA 4IU3A 3WKMH 4TNWF 3IDXL 4X5WB 1Q1PA 4RWYH 4EKJA 5ALBL 1VADB 3KG5A 1PNDA 1RJCA 3ARWA 3UAEA 2NTFA 3TIEB 1NGYA 4L8CB 2K4WA 2E9WA 5DYFA 1H3TA 4BK4A 3M17A 1Z5LB 2ADJB 2P5EE 3KBPA 2LLGA 2VM9A 3II1A 4GS7B 3GMOA 3N9GL 1G9HA 4MD4A 4ERSL 2ITEA 4OZGE 5AB2A 4G7VL 3CVDA 3HZMB 4JFDB 1JZ4A 4Q74A 4CAGA 4MD0B 5GZND 4DAGL 2IPKA 1QRNA 2D31A 2BNQD 4CJ0A 4ZUTB 3CMOH 4WHYH 5I1EL 2WXIA 1MFUA 4TUOA 1OM3L 4PRPB 5EG6C 5E70A 2KPNA 2YZ8A 4WWOA 4D8PB 4XBGB 5EU7E 1C5BH 5BJTA 4B5ZA 5KN5A 1JSYA 3EAKA 5MERA 2UWEF 1S7UB 4J23A 2XDHA 5HDOA 1ETB1 2YAOA 2R0ZH 3Q1SL 3UTQA 4DPRA 3VD0A 5H35B 4JMXA 3EFOB 1NKGA 4LCIH 4N0RA 4WFGE 4F7KA 4JFSA 1BQHA 2R29A 1I31A 1TCMA 2W5PA 2WSPA 4RLDA 1OCOB 3N3EA 2QPFA 3CHQA 4PLNC 4MZ2A 4PJGF 3VD5A 2FECL 4P46A 4HS6B 4PRAA 4Z7IA 4OCXL 3QEUB 1KGJA 4WWKD 2IDSA 3VRLF 1EAOA 2AEPL 5BS0B 5BS0A 5DRNB 3DI2B 2W65B 3PWPD 5CGBA 4DPCX 4X4YB 1I3GL 1F4YH 2Y1YA 4J3OG 3TBYB 1I75A 3QHZH 4G1EA 1J5OL 2VR7A 1U30A 3FSWA 1FVCB 5D93B 1QSVA 4JO4L 3MV9B 1J11A 1NAMA 1P4BH 4FEMA 5GISH 2KLSA 1QWUA 5KBMA 2MQ0A 4X6EB 3TT1L 1A9BB 2AKRA 5EF1A 4CN1A 4TNFA 3EOAA 4LCUB 2ODIA 1L9SA 2G5RA 3SB3A 2FH8A 3NACH 1FZMA 4I3SH 1AP2B 1SJHA 2JB6A 6FABH 4HXBL