1OT4A

Solution structure of cu(ii)-copc from pseudomonas syringae
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
102
structure length
102
Chain Sequence
b'HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein C
publication title A Strategy for the NMR Characterization of Type II Copper(II) Proteins: the Case of the Copper Trafficking Protein CopC from Pseudomonas Syringae.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Metal binding protein
total genus 7
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ot4A00
4CC4C 1M9SA 3FAWA 1H6UA 2UZXA 3BCDA 4AW4A 2WQXA 1O6VA 2WQVA 3FAXA 2OMYA 2Y5QA 2C9QA 1NM4A 2OMUA 1IX2A 2UZYA 1H6TA 2WQUA 2OMTA 2OMXA 1LYQA 1O6TA 3BC9A 1XEUA 4CC4A 3BZ5A 1M42A 4AQ1A 2YA1A 5ICUA 2C9RA 2OMZA 2OMVA 2OMWA 2WQWA 1O6SA 2C9PA 4CILA 3BCFA 2RA1A 1OT4A
chains in the Genus database with same CATH superfamily
4JGJA 2R2BB 3VG0H 1HTYA 2J8UB 1G7LA 4P8QA 3TP4A 4MXQD 5DUPL 1UVQB 4UQ2A 4OUUA 1TQWA 4GAGH 5GS0H 3MO1B 2EINB 4JDVB 4HAFA 1EEZA 4ZT1A 3HI1B 5D7SH 5DDHB 1A2YB 1CLCA 1J7VR 2FQFA 2WM0A 3FT2B 4GSXA 5FEBA 2WAHA 3RVTC 5GGUA 1RJZA 1ZTMA 5D2NE 2OYPA 1UCTA 4PLJC 4KTDH 1HE7A 1LMIA 1NCDH 4Q2ZA 3PHAA 4XRCB 4LEXH 5D55A 3G5WA 4RX4A 4WV1A 4XPBL 1SGKA 2YA0A 2PCFA 2D03L 2XWTB 3QUZC 4H20H 1V7MH 1BM3L 2RCSH 3EOTL 4XP4L 4EIUA 3K71A 4D2NA 3IDXL 1YJDH 4UZUA 1XCQB 3G08A 5I1DA 4I9WD 4PJXA 1YEJL 4ZMTA 3FRUA 2ITDA 3QH3B 4P2RB 2CDEB 3NVQA 4PJAF 5CD3B 3HZKB 3N40P 5IV2B 4HK3J 3FO2B 4EI0A 3RKDD 4FMVA 1G9EA 5D4HA 3DX9B 1JNLH 4MSWA 2A9MH 4MA7H 1E8ZA 3RU8L 3CNKA 5IG7A 4W9KC 4EIGB 4P23B 4FNLH 5B8CB 4ICXA 3BZEA 1QEXA 3ZIYA 1V10A 3EH5B 2PP7A 1BREA 1D6EA 1AAJA 3QQ3A 4LLVB 5F6HJ 5FHAH 5IVXE 1PY4A 5BVPH 3GBNH 1UXSA 3IAQA 4PGCA 1RZFH 4UT9H 2UVEA 1F6FB 1J8HA 1U3YA 3TBYA 1LP9E 2OV0A 1JGEA 4FGMA 5JPMA 2WLIB 2ZCLL 3AC0A 2XI9A 4PP2B 3ZL4L 1AIFB 1BVNT 3DK2A 3VRIB 4YLQT 5HHQB 2KYIA 1JPST 3N42F 5C71A 5HDLA 3FO1A 2V7NB 3MJ6A 1CXLA 3FQXA 3R1GL 2F58L 3X1BA 1K2DA 3N44B 4U3SB 4CW1B 2WHVA 4PJXF 3IKKA 1MIEL 3MUZ1 2FH6A 5FYLD 3PNWB 1VGKB 2FVNA 1KTBA 3G5XB 5DD3L 1CE1H 2F54A 1KCVH 4KK8C 4G7RB 4PJGF 1O6TA 3G6JE 3MRKA 2J43A 1MFNA 4K7FA 4QMEA 1HYSD 4DP2X 2IAMD 1V3MA 2ZUUA 3SCMC 4M1CC 1FZJB 1RZGA 2YBRA 2X87A 4YEFA 2VQ4A 5DMKA 1J11A 4NWUL 2CG9X 2NNAA 1MVYA 2BRQA 5ABAA 3CG8A 1I1FB 4JKNA 3Q1SH 3HN3A 1PLCA 4KI1A 3WFCL 5BJTB 4FQ1H 3UC0L 5I9QB 3TZVB 3ZE0E 3F64A 4GNKB 5C07D 4JKKA 4LGRB 4XWOD 4ODVH 4Y4HC 5TJWK 3KYMB 5CJQL 4FA7B 4HS3B 4DOHE 1GOGA 3EFOB 4A63A 3NJHA 5K9KA 3EF7A 3HZYA 5DMGD 4QXTA 1RJCA 3VFMA 3GUFA 1GGUA 5JORA 4PRPE 2EO1A 2X40A 4LPXA 4BRJA 1JWUA 2AXHA 3VFGL 3KDMB 1FV1B 5F7DB 4XP9L 1U8CB 3ARQA 2GBVA 2CRYA 4W68A 2MNUA 2VJ8A 2MPAH 5IESH 1D5MB 2AV7A 2YRBA 1PG7H 3STZB 5A16A 3QIUD 1WS7A 5BO1H 2YEQA 3WFEH 3II1A 5BRZE 5DA4A 1JPFA 4L0ZA 2ROYA 3SGDH 3VACA 4AMWA 2PYFB 4NNXA 1ZY9A 5EWIH 4L5FH 1D6VH 2XWJA 3BAWA 5KBKA 3HCVA 3LZLA 1RURL 4C56A 3BP7B 1OTSD 3GPEA 1HHGB 3EDKA 4Y7MA 3HC4H 1ET5A 3AB0B 2J71A 5AVTB 1A7QH 3US1A 5B1AB 4OD1H 4BQ6A 4FFWC 2ZSVA 3HMXH 4LSTL 1M1XB 4JR9H 4P3DB 3MR9B 5DUMH 1OHQA 1FNLA 2WMPA 3Q2LA 4P5MA 3ASWA 1SXAA 1FFQA 4WV1C 1IGTB 5IB2A 4KQ0A 1AHWA 3AG3B 4ANUA 4ZO6A 2Y72A 2VM3A 3H9SE 4ZMXA 1N2RA 1JHKH 2NDFA 2CBMA 2R1YA 4PJEB 4M5ZL 4PJAE 2GJ6D 4QCIB 1YO4A 4EUPG 3B9AA 4BFGA 3EG9B 3FZUD 4U6YB 3OXRA 3NCMA 4YX2L 3BWUF 5AVXB 1JNNH 7PCYA 2HH0H 5MEPA 3IMRA 3V7AG 2PO6B 2IGLA 2YQ2A 3TA4D 5GZOA 2PW1B 4EIZC 2ZG2A 4HS8H 4TL5A 1B0GA 3N0AA 4YSPA 1XGRB 4LGSB 1ZS8A 1E0OB 3QVAA 4JMNA 1FNHA 1GCFA 3W56A 1QBML 4DHLA 2NUPA 5B3JF 1R5VB 3SOBL 1MFAL 2CCWA 2PWGA 1DVFB 5JPMC 5A2CA 3G9VA 3IMBA 1NQBA 3D30A 3F7PC 2FECL 1YAZA 2VN3A 3L4CA 3Q8CA 5DTFB 5E9DA 2MCMA 3APFA 3V6ZB 4O4YH 4RMBA 5CGMA 1LO5A 1S7QA 2P46B 1COBA 2ZOKB 1YEIH 1IX2A 4PJXE 1GGCL 3LPPA 2HFFA 4XMWA 4OI8A 1BV8A 1FBIH 3CDCA 5DZPA 1RVFH 3ZDZF 3C8DA 3VFVB 3WLWC 4OLEA 4PJGE 1URIA 3OLDA 5E1HB 1KENH 2Q1EA 3FUEA 4NN6B 4GP8B 3RWEA 3P0YH 1E90A 2OLDA 4YHPB 3EXJA 2WN2A 4D9LH 4O2EA 2OMZB 5J6GA 3GINA 5DJXA 2YAEA 3ECWA 1RERA 1J8HE 2XOTA 3B7TA 2C3GA 2VERA 3MREA 4DO6A 1JK8B 3DETD 4YHYB 1A6PA 3D3VA 5D2LF 3GJEA 4KJQD 3FUFA 5EA0L 3CMGA 1NGQH 3KEDA 4M6OL 3Q6FA 2F9BT 4UQ3B 2N1TE 4N86A 4WI4A 3CFKA 3MRDA 4HHAA 4BWTA 4UILL 5D4QA 1S5IL 2Z3FA 3V6BR 2UZIH 1JF5A 4HJIA 5FW7A 5E6ID 3UYPB 2AJ3B 1OT2A 4TSBH 4F33B 2YAQA 4YFEA 3DVNB 3G6DH 3KLHD 1NC2B 4I88A 1XH3B 2C26A 5IB3B 1A3QA 4TLSA 4F92B 3CSBA 5C0CD 3TYFA 2ATAA 1AXIB 2J7LA 4QR7A 4JZJA 3JSSA 2ETWA 2VQTA 4N2KA 4CVUA 1F58H 1BHGA 5ETUA 5HYQA 2DICA 2PYEB 3ZBMA 3B34A 4QTHA 1AH1A 1GCYA 2OL3L 1W0WA 1IGYB 4ZODA 4UQCA 4Q4EA 2AP2A 3BWUC 4K8RH 4Q9QH 3P30H 32C2B 4OCLC 2XBTA 2JQAA 1QEWB 1U93B 4YVNA 1QACA 3VD1A 1G7HB 1FIEA 2G0LA 3L5XH 4TNWF 1FCGA 4G3YH 3QFJD 5F44A 3C6LD 3PIQA 4MZ3A 6PAZA 2R39A 3JV6A 4R26H 4KNTA 4EZKA 2IOMA 2WBJD 3R4RA 1JOIA 5GS0C 4AEIL 4W9EC 4R4ND 2B3IA 4NBZB 3W38A 1CO1A 1OM3L 4OLYL 5I6LA 2BDNH 3HI5L 2DDQL 4AEFA 4DEPB 3RRQA 4G6MH 3IN0A 1Q9KB 4IHOA 4BZ1L 4B9ZA 2J1KA 1BQSA 3TH2T 3DJTA 4N3UA 2F53B 1A6WH 3HMXA 3MJ7A 5I5JA 5TK2A 1FL5B 1QSFB 2Z92B 2HWZH 4JE4B 3IFPB 4PVBA 1F13A 5C0NC 2HVKA 3Q44A 4IU2A 3CUPB 2R51A 3DSNA 3QXUA 4Z7UB 4O51A 2ADIA 5ALBH 1FO0B 3VFOA 4AC2A 1KCSL 3QYNA 3KPRA 5FECA 3FF7A 3K72A 1ZGLA 1LD9A 5GZOC 4C56E 4O9HL 3BCFA 2NY2C 3PFQA 3MJWA 3VQLA 4LPCA 3BVUA 3D6GA 1WK0A 3VXMA 1YEKL 3GMQB 3MRMA 5B3JE 3MBED 5LQBH 2YD0A 4JO5A 4B95C 1QLEB 3WE6A 2YRLA 3MXWH 5EV7A 4J6IA 5GSRA 5JOFB 2COQA 4WTZA 4IKLA 2P9RA 4X4KA 5EEVA 2YPLB 5EU6D 2L0DA 4HOXA 1BZ7A 3FSAA 3OLEA 4GRLD 3CSPA 1NBQA 4HJTA 1MVUB 2MPVA 4JY5H 5F9OL 1AQKL 1MCWW 2NW3A 3KPPA 3SB3A 4PJ5A 4DQAA 3VD4A 4KQ3H 4QKXB 3LB6C 2V9QA 3CN1A 4Y2DD 1Z9PA 3OZKA 3DRQB 3H4HA 4HU8A 1I3RA 1OTTC 1ZSHA 3D85D 4OZFB 2F7PA 2NZ9C 1U8MA 4XBGB 4RWYL 5A2JH 4GI9A 5EOCJ 2ADYA 1DUZA 3ZDZE 4DAGH 1JK9B 3VX0A 2ZNWA 4HMCA 4WTWA 3CVDA 4PGZA 1EZVY 3CE1A 1RUKH 4KK9D 4MDJA 1KC5L 3SBRA 2VZ1A 3GIZH 1RJLA 4OIBA 2ATPA 2WQAA 3NIGB 1H6TA 1H5BB 1P1ZA 1PYWB 2D0HA 3SKOA 3FQ1A 3V10A 3X1GA 1BVKA 4WK0B 1HEZB 3KS0H 3T3MF 1IMHC 3JV0A 3CFEA 4XVTH 1NCCH 2PPAA 3QCTH 1F97A 1B0RA 3FOMA 5D2LE 4LP4A 3ZR5A 3MBWB 5ICXA 3U9PL 3P69A 3MU3A 5TDNA 3DO4A 5JUEL 1G7JA 1INQB 1F1AA 2G75B 3T8XA 2BSED 1I8KB 1RPUA 1FE8L 1TKWB 2VKXA 3H42L 2Z8WC 4ANVA 1AE6L 5E2WH 3Q9PA 4FI8A 5I74C 4FFVC 5IIEA 2KQMA 5LKNA 3MFGB 4KTYA 1TZGL 2XWEA 5EB9A 2VLKD 2FQDA 5LGJB 4LHQB 3RX8A 3SKNA 1S9YB 1F8TL 4B3EA 2VH5L 5JW5A 1X5YA 4OZHB 4WFED 5K93A 4F1ZA 1JGLL 2Z91A 3IJ8A 2LTQC 3MLVL 1WWWX 3RYMA 3TXAA 5EPMA 5K39B 4YHZH 1I7TA 1KTJA 4JZJC 1XSKA 1EXUA 4DPCX 5SX4H 1EZLA 3ULUL 1KEGL 3OQ3B 3LHPL 1LJMA 1Q72H 3VW3H 3BLKA 4L9LB 4JZOA 1ZXQA 1G9ML 1KFAL 3GLAA 4G82A 1T83A 4WK2B 2OCCB 5BMFH 1KIQB 4ATWA 2P43B 5F21B 4LL1A 3TN0A 3TEYA 1SMDA 3K2KA 3MLSH 1UQSA 5FR3A 2YIHA 3MOAL 2DBJA 4L3EB 4L3AA 4QHKI 2EAEA 5I26A 1ZA6B 2NDGA 3BAEH 3NN8A 4R5TA 4OCXL 1ULVA 4M43L 2XZCL 4MA3B 2EDLA 4YO0A 5AOIA 1UB5A 2XKNB 2EDEA 2A6JB 2OZ4A 2BCKA 3KL5A 3OKDA 4JFDB 3BP4A 3U0TB 1NEZG 3R0NA 3SYPA 3UFIA 3F00A 2VJ0A 2OMTA 1ASQA 2R0WL 5JNYA 5EF0A 1FNGA 3OXSB 4X9FA 8CGTA 4DKTA 3OWEA 2FIRT 3FH7A 3QHTC 4CVZA 1BBJA 2DWTA 3BZDA 5D5MB 3HAEA 2BRRH 1GC1H 3BT2H 3P3SA 2X4OB 3QUXB 5C0RL 1T5XA 3IJYB 3SD5A 1VA9A 2VMEA 2H32B 3OKOB 3MRNA 5DJAB 1CLYH 4XOBA 1WZ1H 1QSVA 5EOCL 3WKMH 2BFGA 2HKAA 4M7KH 3DUUA 4PCKA 5IQMA 5E1AB 2O6EA 3CFCH 3HE7D 4Y9GA 4PY7B 3VH8B 5EDSA 1H15A 4RA0C 2RHEA 5F7BA 2CWRA 2RIKA 3KAAA 3TT3L 3L7FA 4LVHB 4PJ8B 1IC4L 1E9QB 3QIBD 1HZHL 5HI4D 4JHVA 2W07B 4Z7VB 4JM2D 5HJGA 3B2XA 5KANI 5AOJA 4JVUA 3OKNB 3VJ6B 4ABVA 2O6DA 3K91A 3LKRA 2O5XH 4IKNA 2YZ8A 4AGPA 1URLA 1Q0YL 4JCWA 2R0LH 1GZPB 5E6ZA 4MAYA 3VFUB 2VZTA 1WTGT 4BFIA 1X44A 4AQ8A 1C8QA 1UD3A 3WEMA 1I3UA 3IEAA 3CIAA 1V27A 4KXAA 3L3GA 4AQOA 3EH3B 3BGFB 1M05B 2YBGA 4N2CA 3SDAB 1EGJL 4PW4A 1JPTL 1A6VH 1KJMB 2UYLB 3KPQB 3KPRE 4MMXB 3NRQA 4X0KA 4XO3A 4L1LA 2GT9B 3T3ME 2VW4A 3QDJA 4HIHB 1L5GA 1J1OL 1KCVL 4YS4A 4K3HA 3K6DA 1D7CA 4LOUD 5JW4M 1BFOA 4WJG3 1YMHA 4JO3L 3QRBA 4IBVA 4HWBH 1BW8A 4H8WC 4F7PB 5CU9A 4TOYL 2YN3A 4URTB 2FLMA 1HK6A 4PJ5E 3WS3B 4M5YH 5DVMA 4EI6A 2Z0BA 4AQEB 3FXIC 3ULSA 4BYHA 5DC0A 3FN0H 4N85A 2IV8A 3HC3H 4CU7A 4IU3A 4EMZA 1AGEB 1SLXA 1OIOA 3T2NH 4YSQA 4LESA 3QUMA 2QQNL 4UI2A 4CKVX 2WANA 4F2MB 2WKLA 1IAKA 1LK3H 4B9FA 2B1AL 2FK9A 3WTUA 5DA0B 3GK8H 3CXFA 3FS9A 3GSQB 5BXFA 1HCYA 3SBQA 5DD5L 5KTEH 2QADB 4FKKA 5HD8D 4HV8B 1N0XH 1IC1A 2YAOA 4AVIA 5C09E 3FT0A 3R06A 2QQLL 4WI2A 2VABA 2BVYA 2VLJB 3RB7A 3QNYA 3NAAL 1PFOA 2MPAL 3QPXH 5CSBA 3HTLX 4I89A 4RISH 5AUMB 4L05A 2JQZA 4IOFC 5ANMA 3IDJB 1ZJAA 4OIAA 3TN0C 1B6UA 4S2SB 2R8SL 4IRSD 4L8SA 1PZAA 1TTUA 1UJ3A 2PETA 4JRXB 1FLTX 1JWSA 5EG6C 4XN5A 5INCA 3FTSA 5IMLA 3S36H 2YWYA 1SEQH 2UY6B 1R34A 4I2XA 1CB4A 4M7ZC 1GYAA 4N0FA 2JMRA 4FFYH 2WIIB 5EZIL 4AGQA 1OANA 5C0AB 4V2BA 1EX0A 4FKEA 2Q87A 3TBTB 5ID1A 1MI5A 4NQCD 4ODTH 1Z66A 4JR9L 4OVUA 1T03H 1ZLSH 4WNQA 4YAQA 3CXHK 2J88L 1CDGA 4XNDA 1JZ7A 4GG8A 1C5CL 1T7VA 3SDXB 3OPZL 1JYWA 4M3HA 2CJTA 4H88H 5CP7A 1MQKL 2YQBA 4XXCA 1UHVA 3KLAB 1NH6A 5C08A 1U8NA 7FABL 1RZ7H 3NCWA 3EOBA 1MCWM 2YD7A 1OPOA 3QFGA 4N24A 4PB9H 4D7PA 3FB5A 3V4PB 3ARDB 4JFXA 2YLKA 5SWSB 3BWAA 4BSJA 5DMJB 3CN0A 4G6AC 3QK0A 4JDEA 1QSZA 4K7PH 4AUJA 1CGTA 1IM3A 1KEMH 4BDVA 1DVSA 1XX9C 5IM7A 4CC0A 2YLHA 4QKTA 5G2NA 3GKZA 5AL8A 5D1XA 3OJVC 2EYSA 2KPWA 2VXTH 3U6RB 4M62H 4MAYC 4PBVC 5I19H 3VI3B 1D2OA 2YEZA 1VACB 2OCFD 4AQ8C 4OF5A 1C08A 3W81A 2Y5TA 3N41F 3QZWB 1WQVT 1VFBA 3IDGA 3VXSA 5IOKA 3JYBA 2XIBA 2OMXB 5IEHB 4N2HA 4Z78B 4OFQA 4JFYA 1ITCA 3MLZL 3KZ8A 3CHQA 2NY7H 4NZDA 4E5XG 3ZDXB 2BZDA 4YGAB 4V1DD 3QXTA 1CK0L 2B1OA 2H2PC 3K1DA 3M7OA 1P5UA 1QBAA 1R24A 1SDDA 3I84A 4Z7QB 5B1KA 4DNLA 2Q6WA 4ODWA 1BIIA 1MRCH 1TEGA 3ZKMC 5FUZH 4IGBB 4D9LL 4DTGL 3KGTA 3PXLA 4PIRF 1JZJA 5EIIG 4AVJA 5DVOA 2OTUB 5ESAA 1Y18A 2FR4A 2L7QA 2VDQL 3L48A 3FQRA 1J9TA 2NY3C 7PAZA 1C5BL 3IJHB 3GT6A 4IOIA 1CTOA 4LSPH 2R0ZH 3EIFA 3TONA 1R33A 1ZT7A 2LU3A 4G1EA 4TSAL 4ZBJA 3KD4A 1I7ZA 4XNZC 5H2BB 1FQ9C 3AU1B 3HR5B 2BSRB 5C0DA 4PJ9D 2IBBA 2YA2A 5F9WB 1R47A 3OM3B 5E99H 3WFBL 3IGLA 1FRGL 5HTSA 4UQDA 3SO3B 4NC2B 2VN7A 1RUPL 2XPZA 2GG1A 1XGUA 2D3NA 5IMKB 1PX3A 5IBTL 3WD5H 2PW2A 4KY1L 1XGTA 1Q1JL 2JB6B 3CVCA 3QDJE 1H3GA 4KU1A 4KTEH 5HGDA 3CHRA 3WFHA 2LLLA 4AQZA 3AVEA 1U8HB 1J9QA 2YD8A 3KS0J 1M2VA 2XV3A 1G0DA 3BUIA 1HAUA 5T1LB 2L4OA 5TQ2H 4QRUA 2EYRA 3QG6B 4KH2A 4DKFH 1IEAB 1UZ8A 1HC1A 5JLZA 5L4JA 4HC1L 5E4EC 2BWDA 1QD0A 3D39D 3NSXA 3GS0A 4G80B 1AZRA 3DURB 3AJ7A 4QHLB 1CIUA 2AJYH 4L8SC 1FCCA 1T22B 3CU1A 3ILQD 1YN7A 2XQYG 2Y1YA 3DMMD 1UJTA 2PP8A 3QCVL 4MCYA 5DLLA 3ZXAC 4KRLB 1SHXA 5A2LH 5KN5B 4XXDA 4Z3HA 1J88A 1NUGA 5DK2B 3VQ1C 2KS0A 3CX5K 3FTYA 3QJFB 5GISL 4G9DA 4QTIL 1MWAB 3VRLF 4H2CA 3S35L 1PF3A 2NZ1A 3IM1A 3MRFA 4OI7A 3FCSA 2BP8A 2EH7L 1NGWA 2YWZA 4Y4FB 1FYTB 3IPEA 4ONFL 3WN5A 3UTZB 1I7UB 4QHUA 2P5EB 5DHDA 4FFYA 1AY1L 1BFTA 4O00A 5B39A 2BVEA 3VG9C 4ZDHB 1U3ZA 4TULH 3RPIA 4JLRA 1AD9A 1TMCB 5ICYB 1T7WA 4J1UA 4XXCC 1BWMA 4RMVA 4PCSA 3HS0A 5JHMA 2JIXB 4AW7A 3L1FA 4HQQH 3GI8L 5ANME 1ZEAL 2HWZL 3HZ3A 4DZBB 1CJYA 1XV8A 1YEDB 4LEOA 1WFNA 2J4WH 4FL4B 4JFFA 4AE0A 5KANG 5K69A 4LSUH 1D5BA 5D4IA 5ALBL 1IAIL 2WTPA 4X8GA 3AQYA 1NCIA 1JGIA 4I2XE 4P06A 4YHML 3UO1L 3V0DA 4P07A 2G2PA 3C5SB 4UBDD 5HPMB 1TJHL 3STBA 3VXNA 4BSWB 3UADA 4JY4A 3UTQB 1J8KA 3W0WA 3BOVA 1DE4B 3T6XA 5MEQA 4FFTA 5CHNB 3ARFA 5DGRA 4TVPH 1SBBA 5D1XC 1PEWA 1MI5E 4X5XB 5IQ7L 4W4NA 1JV5A 4G83A 1R3IL 4AEHH 2KERA 4WO4C 2EH8L 3MCKA 4J3OD 3BEWB 5F6HI 5C0FA 5IB4A 2DD8H 3IFOA 1SMAA 2R1XA 2G2RA 2E9IA 3KLQA 1A4JB 4KQ3L 4XPHH 1MG2C 1PBYA 5B3NA 3A24A 3MRHA 3BPOC 5C08E 5T3XH 3NCJL 3LV3B 3O4LA 3NTCL 4YIQA 3BC9A 3ABMB 4G8GD 5ADPL 5F9JB 4HUUA 4TS6A 3AAZA 3CAFA 3D4ZA 4HBCH 3GIZL 2I5YH 4K71C 1P6WA 1YG9A 1W80A 2WO2B 1VZIA 1AMXA 2VZVA 1FNEA 1BD2E 1JGDB 2Y6TE 3SJVA 3H0TB 2EDYA 4JGUA 1GJUA 2ZT9C 2ZWLT 4TRPL 5C6WH 5K1NA 1KN4H 3BZ4B 3IB4A 5D1XE 4F7TA 3VCLA 4ZMZA 1DEDA 1DBKH 1DBAH 1PZ2A 3GB7A 4KWUA 2ZUXA 2DMHA 3I9AA 3VA2C 4X6BA 1HL5A 1TFHA 3CV5A 3HG1D 1P4LA 1KJVB 1RIHL 2J8UA 1TLMA 4NBXB 1MFCH 3O6KH 1UVQA 1N3NB 5DMIH 2X41A 2FECI 1J5DA 1G94A 5IVZB 3DTUB 3MO1A 3T04D 2P42B 1WFOA 2HPOA 3HI1A 5E23A 2P26A 4ANXA 2C3HA 4YHIB 2Z8SA 1A2YA 5DDHA 3VM7A 4KK6D 2VMFA 3FT2A 4G7SB 4JPWH 3WNMA 3DX3A 4P5TB 1RZ8B 1EAPB 1VCBC 3FQWB 5MEND 2QELA 3VXPA 5C9KA 2FHBA 1CQKA 4MXWL 2CGRL 1OP9A 2WXGA 4XRCA 3RWIB 3DGDA 2CJUH 2DH3A 5L88H 3LDBC 1DUYB 3EYOB 2IAMB 2XWTA 2YGVA 1P7KB 5TE6L 4BKLB 4DEUA 4NHUB 1GOFA 5IQ9B 5M7QA 4LNVA 1H8SA 3OJMB 5E8OB 3HZMB 3AGWA 1ADQA 4P59L 3V4VL 3ZN6A 4KNQA 1XCQA 4CNIA 3U9WA 3MCLH 5GRVL 3PABB 5HDOA 4V33A 4P2RA 3QH3A 2CDEA 5CD3A 3VRLE 3B5GA 3HZKA 4G7VH 5IV2A 2XT1B 1TTAA 5JDJA 3FO2A 3GSWB 5C07B 3U4BH 2O26U 3DSFL 2J2ZB 3OHXB 4FN0A 3DX9A 3GLDA 3UOAB 1KT2B 3F85A 3HPJB 2NY0D 4N2DA 4DPBX 3L7EB 2DMKA 4RMRA 4EAEA 4P23A 3WN5C 1ZLVK 5B8CA 4C83B 3HHMA 5B7MA 1F56A 5EZOL 5CEXB 2DQJH 2E8YA 4OLUL 1LEGB 4P4KD 3RGVC 4LLVA 1AHMA 2V4LA 1OT4A 1UG9A 2I9TB 1TG8A 1AG6A 3E1F1 1GAFH 2ZX5A 2WLLB 1CFBA 4DUVA 1NGPL 3BGMB 3Q1EA 3HS0C 4PP2A 1AIFA 2AQNA 3KHOA 3RLSA 4CJ0A 5HI5C 1MNNA 3QIWD 4PSRA 5HHQA 4S1SH 1CLYL 2V7NA 3NUKA 2ZSWB 4YPJA 2VDMH 1OAQL 3W3BA 3KWUA 3ORJA 3WO4C 3GF8A 4U3SA 4CW1A 1BQLL 2DIJA 1VPOL 2FGZA 5DRNB 2WC7A 2R1WB 1VGKA 3JT0A 4J6RL 3QEQB 2FX9H 2XV2A 3BISA 3R19A 4YHOH 5AVZB 3ARFC 5D7HA 5FYJH 2DWDB 2JCWA 4U4BA 1D5IH 5F0JB 3V6OA 1BF8A 2F6AA 4IBZA 3N1QC 3RFZB 1IJNA 3CWGA 1TQCB 3GFUA 3G5ZB 3TGXA 1WCBB 4OB5H 1NCBL 3X11B 1FZJA 1MFBL 5T3ZD 2R0KL 2RALA 1A6ZB 2TAAA 1YQVH 4PTTB 3ILDA 3O6FB 4AIEA 2I7SA 1SY6A 2C4FU 3NCYS 4OKVB 1I1FA 3LH8A 2H6OA 4G8AC 3TZVA 1UWXH 5L0QB 5FIEA 2AMUA 4XXWC 1L6ZA 3ZX1A 1BLIA 5LGHL 3KYMA 3FTZA 3K81A 3B9KD 3IGKA 3I3DA 4HS3A 3EFOA 2C4FT 4LPYA 5DD1L 1P7QB 5AW4B 2D4FA 3N44F 3U7YL 3W0WE 1TR7A 2IDUA 1DSFL 2WWMD 5CZVL 1K3IA 3KCPB 1TTBA 1MJ7H 3NFSL 5B3SB 1E27B 4QLRA 3CGTA 1FV1A 2PCPB 1LDPH 1EHKB 5AW5B 1U8CA 3IMWA 1F4XL 4BEIA 2G4EA 3DYPA 4NKOB 1QFUH 3LKNB 4PGJA 4KMLB 1V3KA 3STZA 3MODL 2EILB 4PYGA 1UH4A 1DQLH 5HHNA 1SM3L 4EUPB 2PYFA 1A66A 3O4LE 4ZS6C 4FLSA 4YFLF 1X5GA 1KELL 1Y0LB 3DOHA 3FHAA 5D70L 2JJTA 1VFUA 2W0PA 3PWPA 3BP7A 4TLUA 5JZ7C 5SV3A 2QBWA 4XWGL 1HHGA 1T4WA 2C5DC 5I6MA 4GQPH 1U8JB 4NLAA 3VWJD 2BCMA 1M1XA 3SJVE 3E38A 4P3DA 3MR9A 3QDGD 1ZT4B 5FUOH 1C9SA 3SPCA 3ARBA 2Y6SD 1IGTA 3MKKA 2B1HL 5EUKB 4IRZH 4N28A 1OAXH 1S3RA 3D09A 3HC0B 2GKIA 2WNGA 2EDKA 2NR6C 2X4QB 1JPEA 2IWEA 3LRSA 3EJQA 3BESR 4QCIA 5DK3A 3UABA 3EG9A 4J4PA 4Y9CA 4U6YA 5KSAB 4UOQA 4Y5XB 4EPSA 2VSKB 2DQHL 3WTVA 2IC2A 1OP3K 1DP0A 2PO6A 5ESQB 1HDMB 3WNIA 3KBFA 4QXUH 4ZW7A 1C7SA 2OMVB 1B4LA 2PW1A 4P23C 2PPFA 4UQBA 1KLGA 4POUB 5E6IB 2X2HA 5B8CC 1XGRA 3UZQB 2B7DT 1E4JA 3LEVL 1BAGA 2X1WL 2V8LA 1RFDL 3ARUA 1R5VA 4P9HH 2XZQH 1DVFA 3D33A 2JQMA 2X2YA 2BW5A 1SJEB 1XF2B 5HY9A 3QR0A 4H8UA 2ZYIA 3CH8A 3ZDWA 5DTFA 3V6ZA 3F7RA 2IFGA 4CSTA 1K3ZA 1F1DA 3DOSB 3F58H 4Q7DA 4TVSa 1HL8A 2WTRB 3EF4A 3NK4A 4MJ4A 4M3KB 4PJEF 5BZXA 4ETQB 4P2RE 4DK6A 1U8IB 4NO3B 4YDVB 4YLBA 4MQ7B 2X05A 3HPLB 5T1MB 3ABGA 3EJTA 2AJXL 3QFJB 2LLNA 3VFVA 3C6LB 3AU0A 3JWNG 1O7SA 3ML8A 3V6OC 3CZKA 4PP1D 3FOLB 2NCMA 3EJZC 4UANA 2HUHA 1MCSA 4HUNB 4YHPA 1VDGA 5A3ID 5T5FL 2EO7A 3FSZA 3UJIH 1KXQA 1MW1A 1ED3A 4XO4A 3VI4B 1A64A 4EDXA 2N1KA 3VXUD 2K6ZA 1WA0X 5I19L 1K6QH 1JK8A 1ZS2A 4A66A 2AS5M 2GY7B 5FDYA 4IBUA 1H6UA 4LMQE 4NJAH 4OBSA 3OR7B 5ECJE 1JWMB 4B5ZA 5A7BA 3TZVC 1YYML 5I9QC 4RESB 4UQ3A 1NJ9B 5E4AA 4WSJA 3RIAF 3NK3A 2O93L 1ZLWH 4F9LA 1OOAA 1L9RA 3TCLB 1J0ZA 3LNGA 1WIOA 4XAKE 5F8QC 4LKCB 4XMTA 4YHLL 3JWDL 3TEZA 1BXVA 1KXVA 3WTTA 1UACH 3UYPA 5J56B 1TSRA 2AJ3A 4F33A 3IFLL 3WHE1 3P4LA 3DVNA 3P11H 1ZVSB 1NC2A 4K2UH 4WWNA 2VAJA 4NERA 2VUKA 5IB3A 5TGBB 1MJ8H 3G6AB 4D3CL 2VERN 1O5DT 3V6OE 1QLFB 2K3TA 3MBEB 1JZEA 4Q74A 1F11B 3QJZA 5AYUL 1SQ2N 3QORD 1NWPA 3A47A 2PYEA 2UZPA 3CVHB 3GHBH 1GGBH 3WTSA 4ZX4A 3WTYA 1PCXA 3ZYIA 1JF1B 1IGYA 4GRLB 3AXHA 3OR6B 5BQ7B 32C2A 4KKCC 1XGYL 2QSVA 5DJZB 5DT1H 2MNJB 4KZDH 1U93A 2GSIB 4YHNA 2MEJB 3RGBA 1OGSA 2GBAA 3THMH 1MCJA 1G7HA 3QJSB 3GEFA 1JIBA 3D0LB 3WFZA 3WEAA 3D85B 2JJTC 3U0PB 2V0AA 4IOSA 4K3JL 1UASA 4GKOA 2YXMA 2YPKB 3AB0C 3N85L 1DJWA 4OGXH 3CZJA 5L7XH 2VN5A 1RPKA 5I0YA 1QWUA 2H32H 1DQVA 4XMUA 4GS7B 4X80H 5FYKD 2N0KA 1KYOK 5EH1A 1KIRB 3K80A 3ZKQD 1Q9KA 4YBQC 5HI3D 1FH5H 2EDMA 1INDL 1D2PA 5AKRA 4OM1H 2F53A 3VYOA 2WGXA 4TQ8A 1JVKA 1FL5A 1NAML 1QSFA 2Z92A 4KK5C 3IFPA 4J4PC 4JNXA 3UXFA 3H9YA 4WI9A 3CUPA 1JGVH 4IRZA 5KVEH 4KX7A 3EO0A 4F58L 1FO0A 3PXHA 2PO6C 4F57H 2A77L 4X6CB 1I1RA 2J3SA 2D9CA 2VLKB 2X89A 1UT2A 2OA9A 2H3XC 4AKPA 1QA9B 3MXVL 3NJNA 3FUNA 4QPEA 2EKSB 3GMQA 3NSDA 5DZJA 3AY4A 3U2JA 3I2CH 2J6EL 4HAGA 1QYGH 5C6TL 4KKBC 5IJKA 1DVFC 2YOCA 4K73A 5B1JA 4AYDC 2YPLA 1RV6X 1K4DB 4R96A 2XYBA 4FF9A 3ABZA 2AANA 4X7EC 4KFZC 3L6FB 1MVUA 2WOYA 3TS8A 1I9IL 2VSCA 3BUDA 2ZUWA 1UT1A 4U1KB 1YNKL 4I77L 2QPUA 4PJEE 1PCSA 1N4XL 3DRQA 1Z3RA 1KCLA 3GZOA 2HSIA 4OZFA 4XBGA 2DL2A 5E5MB 2WJ5A 3CCHB 4UU9B 4EZJA 1YEGH 3UGUA 3IRPX 2CPCA 3TPKA 1JK9A 1YEWA 4M6AA 1XTLA 4GLRH 4JN1H 1CTNA 2AAAA 4NM8H 3SYOA 5H4ZA 4Z7UF 1U91A 1C1EL 4NN6C 1BOYA 4JRYD 5KVDH 4KO9A 1H5BA 4MNGA 1KZQA 4LP8A 3SE4A 2JJWA 3HW7A 2H1PH 4U6VL 1RULL 4HBQA 1LWHA 4LLMA 1PQZB 4MNQD 2WAQA 5DZAA 4YHYC 4PUBH 3AS1A 3AZUA 3BQUD 2WTOA 4HK0B 3RY4A 5L2JB 4MMZA 3MBWA 3DRTB 2FHCA 3O9WD 5JTWA 4XPHL 1INQA 2A9NL 2G75A 1WBXB 3FPYA 1OWWA 1I8KA 2VDOB 5DRZB 1I1AD 1TKWA 3N50A 4BCZA 4EE2A 4F9LC 1BXUA 3GQFA 1E2WA 4J3SA 4XPGH 3DIFB 3WNNA 4F93B 5EEUA 1CFVL 3GSNH 5LGJA 1S9YA 5D72H 2C1OA 4JANB 1EVUA 1Y6NR 1CZ8L 1ZVYA 2QMJA 4OZHA 4U2ZA 4AITA 3HE7B 1IBHA 4HSAC 4PQXA 4EKXA 4NO5B 1E8XA 2NY5C 3C5ZD 4NJ9L 2ICWJ 5K39A 1ML0A 2OR8A 3QIBB 3WJMB 1EJFA 1NEZB 4JM2B 3U1SH 1KXQE 3NIGF 5DQJA 5I18L 1MVFA 2G5UA 2BP5M 2XWCA 5DC9B 2WWKO 4L9LA 4L1TA 4PSPA 5IUSA 1CD1B 4ZMPA 4Z18A 4LOVA 5D7KE 1T4KB 1CGXA 3JWOH 3VTAA 5E4OA 2BJML 5FYJE 1PZ3A 1KIQA 4ZOBA 4PTUB 3L9YA 4J8RB 3T4AB 2IBZY 3RBGA 4IRJD 2IOOA 2K8MA 4PJDB 1PLGH 3TCTA 4L3EA 5HYEA 2J57A 1ZA6A 3QQDB 3Q7JA 1W72B 1F3DH 4UYPA 1VFAB 2CUIA 2JB5L 4RMUA 1GS8A 3HA0A 3US9A 1Q1PA 2CQVA 4KKAC 2EJ1A 3SGEH 4MA3A 5DD0H 3WO3B 3D2UB 5JYLA 2OFQA 3MLTB 3KWTA 4M6MH 2XKNA 2A6JA 3B5TA 5JHBA 4JFDA 4K94H 2AQTA 4OZHF 3U0TA 1HWWA 2H1XA 4P2QA 3VYNA 2HRLA 4M4PA 5EOQL 4DEPC 4NKIH 5ALCL 2K45A 3OXSA 3UACA 4F91B 2PYEE 1YY9D 2BVOA 3KPLB 3UAEA 5D5MA 2AV1B 2X4OA 3F8UB 3QUXA 4F80A 3IJYA 4L4VD 1CI5A 5HHME 4AMXA 3CC1A 1UWFA 3EW3B 5KVGE 2TRYA 2BVQB 2B15A 3RVWD 3UTTB 4URKA 4MASA 4G7VL 2R4RH 3CU7A 4FHJA 5DJCB 2AXJA 3ELQA 3BHBB 5E1AA 4PY7A 3VH8A 4KUCF 3O45B 1PD6A 2ZXAA 3DJSA 4PJ8A 1E9QA 2VDRB 4AIZB 3AY4C 2UX6A 2W07A 4N6RB 1SXZA 4KJYB 3WELA 3VJ6A 3OKNA 5FGRA 4AYEC 4JHAH 5IJKC 5B1JC 4HXBH 2X1PA 2NSMA 2RFXB 5TDOB 2CHWA 1CFNB 3T0WA 4C59B 4JFPB 1A4KB 1GZPA 2AJZB 3ASOB 3PGDB 3BSHA 4HH9B 5GRUL 1VAHA 5B7EA 3VFUA 4PG9A 2VL5B 3WGUB 4HULB 1AZNA 5AYTA 2JJUA 5GS2H 3I02B 4FEMA 2ZXCA 3EUUA 3HI6H 3IFNH 2DQ6A 3EJCA 3OB0K 1E5YA 2YAHA 4P9HC 3BVNB 4S1SL 1QSFE 1IIIA 2DJMA 1ETZB 1I8LA 5D5MF 3NJLA 3NJJA 1CYGA 1M05A 4PJFB 4X98A 3SDAA 4AXWB 3VNZA 4N22A 4Z7UE 1KJMA 2UYLA 3KPQA 5HYSG 3DO7B 1I9JH 2QKIB 4MMXA 15C8L 2AK4D 3V0JA 4A2MA 3WOVA 4XP1H 3TTYA 4J3BA 4KFMA 5DMYA 1OZUA 4MVBD 4A2FA 2GT9A 1H5BC 2Y3NA 3RVUC 3AQZA 3SDDB 3SE4C 4I0KA 1OSPL 3CXDL 2Y7MA 4HIHA 4XCCL 3VXQB 1AC0A 3ULUD 4PJHB 2ZX7A 4QRTB 3ZQ9A 3WDHA 4Z7VF 2DLFH 1CBVL 4HWNA 2YPLE 5C6PB 4F7PA 1HI6B 4X6DA 1TF4A 2D7OA 1OARL 4FQPA 4W81A 3VO0A 4L4TD 4LRNH 4WNSA 2EVFA 1YSOA 4MA8L 3CQPA 3F83A 3WS3A 3RZCB 1X5ZA 4ODBD 4QHPA 5E9AA 4F8NA 4N0YL 1QUNB 3WIHA 4AQEA 2J25A 2GHZA 4KZ0A 4OCRH 3SDYH 4ENEC 3DX0A 4KGLA 2P5WA 3ARRA 1MPAH 4PV9B 5GRYA 1MREH 1AGEA 4XP6L 1NBVH 4HJJL 3B37A 3NQIA 5EIQA 3UTSA 1L7IL 1YHPA 3IF1B 4GMTH 1F6LL 4XBEH 1IAII 4JKPH 3NIGE 3BPNB 4HXAH 1WE5A 2ED7A 3GHEL 1MJ7L 4QXVA 5B7FA 3S97C 3WIIH 4WAFA 4HV8A 4L9LC 3M1BB 5CLWA 1GKEA 2K3HA 2ZPKL 3FUKA 2OSWA 4RGMB 2FSDA 2VLJA 3KJ4B 5MERB 1T2XA 5FA3B 5CILL 3UDWA 5AUMA 1F3RB 2NNXA 5D8JL 1MWAH 3IDJA 3Q6GL 3VA6A 1UUNA 2Y0SA 4O02B 2XVGA 1WJ3A 2X44D 4W9FC 5B4MD 4HG4K 2A9BA 5FAAA 2ODIA 4JRXA 1YNLH 4ZMLA 2X6UA 1AOZA 3BSGA 2E9BA 2ALWA 4NIYE 4OQTH 5T1KD 1DBJL 2AJVH 2UY6A 3TM6A 4OD3H 1ZE3H 2D2OA 4POZD 5SX5H 2A7BA 2WIIA 4OZHE 1RY7B 1CWVA 2BMKB 2HVBA 3CSYB 3FTVA 4V1DB 5C0AA 1XDTT 4DCQB 4UYQA 1TJGL 3U4AA 4NX0A 5JHDA 2QDWA 3TBTA 4NGHL 4QO1B 5F3BB 5HVHB 4YXHL 4XT1C 4KJWD 1AC6A 1MHHB 4P2OD 1CFSB 1OAKL 1SVBA 4X7SH 2V37A 2V5MA 3H3PL 1F4WL 1E6OL 3SDXA 5HYFA 2AK1H 1A4CA 3QUXC 2FEJA 3FFDB 2HX8A 5DZOA 2F7QA 2VISB 1E2ZA 2CU9A 5SWQB 4JCMA 5I30H 4HWUA 1JZDC 2WPGA 3PAYA 2QHRL 4LCYB 4L3EE 1S9KC 3GXIA 4PJ9B 2JSFA 3OMIB 3V4PA 1MAKA 3ARDA 3BFWA 4E5XB 1A22B 1H3XA 1FC2D 1VIWA 5AAPA 4LVHC 3RL1B 2A6IB 4PJ8C 4YSRA 5SWSA 3T8VA 4ZNEA 1V55B 1RL1A 3OF6A 3FU6A 4OLZH 4TTDD 1WCQA 2ICES 4JFDE 3OAUL 2F08A 3I75A 4X8JB 3MNZB 5EIIB 3MBXL 3PWUA 3UBXI 4LVOB 2XA8H 3GIVB 1JZ2A 3VI3A 3CPLB 3IAGC 4YSUA 1VACA 3FBKA 1X7SA 5CINH 1NCUA 2A4CA 2VLME 1QO3B 4WJKB 5D5ME 4HFUH 5CBAB 3D39B 4A6YB 2X0UA 5T8IA 3SDXF 4XPTH 3BGFC 4Z78A 3SDAC 3O6LL 1GGTA 4D0CB 2OMYB 3DI3B 3VMNA 4B9YA 2YK1H 3S34H 1CDIA 3DMMB 3DX7B 1IAIM 3FO9B 4MMXC 2OR9H 4PW9A 4F2EA 2F7IA 1AXTH 3OWRA 1Q38A 4PAZA 5LN8A 2VC2L 4Z7VE 2DIBA 5TD4A 4IGBA 4B50A 5KVEE 3LSOA 3K2UH 2OTUA 5IFAH 3MV01 4MYPA 3PLYA 3IXTB 4WLCA 1G43A 1CE6B 4UT7L 5LXVA 3OJDB 3IJHA 2NMSA 2AC0A 5KJ4A 4D9RE 2DEWX 4PMFA 5DQDL 3NEOA 3FT4B 3VI3F 4KI5D 1K4CB 1BQHB 1XIWD 4XVJH 5H2BA 2APWA 3AU1A 3HR5A 2BSRA 3IDMB 4K5OA 4G1MB 5FYLH 1TIUA 5IROA 5M94B 2I07B 4Z0XB 2N3JA 3QZPA 4XVSL 1GIGL 4M29A 2Y7QB 1G7MB 2EEBA 2MOGA 1T20A 4YE4L 3TEWA 3OZ9H 4KO5A 3P11L 3ZR6A 5IMKA 3ZDXF 2JB6A 2WJ7A 1BJMA 3RTQD 1U8HA 1EEYB 3B1TA 2JI1A 2QADC 2XVLA 5IGXH 4Z7QF 1RZKL 5T1LA 3TYGH 3LHAA 1HINL 2BIIA 3QG6A 4FQLL 3GHBL 3TASA 1IKNA 5IOPB 1FG2B 4U3HA 2HKHH 4KX9A 5KVDE 4DGIH 4HU2A 4G80A 4M8RA 4JG5A 1UD8A 1BJ1H 4QHLA 4ZOCA 2ED6A 2WGNB 4EOWL 4AEEA 4BCYA 3ULVH 1N26A 3FQ4A 3QA3B 5KN5A 2P49B 5DK2A 1QRND 4DKAA 4D9QE 3WV0A 4Y1AD 3DXAD 3GNML 3QJFA 4JHBA 4NZTH 4G7YL 4G8GB 4YDLB 3LJ3A 3ASNB 1BYPA 4OM0L 4F2ME 3WJLA 1EMTH 3HRZB 3LNDA 1X5AA 3NCYP 1FYTA 3H2QA 4Y4FA 2IGFL 5L7XL 3UTZA 4OQTA 1I7UA 4NQDD 5J6SA 5I0ZA 1QNZH 5C0GB 3C87A 2P5EA 1I85A 4CMHB 1LLAA 1ZCRA 1NUFA 1YECH 4K94C 1B4RA 5E1GA 5ICYA 2VLJE 2WCPA 1I8AA 4GXFA 4Y9BA 2JIXA 3RG1C 3X3GH 4DZBA 3ISRA 2FBOJ 4PLOB 2DWSA 3KBPA 2WQWA 1W0YT 2HN7A 2HB0A 2APSA 4JRXE 2WYTA 2L7UA 1G1KA 3ARDC 1AZCA 4DKDC 4F57L 5DD6B 4HKBB 3C5XA 4UOZA 1WAEA 4R97B 3TIEB 4DN4H 4YJZL 4YDIH 3C5SA 2NT1A 4BSWA 1I9EA 5C0AE 3U4KA 4G8EB 3UTQA 1XEDA 1S7UB 1DE4A 1EFQA 1NTDA 2YS4A 3FBQA 3L1OL 5EEZA 1GS7A 2YD6A 3P73B 3A6BH 3GRWH 5MENB 3OKKB 3EBHA 4NDMB 4X5XA 4FG6D 4LCUB 1KJ2H 1ZHBB 5GGTH 1P2CB 3PHQB 4K23H 1ICTA 2CRZA 2F68X 4OUOA 2NQCA 3V9EA 2HKFH 4ZMYA 2HMIC 2KLSA 2ITCB 3SDXE 3S3SA 4Z1PA 1A4JA 4P9MH 5T33L 3IBOA 1UXWB 4A04A 3KPMB 3CVIH 4M61B 3S5LG 4YZFF 3B4NA 2BVPB 3LV3A 3P4MB 3H6AA 5KYXB 3INOA 1NGZA 4NPKA 4YXKH 5F9JA 2MQGA 1AXSB 1S78D 4LHUG 2WZ6A 1HQ4B 5SWSE 4ZNEE 4M7JL 5KYUB 4IGBC 3S5ZA 2NY0B 3I6KB 4NSKB 1JGDA 4W93A 5D7LD 2XC8A 3H0TA 5AL0A 1AO7A 5FB8B 4XAWH 3BZ4A 3FCBA 4P4KB 3LEYH 5JO5B 3ZKNC 3H6JA 4N2AA 5E2JA 1X5KA 3VI3E 1UD2A 2V7HB 5F96L 1KJVA 3RX7A 4NOFA 1P84K 3H2WA 2VDPL 5IROC 1HIML 1DVXA 3QIWB 4X7DC 1RMFL 5F9WC 1KWKA 2YGNA 2XY1A 1RUAH 5IVZA 1KG0B 1TQVA 2JKTM 4K3DL 3SO3C 5TDPB 4FTVB 2OMUB 3QCUH 4Z3JA 2UZYB 5D72L 4XN8A 4LHUD 1WHOA 4YHIA 3ZDXE 4GUOA 5AVSB 2BY1A 3DJRA 3V5KB 4MB3A 4MS8C 4P5TA 5BV7B 1RZ8A 5I0XA 4Z7QE 1EAPA 3FQWA 3N06B 1KN2L 2X42A 1AQDB 1ZLUH 3WAJA 1QBLL 2BWIA 2P48B 3U1SL 5ILTH 3F7VB 4L1HA 3N91A 4HZ1A 3BVXA 3RWIA 1UB6B 3VD5A 2W9EH 5HHXL 3WG7B 4JG0L 2BSSB 1IKNC 2QGCA 3A4AA 4G9FD 4JO2H 1DUYA 1NUNB 3FN3A 3EYOA 2IAMA 5FUCC 4BKLA 3JWOL 5CEZH 4ABWA 3HC2A 2Y1AA 3IK2A 5G55A 2V5TA 5E8OA 3HZMA 3LRLA 2CK2A 4JFQB 4CN1A 4HWEH 2EEXA 2B16A 2EE9A 3WKNA 3FW6A 3PABA 3KYKL 2W88A 2F8IA 2AJSL 3GLEA 3KM1A 1O6SB 2W0KA 2X4RB 3GSWA 1EO8H 1RU9L 3FHEA 2J2ZA 5C07A 1JNJA 3NSJA 2XG5B 4GMSH 4MNHB 4AIOA 3B9KB 4HCRH 1ANUA 3HPJA 5LB1A 2DQDL 4P04A 3WJLC 3L7EA 2QHLA 4M6ML 4Y4FC 4TQEH 4C83A 5CEXA 4DH2A 2BSTB 3NMEA 1SRDA 1LEGA 1ZE3C 1VENA 1XGZA 1QLRB 1JPSH 2MRYA 5F7UA 3V5HB 1WRFA 1I85C 1BZ9B 4GW5B 3UPCA 4NWTH 1OAUL 3T77B 2WLLA 3BGMA 2H3KA 5FUCE 2DWEB 3FAWA 1J8RA 3BH9B 3P4NB 1MNUL 2EYTB 2ZSWA 3P1VA 4FL4C 4MXQC 1FLRL 5C8JB 3CBKB 3V7MA 5I5IA 1P9MA 1F2QA 4FQIH 4W9JC 4NAQA 5DRNA 2GB2A 2R1WA 5DS1A 3QEQA 2H26B 2CKNA 2GK2A 3EFFB 3HG5A 4DEWA 3B2DC 2DWDA 2EXYD 3NACL 1FYTE 4JHWL 2X4PB 3E8VA 5KEZA 3RFZA 1MRFL 2R23A 1ZHKB 2MHAB 1WCBA 4H0IA 4XHJD 1WICA 4HKXB 1TO5A 1F6AB 4JPKL 4EI5D 1HKLH 3MV9D 3G9AB 2QSTA 4Q4IA 1WEJH 1A6ZA 3QWQB 4MQTB 4PTTA 4Q0XL 3O6FA 2DYPB 4YZFE 1PKOA 1N5YL 3FQUB 3QRGH 3GRWA 2R7EB 4NUGH 3D5OF 5JIMA 4XMPH 1U3NA 4H8WL 5GGTA 3DX1A 3BDYL 1AI1L 4OJYA 3QAZB 4EDWL 5D1ZI 1YQ2A 5AFAA 5EC1B 3DJ9A 1J1PH 3C75A 3QHZH 4R2GD 4ANKA 4XP1L 3NRFA 4JO4L 3RKDC 4R83A 2QV4A 1P7QA 2E46A 5CNHA 5AZEL 2YARA 5DRXA 3MAWA 3WS6A 4BZ2H 4G42B 1PLBA 5FW6A 3KCPA 1J5OL 1IBGL 1E27A 2PCPA 4CC1A 3W11D 4ERSL 3Q8FA 3RE0A 4NKOA 1UD6A 1QTYT 2D31B 2DQIL 4NB7A 3LKNA 3UYRH 5EZJB 1NCAL 2K0RA 2F5BH 2ZUQB 5CFHA 4EVNA 2Y36L 3HB3B 1E28B 2KKQA 5HGBB 1EPFA 4AYID 5HDQH 2GAZA 4EUPA 2IF7A 2K9FB 5I1JL 1N6UA 3HFML 2O5ZH 1MREL 4I9WE 1Y0LA 5E9NA 4JKMA 1YEHH 4ZYKA 3WNJA 2LGNA 2NY1D 1JPGB 4P5TC 3NGBB 1RLBA 5I23A 5CIPB 1HSAB 2NNCA 3OAYH 4M1GL 3PV6B 4KHXL 3SE9L 1U8JA 1WD9A 3HNSH 4NPYB 2JLLA 1A0QH 2OZ4L 1ZT4A 3PP3K 4B5EA 2XTJD 1HYSC 5EUKA 4ORGB 1WBYB 5GRJL 2IAMC 2ZTBA 3DX4A 5FCSH 2WOBA 3E2HB 4UOW0 3QQNA 3VXUB 3BP5B 4RFEB 2WXFA 3HC0A 1A9VA 2GSGA 5H37H 5TFSH 3R0MA 2BY2A 2NX5D 2HVJB 2X4QA 3VD2A 2KDGA 1QP1A 3MOBH 4H8PA 4ZXBD 4GIPD 1MFEH 3W5MA 5KSAA 3F6LA 4Y5XA 2AI0L 3BKJL 3BP6B 1LQSR 4I8DA 2VQ1B 1WFJA 3TURA 3LKQB 4XWOC 3OHXC 3BVVA 5KVFL 1HDMA 2EEDA 5T1DH 1LP9B 4GI6A 2OMVA 4ALAC 1PLAA 4WFFD 1IFHL 2VXQA 1F2XK 4MZ2A 5E6IA 3NA4A 4P57B 5FYLE 1NCGA 3UZQA 2VDKH 5DMGC 3UEQA 4RCAA 3AUVA 1KSRA 3HG2A 3NEEA 4KJPC 2ZX9A 3Q13A 4FFZH 3WGVB 2M8XA 1CCZA 4H1LB 1SJEA 3QORB 1XF2A 5IB5B 4NZJA 3EGSB 3CN2A 4JMXA 4LPWA 5LDSA 3HS8A 4JFED 3ARGB 3GMPB 1EHNA 5D71L 4A7GF 2BNRD 2WZ5A 3DOSA 2WTRA 3DX8B 2ADGB 1E4XL 3QEUB 5EN2B 1NCWH 1MCPH 1P53A 1P9MC 3CBJB 1U8IA 2E75C 3CFBB 2ZWSA 3PL6D 3P4OA 4YDVA 1DQMH 4YXLL 4MQ7A 4E2OA 2WUBL 4W9CC 5C07E 3HPLA 3BE1L 4IDJL 3QFJA 1U8KB 2VQUA 5DRWB 1OTSC 5A40E 4Y89A 3QEGL 1DN2A 3FOLA 3UYOD 1YNTB 2WZ0A 3L4TA 3RFZC 1TQCC 1AIZA 5J7CC 3C6SB 5LBVA 4R7NA 5DEGB 1I8IB 4GSQA 1X9RA 3O6FC 2EZ0D 5DUJA 3CXHJ 4J2XA 4QY8B 2Z6FA 2WWNA 3WKYA 4HFUL 1JWMA 5L4FA 5L0QC 1NJ9A 4DGYL 2CBQA 2EDNA 5GGQL 1ES0B 3RBSA 3FZUC 4LKCA 1CVRA 3Q48A 3OAZK 4OLXL 2HFEB 4XMKH 1OPGH 3V0WH 5CCJA 3AWEA 3BAKA 4JRLA 4AWJC 1ZVSA 1BBDH 2BSCA 3WS6C 3QEQE 4JM0A 5TGBA 3E3QE 3G6AA 4QYAA 3QUML 1RP8A 1QLFA 2FJHB 3VRJA 3MBEA 1HXYB 3M88A 2F2HA 5ANHA 1F11A 2J1XA 3EFDH 2FLRT 2CSPA 2DI8A 3CVHA 2OMWB 2YZ1A 4KMTH 1JGUL 4XX1E 3WIAA 3JTSB 3H1ZA 1W72H 3STLB 1FAIH 2VE6B 1JF1A 2E56A 4MX7B 4G8IB 4GRLA 4HIQA 3VI4F 1TFPA 4BZ2A 4AMKL 3OR6A 4U1IB 5BQ7A 5DJZA 3ZUNC 5CGBA 1ZLEA 1R3KB 2GSIA 3RJOA 4UDTB 5DJYB 5FXCH 1DEEB 3D0LA 4ZZFA 5L6YH 3D85A 2X4SB 3U0PA 2ZCKH 3ESUF 3RUGB 4A2DA 5EORL 5FS5A 2DLHA 2ZAIA 2YPKA 3FH5A 3H9SB 3OZ9L 1IC7L 3BKMH 5JYMA 3FL7A 1N6VA 1XSOA 1NDMB 2QQQA 5I75B 1ZHLA 4JRYB 1JP5A 2DN7A 3WAKA 4HEMA 4PWGA 2KL6A 2E4TA 3D05A 3VVVA 1KIRA 3GXNA 3ZZQA 3KCWA 4MNQB 3K4DA 3AM8A 2OL3B 2CO7B 3IGAA 1PSKH 4OFPA 3NJKA 2WKGA 3K8LA 2QDVA 3O9WB 5LJYH 4P4RB 4FEIA 1TETH 2VDRH 4N2GA 4AE1A 3VMPA 3ULVL 5KSAC 2BSEA 3BN9D 4Y5XC 1JJUA 1RJYB 1HHKB 3MRCA 4XNUH 2GI0A 5E8NB 4GKZB 4HX1B 2FO4B 4APQB 3BEVB 4X6CA 3VSQA 2VLKA 3Q43A 3P0VL 1AMYA 1O6VA 3V7AE 5E6IC 3E0GA 1QA9A 2EKSA 3KLHC 4KVPA 4R5VA 4IKIA 5DYFA 2A9DA 2V6HA 2FT8A 3C5ZB 2BP3A 2AERT 2P80D 4GQRA 1KACB 2JJVA 3B2PA 5FF6A 3I50L 2VMDA 2AITA 3T5WA 1IKOP 3C6EA 4HPOH 3TO4D 4UT6H 4BSVB 1BEYL 2IBGA 3L6FA 1MF2L 4AL8C 3BKCH 2CLZB 4U1KA 1HCZA 2F5AL 2ORBL 1QASA 2XHNA 1WGOA 5FLUA 2OS7A 1KGJA 4FQJL 3S35X 1LMKA 3NZHH 3SQRA 3GI9H 1PDKA 4F8PA 2ZWKA 3CCHA 3UZEA 2EDWA 4OGZA 4IRJB 3NABH 4KKNA 2VAAB 4TNFA 3KWVA 3C6LC 3ARXA 1U36A 2P8LB 2WYHA 1MDAA 1R5IA 3CX5J 4ACPA 1IAOB 1HX0A 1A1NB 4WEEA 3E6FB 4X6CF 5HYJD 1N10A 3SY0B 3GGWA 1CR9H 4KY2A 3KJ6H 4E9RA 1QG3A 1PQZA 3MGOB 3HLKA 4K23L 1YEFL 3O0LA 4HK0A 5L2JA 2MCAA 3DRTA 1WZKA 1CFMA 4ZW8A 2EQDA 1WBXA 5DRZA 1HH9B 3TC9A 3V52L 4L4VB 2WNWA 3AFLA 3TPUA 2RBLA 2JELL 1UM4L 1NFDA 3DIFA 4FERA 4M1DL 3QYCA 2ZCHL 1OLLA 3WUWG 2X70B 1WC7B 4JANA 1W6WA 3FFOA 4R7XA 1XO8A 5I73B 1OM9A 4NO5A 3QFJE 4OD2B 3OX8B 3DVIA 5F0MB 3MBEC 2OTWA 3QIBA 1DBMH 2WIMA 3WJMA 1NEZA 1RZJC 4OGAD 1X4ZA 3QQ9C 2ZICA 3LAFA 1PZSA 1XBDA 3LEYL 4RZKA 2IDFA 3V4UH 3VI4E 3WEBA 5D1ZD 5AOLA 3KPNB 1CD1A 4OTXL 3GC3A 4GRLC 2N4IA 1OAZL 4GXVL 4CA4A 4L8DB 1Z6JT 2Q2LA 2PCXA 1SF3A 1HVXA 4J8RA 4ZQKB 3QJHB 3T4AA 4QRQB 3BAYA 2IQAA 4PJDA 3MNVB 4HMEA 1JZ4A 4MBOA 4RRPG 1TTRA 4P0DA 3QQDA 3V0VA 1W72A 1XH1A 1VFAA 4ADGA 1VGEH 3KM2A 4BWUA 4R7DB 4NQTA 3VSUA 5DFAA 5LNEA 3D2UA 2CBTA 2W1NA 2OP4L 5ADOL 3MLTA 3TVMD 3ECBB 3BSZL 4RBPH 1J1XL 1QWNA 1B2WH 4JQIH 4GRMA 2NSQA 1HCFX 4KPHL 4KVNL 2MOVA 4GS7C 4DP4X 3W9DB 1Q9LB 1I9RL 3AM8C 4A7SA 3NIDB 1WUZA 2XN9D 4YPGB 4JM2F 2BIOA 3MJ9A 3KPLA 5CEZL 1P4IH 3PWLB 4DN3H 3TA3B 4E9SA 2AV1A 3GZQA 4B53A 1XR8A 4M8VA 3BQVA 1B9KA 2XUWA 2ZJSL 4PBXA 2ROXA 5AKTA 5BZZA 4F8QA 3OB8A 4TSCH 5DEJA 1JD9A 4X5LA 3QI9D 3RWJB 2UZXB 3UTTA 2BP0B 5ACMA 2I60L 5E03A 2DQTL 4GOSA 5CUSH 2X6BA 2WW8A 5DJCA 3BHBA 2VXSH 2O4EA 5HYSB 2XYCA 3O45A 2X53A 3KLLA 1UM5H 1BMGA 2YD5A 4HCRL 4KKZA 3B7SA 4UTAH 1AS8A 2YQ3A 3QQ4A 4N6RA 3P3TA 4KJYA 3VWKD 4U33A 4TUUA 4PR5B 5LBSA 4AJ0A 4ZFFB 2EUZA 2CHNA 1A1MB 4J8QA 3EJJX 4OF0A 1EO5A 1YYCA 1SN0A 4CDHA 4A6YH 1AJ7H 3GKWL 4L8CB 4HEME 5FKPA 4JFPA 1A4KA 2ADFH 2CLRB 1XGPB 2AJZA 1UD4A 3PGDA 2NW2B 4FJ6A 4HH9A 2IH3B 2VL5A 3AXIA 3BIBX 2WCSA 3I02A 4X99B 2WVUA 2CLVB 5D93B 1DLFL 1MAML 3BVNA 1BECA 1XZ0B 4JGMA 4KXBA 5KUMA 1ETZA 3UZEC 3TJEL 5FOBB 2BIQA 4PJFA 4AXWA 1SBSL 4MJIB 1GPOH 5EBMB 3L2LA 1SXNA 1AKJD 1NLDL 4FQIL 3O0RH 2QKIA 3DO7A 4FLOA 4X6CE 4MFHA 5T1KB 2P44B 4Y88A 1NOLA 2B08A 2VLKE 1NBYB 1J9RA 3PPSA 2Q8AH 3SDDA 4S1QL 4WFEE 2VXUH 3VXQA 4A2EA 4QXGL 3RPKA 4PJHA 4I13B 4QRTA 3RVTD 2Q2EB 3QAQA 4C8XA 2YPVH 5G4NA 1E8WA 1GY2A 2BFVH 2N7SA 3M8OL 5M95B 1HI6A 4QD2E 4P2OB 4ZTEA 4IKJA 3BFOA 3ARED 2P4AB 3RZCA 4BFFA 4I4WB 3TJHD 2VYRE 2FX8L 1QUNA 4NQVB 1U3HB 4M5SA 4DW2L 1K85A 3QJVB 4V11A 2M2DA 1A25A 1QPPA 1CXHA 4PV9A 3W2DL 4OCWH 3VSVA 2OJZH 1XH2A 3AQDA 2CJ3A 4Z8FL 3HE7C 2V9RA 2MOQA 3IF1A 4PJFF 3IN2A 4WY7L 5FC9A 5FW8A 1B4JH 1DBBL 3DK0A 4FG4A 4J3OH 3QIBC 5DK0A 2HRPL 4FXKB 4QOKA 4JM2C 4K3EL 5F88B 1LE5B 1Q94B 5GHWL 3JT2A 3CN3A 1ZWIB 2K6WA 2YR3A 5CLXA 3M17B 3QEHB 5K1JA 4OCSL 1JL8A 4PJHF 5EHFA 4BQBA 4K5MA 5MERA 5FA3A 3MQIA 5I1CL 4UV4L 2D73A 3T4AC 3RHWK 4LT7A 5I8CB 4O02A 1T04B 3LMJL 3SPHA 3CLEH 3ZTJH 5AB0A 3LIZL 1YLBB 3ABLB 1ADQL 1OCCB 2XBDA 2CKBH 4IBQA 5EEYA 4ZPVB 1G87A 2ZXBA 5CD5C 1GJWA 1H8NA 2CD0A 4U1JB 1CMOA 8FABB 1H8OA 2BMKA 2DYSB 4L3FA 4V1DA 3FB6A 1QQDB 3PUCA 4FNSA 4DCQA 1WGVA 3KGUA 4D8OA 1M6UA 5CJBA 5ELIA 1CF8H 1QHPA 2AVGA 3Q2VA 3BUBA 4GLRI 4LARH 5BRQA 3NDZE 4QO1A 3TEXA 1KB9K 3FF8A 4PRPD 5F3BA 2G5RA 1KXHA 2B4CC 2F74B 25C8L 3DX6B 4KK8D 3HG4A 4R90L 1DJHA 1MHHA 1CFSA 1FORL 1CXEA 4H44C 3RZWA 3IWVA 4ZFGH 1EFXB 3BRDA 5G4MA 3PXJA 4LO9A 4G5ZL 3LPGA 3FFDA 2TSBA 5TFSL 3S3DB 1DTUA 2VISA 3PWNB 5SWQA 1JI1A 1IQWL 5BRZD 3T6QC 1KCUH 4GY4A 4LFHG 5AW8B 4WW2B 1XIWB 3LRKA 1NLBL 1SOXA 2V2TB 3C09B 4RFNB 4XC3H 4HOWA 3TWCL 4E5XA 5C2BH 5IUCA 4Y4HD 1IGCH 3U7AA 3LXBA 4G6JH 4HDIB 1YDPB 2FYYB 3WSQH 1IL1B 4UAHA 4LOEA 1ZHNB 3EJSA 4U6XA 1MHCB 4XVOA 1WFMA 3KH3A 4PVNA 2VDKL 3UL4A 3B43A 4X8JA 4QLWA 3G04B 3MNZA 5EIIA 4GG6B 2ZP8A 1ZANH 2IVFC 4PY8J 3RTQB 4CGUB 2HJFB 5GJTL 1YYLL 3GIVA 4NO2B 5HD8C 3CPLA 3ML9A 1JRHL 1KYDA 4GW1A 5DEFB 1ZDSA 1N6QL 1MEXH 2BWQA 1MCNA 1DQDH 1QO3A 3TWYA 3FN9A 4LFHD 1KJ3H 3NCFB 4QRRD 5CBAA 2CK0L 3D39A 4PJ6A 4CN6A 2G60H 2XY2A 1E7VA 4D0CA 2O5YL 2OMYA 3U48A 4HF5L 2J1ZA 1N7MH 1MCPL 2C34A 3UTTE 2QKIC 1DQML 3FO9A 1TZIB 2DQGH 4FXTA 3MYJA 1QRNB 3R8QA 1QWHA 1CLOH 4E0RB 4Y1AB 3DXAB 2R69L 4PS4H 3SDDC 4LPVA 1GGIH 4MA1B 5IHZB 5ITBH 3MRQB 5KW9L 5BCAA 2Y06H 1W6LA 3QS3A 1E5BA 1KCRL 1E9OB 1Q0XL 2B8OT 4N9OB 3IXTA 4LSRL 1CE6A 1BVNP 4NQDB 5D1QD 2NY6C 4H26B 1LO4L 3OJDA 3DUSB 4GT0A 3T6WA 4RX4D 3FU0A 3WENA 4C4UA 5E6UB 3RZCC 4BZYA 1ZV9A 1LHZA 3FT4A 3MROB 1MOEA 1K4CA 5BV7H 2H8PA 3IMUA 4G1MA 2XQYA 3LS5H 2AEWA 4YGVB 4K7PX 2ATKB 2I07A 3SPIA 4Z0XA 4BE5A 4PJFE 1KNOB 2QFPA 3B7RL 4NQSB 5I1IH 2Y7QA 1G7MA 4NZRH 2Y07H 4M93B 5ERWB 3V0WL 4Z7OB 3LX9A 4OIIH 3DYOA 2SEBB 3QG7H 3BPNC 2Z93B 1IC5H 5T3ZH 5C0EB 2IWFA 4PJHE 1XD1A 4GRWH 5DUPH 2VDQB 3E9TA 3ES6B 3GS7A 4RGMC 4FP8L 1J8HD 3KJ4C 4KMTL 3MUY1 1GYVA 1RIVH 1FG2A 1R75A 2FJGB 1HXMB 5IOPA 3UBGA 4UUJB 4OFDA 5EFIB 1P7BA 4NENB 1NBCA 1NGYB 1QVOB 2CDFB 3PP4L 4LLUA 3U4EB 1R17A 2IWGA 5FPIA 1JMXA 1TTFA 2G3NA 2H1LM 3QA3A 4HUCA 1WHPA 2LW3A 4JKWA 3HOGA 5FO8B 2D7PA 4P49A 2E47A 2CCLA 4FXLA 4I18B 1KGUA 4OH2A 4U6HB 2EDOA 3KLKA 4KROB 3UH8A 4XPBH 3OGOE 3QDMD 2EIBA 2D03H 2FUQA 3BKML 3HRZA 3EOTH 1BM3H 1I3GH 5C0IB 3WLWD 5HVHC 4AGOA 1EANA 3IDXH 3C5JB 2F54D 4L1BA 4RWHA 3CDGB 5C0GA 4C47A 1PNCA 4UZSA 2DJSA 1YEJH 2GTWB 1QX1A 5F1IB 1BCIA 4UMSA 4BFNA 5DWUL 1TQTA 1DZBA 1GYUA 4Z3GA 4ICWA 4Q58C 4ANWA 1IGFL 2JKWA 3B8YA 3QW9A 3CDFA 3RU8H 3EDJA 3S88L 4DO4A 2OW6A 2AKRB 1FPTL 4LCIL 3S5LB 4F20A 3N40F 1NCOA 2W9LA 4PJ9C 1UUSA 4PYHA 3VE0B 1NPNA 1HOCB 4HKBA 5DD6A 1F4YL 2H0FA 1FH2A 5AENA 4CGTA 1ZV5A 4LHUB 2Z4TA 3GJFK 4V1DE 2ZCLH 2R56L 4EJ1C 4G8EA 1ZGLM 1S7UA 3ZL4H 3A5VA 1J5HA 3P73A 3W1ZA 2COVD 4NXKA 5MENA 1JCKA 3OKKA 1M57B 4NDMA 4AC4A 4LCUA 4LVOC 1ZHBA 4RMWA 5JQ6L 1P2CA 3PHQA 3S3CB 3TBWB 4PI2A 3H3KA 3U7WL 5IHUH 3EYVA 3R1GH 4H5SB 1EAQA 2EIEA 2ITCA 4MDRA 4NHCL 4WI0B 4G9FB 3WE1A 4DVBB 2FNWA 4KC3B 1KYOJ 1MIEH 3TOPA 4KVCL 4CJ1A 1UXWA 3KPMA 4M61A 1UFUA 3OTTA 3ILQC 5DD3H 3P4MA 4XMLL 7CGTA 3NH7L 5KYXA 3IGUA 4MJJA 1AXSA 3HNVL 35C8L 1WD8A 3OL2A 5I1DB 3BCDA 3S4SG 5EU5B 3K4ZA 3N0PB 4Y9EA 2LFGA 3VQMA 4AIXA 3SQOL 4IIZA 3I6KA 4NSKA 3ZO0A 2OMBA 2NY4D 4LLDB 2A83A 3WFCH 5IW3A 1G7PB 2NY5L 3QXAB 4P4KA 3UC0H 2FATH 3ZMRA 4KNUA 5EU4B 5JO5A 1IGML 2DM4A 5E5RB 4RAHA 4WW1B 1HH6B 5CJQH 4Z9KB 2V7HA 5E2UL 3D39E 3QIWA 5CIPH 2EDXA 4E9WA 1SYVB 2GCYB 3SGJA 2BXZA 1KG0A 2WV3A 3X14A 4ZMQA 4YSEA 5TDPA 4FTVA 5KVGL 2APBA 2OMUA 2UZYA 2GIMA 3GBML 3VFGH 4HGWB 1LWRA 1E4XI 1S3KH 4N9GB 2RQ8A 4XP9H 2EECA 3D08A 4D0BB 2NYYD 5FHBL 5GZOD 3WL9B 5LN4A 4KKLD 4UBDC 2D9QB 5K9QG 3N1GC 5E00A 2Z8VC 1AQDA 5I8EB 2WN3A 1DBML 5DXWA 2P8MA 4FLRA 3F7VA 2Q3ZA 1ZDQA 4PCTA 1S9VB 1Z5YD 1UB6A 3VXRB 1GR7A 2BSSA 2MTAA 5F1SA 1CDJA 4EI5B 1L9PA 3MV9B 1RURH 2YSSB 4PS8A 3MA7B 2PKDA 4GKNA 4JFQA 4OZ4B 4AQAB 1E5AA 4OVVA 5E9DD 3OLGA 3JWNH 4U05A 4FS0A 3L5WA 2FLBT 1G5GA 2MCPL 1BMWA 1SJXA 4K5NA 4QWWD 3G5VB 4RVBA 3HR6A 4A67A 4ACTA 4LSTH 3FQNB 2NZ9D 5HJBA 4AK2A 1A7NL 1O6SA 2X4RA 5DJ8B 1IZJA 4O58L 2DM2A 4YDLC 4MNHA 2XG5A 2H0JA 4PREB 1NMAL 3B9KA 1AZVA 4H1LH 1FO0L 1IIKA 2I32A 2NXYD 2XDHA 3CZNA 3HRZC 4NRZB 4R2GB 1SLVA 3UBXB 4RMSA 5GS1B 2BSTA 4ATTA 3PGCB 3IJSB 5ISZD 4ZFZB 4M5ZH 4A7UA 1QLRA 4GP5B 2IWKA 3V5HA 1V3JA 3E6HB 3QQXA 4WFHD 4CMHC 4FQ2L 3QXWA 1BZ9A 4GW5A 5TE4L 4NI3A 1QLEL 2WXHA 1JI2A 2LT9A 3T77A 4HLEA 4YX2H 1EHXA 2Y2TA 1P4IL 1L3NA 1GYWA 2B20A 1M7DB 2DWEA 1KGYE 3D3VD 3V4VB 3BH9A 3P4NA 4ECNA 2EYTA 5EO1B 2JV6A 1P0SE 3L2NA 5C8JA 1KIUB 2IH9A 1QBMH 3F7LA 4FFVD 4GRWF 3DWTA 4R97C 3TESA 1MKFA 4LBEB 4U31A 3SOBH 1AYRA 1MFAH 3ISWA 1XL4A 2OJEB 4R9HA 1FNAA 4G8GE 3B56A 4KK6C 5IT2L 2NY1B 2CR6A 3EFFA 1HSBB 2Z7UA 2DWXA 4BE6A 3U0WL 2DW5A 3U9UB 3GO1H 2X4PA 4Z77B 1LXMA 1ODUA 2OAAA 1DQQB 1ZHKA 2MHAA 2OYKA 3MRGB 3TCXA 4HKXA 4ZUWB 4UTBA 1GGCH 1EZVX 4GH7B 5ITFB 2XTJB 5FFGA 5LNDA 2DYPA 4Z7AA 3FQUA 4QEGA 2R7EA 1WIUA 2XQ0A 3O41B 5DJ0A 2O5NA 3VFRB 1BD2B 3PHOB 3ECQA 3MJGX 3HIZA 2Z7WA 4ZXBB 4HCGA 3RILA 4JRWA 4NCC2 1Q9WB 4I3RL 2OW7A 3ZL2A 4ZQTA 2A3TA 4JPQA 1FL6B 1SXSA 2Q8AL 2NY0C 1AGCB 4G42A 5EA0H 1GJIA 2DQUL 4IJTA 2BINA 4M6OH 4BK4A 4P4KC 1A8JH 3S7GA 5MENE 1N8ZB 3AG4B 2AQRA 2BFVL 3QJXA 4LDOB 2DIEA 4NCDA 5GGVY 4PGDB 4UILH 2EDBA 1S5IH 3TBCA 1KTDA 2D31A 3FO0L 3BJLA 3ENEA 4Y1SA 5E2TL 2CIKA 5EZJA 3WNLA 2I9LB 3QYMA 3RY6A 3QIWC 4BGDA 1E28A 3MNWB 3BFQG 2GIXA 2KZ1B 4JFEB 3SGJC 1TZAA 5D2NA 4ZUTB 2BNRB 4TNEA 3VGDA 4GO6B 5IB1B 2OJZL 4EN3D 1WBZB 3IAPA 4L37B 4B7LA 1GW6A 1OP4A 2FE0A 3F2LA 2DKMA 2C9VA 3PL6B 4ZSOB 1JPGA 1FZOA 1O75A 1JNHB 2BIMA 5BV7C 2I26N 2BH0A 3ARSA 3KPSD 1B4JL 5CIPA 1HSAA 1JZGA 1OZTG 2OL3H 4X7CC 1KLUB 3PV6A 1R3LB 4N5ED 2JXMB 4XNBA 3QZWG 3VXMD 5IR1B 1T1ZB 2A1WL 2XWRA 3PG2A 4Y4KD 2X4TB 4NPYA 2DB8A 1J12A 1B0IA 3Q01A 2DJ4A 3CFMA 3SHSA 4ORGA 3VXUA 4RFEA 5EU7C 4RNRB 4D0DB 1QRKA 4PJ5D 2HVJA 2ZXEB 3OVUB 4QRAA 2GC4C 3WMSA 4FRWA 4AEIH 5BVJB 1HHJB 3HBPA 1QMUA 1WWBX 3BP6A 1OM3H 4OLYH 4ZS7L 5BW7A 4O5LH 3D9AL 3LKQA 1KB5A 1HAWA 2A4ZA 3HI5H 4WWKA 4K9EL 2DDQH 2QSCL 3ZE2B 1LP9A 3B9KC 2DQCL 4UIKL 2Z35B 1BDYA 2GEQA 3IETA 3N9GL 4BZ1H 1G6RH 1TDQA 4P57A 4QT5B 1N70A 2ESVD 3ATFA 2P47B 3MLUH 4G7QB 4J27A 4N25A 4LARL 2CIIB 2KMWA 1QFWL 2WWMC 4OQ1A 2XSKA 3U83A 5KG9B 5LLIC 1J87A 2I25N 3QULB 3S37H 5E8DL 4AUYA 1CGYA 1KCSH 3EGSA 2H2SD 1T3FA 3GMLA 3X12B 1X7QB 3ARGA 2WQVA 4F5CA 2Y1VA 5T3ZE 3L5IA 1TTCA 2DLEA 3X1FA 4GRWE 1YEKH 3DX8A 1IGJB 2ADGA 1LYQA 3B6SB 2X2UA 5L9DL 5EN2A 4JEGB 3CFBA 4HG4J 5DCCA 3Q5OA 2P28B 1BA9A 2E27L 1U8KA 1Z32X 2BNQD 3IRZA 3OG6B 4NXSA 3TNMA 5F9OH 1AQKH 4PHXA 1YNTA 5K59F 5FGSA 1R4XA 4LAQL 1M53A 3EGXB 2PP9A 4GSDL 1XL6A 3C6SA 4ZUVB 2V3EA 1LDSA 3VGBA 3ZRCC 1I8IA 4RWYH 1S7XA 3BGAA 2ADJB 4DSYA 4BHUI 4BKSC 2BHZA 5IQLA 4QY8A 3UO8B 1MQ8A 3L4YA 2CR0A 3QAZC 2CH8A 4IOFD 5KSVB 3SEPA 1KY7A 3QDAA 5TF1L 3TN0D 5F70A 1LQBC 3HUJB 1U92A 4KGJA 4ZAKB 5KJRL 4ZFOL 3WIHL 1EEUA 2HFEA 4FOMA 5EC2B 1OSZB 2WXNA 5CJXA 1TO4A 3TFKD 1PVHA 3RDTD 3LH2L 3P9MB 4OGQC 4P3WA 4K55A 4WEBL 4X6EB 1G9NL 2Y9RT 2QVFB 3U9PH 4F37K 2Y06L 5JUEH 2CNZA 4NKMB 4BQCA 2FJHA 3ZTNL 3P0GB 1AD0B 1DSYA 1FE8H 1HXYA 3H42H 1MHPL 2D7QA 1AE6H 1T0OA 4I7ZC 1YNTF 4BH7B 2OMWA 3PWVB 1TZGH 2BPBA 2FL5B 3JTSA 2VIRB 4O2CB 5CN2A 3STLA 4MX7A 1KGCD 1F8TH 3EOYG 2VH5H 2VM4A 4G8IA 2ZUQC 3TO4B 2DTML 3RY6C 3REVB 3HB3C 1E5ZA 4U1IA 1JGLH 1UT9A 3ZUCA 3MLVH 2CUHA 4JN2B 1KCBA 3UAFA 1R3KA 3LS5L 1N67A 2OM5A 4UDTA 4NAJA 5DJYA 3ROOB 1DEEA 2CO2A 2OZNA 2QJDA 4WNJA 3BDBA 3ULUH 1KEGH 2AW2A 4LEBA 1YUHB 4NZRL 3RUGA 3LHPH 3NGBC 3POHA 3H9SA 2E7LA 3UIZA 2EUXA 5EBWA 2VLRD 1KFGA 1G9MH 1KFAH 3A6OA 3K74B 1XHHA 1NDMA 4G6AD 4PP1C 4JRYA 5I15L 2Z64C 1J5CA 3EJRA 5A3IC 1SHSA 5HYJB 3KWWB 2GUOB 3PJSB 1RQ5A 1XF3B 1CL7L 3P3YA 3E2HC 3MOAH 3DYMA 2WLNA 1RIVL 4MNQA 1HZKA 2OL3A 2R27A 2CO7A 2YD4A 4MAYD 4OCXH 4ZX6A 4M43H 2XZCH 3LKOB 2PPEA 3LKPB 2Q7YB 1AZZC 3O9WA 4P4RA 3L3IB 1RJYA 4J3TA 1HHKA 5BW7C 5E8NA 5FO2A 4GKZA 4HX1A 4WWKC 4APQA 3FC8A 3BEVA 4BGLA 4XTRC 5F97E 4XNAA 2R0WH 3BUQA 4KZEL 3JWNC 3OBAA 5AW6B 5AW7B 4GXUN 2LOEA 1I3GL 4I48B 2KLRA 2QSQA 3QDJD 4NCC1 3RUGF 5C0RH 1E42A 1L9MA 3ZKMD 2X10A 5SWZD 4F37F 2HG0A 3ZZ1A 5EOCH 1KLFB 1ZTXE 3QORC 5EO0B 3UG3A 4BSVA 4BZ1A 2ED8A 5BNXD 5JXAL 3DPBB 3QB7C 3V5DB 1TPXB 2CLZA 3ARGC 5D1ZB 3CH1B 3E7JA 3VXUE 2J5LB 3K2MC 3BH8B 3Q5TA 4MMYB 4PJGA 1NAMB 3TT3H 3ZDYB 1IC4H 2WVTA 1HZHH 1CXFA 2X1OA 3QARA 3WMPA 2PF6A 3L9EA 3TPUB 4IRJA 4DO5A 2PR4L 2VAAA 4NQXB 4DGUA 2QTVA 1ZVNA 3WUWB 5K59E 1Q0YH 3RNKA 4MJ2A 2P8LA 1MW0A 1IAOA 1A1NA 3E6FA 3JWNE 4ZTPL 5LAXB 3SY0A 3TVMB 1E65A 4CC4A 4S0HA 1BG1A 3VGEA 4UM9D 3C9NA 4OFKA 1AS6A 3MGOA 4Q14A 4U1HB 5D7JD 2IALA 5DJDB 3FJTA 5IHUL 1EGJH 1JPTH 1U2YA 4TN9A 1CDHA 4N1HB 1CXKA 2XN9B 4HP5A 4NO0D 4F5CE 1DJXA 4FZEL 1J0JA 3BVDB 3C8KA 3FDWA 2DKSA 1J1OH 4JDZB 1DANU 1DFBL 4LNRB 2WXJA 3IDUA 3QI9B 4NFCA 5CJXC 2JWYA 1WC7A 2X70A 4WJ5B 1WFIA 3Q06A 4JO3H 1SLWA 4G5AA 2C9SA 4OD2A 2XPYA 4UINL 4UV7L 3OX8A 3SBWC 4TOYH 5I1AA 2BNUB 1RLWA 3IT8D 2KZWA 3CFUA 1NICA 1LE9B 4P3CL 5J9PB 3MRIA 3P2BA 3VWKB 1DANT 2NXZD 3FRPG 1F4AA 3J7HA 1CICB 2E7HA 2UY7B 3B9VA 2FATL 2IDCA 4Z76A 2Z31A 2DS4A 3KPNA 4NP9A 4MYWB 2B14A 5FYKE 2F15A 3ZYZA 3ULVD 4L8DA 1IO4C 3FTXA 5L2KD 2QQNH 2HTLC 3EYSL 4ELMB 4XNYL 1JRHI 4ZQKA 3QJHA 4KOCA 2B1AH 4QRQA 2IQ9L 4G6FD 3MNVA 2GK0B 1NCTA 1MLCB 4HJEA 3QP3A 5DD5H 4XX1G 4R7DA 4V2CB 4YUEL 5LCVH 5FGBA 1S3KL 2E7LC 5CKAA 3MCYA 1AKJB 2QQLH 2K1MA 3ECBA 3WEOA 1USQA 3C2AH 3NAAH 4H13C 2K6YA 5I75C 2UX7A 2X1QA 1J05B 5EZLB 1IM3D 2DZEA 3EGDB 4YDJB 2R8SH 4DP9X 3HJ0A 5D1XD 3W9DA 4YSCA 1CTMA 3K8KA 1MJUL 3BVTA 4YPGA 4A2LA 5KVMC 5KSBB 3FT3B 3TA3A 5CJOL 3O9WC 2BVTA 2X7LB 5C1MB 5EZIH 1A65A 3FULA 5I1LB 3AREB 4ODSL 4IK7A 2H0EA 3RA7L 3VXSD 3ZMNA 3L4ZA 1RUQL 4AYSA 3EZJB 1SXCA 4PB0L 3RAJL 1P84J 2PWDA 2UZXA 3RWJA 2BP0A 4APQC 3OV6A 4ELKB 3BKYH 1H8LA 3LNIA 3WKPA 4KITB 1A3RL 1YEEL 5HYSA 1DLHB 4J7RA 4DVRL 2J88H 3RGHA 1NIAA 3RUGE 1C5CH 1YVLA 2V3DA 1IAMA 4NKDB 2ZWYA 3OPZH 3SOTA 1UH2A 4ZFFA 1IBDA 4PR5A 1MQKH 1N19A 3AACA 3C5ZC 3EJPA 4P5RA 1MLBB 1A1MA 2HT2D 3NJIA 4JRYE 7FABH 3OMAB 2VXVL 3MRPB 3HMWL 3WCYA 1UH3A 5KS9F 5MHSD 3FT9A 2MQCA 4L