1OT4A

Solution structure of cu(ii)-copc from pseudomonas syringae
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Strategy for the NMR Characterization of Type II Copper(II) Proteins: the Case of the Copper Trafficking Protein CopC from Pseudomonas Syringae.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Metal binding protein
molecule keywords Copper resistance protein C
total genus 7
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ot4A00
2WQWA 3BCFA 2OMZA 2WQXA 3BC9A 4CILA 2OMTA 2OMUA 2C9QA 1IX2A 1H6UA 1O6TA 2OMXA 3FAXA 1M42A 4AQ1A 2YA1A 1XEUA 4CC4A 2Y5QA 1O6VA 1LYQA 1M9SA 3BCDA 4AW4A 1H6TA 2UZYA 2OMVA 2C9PA 2WQVA 3FAWA 4CC4C 2OMYA 1O6SA 1NM4A 5ICUA 2WQUA 2UZXA 1OT4A 2RA1A 3BZ5A 2C9RA 2OMWA
chains in the Genus database with same CATH superfamily
1ZGLP 4JFDE 1Z9MA 2VQ1A 3VFGL 3N44F 4L0PB 5IJCC 3UPRA 4EIGB 4J12A 1FYTD 5GJTH 2ZUTA 4XP9L 2FJFA 4QY8B 3JT2A 3FK3A 4LSVH 1JPSL 2HJLA 3CN0A 2G0KA 1WFMA 4KTDH 4F58L 2K1MA 3VFVA 5JDSB 1CT8B 4WO0A 2X38A 1KBBA 1W9XA 3MRMB 3NRPA 5I8KH 5D71L 2XG5A 4FXLA 4MJ5B 3C5ZA 1SFDA 1ROWA 2FX7L 5T5NG 4BDVA 4PRNA 4DQAA 2BP0B 3NABL 4QOKA 5IB2A 1KTLA 3ARZA 5C6WH 4D9LL 5B3JE 2W81C 3MDJA 1BQLH 3VH8G 4YJZL 4P2RA 4DPAX 4Q9QH 2BSTB 3NRQA 4KDVA 1R46A 4NI3A 1KDJA 4WCYL 5F0MB 4DZ8B 4W1TA 5HYJA 1Q94A 4JRXD 2Z4TA 3QDMA 1HK6A 3CUPA 1OKEA 3DVGB 2V0AA 3FCTA 2O61A 2RHEA 1FGNH 4PWJA 4Y19A 3CN3A 4FQIL 5KS9A 5INDB 2QLYA 5HHXH 3CHXA 1T0OA 4W9KC 3BIKB 4GMSH 2WXGA 3HVDA 5BZDB 3EJCA 1QA9B 3M45A 2E8ZA 5C0CB 1UWEH 2R56L 3MJ7B 2QVTA 4OI9A 3ROOA 5IMLB 1GOGA 3FO2A 1OGAE 4EDWL 1B4JH 2OKMA 1Q4NX 1WBXB 2C3XA 4XO3A 5AEAA 3U0TB 4YX2L 1OTUD 3V4VB 4OAWB 5T8IA 4GS7B 4MMXA 1SYSB 5ISZD 3UJTH 4MNQA 2TRHA 3IE4A 1ZLUH 2PNDA 1BECA 1UWFA 4ZOBA 4FQQA 4JHVA 1T21A 1J0YA 2DQGL 4DO4A 4GQZA 4MMZB 2HFEB 3DARA 4O02A 3S7GA 2LOEA 5EUOB 2Q86A 5M94B 4HJJH 1HQRB 3EG9B 2EIMB 3RWIA 2IQAA 5GS1A 1IAIM 2FD6L 2UWEB 4R4ND 5I66B 4HV8A 3HN3A 2J56A 4ZSOE 1BQUA 1IFHL 2X1WL 5E70A 5DGQA 2GW5A 3HUJE 4MD4A 4Z76B 3UPAA 3WD5H 1YEWA 2QKIB 2VGLM 1PSKH 4P23C 1I8LA 3CAFA 2OR9H 1AGEB 3LNHA 4GSUA 3IDIB 4PRDB 1ZVNA 2IOMA 3A4FA 5E5UB 2IANB 3NSYA 2DKMA 1IKFL 3H9ZA 3IXTA 3QXTA 1EANA 2QGCA 3QUYD 4BCZA 4KKZA 5J5EA 1XCQB 4PJ9D 2AQ1A 3DUUA 1MH5A 4CMHC 1CE6B 5FOJA 1RL1A 5A16A 2IDSA 1OSPH 3H9YA 1ULVA 3MACL 4A38A 1TTUA 3PDGA 5EBMB 3TH3T 4AX3A 4BGDA 3KWUA 4S2SA 5C0AE 3UMNA 2A38A 2ZUQB 2DMGA 1IV8A 3KE0A 1CYWA 2OTUB 5DCCA 5EBWA 4TNWK 2X9WA 4UQDA 3MV9A 4LVEA 2H3NB 4TQ8A 4GT0A 3O0RH 3L7FB 1FNEA 4M5ZL 5E4EC 5CJOL 4MBOA 1AYRA 4Y2DD 4G7QB 1INDL 2LFEA 2G4GA 1RIVH 3I75B 3N0AA 3MZGB 4GG8A 5PCYA 1M7IB 3WHE0 4WHYH 5HHQA 2WLLB 3FB5B 3FQ1A 3OAYK 4ZMAT 2YD4A 1F1DA 4K5LA 2GG1A 1X5HA 5CJQH 2YA0A 1LHZA 1KYDA 5GSVB 5EWIH 1I7ZA 3BUDA 4ZFOL 5FO2A 1WBZA 2R4RL 4LPVA 3DHMA 1S4IA 5EV7A 4FCAA 1OT4A 4F33B 3MFFA 5JW3L 2I7OA 2PO6B 3BP5A 4CL7A 5KSVB 4NUPA 4JRXB 3UGEA 1IGFH 5DR5L 2YK1L 1HJCA 2AJXH 3VD9A 3L1OL 3W39A 3K46A 1QZ1A 3QEQB 3UAJD 1WC7B 1Q0XL 4XZUB 3QFJB 3RY6C 4ODWB 1GJWA 4YXHL 1OTTC 2AC0A 4JM2C 5DZVA 3O2DL 4AL8L 1UASA 3EF4A 1SM3H 2D9QB 4GMSL 4FFWC 2Z3FA 3CZSA 2UZYB 5E1AB 5F9JA 1RHFA 1MHPL 3HC0A 1EPFA 2NR6C 3S3JA 1RVFL 3LXAA 2F53B 3UIYA 3MLYH 5A3ID 1CU4H 1BG9A 4FFZL 5B39B 1QOKA 3AU0A 3SDAA 1BFOA 3QQ3B 2R2HA 2WW8A 1HWGB 1A3LL 1A6AB 1ZV2A 4UZGA 3ARFC 3Q48A 5D93C 3VFTA 1HKFA 3SJVE 5ADPL 4FFVD 3TYFA 2XTJC 2YD7A 3L4VA 1MRDL 4PV9A 1TETL 4JX0A 3WFBH 5JPNC 3P3TA 2MOGA 4UT9H 2EVHA 5FYJL 3MLTA 4P04A 4Z76A 2NYYD 4FFYH 2E7BA 2ZYSA 1LE9B 1OT2A 1XSKA 2FZ3A 4NQUA 4PN6A 3TT1H 3V0HA 1H6UA 2LHAA 4OLYH 2TRYA 4C8XA 3IWVA 4EOWH 4H20H 3FONA 4GSXA 1AZZC 1U93B 1TNMA 5GS1C 3TCLA 1X5GA 3GNMH 4GIAA 4YMPA 1GPOL 4UT7L 2WAQA 4MJ6B 5JIMA 4BH8B 4J3VA 2C3HA 4JKPH 3TTYA 1QR1B 3D0VB 3ZRCC 2EZ0C 4KJPD 1GZPA 2V2TA 1L9QA 5DQDL 1KULA 2W88A 1AS8A 3CC1A 3IMTA 1X9QA 4DIXA 1FCGA 2RH0A 1O75A 3IT8D 1R5VA 4MNHA 4HAGA 3HOGA 3BGAA 1JNJA 4PG2A 2WZPD 3WNPA 2O6DA 3INOA 2A6JA 2CQVA 4FEIA 4LCIH 4NWUL 5ACMA 4OF3A 4PJFF 1YPZE 5MEOB 4JHWL 2Y1VA 4R5XA 3VDCA 1UATA 3FQYA 1PY9A 5IMMB 1DSYA 2ZAHA 3ILDA 4KRNA 4L4VA 3O2VL 4EZJA 4G8GD 3Q6FB 1C12B 2EDWA 3BZEB 2H0PA 2A83A 5EZOH 7TAAA 1JHLL 4PWEA 2UV3A 1T1WA 4Q4IA 1YC7A 2ORBH 3U2SA 5BOPA 1RLWA 3B2MA 2A1WL 5JW4M 1OSZA 3FU7A 4HXAH 5I8CA 1E5ZA 3P0GB 3BZ4B 2AEQL 4IRJD 4WFEE 3RJQB 1C8PA 2CDFB 5LCVH 4ONOA 1EHXA 3EJZD 5E5MA 4G6AD 2EUWA 1W0VA 1NTDA 5B1AB 2AS5M 2ZE0A 1JHTB 3HB3B 1T4KB 1HCYA 1YEGL 4XODA 4U3XA 1W6WA 5KJ4A 1D5XB 3QDGA 1U8CB 4H88L 1WT5C 5KBMA 5C07B 3T3MF 3QO0A 5DT1L 3V79C 1XF4B 2FL5A 3VXUA 1A7RH 2QSQA 2NY6C 4YNYA 4WUUA 4XNXL 4M8VA 4R90H 3WBDA 3BKJH 2YN3A 1A7NH 4LNRA 3BAEH 3WIFB 2YJLA 3L1OH 4JG9A 1EFQA 1AIFA 2H2SD 2IFGA 3IM1A 4B7IA 5C7XH 4PRPD 4Y0GA 2YD5A 6FABL 1KLUA 1C5BH 2BC4B 3QRGH 3DYOA 4ZXBD 2FGZA 2YO3A 4YHNA 1ND0B 4KRMB 4XVSH 3V6FA 1GCYA 5F0PB 1XGPB 3A47A 4F33A 1LP9A 4PLJC 4PJ7E 3SE8H 3BH9B 4J3XA 3VG9C 5CEZH 4Q6IB 3N40P 1QW9A 2VDLH 3L9BA 4X5QA 2V17H 5GZOC 3EFDL 3EJYD 1Q72L 3ZO0A 1CYGA 1KTKE 1NEZG 1VCBC 2WXQA 3MGTB 4PLKD 1LO4H 4S1RL 1MNUL 4RH4A 3ZKQD 3IWUA 2R8SL 1KT2B 4K4KA 5EZLA 3TBSB 1CS6A 4ZUUA 5IWLA 2YD9A 1Q9OB 3BCFA 2GY5A 3W2DH 3SKUD 1UVQB 4PVMA 1QQDA 3PNWA 1IBFA 5TQ0L 1NGPL 1KYAA 2K6WA 4B96A 3KPQB 3CLFL 1NCAL 1FNEB 1WGOA 2FB4L 4I48A 5D8JH 3P69A 3B5GA 1BD2B 3INUH 1CI5A 4G6KH 4NGHH 1EHLL 5FX3A 5ALBH 2YGNA 5AOMA 5DRNB 3JTSA 5IQ9B 2G75A 1E4HA 3SOBL 4B9JA 2HTKD 1L0XA 4LIQL 5JW5A 3AREA 2EVGA 1TZIA 3QGVA 4QJ5B 3W9DA 5FO8A 4PGZA 4MVBC 5DD0L 5TDNA 4R0LA 3RURA 1JV5B 4FQ1L 1YY8B 5I1CH 3MI6A 3P11H 4ZQTA 2XOTA 4NZDA 4Z8FL 4S0TD 3ZMNA 1ZV5A 2MHAB 5TE7L 5TH2B 2X9ZA 4U1MA 3TCTA 2XQ0A 1TCRA 3STBA 4UNIA 1MDTA 3CLWA 4JDVB 1AGFB 4CSTA 5FUCE 2B20A 4U7SA 5F88B 4X83A 2OMVA 3RWGA 2EDHA 2GQHA 3PS6A 2YPLA 1ZS8A 2EDJA 3D8MA 4L3EA 4Q9QL 5DEJA 2V5YA 5IESL 1KB3A 5E8EA 2B4CC 3O41B 3BYYA 4F1ZA 2Z92B 1OAQL 3K1DA 3I2CL 4JDZA 5LXGL 4AEFA 4KGJA 4MQXC 3S0PA 1RUAL 3O6LH 3L3KB 2VJXA 1NGXB 3ASOB 4OZIB 3ARRA 4ZX6A 3PGFH 4HCGA 1UJ3A 3VE0B 1KCVL 2ZOLB 4M6ML 2AQTA 3TA3B 1KCKA 4OIIH 2PETA 3O4LD 2MTAA 4P46A 3HNSH 2X1QA 3AU1A 3O11A 1JZJA 1T0NA 4XGZA 4KTGA 3IFLH 3T0EA 2AVFA 1IQWL 4FFZH 1MPAL 4EDWH 3IGAB 4F7MB 1R3JA 4DPCX 2R0KH 4KRLB 3VXSE 1FNGB 1RZJC 1ED3A 1ZK5A 2ATKB 2PW1B 4Y4KC 3V0DA 3ZKND 2QEJA 4N68A 3RB7A 3FO2B 2NY4C 3KDPB 4DETA 2FEDC 3P4NA 4TLSA 4NUJB 1QEWA 5K33A 3NAAL 3MUY1 3QEUB 4Y5XC 3TN0C 1MNNA 2CUAA 1AQDB 1S3KL 1P1VA 1QNZL 1NH6A 1BJ1J 1DVTA 2ZJSH 4W6YB 1O6SA 1G7PB 2BZ7A 3BSHA 5J06A 4AH2B 3OJ2C 1KIUA 3U7YH 2W0PA 3EXLA 4JZJA 5GJTL 3FNKA 1NAMA 1EDQA 5KSVA 1NM9A 5DZNA 3UZVB 2Y22A 4UYQA 4RNRA 1PQZA 1MJJA 3HAEB 1KYUA 1ZT7A 2VISB 1Z0NA 3GXPA 2ITCB 5AW8B 3BSGA 4OW6A 2CO6B 5HHOE 4DGVH 3DBXB 3LVTA 2HPTA 4Y88A 5T33H 1B0IA 2ZKMX 5T3ZE 3ET9F 5ESAB 2VDOL 1SZNA 1RXLA 3QULB 1P7KA 2EDEA 1MW2A 3GSNB 2P43B 5CP7A 3AQZA 1CLZH 2JB5H 4GBXC 5TJWK 3V0VB 1K8IB 1LWHA 4M8UA 2AABH 3QNYB 1QLRA 5IB4A 5D7KE 3GTVA 3OKLA 3JWDL 1GGYA 2BHFA 3J8F7 1D9KD 4GUOA 4P5KA 3O3DB 3ZT5A 4U05A 3LKQA 3OMIB 4FL4C 1TZGL 2Y5EA 4NBYB 1HIML 5C0BB 4PB0H 2BCKB 3CWGA 5TQ2H 5FECA 3I75A 2GUYA 4MQTB 4P57B 1TLKA 1HHKB 1C5CH 1BZEA 1ZA3B 4KK6D 2LAAA 1FGNL 3OKDA 4HGWB 3N40F 1S8DB 4PRHA 3OB8A 5CM1A 1CICD 5KBPA 4AEEA 3BEVB 3D07A 5FGSA 4KZEL 4K7FB 2VSDA 1BV8A 4Z7WF 3RIAK 1DQVA 4PRID 2IAMA 4UTAA 3OXRB 1IE5A 4I87A 2J55A 1EV2E 3HG1D 2M26A 3S88H 2ZAGA 1H5BB 3FQXB 4G7RB 4NKIH 4UQEA 5E00B 2IPKA 1JHKL 4DVRH 4NX0A 4AQ1A 2DIEA 2J8OA 5BZWA 3GF8A 3Q01A 5EN2B 5MP6H 1ZGLA 2OMBA 2HB0A 2WTRA 1E0OB 3ILEA 5JUEL 1NSNL 2MNWA 3PHQA 3U46B 5EF2A 1Z32X 2AKRA 2HP4A 3DTXA 3FT3A 5E6YA 1E5YA 4OGAC 1HINL 3TZVD 2CKBL 1BF5A 5HI3C 4I1NB 2LQRA 3I9AA 4MD4B 1OGTA 1YMMD 2YAQA 1PFCA 4JW3A 5EBLB 3CVIL 1BXAA 4NQQA 3L4CA 1K4DB 4YIQA 3V0IA 5GS0D 1SQ2N 2AXFA 4S1QH 2DQJL 1MUJA 4IMKA 1AZCA 3N44B 3UX9B 4CMMB 1GGIL 1B6UA 4IGBA 5F1NB 1E2VA 4MXQD 3PHQB 4UILH 1CICC 1H8NA 4FHBD 2VSMB 2FD6H 3GBEA 1AXTH 3KCPA 3CVHB 5IB5B 2E6PA 5DHMC 3WAKA 3TOPA 1A02N 3CFCL 4FRWA 1HHGB 3EYVA 1UKTA 3FTXA 1T66D 2YAEA 4QCIA 2YRBA 5T3XD 1RIUL 4AV0A 4GH7B 1MWAA 3RWCB 4PJFE 2NUPB 2WANA 2WVTA 3AS1A 4NZUH 4ZPVB 5DHVH 3WTYA 2G3ZA 1C8QA 3ABLB 4J3OG 5I30L 2WTOA 2KPNA 3BVNB 1T1XA 3D09A 3MCG1 3T65A 1JG9A 1RSYA 3IPBA 5AUMA 2GJPA 1QASA 1JGUL 2ZUUA 4IU2A 1ZKAA 3MYJB 1BFTA 2YD2A 1KNOB 4M62H 2WK2A 4OZHF 4UQ2B 5TFSH 4IBUA 4RCAA 4HIEA 4OD2A 4QWWD 5EEWA 3BVVA 3OWRA 5JO5A 2AJYH 5CJXA 2E59A 2J1ZA 3FKUS 4TOYH 2X7LB 1WFTA 3OTTA 3G04B 5JHLL 1A4AA 3MBXH 4IRZL 3OAYH 1IM3B 4X6DF 3RFRA 1TYJA 4HT1H 5E7BA 3T0ED 5E9DA 3KW8A 3SJVD 3QDJE 4NIYE 1YYMH 3IB4A 2VLJE 3GHPA 1MCBA 2ITFA 5CEYA 5A2JH 3ARSA 3SDXA 2WBJA 4YSUA 3NESA 2P28B 2KPWA 2CKNA 3B9KA 5JHDB 4KK6C 2EC9T 4OD1H 1MIEH 3QZOA 4Q6IC 5E9NA 4TF4A 5D71H 3O2DA 3FQ2A 2BNRA 1WZAA 4L5FH 3UIZA 3VXME 3ILQC 3CH1B 3EDJA 5KOMC 3H7BA 3IN2A 2ZNWA 4TV3A 2E56A 4TRPL 3FU5A 5IROC 3S36L 1SN0A 2IDTA 4PJ7F 1H15B 1THCA 2VQ4A 2IAMB 4NQCD 4YAQA 3SKJH 4YXKH 2QADB 1OW0A 1MVUB 3VGDA 1SRDA 2Q3AA 4DKDC 4O02H 1R3HB 4HXAL 3Q0HA 4R7LA 2IH3B 3SBPA 3GSVA 4CNIA 4QTHB 4ODVH 4P4RA 1BEXA 1IVLA 4NO5B 4AYMC 1W80A 4YO0B 2CDEB 2ZTBA 3D3VE 5B8CC 5EU6B 4F92B 2BSDA 3TA4D 1MRCH 2W95A 3NCFB 3FU6A 1HCZA 1KPRB 2KBGA 3QCUH 1MCPH 4K3GA 4LCCC 4P2QB 4EZLA 3AJ7A 3S34L 2WP3T 3BPOC 3PPEA 3WTVA 1HOCB 2WUCH 3T6QC 4IS6A 4MYPA 4F5CA 2CDGA 4AT6B 5DYOA 1JPTH 3NZ8A 4JO2H 4JY4B 3CCHA 4KI5F 2N01B 5I9QB 1KPRA 4UTCA 1KWKA 4FNQA 1F56A 2Y23A 1B3IA 1YUHB 3I02A 1OCWH 3DBXA 1XGYH 5IEKA 4HKZB 4M5YH 1BQKA 5CP7B 1OP5K 1E67A 1NJ9B 2GFBB 1H0DB 3MOBL 1ZTMA 3QUGA 4MJIA 3UC2A 5ESAA 3PNRB 3T3PE 4AEIH 2HX7A 1A6UH 2DLEA 5KUKA 5B1CA 1U58B 2ICWA 1N0LB 5C0AD 4NYLA 3EFDH 1MLBA 3DGGB 1EJ6A 3UO1L 2FJGB 1FUNA 1S7TA 4PJ9B 4TSBH 4G5AA 1XBRA 4MCYB 3FZUC 3X1GA 5IW1A 5EULV 4YHOL 1N6VA 2IAND 2DF3A 3REVB 2DQCH 1XCTB 3U9PL 1NMCC 3LKPA 1XO8A 3TA3C 3E6FA 4S1DD 4MAZA 5CCKH 4HULB 2ZUVA 1S7QB 2IPTH 4KKBC 1SJHA 5KSAA 1A25A 2BVOB 1EEUA 5AW6B 1TSHA 2NZ1A 1IEBA 2WLZA 4N2OA 1JK9A 2F0CA 1YY8A 2Y5TA 2GCYB 4TUOB 3W9DB 4P2YA 1BA9A 2WD0A 4R84A 4PJ8D 4QHMB 2WXJA 1QR4A 2KZ1B 5K1JA 5IREA 2MSPA 2CO7B 3FN0L 2EXYC 3EO9L 1IQDA 2BM3A 1QI5A 3DROB 3SE4A 4PGCB 2GC7C 2LV4A 5ANMA 3R06B 5FC9A 4JPKL 1Z5LA 3HC2A 1C5DB 3K2MC 1Q1JH 3PP4L 2UXGA 2AANA 2EAEA 4QHLA 1QFUL 4U3HA 5EZJB 5D70L 3QUKA 1HZLA 4IIQB 3ZKSD 4HC1A 2ORBL 3T1FA 1M53A 1MAKA 4JFFA 1AOZA 2DZEA 1BAFL 5G4NA 4WDIA 4O2FA 5F9WC 2BWIA 4W81A 1T83C 1CCZA 1NGXA 1X9LA 1QFWH 3L3KA 4Y9FA 4HKZA 3UEQA 3L4YA 1HEZB 3A67H 4LBEB 2UXTA 3H56A 7FABL 3APFA 2QGDA 5I18L 1MHEA 2D7QA 3IRCA 4PS3A 5AZ2L 3T4AC 3RGVD 1KXVC 4TTGA 5GZNA 4M93C 2DEWX 2EDMA 1J12A 2ZWLT 2AJ3A 4FX5A 5C9JA 5HDQL 1WP6A 2F6AA 3D50A 3WE6A 1LEIB 3PQYE 4Y9GA 1QBML 1FO0B 3PWNA 4K94C 1ZOXA 1AKJD 2Z1KA 5FKPB 1PKQB 3BXNB 4YDNA 1SBBA 1AGBB 1RFDH 1X6NA 3GXUB 5I0ZA 5KVMC 1QFOA 1PG7L 2XN9B 4BSWA 4ZI8A 1J8HA 1ACXA 2XV2A 4H1LH 4V33A 3UTQB 3PL6A 5LBSL 1UM6L 1V3LA 4H2CA 5EC1A 4M4RB 4Y4FA 1EUUA 4KOBA 2VR4A 4KK8D 1JWMA 1PS3A 3GSWB 5ACLA 5FS5A 4Q0XH 3RVUD 2BRRL 3Q1EA 3BZ5A 4LP5A 4YO0A 1FFRA 3F7VB 2HRGA 4AG4L 2JCCB 4YDKL 4NO0B 1AANA 2JJSA 2QR0A 2HA1A 3VG9B 1U92A 4AIEA 1F8TL 4LE8A 1F4AA 4DP4X 3Q6GH 4Z78A 3OZ9H 4W9GC 3SOBH 2QKIA 1S9YA 4AQ1B 2Z35B 1AG0A 3VYOA 3QDHA 4G6ML 2QV2A 4NEHB 4ZFGL 5A2IH 1MCEA 3NCWA 5EEVA 2FB4H 4NKOA 1EAPA 1MOEA 1QQDB 5FDYA 3IAGC 4KMTL 1YAIA 2K70A 4AJWA 4K94L 1U2CA 3CU1A 3QPKA 1FZJA 2D2CC 4Z7WE 2N7BA 4JM2D 1KT2A 3MUUA 2DMBA 3Q2NA 5D7JA 5CF3A 1MHCA 5KBDA 4ZUTA 4GB9A 3RDTA 2K0RA 2I60H 4Y1AD 5GJSL 3IJYA 5I15H 5JOEA 1JZ3A 5HPOA 2GI7A 2OSXA 1D9KC 3V6FB 4MYWB 1SMDA 2FWOB 4AYDC 4WGKA 5I1DB 4M3KB 3ZDXE 3FXIC 4EKJA 4HKJA 4CBPA 3HG2A 4NQVA 5DTFB 3NCYP 5IMOA 4JHZA 2BINA 4KUCD 2EYRB 35C8H 4XC1H 3TCLB 5GGSA 1AIFB 2AK4E 3PG2A 5K93A 4BUHA 5CFAA 1A7OH 3BW9B 2QGBA 2J6EL 4PP1D 1DVQA 5DJCA 1JTPA 2W5PA 5HYQB 1E3ZA 3QC6X 2KLSA 4XP5H 1DN2A 3IJEB 4PWFA 5JLZA 1NL0H 2GJ6E 2E7LA 4K7PH 4FYQA 4JE0A 4JFFB 1OY3B 4AGPA 4Q14A 3U30B 3HI5L 3WS3A 2F74B 4BXVA 1Q0YH 2EEBA 2K7QA 2QHRH 5TE4L 3H0TB 3RTQC 4LAJH 1HESA 4BZ1H 2XY2A 3OKEB 3X12B 5DZOA 3LTVA 3O8XA 4WI4A 4LMQI 5F9AC 8CGTA 1KEML 1WTLA 1RPKA 5J6SA 5C6TL 2YPKB 1FZMB 1MFBL 5JOPD 2A1WH 1Z5LB 1AQHA 1VKXA 3T2NH 4KK5C 1IGYA 4OGQC 3LSOB 3HHSA 4PY7A 1EEQA 4GW5A 5FDWB 2Z65C 1TQBB 4RFNB 5C0BD 15C8L 5E1AA 4A7GA 4X8JA 1UOKA 1TTBA 2P46B 4OZHE 3VVWA 1TTRA 1Z7JA 3WMSA 1E65A 1W72A 2AF2A 5G4OA 5DS1A 2R39A 3P2BA 4JANA 4LARH 3ARPA 3U46A 3LV3B 3MV8E 3T4AA 2PR9A 1ASQA 1KXVA 4GP4B 1QYGL 2H32H 5JNYA 3HRPA 5D4HA 4PJ9A 2H8PA 5I8EA 3BAEL 4OBRA 1RVFH 3QRBA 2AAAA 2FHCA 1KGCE 3L3JB 3QQNA 3LIZA 3IE9A 4PJ6A 2VZUA 4TS6A 3QZLA 4YSRA 4KI5D 1RK1A 5D7JD 2P8PB 1QWNA 4GKSA 2JKLA 3SDCA 3ZDZE 3G5VA 3IS0X 5B1KA 1XEUA 4JVUA 2X4UA 3C5SA 4PUBH 1MFEL 5INCB 2IFFL 2QSCL 3SBWA 1MCKA 4UT7H 2Q76A 4G8GB 3SPGA 5GS0H 2EH8L 3O3EB 1BZ7A 1JRHL 2F7PA 3IU3B 5AYUH 2H32A 3C8DA 1UT2A 3GHEL 1VZIA 5FIEA 1OSEA 3APNA 2P8PA 5DRXA 2WQXA 3CPUA 2XTJE 4GMTH 1CFQA 1G6RB 4U3SB 4HCRH 4NHUB 3LY6A 5FCUH 3QUKB 3WFEH 3GXMA 4ZO8A 5IJKA 4M6NL 5FFOA 2V7NB 2V5TA 4KFZC 1U8PA 1KG0B 4KQ4H 3FN3A 3J07A 1XDTT 5AW7B 4AITA 2IDFA 2UVEA 1NMBH 1WZ1L 4DP9X 4FTVE 3RZCB 2EJ1A 3GXIA 4KVCL 5F1IB 3S5LA 1BMWA 3GFUA 3OKLB 1CFTB 5EBMA 5HD8C 2FK9A 4N0CD 1PZCA 2X6CA 3ZOAA 1MY5A 2NY1B 2UZXA 3VSTA 3MRPB 1PDKB 3PWVA 5EOCH 3UBHA 4HVBA 3KVDD 5LGKA 3C6LA 3C8KB 4LPUA 4XVJH 2NX5A 3U9UA 4G83A 3CNKA 5DMKB 5DK0A 1VLXA 2F53D 3B5TA 4HJ1A 5FYKE 5E6UB 2BIMA 5BO0D 2P24A 3FFCA 4FTVD 2WXNA 1MFNA 4KI5E 4L18A 3F01A 1LE5B 2F54B 3I3DA 5FM5O 4P48A 3X3GH 1YDPB 5CJBA 3NABH 3S8WA 1UA7A 2OMYA 1FVEB 2WKLA 3C6EA 4YQXH 5HYJD 4JZJB 1MXDA 4LSUH 2QMKA 3CZGA 2WWNA 1LGVA 1JD9A 2R7EA 3JVGA 3KLAB 3MJ9L 3VQLA 1I1AB 1F1AA 4U7MA 4EZKA 4PVLA 5HYQA 1G7MA 3SN6N 1CTMA 4PJHE 1I7ZB 1KPUA 1UXWB 5FYKL 2EDTA 4WSKA 2OS7A 4FQQB 4L4VE 4RSYA 2WXIA 1E5AA 5GSRA 1JZ8A 4YOKA 2CWRA 4HF5L 5AOIA 2RR3A 2A4CA 3E2HB 5HVHC 1X7TA 1ZANH 4LF3A 3AS0A 2HWZH 3WMPA 2R56H 4B3VA 1Z9PA 1KBGH 3UTTE 2X87A 2ZKHL 3KH3A 1T4WA 4GEIA 2LABA 4H8VA 4MJIE 5K5YA 4UQ2A 3OAZH 2XYCA 4I0PB 3QARA 2CK0L 3SKMA 1L0QA 1L7TH 4L3AA 2Z8VC 1FZJB 2N7SA 3FTGB 4N1CA 4NHCL 3MRGA 3SQOH 4LVHC 4BCYA 4G5ZH 2IANA 1H6TA 4QRTB 3EGSA 5T3ZH 3VTMA 2C5DC 2J1WA 3SPJA 5ENWA 1UH3A 1HHGA 1MFAH 2QVIA 4QTFA 1FO0H 3BEWA 4IBYA 5IV2A 1DZ0A 2ETWA 4PGBB 5JOPE 5AAWC 1D7DA 5SX5K 3DRQA 4X5RA 3UXFA 4N0UA 2VDML 3ATDA 2BDNH 4N4YB 1MUJB 3EOBB 1CGTA 1JGLH 1R3LB 4GOSA 4KXCA 5K39B 4TOYL 2JV6A 2NY5H 3EBGA 4DJMA 2B7DT 4O58H 35C8L 32C2B 2G9HA 2YMXL 2YZ8A 3VA6A 3GBLA 4L5FL 4Y1AE 2MHAA 2YAOA 3CFBB 3GWJA 1YYML 3AREB 4GAJH 5AVYB 4A37A 3PF2A 3BP7B 1NCCH 4R0LB 5DO8A 1FWXA 2EO9A 4KC3B 3SODB 4OF6A 3IKCB 5LWYH 1XWVA 2AK4B 2YPKA 3HI6H 1QR1A 3B9EA 4K3JL 4RGMC 2DDQH 4LLQB 5JIDA 3ROOB 3FHEA 1XHHA 2PXYC 2FEEI 1QI3A 1WAPA 3MODH 4DPBX 3TIEB 1MF2H 5EH1A 3M7OA 1NA8A 3WKMH 1UWEL 4DK6A 5I1AB 5FM5M 2A74A 3AWFA 1S9KC 1N59B 4U6XB 2X2UA 3LDBB 1JF1A 3S35L 4FQLH 1B4JL 1QA9A 4OSUH 3IJSA 5D1QC 5F96H 3S5LG 1IVTA 2HG5B 4YHIB 3X13B 5I73C 1KLFB 4B7LA 4UQAA 4ZX5A 4KO9A 3UTPD 3V6ZA 3AY4A 4AW7A 3GZPA 1IAKB 5K1NA 3WDIA 4WJKB 5E08H 5SX5H 3REWA 4I5BB 3QUMB 3EYVB 3WYRA 4P5TC 4BK8A 1T22B 2AJVH 1OAYH 5C0CE 4RWYH 4MXVF 3O2WH 3O6ML 3CVHA 4LEXH 5IB5A 2WVUA 5I6XC 5JUEH 3VG0L 5L2KE 1G84A 5E9DD 4XMLL 3SJVA 1INEL 2BVPA 3UABA 5EMYA 3R1GL 3N85L 1CGYA 1XF4A 5BRZE 5CINH 1F11A 3D9AL 4ELME 1UGNA 1AR1D 4Y9CA 5C07A 1ETA1 1VEPA 1LO2L 4WUUB 5SX4I 1CXKA 3X1FA 3IF1A 2Q8BL 1OALA 4DO6A 4HH9B 1SJHB 2JSFA 4BQ9A 4DSYA 1WA0X 2VERA 1LMKA 1YC8A 1PZBA 4KNSA 4IRSC 3BAYA 1NINA 1EAPB 5B22A 2DLTA 1RMFL 1WC7A 1KIRA 2PYEB 1KIUB 1QFHA 1CWVA 4YLBA 3T9WA 2ITEA 3VDAA 3SYQA 4HEMA 3MO1B 4X8CA 5B38G 2ZPKH 4KITB 1GTNA 1MLBB 2Z31D 1JGEA 3DUHA 2CMRH 3HS9A 2DMCA 4MKTA 3MRCB 5L7XH 1CE1H 1P7QD 5JYMA 3K2IA 1YLBB 2F1EA 5ADPH 1NANI 5DRZA 4B0MM 2IIJA 5G5DA 3WY2A 5J6HB 4W4NA 1TLMA 1I9RL 3QK0A 4QRQB 1NPUA 1HL8A 1R5VB 4WV1C 5C0EA 3FO0H 1YA5A 3RPKA 1C16A 5DZ9A 5ISZB 3FFCE 4I18C 3EO9H 4OFVA 2DM7A 4PJ9C 4KNUA 4MZ3A 1EO5A 5D1ZA 4ALAL 1CLYL 3LH2L 1QTYT 4Y4KA 2P5WD 3OC8A 1FAIL 4MMYA 4PRBA 1TEYA 4XCCH 3UTOA 2JB5L 1CDHA 43CAB 2Z93A 5C9JB 5DD1H 1JS4A 4PGEB 4FNPA 4XPGH 5F7WC 4U2YA 3LQAC 4GAJL 3GJFH 4HIXH 5L88L 4LLWB 1QFWL 3HCVA 4ZAKD 1MVUA 3SGJC 4YXLL 5DWUH 2AK1L 4KX8A 4N8PA 3UTTB 1NC2D 2BZDA 3FRUB 1YEEH 4QNPF 3DSFH 1JN6B 3A4DA 4X7EC 1SHMA 2I07A 4Q8BA 3VWJB 2ZCHH 5F44A 1RP9A 4HUNB 2WXOA 4AYFA 5E2JA 4JZOB 2VLKB 1BFOB 2E9BA 4HD5A 4LCWD 4B9KC 5IQ7L 1G5AA 1LYQA 2OFQA 1A9VA 2L3BA 2ZX8A 4KJQC 3FOLB 4XCNA 3DETD 3DX0A 3OKMA 5BVJB 4JR9H 5EEUA 1XSOA 3TWCH 1U8QB 4PIRF 3GMMB 2QPFA 4JKMA 2BH0A 4H0GA 5DJ0B 2CHXA 3VGAC 3AUWB 5AVSB 1VGKB 3TO4A 2GCYA 2Y5TB 3HC0B 3LKSB 15C8H 2NX5D 4F2FA 2D7TL 1Y18A 1MRCL 3B8YA 4R2GB 4IK7A 1M6OA 5D7IA 4NPYB 5I71B 5I2IB 3IEAA 3KWVA 4P5RA 4AKPA 1ZA6B 2H1PH 5GQBA 4JN1H 1R3IL 1XCTA 3LNIA 3B5HA 3AQXA 4XAKE 4NKMA 1GGIH 2GTQA 3FN9A 3PWPD 1FNLA 3E80A 4NQEE 4U6YA 1MWAH 4JFDA 1PGRB 1FRGL 3MNVA 4H0IA 1LO2H 3EDFA 3HS0A 3QIBA 2WLYA 1WHPA 1N6QH 2LU7A 1GZQA 3KLAA 4XVSL 2OXGB 1JGLL 4W9JC 1A7QH 1TVBA 4Q4EA 3FS9A 1VPOH 4JFDB 4H26B 4J3UA 5E5RB 5KVEH 2FX9H 5BO1L 1YEIH 4XC3L 1NCHA 3T0EE 5IQMA 1I8MB 4WWKB 3ZDZF 5HHOA 4LSDA 1MNUH 4MCNA 4DZ8A 2WO2B 1OTUC 3MREA 1W8OA 1TQUA 2G2NA 1DJWA 2X28A 2QADD 2FUTA 5CNHA 3V6BR 5I73B 5I1IH 2CR6A 1W0YT 2BNUB 1KJ2B 1S3RA 4B3EA 3W82A 4DKFH 3L3GB 4X7FC 2RD0A 4X5LA 4U1MB 1Q9KA 4XCYA 4G1MA 1T89A 1U3YA 1OE1A 1SMOA 4QGTA 1PDKA 3PWVB 3ZQXA 2QQKL 4Z95L 4ZUTB 4DCQB 2NYZA 1TG8A 4J3OD 1S2EA 5E2VL 1P5UA 5FLVA 3KMDA 1EXUA 3I50L 4HG4J 1D5XA 2MRYA 4L9LA 2QLVB 1W0VB 4NKOB 4EI5A 1U4FA 2HCZX 1PKOA 4HUUB 3EJPA 3VW3L 2CBTA 1MVFA 3HE6C 3V9EA 1WUZA 1U8HA 3ARVA 3LH2H 3ESOA 4JPKH 2VO8A 5SX4H 5E6ID 5JIPA 1H15A 3UG5A 1J9QA 1C12A 3ASNB 4P2AA 4KK8C 2QR0B 3TNNB 2YFNA 3HRZB 7PCYA 2UZIL 3GMPA 3CN1A 3ARDB 3RGVB 4NT6A 4WNSA 1BZ9A 2EP6A 3TV3L 2FO1A 3OAUL 1SXZA 4HGWA 1XL6A 3BP6B 5I5IA 1T03L 4FNSA 1D5RA 4P07A 3WJMB 1A7NL 4BFBD 2E0PA 3NIGF 2EYTA 2QPEB 2R27A 4OCXH 3UL4A 3DSFL 1RP8A 3SCMD 3GINA 4ZFFA 1PEWA 2VZSA 3QPQC 4G8FB 3AC0A 4LFHG 3ZMEA 2ZOTA 4H5SA 1A6TA 4PJFB 3WN5C 2ZAIA 3QYNA 2GC4C 1L6PA 2LLGA 3HPJB 1CL7H 4R8WH 4JPVL 5ACZB 2EC9U 4IBTA 1JRHH 1W72B 4B9IA 1KN2H 2V3EA 3PDOB 3O3BB 3TVMD 3PAVA 1K4CA 3QWNA 4OM0L 4X8JB 4B97A 2R0LL 4OV5A 4P9HC 4PRIE 1TU2B 1MZZA 2V5SA 3H8NA 4UUJB 2VM3A 1UOWA 2YN5A 4AYBA 3C75A 3GBNL 3Q2VA 2LT9A 1NCOA 2F5BH 2NQDA 4NP9A 5EDSA 1AI1L 4OFIA 4JS7A 3US9A 1FFOA 2EIZA 1OE2A 1J1XL 1A6AA 4PB9L 4NGHL 1QVOB 4JM2A 5DMIH 3RRQA 1SUHA 2QMJA 5FYJH 1GAFL 4GSRA 3TCXA 1BPVA 1QHOA 1XEDA 2DWDA 2OL3H 1ZHBA 4NWTL 1E9QB 4OU3A 2J6WA 3P3SA 3FB8B 4D0CB 2H7WA 4MAYB 5ALCH 1GHFL 2BP0A 2YPVH 5CCHE 1MI5E 5GGUB 4MASA 3C5ZB 4BDVB 2FH6A 5EZIH 5I6KA 4XNDA 1N10A 4FTDA 5IB2B 1NFIA 4JM2F 4ATTA 4Z5RA 2W60B 4HFUH 3FT1A 2D2OA 5KW9L 2C9AA 2FJUB 3VFUB 3LRHA 1EO8H 2CR0A 5T3ZD 1QLEL 3FT9A 3T3PF 3MTRA 2AQ3A 4NZTL 3MAWA 4K8RH 1A2YA 3L3IA 5EIIG 3FTYA 2IOOA 2QFPA 4YQXL 3QEQA 1PY0A 3LXBA 1MCNA 3O9WD 3WN6A 3QR2A 4KTEL 2ZOLA 3VI4A 4ELMF 1K3IA 2YPVA 3JSSA 5EEYA 1XGRA 2FJHB 1ZIAA 5D7KD 1KLFA 3FQXA 3AWGA 4O2EB 3P3RA 2UY7B 4DN3L 4Y5XA 3C9NB 1A7OL 4B50A 3VRJB 3CBKB 2G30A 2G60H 3T0VA 5L4JA 2BJMH 1EQWA 2G5UA 3NG5A 3PJLA 2ZSVB 1G7IB 1SJXA 2I5YH 4NS0A 2HVKB 4NAQA 1TJGH 4I85A 1LO5B 3QWOB 4ODXB 3NCYS 3ZE2B 5A3IC 4GAYA 2CXKA 4YDIH 3HI5H 5D1ZC 4P49A 1F90L 2FQFA 4YL4A 4DTGL 2AEQH 5D2NA 3VRIA 5JZ7C 2YBRA 5KANI 3VXSD 4BZ1L 5FECB 1F6LL 3WHE1 1NCWH 3BUPA 4IEFA 4LLUB 5BNXD 1H9DA 4JGNA 2HT3D 5CJ8A 4JM4L 1YEFH 3SO3B 1K2DB 3N9GL 1I9EA 4EIUA 5IFJA 4MA7H 3V4VH 4HUUA 1PCSA 2BS9A 2VDQH 1OP3K 3E0GA 5M95B 4M5SA 1XR9A 2BFVL 2NW3B 5TF1H 3LEVH 4JQIA 2CDEA 4D3CH 4FA8A 5EC1B 4HPOL 4X6DB 3T2QA 3RKDD 3PL6B 2X4NA 2BXYA 1DZBA 3GXTA 3BPLB 1WIOA 4KZ0A 5K39A 4FQCH 4YFDB 4Z7IA 5CJXC 1DJXA 3QRGL 4OZGA 1G9NH 5DEZA 5FLUA 4ETQB 4PJ8A 3RTQA 1IM9D 2BNUA 4WWKA 2O6CA 2DL2A 5DRXB 1X5KA 3OR7A 5KVEL 2GTZA 5DD6B 2FX9L 3W5MA 2CUMA 3D69A 4UILL 4WFGD 4YDLB 2WNXA 3KPLA 3R0NA 3K6FA 2DH3A 5IHZA 2DKUA 2BVEA 5SWSE 1BMGA 3QIWC 4QRTA 2R69L 4F8TA 2QSTA 3H9SB 2XXMB 2VDNH 3NJHA 4LESA 4WWID 4MAYD 3HE7A 3DHPA 3B9AA 3LPFA 5CZRA 5C08A 3UAJC 5EU6E 1EAOA 1R5WB 4UMGA 1DCLA 4Y4HD 2HLAB 1NEZA 5I76A 3HC3L 4AM0A 3TJPA 4W6WB 1IC5H 1P5VA 4QF1B 4QRSB 3B1UA 5C09A 4IDJL 4JRWA 1RH8A 2CJTA 1JPFB 2XBTA 1ZHNB 3W11C 3IMVA 5CMAB 3GMLA 1N2RA 1R3JB 3ILQD 4JB9H 1TQCB 2BHYA 3BZFB 1U8KA 3CIAA 4BQBA 4H2AA 4RQQA 1PBYA 3X14A 3VD3A 4N3TA 2D03L 2VDRH 3DMMD 1HL9A 1NEZB 1A6WH 4U4BA 1HYSD 5FYLD 1NDTA 2FL5B 3O9WC 1JL8A 2FATH 1P5VB 4D7PA 2CHWA 5AVQB 4PSRA 1R3KB 2OJZL 1D6EB 4OD3H 2VDQB 4XPTL 3HFML 4AQZA 1RJYB 2ALAA 5I0VA 1EMTH 1HI6A 3UAJA 3PGDA 2R7EB 4UU9A 3UP1A 3FCTB 4DEPB 5C0GB 2GJRA 4TQPA 3AB0C 4GBXA 2VLRD 3VFPB 1ANUA 4BWTA 5E8NB 2AVGA 4E9LA 3ZBMA 4OI7A 2VLKA 2I07B 3S3CB 4RIRB 3BUTA 2XWXA 3VMPA 1CLOL 5TDPB 3QYCA 3VFNB 1G9HA 1WD8A 4HCRA 2GTZB 4JFTA 4LGPB 5DD6A 2VDKH 1DVXA 4F20A 4ZXBC 3ARXA 4NQCA 4C56B 3QUXD 4ZW5A 2Q87A 2E3VA 1KYFA 1G7JA 2C3GA 4DEWA 1TO5A 4BV1A 2OMNA 4L48A 1E50A 1HXKA 2IH1B 1NCGA 5IQ7H 3BKCL 5I26A 4X6FB 3WFZA 3A21A 2EH7L 3CFNA 1AQKH 4GRWF 4RMUA 2ROXA 2EIEA 2HFEA 5C2UB 4QRUB 1H6EA 2Y07H 2VM4A 5JHMA 4JPQA 1FC1A 2EC8A 3ULUC 1Q9WB 4BSJA 1Z3GL 1IEAB 3IDNA 2FUQA 2EDYA 4DW2L 1BD2A 3LKRB 4U1HA 1MCPL 4PI0A 3I3BA 2YUXA 1I3UA 4WW1A 1JMXA 1RI8A 4TXVB 5D5MA 1U93A 3WO4B 5K9QG 3TEWA 5TF1L 3DA0A 2ZOWA 3FONB 2EDRA 1WZLA 5ILTH 4NO5A 2BMKA 3CSGA 1JWSB 3ARDA 4JFZL 4WNQB 1IJ9A 5IHHA 3O3EA 1FJ1B 4PJ7A 3BN9C 2Z0BA 3POCA 2YLHA 4M62L 3PE9A 4DP1X 4ONGH 3R0MA 1F41A 1CLYH 3O3AB 2XPYA 3QORA 1MCLA 4FQ1H 4RZCB 5DUJA 5SV4A 2OW7A 4DUVA 3AGVA 3EJZC 4X4KA 3ZDYF 5F6IC 4DP8X 4YHMH 4E9QA 4L9LC 4EZMA 4O9HL 3MO1A 4EQ2A 4DKTA 3WDHA 1HAUA 4XC3H 5KBNC 4XPGL 1D6VH 1VA9A 4MHHI 4ODSH 3KHQA 4ONHA 3WIHH 5BJTB 1IRAY 1BG1A 4DCQA 1SHWA 5DQJA 2B9AA 1M42A 2VXVH 2IGTA 3KNBB 3D0LB 1P5UB 5I1IL 4JFPB 2Y3AA 1DUYB 3NIGE 1BM7A 5IESH 3ZTJH 3LDBC 1JGVH 4ICXA 3VQ2C 5DI8A 3I2CH 3SYCA 1PZ5B 1G5GA 3L7EA 4CW1A 3CDYA 3V4LA 4XP1H 1E4XI 2HJLB 3GKWH 4IGBD 4JGMA 3L3GA 4NBXB 3EBIA 5LUMA 3PQYA 1JHTA 2BWQA 2P7TB 4NN5B 2OQJA 5HHVL 2FQDA 3T0EC 2OYMA 1KJ3L 3VNYA 3LEYH 1E42A 3MBED 4KJWC 4MJ2A 4WI9A 4QEGA 1F4WL 1XH3A 4PS4L 2DBJA 4IKLA 4XMXA 1I1YB 5EFIB 4Y2OB 3ZU8A 4NXSA 1KFAH 3QUML 1PAMA 5C92A 5CGTA 3K6OA 3BWAB 4QXGH 4W4OA 4HUVA 1RZPA 3BVNA 3QJFA 4OCSH 3A24A 1EJOH 5H2BA 3KLHC 3VD0A 1GS8A 2BXZA 5AOKA 4FG4A 1WAEA 1SJEA 1UUNA 4H1LG 1SLUA 4WTZA 1D6EA 1CZ8H 3LVEA 2EE6A 5C0FA 3EH3B 4MA3B 3WXWL 3SDYL 3OMNB 4LL4A 4PRIA 4HDIB 4QHLB 2YD1A 4DOHE 1HHIB 4F80A 4R7DA 1MJ8L 4X4ME 4EN2A 2FBJL 2FGWL 4ENEC 2C1PB 4KHXL 5HGHA 1YJDL 2CLVB 3TPUA 5DJ0A 4MLIA 1B2WL 4PREB 2X6AA 3A4EA 4A2FA 1AAJA 3MCLH 1JXFA 5D6DA 1XF2A 3Q7JA 4HQQH 2C4FU 4Z7QB 3MMEA 1VGEH 2L7EA 3GMMA 5SWZB 2OR9L 2PPEA 1QMUA 4FHJA 4LL9A 3OAWA 1ET7A 2WBWB 4M7JH 1HCVA 3HE7B 2FECI 3DIDA 1JZ4A 2FIKA 3H6JA 2H3XC 5E9AA 1M2VB 1BZ8A 4PJHF 2WZ6A 3C6SB 4C59B 2PR4L 4YSTA 4NAJA 4QHKI 1AZNA 1IIIA 4FNLL 4D9RD 3OD3A 3D48R 4HG4K 5F3BA 2ICWI 1OHZA 4X5XB 5DQDH 2DBLH 3PLYA 3ZHFA 3K8MA 5D6DC 3U0PB 4ZNEE 3QQ3A 1XTLA 3SSGA 5F7LB 1OVZA 2DI8A 4RFEB 4WJ5B 4AZ8A 4UQBA 3CFTA 1OQXA 1V3MA 3VI4E 5CR1A 5FFLA 3RPBA 3BAXA 5I0DA 4RGNB 1LJMA 1KN4L 3IFOB 3PV7A 4A2DA 1AHWA 1KTCA 2YQ2A 5DRNA 2XPGB 4E42A 3DIFA 4FD0A 4AVIA 3UG3A 2AQ2A 2FQEA 1II4E 3CBJB 4RDBA 4U1IB 4F15C 5HHME 3QHFL 4TPRL 2ZF9A 1I7UB 3CIQA 4YSDA 1DQDL 2AJ3B 5ECJE 4E9XA 3SPVB 1DUZB 4KX7A 3F58H 2VOTA 1PLCA 4X9IA 1WE5A 2BVQA 5AVXB 4KVNH 5D9SA 1CQYA 4IHOB 1G7IA 3HN5A 5D4JA 3WFDH 4LHQB 4QKXB 2IDQA 5DC0A 4FTVB 1JNHB 1Y6NR 3GKWL 1EJFA 3WLWD 2Q7YA 1BEYL 3KGSA 4BCXA 3D39D 1ZIBA 4ELKB 4HIXL 5L88H 4O2FB 2IWGA 3DX7B 3HS0B 3QIBB 5TDOB 2XZCL 3WLBB 2VDKB 2EH7H 4KROC 3KWXA 5BUAA 4NPYA 4OLWH 4A6YB 3V0JA 1LE5A 4PJGA 1F58L 1FORL 1ETB1 25C8H 4ZMZA 1H8OA 3U9WA 1G6RH 5J7CC 3DX1A 3U1PA 4OFYA 1KZQA 4TVPE 3IVKA 2AQNA 4LSRH 2R2EB 3II3A 2YPLD 2DQUL 5KSUA 3RL2B 3U4KA 4AEHH 1EJOL 5D7JC 4L8BB 3WELA 2O5NA 3SJVB 3VXPA 4G6AC 2ZX5A 3N9GH 5IMKB 2F5BL 4QHMA 4AI7A 4KXDA 4W4OC 4HS6B 1RJZA 3KZ8A 2BVPB 4IQHA 1NGWA 2H2PC 4BFGA 4HKBB 4LLYB 3M17B 5I9QC 1FNGA 1IC1A 1KJVA 3EUDA 4XOEA 4HWEL 4OZIF 3OKMB 4KOCA 5FYJU 1ORQA 1ZLWK 3S5LB 4PWKA 3KR3H 5I1GH 4FP8L 4J8RA 1A3RH 4GO9A 3D5OF 4JO2L 1MAML 5IROD 1CDYA 2A99A 2G2RA 3WGUB 3MJ6A 1M71B 4OLZH 5K9JH 5DHEA 4Q97A 4RAVB 1GY2A 2GIYA 2X3CA 4MXVE 3MXWL 2CHZA 1E2WA 3LHPL 4O5LL 2WBJC 1NOLA 4YLCA 5JW4Q 5I8OH 4JFHE 1TJIL 1NJ9A 2GFBA 5BRZD 1V10A 3COOA 3BDBA 4IU3A 4L8DB 4UNUA 5DVOA 2KZWA 3GI9H 1MFEH 3D08A 2N0MA 3MFGB 4JCMA 4KH9A 1XGRB 4Q9BA 1XIWA 1I1AC 3APMA 3EHBB 4CVXA 1FYTE 2NUTA 4N2GA 3ESPA 4N0RA 4XP1L 1CLVA 5AAMA 1XZ0A 4A7GF 4A2GA 4DGIH 3UTPE 3DVIA 1I9RH 3IDXH 2NY5C 3TNMB 4BWWA 1NCIA 1I7TA 3M46A 4XNUH 2V5MA 1RZFL 4YHKL 4RRPM 4WY7L 2VLJD 4ZXBA 2V2XB 4OH2A 3QJTB 4A66A 4S0HA 3HVNA 3VFUA 4MA3A 1RK0A 3MHZA 4N8CH 3GMPB 4X9GA 5J1SC 2JKXA 1UC6A 1VKXB 5B7EA 5DMGD 4LCCA 1JVKA 4Q2ZB 5E2VH 3VTAA 3GMQB 2WTRB 1AR1B 2OJZH 1ZGLB 4ANUA 1IGYB 4XPTH 3VXUD 5T1KA 3FT4B 2NYKA 3AWEA 4BFKA 3QCUL 1PZAA 4JAMB 4WI0B 1NUDA 3WN5B 5C6TH 5KS9B 4RBPH 1X5LA 2PABA 2VXUH 3L16A 3QDGD 4QOKE 5AENA 4M8RA 2WGNB 2XICA 3JXAA 4EI5B 1LK3H 3EGSB 4UZSA 4LVNC 4NFDA 3N1PC 2VDMB 1LVEA 4FXGA 1BLNA 1F2QA 4X5WA 4NJAL 1ZSDA 4PWHA 3SDXB 4Q6IA 3HZVA 2LU5A 3QI9D 3NCEB 4P59L 1RKRA 2XLLA 5KSUB 2PP7A 1VACA 2GK0A 2YRZA 3KJ4C 4AEIL 4FQXD 4GUQA 5CSZA 5DMGC 1C9SA 1HSAB 1MWAL 4I5BA 3WE6B 1LEIA 2ADJA 3NJJA 4V1DE 1JERA 1Z0MA 4IIZA 2ISDA 4FXKC 4IMLB 4XMPH 4X7CC 4QHNB 3CXFA 3UO8B 3OKYA 1KC5L 2NY7L 2HT4C 4OJAA 4F8NA 3FOMB 2J3SA 3PHOB 4DP7X 5ABZA 4FMVA 3FYEB 4ZBJA 4HOXA 2WLHA 1EO7A 2NY4D 3VXMA 3INUL 2DQIL 4Z3IA 1GZQB 1ZT7B 3MA9L 2DW5A 5DUPL 4DFHA 1YNKH 1QI4A 5HY9B 4JHBA 4M6OL 5JIIA 1XMEB 2XWTB 4JQXC 1NAMB 2YEVB 2ZF8A 3D51A 5AD0B 4ZMVA 2EVFA 5FYLE 1WS8A 3F65A 3V55A 4M1CD 3UAEA 3NEXA 1I7UA 1QO3B 4N2AA 2FAUA 3HG1E 2FWUA 3P1VA 1WZ1H 4LAQH 1CF1A 1UOVA 3FUEA 3SY0B 4Y4FC 3HS0C 3QIBC 3LOWA 4X4YA 3FW6A 2EIDA 2VR3A 1ONQA 3FBKA 4ODTL 4XN5A 4JQVC 2GJJA 1PLGL 5EORL 5HHPA 3B34A 1D5BA 2D03H 1J1OL 1AC0A 2CIKA 2EYSA 3QUYC 3TN0B 3VUAA 4Y9BA 5E8PB 4B9FA 5IVNA 3H4FA 3N04A 2VDMH 5F7NC 1CFTA 2IG2L 3SDAD 1DANU 1I7TB 3MA7A 1PYWA 5FUCC 3BE1H 5CZXD 2QQNH 3MYZA 4N8VA 5JR1L 4ZX3A 4C83A 2QKIC 4X6DE 5C2BH 4F8PA 4NC1C 1KY7A 2NZ9C 3UBXI 2PTTB 4D9LH 4UB0H 4ETYA 1FG2A 2JJTC 1H5BA 2ENSA 2W07A 4XNUL 3HZKA 3FO9B 1NOAA 2EADA 4U1LB 2IXQA 2MH4A 1U4EA 3PGDB 4UU9B 5E4AA 3E9UA 4UV4L 5E8EB 5C0GA 1OWRM 2NNAA 3CG8A 4TSAL 2ZD0A 4ZMXA 1ZSHA 4WTQA 4DKEL 2AMGA 2OBGA 3H3PL 4R96A 1UEYA 2CG9X 3H42L 1H3WM 3ZL4H 4BZ2A 5ERWB 3S88L 4UIMB 4WO4D 5E2TH 4JKKA 4AXWA 4KK5D 4PREA 5AKRA 3BISA 1C1EH 2CLVA 3TPUB 4HIPA 3OL2A 5TH2A 4OJDH 3SZ6A 3X3FL 4QT5B 2E9IA 2FRGP 1OGSA 1FGVH 2XTJD 1IARB 4RAUA 1NBZA 5GSRB 5JXEA 1L7TL 5FO9B 1ZY9A 2JJWA 4ODHL 3QAQA 1MAMH 2OZNA 3BGFC 3VI4F 5C70A 4GFXA 5E08L 1XMWA 1DQQA 5CIPH 2WKOA 5ID0A 5IQLA 3SQRA 1J5HA 1X3DA 2NY0C 4HWBH 1HJBC 5D2LF 3DPBB 1LEGB 2ZX9A 1QFWI 4MA8H 3UEZA 2NSQA 2SEBB 4I0CC 5J11B 1I8UA 2DQHH 2GUOA 4MBRA 3MRCA 2VDLL 1G0XA 4I3GA 4CN4A 1TEFA 3DMMC 4YGVA 3ZHKA 3P9WB 3CMOH 4MGXA 5E7FA 1UVQA 1DL7L 4FFZA 4GIOA 1E5UI 2HVJA 3GBML 3GNML 3MKKA 3HPLA 4NNPH 3MV8D 3KPTA 3U48A 4F57H 4F9PC 2ICWB 1O5PA 3BO8A 3EZ8A 3IJEA 2XBDA 5JLZB 1HC1A 4ZW7A 3FRUA 2W1NA 3A22A 5F7KC 1KCRL 3EGXA 2L0DA 4N5EC 4OCYL 3MA9H 3MRMA 3A23A 4X7DC 2VXVL 3CSFA 3O45B 2XCMC 3N41B 4XPAL 4N85A 2Z0UA 3TIDB 1JZEA 1X5MA 4APQC 4DQOH 2P48B 4FJZA 4P9ML 3PWPB 2DM3A 1MIMH 4FI6A 5JW4R 3BSZH 2M8XA 5GZNC 1B9KA 1WCBB 4WRLA 4OQTA 3M6DA 2FECL 3UDWA 1KACB 5DWPA 4Q89A 3CPLA 3FHQA 1FIGH 5KW9H 3Q06A 1HYSC 4OGZA 3HZMA 1G6RA 4U3SA 5K59F 5C0JB 1PLGH 3DV4B 4AQOA 4JPSA 2GBTA 4HBCL 3EYFB 5I1LB 1BPLB 4RZCA 4P5MB 5D93B 1I8KA 1CPUA 4ZS6C 2ATPA 3MBEA 1QX1A 2EICA 2IDCA 3H2WA 3IJ8A 4YDIL 1JXGA 4LOUC 4OZIE 3S8GB 4FCHA 4BZ2H 4ZTPL 1U2YA 3WNJA 4TTDD 3KG5A 3OQRA 4GT7A 3NGBB 5B7MA 4TM9A 4TRPH 3MBWB 5I8EB 1ZS2A 4XI5C 5FKAA 5HHXL 2C1OA 3S8FB 3PGFL 3GHBH 4YBHA 3ARGA 4Z7NF 1SOSA 5T5NF 3ML8A 4N9OB 4HXBL 2P45B 1IBGL 3N85H 4HUWA 4R26L 3F7VA 5E4OA 2ZUSA 4BEIA 2J4WL 3GZQA 4JHAL 4QRPA 2ZICA 3FCSA 3FULA 1Q0XH 2G9HB 2D4DA 2VDPL 4E9YA 1E9OA 1OGPA 3AFLA 3QPQD 1OHQA 3AW5A 1OD7A 4AGOA 4KAQL 2UVFA 2QELA 3FCGA 4I0KA 4YZFE 5EOQH 4HUWB 3DURB 1WWAX 3VD1A 2B0SH 4QOKD 4XHJD 4BBWA 4OTXH 1F6AA 2AK4D 3NPSC 1GMIA 5G55A 5BUPA 3KLLA 1A7PL 4PCSA 3ZGIA 3GXNA 5HGHB 1WTGT 3MRFB 5F71A 3I6KA 1J9RA 4MDJB 1CGVA 5CGBA 4FHKA 1T7WA 3OLGA 2MMXA 3ULAB 1AR1C 1J0IA 4JMXA 5GISL 5KJRL 1HZKA 4OD2B 3Q8CA 3ARGC 1S7RA 2GY7B 3GSRB 1OOAA 4H26A 1FYTA 3F7QA 5CILL 1A4CA 1J7VR 4FLOA 3AGWA 4PM1A 1P5UC 4N1HB 1S9XA 3A6BH 2IF7A 3W38A 3VJ6A 1ZAGA 3N1GC 3SQOL 3WJJA 1XGTA 1JF1B 4E68A 4WEBH 3NZUA 5CSBA 5AL8A 4UM9A 2YXWA 3JWNH 4WFED 1KDIA 1KJ2H 4IMKC 3SKMB 4JB9L 3GZOA 1S9XB 5GGSB 2GK2A 4E36A 4XB7A 1OARH 1U95B 3X11A 4UDTA 4HIJB 2EDDA 2WVVA 3CFQA 4M61A 3L1GA 3PWLA 4N2EA 1I85C 2B4CH 4Z77A 4YHOH 3CLEL 4DN4H 1QBLL 2DMKA 3GMLB 3DROA 3LX9A 3R4RA 4I3RH 4U6VH 3X2QB 4K15A 3EO0B 3HE6D 3DRTA 2CO7A 1FZOB 3I9PA 3K4AA 4K8RD 3V7AE 5F7DA 4GKZB 3QYMA 4XN7A 4GEJA 4DUWA 4L3FA 2EDKA 1OP9A 1KCRH 4M9OA 5AW4B 2R1XB 5F7EL 4ZFFB 5I1DA 1VFAA 3BD5A 1VF5C 1OSYA 1D7CA 3ZDXF 2JIXD 4S0SD 3EGXB 3WTXA 1G7MB 1VERA 4LSUL 1N5YH 4HGMA 4P23D 2ZXCA 4WQOA 2IGFL 4JQXA 2VDRB 3BSZL 1DQJA 1ZMYA 3OX8B 5ITBL 25C8L 1BHGA 3IMWA 2E27L 4U1GB 4ZFQA 1NWPA 1NKOA 3BPCB 1RZJL 3B2PA 3VWJA 5CLZA 3HZ3A 3NIFB 1WWCA 5L8LB 3EUUA 2Q7YB 5DLML 3P77A 3W0WA 2EKSB 1IB5A 3EJSA 5DHVA 1V3JA 3WKYA 1U8MB 5ICYA 4CJ0A 2A83B 2X0VA 3QIWA 4JFHD 4EDXA 4BFIA 3I02B 1Q0EA 4L4VB 1HHJB 3QHTC 1DJZA 4KZDL 4YE0A 5LCVL 3LXUX 5LGHL 2UZXB 2ZIDA 4X8GA 4HMDA 4KKLC 4N2CA 2DM2A 1CG9B 2MKLC 2XIDA 1I8KB 1J8HB 1ECZA 2V6HA 4MSWB 2YMOA 4F7MA 2VQUA 3NAAH 1O6TA 4L4TB 2B3RA 1Z9LA 2WOYA 3FCUB 4MA8L 1UYWH 2XWJA 1NUFA 3BIAX 4LCWE 3OG4B 4P2OD 4S1QL 1DQML 2WYIA 2YBRB 4JFZH 5JHDD 4Q58C 4LLVB 1HOEA 3CX5K 1D5IL 2GYSA 3F64A 3IJHB 3VXOB 1CG9A 2LU3A 2VQTA 3QIUD 5LBSH 1I8MA 1GYCA 4KDTA 3JV4B 5LAXB 2VN4A 3GJFA 1RUMH 1ZPLA 3MCYA 1NAKL 4N2DA 3TIDA 4JG0L 4RMRA 4TVPD 4DP6X 2V7HA 3HBGA 3O45A 1FDLH 1BLIA 3HG5A 1PZ3A 3LPGA 1J9SA 1RK1B 4PG9A 4RNRB 5HGAB 3DIVA 2XWBA 1FI8C 1UD6A 1DN0A 3HAEA 5I6NA 4OCNC 1P1ZB 2P5WE 2PYEA 3CHRA 3BPCA 4Y16B 1FNAA 4H25B 4U0RB 4FN0A 5JPNA 1GGCH 3QNZA 3VVVA 3VB9A 4ZMQA 3MNWA 4XXCC 1TXKA 4WTXA 3RPIB 3PHAA 2WQSA 2F19L 1K5NA 5E6IC 4FERA 1KCSL 3WKNA 3ETBF 1ZVHA 3FYIB 3B9KB 2NX5B 4PJDF 4PB0L 3HJ0A 3TF7C 2WBJB 1MW0A 3EH4B 4NFCA 4P46C 1MREL 4J23A 3RWEA 5F7DB 4GAGL 4P2OB 4RSVA 1GH7A 5KYUA 3GXFA 1GHFH 2ED6A 4LDEB 2BIHA 1QUPA 4MNQB 1YN7B 5EZIL 4OLXH 2ENYA 1Z5HA 2VXUL 3P11L 1U3HA 3IXAB 1VENA 5DFWH 1RZKC 3ZDYE 3FO1A 4LRNH 3BRGC 3CDGA 2O72A 2IC2A 3BPLC 1CMOA 2MOQA 2UZIH 5CLWA 1MFDH 2GITB 3UBXB 2X41A 3GSUB 2F1AA 3TA3A 3S5YA 1RAMA 1P9MC 1OXYA 2WIIB 2EEDA 4TYUA 1U8LA 3FHAA 2MCPH 2K3HA 3H0TA 1AIZA 2EE2A 3SHSA 4DVBA 1FL3A 5I23A 3BWAA 3FQNB 3NDYE 3TBVA 4AGNA 3ROLB 3VG0H 2W9LA 2VZVA 2ICWJ 2XHNA 3QCTL 3HCVB 4ZQKB 2CO4A 4E2OA 2DWSA 4YXKL 4BFOA 4L3EB 2BVQB 3KPLB 4Q9RL 1Q94B 2AJUL 2Z8WC 4Z7UE 3SE4C 1EVUA 2R1YA 4GSDH 2X42A 1IUZA 2WWKO 3QPXH 5E8OA 3I6KB 4M6MH 4L0ZA 4P4KC 2QDVA 5A7EA 3NZ8B 4AZUA 1OB1B 4UM8A 2D4FA 2ITDA 3CDZB 3U4EA 3VGHA 2HLFC 2V9UA 3D18B 1RSFA 4UZUA 5DZPA 3DOSB 5FWRA 1CYXA 5EBLA 5T1JA 2O5YH 1M2OA 3D85B 4RETB 4P9HH 5MENE 1K4DA 4ZNCD 3ZT7A 1YG9A 1JGDB 1JPTL 4XNYH 4F2ME 2D3LA 3FU8A 5E0FA 1QSEA 1UA6L 1DFXA 1G9NC 1KTJA 3PWUB 2NNRA 4EDXB 1TQSA 4QJ4B 1HEHC 5ISZE 1KCLA 5BRZA 3TBYA 4K94H 1NCNA 5T3XE 1W6LA 2OJ1A 4N0UB 3L17A 4N0FA 1EHLH 2HT2C 4M6OH 2EACA 3WXVL 4GJTB 4ODTH 4IOSD 1H3UA 1L7IH 2FSEA 1N0XL 3AADB 4KJQD 1URZA 1U30A 2D0HA 1TZ8A 2ESVA 2YZ1A 1EJ8A 2N56A 4M1GH 3U6RB 3OXRA 3AMLA 4YDMA 3EYOA 5HPMA 2CGZA 5I19H 2A4EA 2WLNA 5H37H 2C9VA 4TNVK 3TBYB 5BRZB 4E0RA 2XYBA 1PX3A 3VXMB 4UOW0 1NC2B 2PWDA 3DVNB 3VH8A 4QTIH 1WFJA 2V2XA 5CU9A 1VPOL 3P4MB 3MBXL 3B56A 4XN8A 5IWLC 5EF3A 1PIFA 4Y8DC 3U1QA 3ZDWA 2ZP0T 4Y5YC 2QADC 3SCMA 5MERB 1FHNA 3ME0B 4JRXE 4MNGA 5DJDA 2P80A 3F3HA 1LWJA 2PYFB 5D2NC 5AVZB 1DCEA 4NLAA 4P3DB 3KGUA 2AK1H 4UF7C 4W9CC 4Y16D 3VD7A 3D0VA 3GI9L 3O6FB 3N1QC 3T2PA 1IM3A 4OD1L 3KM1A 2J6EA 3MREB 4RA0C 5A2KH 5CGMA 5DD3H 4DP0X 1CICB 3P30H 3HAEG 3HMXL 1YEKH 3VWKC 1U41A 1JCVA 3GMRA 5DJDB 4IGBC 1M9WA 1B4LA 3QULA 4JRLA 4P2RE 3GJFK 5E6IA 3WUZA 4FXGB 3QG7H 2QZQA 3CFEA 4AK2A 1HEZA 1T4KA 3TBWB 1WFUA 4GRMB 4C4KO 5LGJA 3OF6A 5T1DL 3UC0H 4CSSA 5HVWA 1NOFA 2APTA 1WFNA 1CB4A 4XVJL 3RWCA 1BJ1H 4X8XA 2AQSA 3LEXB 5GGTL 3TIEA 3DOIA 1M3JA 1XGUA 2O30A 1QSFA 5FUOL 4BZ2L 1LMIA 1PZUB 3O4LB 1QVOA 4JM2B 1KV7A 3NA4A 4AIXA 3RE0A 1E27A 4B53A 2BIIA 2VT0A 4PVNA 3WFHB 3ZDYB 4LKXA 3OF6D 4JRFA 4F7KA 4KRPD 3NPZB 5IVZB 2AXGB 3LCYA 1BQSA 2B1HL 1ZLVK 2EILB 2RMNA 3V4PL 2VUYA 1R3KA 3JZYA 3P4NB 4ADIA 1LXMA 1UM5L 3B37A 3MJ9H 1NIBA 4E5XB 3OZKA 4LKCB 3V6OC 1QHQA 3F8UB 2DQTH 3K74B 1TMQA 5HHOD 2BIPA 1P6FA 4Q9RH 2D7OA 3FBQA 2CLZB 5KVFE 3D85A 2AKRB 4G59C 2IPUK 4PSPA 4FZ8H 3GRGA 1SM3L 3I3EA 4Y16A 1R33A 3MLRH 4JFEB 3QUZC 3FRPG 4BM7A 4NZJA 2B3IA 3HAEH 1DN0B 4PJFA 3ZUNC 2VLRE 1AQKL 2E8YA 1GYVA 1HL5A 4HHWA 1TJIH 3RWJB 4K9EC 4I9XA 4AYGA 1WA1X 3WIHA 2AW2A 3AM8A 3OPUA 4BELD 4KKPA 3B9KC 4FC3E 3V0GA 4NRZA 1H0DA 4KRPC 5CIPA 1BMZA 2XA8H 5I28A 4UAHA 3H9SA 2NY5L 3DJTA 3RGBA 1AQMA 5I0WA 1W15A 2W07B 5JMRA 2HJKB 3V0AC 1ZA3A 2ESVD 2JMRA 2CE6A 3OC5A 5HHQB 2HRPH 3SGJA 3WFBL 5LB1A 4ZUSB 3BT2L 5T5FA 4WW1B 1HT6A 2BS71 5D5MB 4EN3D 1OF2A 2C9UA 1JDAA 5HXMA 3LYRA 1VIWA 4L4TA 2B1AH 4GP5B 1EWHA 5GZOA 1QSED 3T4AB 1WUNT 1QW8A 1K8IA 1GYUA 3IMBA 3CX5J 3O3DA 3FFOA 4YHML 5FA4A 4JFYA 4Y4HC 5ANMB 2F7QA 5E1IA 3C2AH 5MI0B 3ZXAC 1MCOL 5J13B 2WN2A 1COBA 3JTSB 4AENA 4WLCA 4RGOH 1JV5A 3KDMB 2XXGA 1JMZA 1FV1B 2BPBA 3DX3A 3QFGA 3LPOA 4XAWL 5F96L 2DLFL 1F2XK 1KELH 1ETZB 2DI7A 2EKJA 2AJXL 3LIZH 5FB8A 4JFOA 3LKOB 1IKOP 4XMTA 2CR3A 4PJHB 1D3CA 5KTEL 1SHXA 3MLXH 4RIRA 4PJAE 1LO5A 3OKEA 3WTWA 2X4RA 2GEQA 1P0SE 2WCPA 3JTBA 5EU6D 4D0BB 1DEDA 3WFCL 3FFCB 1FPTL 2PO6A 3BP5B 4G8AC 2X53A 4HLEA 2BNRB 4Y4KD 3CSBA 4I1RA 5C6PB 2XPZA 1MCHA 3HB3D 1ZWIA 3M1BA 2B0SL 1RFDL 4EI0A 5IR1A 1INEH 3ULVF 1E3XA 2DYPA 2B2XH 4IHOA 5F97E 4CADA 4ZZKA 3IGKA 5D1ZD 5E94A 3RWHB 2D3VA 1HWWA 3N06B 2BIQA 3MLSL 1T0MA 3P73B 4U49A 5C0BE 3ZKMD 2CH8A 3WV0A 1SY6H 2UY6A 3UFIA 1AD0A 1ET5A 2R2BA 4MB5A 1AOHA 2JTDA 4H88H 3F7RA 4UTBL 4HOZA 3CHSA 1IC4H 4U6TA 2NPLX 3CSYB 4AQAB 4ZSOB 4BFEA 1A5FH 3U0TA 2CNZA 4OZ4B 2B1HH 4F27A 4OFQA 3QUZD 3WMQA 1P7QA 4NPJA 1MCWW 2JKWA 2YAFA 4UDUB 3Q6GL 1U95A 4P2QA 4U2ZA 2Z31A 3X11B 4HOWA 2MFNA 1NGQH 4Z3TA 1MY7A 1JGUH 4Z6AT 1A4KB 3J2PA 2X4QB 3DX8A 4JFFE 4ONGL 1OARL 4U1SA 1UUSA 2NY4B 4X5PA 4WV1A 1MWAB 5LQBL 1QPPA 4XH2A 4A2EA 2R4SL 4XBGA 1S7UB 1MFCH 1UENA 2L8AA 3WEBA 1L9MA 1P4BL 3DUUB 3SE8L 4HFWA 4PJ5A 4R5VA 3JWOH 3O6FC 4RGNE 1S9YB 3WD5L 5HYJB 1PSKL 1QP1A 4JNXA 3MV8B 4P2RB 2A5UA 1JJUA 3BAIA 3QQ9D 5F7EH 3ECUA 5D7LE 4ZRGA 4GRWB 2NY3C 4OT1L 1E5BA 3H7BB 1JK8B 1BD2D 5H37G 2ZOOA 3T77B 1KJMA 1BIIA 1HQ4A 5FGCB 3GMOB 4HCFA 1F6AB 1P9MA 5GHWH 2Z31C 2R2CA 5DD3L 1QAWA 3AXHA 3PDOA 3TLRA 4JFPA 3JBG7 2Q5BA 2EYSB 5CZXC 2AEOA 1A14H 2Y36H 3B3IB 4Z1PA 1V54B 2W94A 1NC4A 2EDNA 4ZAKC 4Z7NB 3T71A 3ECBA 4YDZA 4MMYB 4PRBB 3ZYOA 1VCAA 1FL6A 1UB6B 4AGLA 4CVXB 3RZCD 1QHPA 3RIFF 5BS0B 2E5EA 1XD1A 2XTJB 3EO0A 4XVTH 3KPQA 2X1XR 3PL6C 4FQLL 3HN8A 3R18A 4GIPD 2V9RA 2D0FA 2VZTA 4OQ1A 4POZC 1JDCA 5BZWB 3CFIC 5EBGA 1YNTB 5LGHH 4G8GE 3IN0A 4JM4H 3SGKC 3EH5B 4L1TA 1MFDL 1CD0A 5ELIA 1U8JB 2P47B 4HBCH 3WS3B 4HUVB 3LN5A 1DVFB 3SDYH 2WQUA 1VJSA 1CC3A 2EEFA 3IDMB 4M7ZB 5D72L 4E41B 2I26N 1X4XA 3GB7A 3RVWD 1UD5A 4YUEL 1ERNA 1FGVL 1ZHKB 2UX7A 4M3HA 4Z7WA 3UYRH 1YY9D 5EIVA 5C7XL 1C08A 2BSBA 2GPZA 3SGDI 2IBZY 3BH9A 1TNNA 4NUGL 1HS6A 3C8HA 2F5AL 4HWZB 1F4HA 2COQA 5FA3A 3U7WL 5JQ6L 2WWMD 4AKQA 3D3VA 1JV2B 5IFHH 5FWQA 3EH2A 1W0WB 4KK9C 4MWFA 4KDWA 4QXUL 3TBBA 4YHLH 3C2SA 1ZSDB 1KTDB 2AXFB 2NW2A 5LVEA 3CZKA 4NQCB 4ZK8A 4Y9EA 4C56A 2WMPB 1A9EB 2OMXA 2GABA 1RUML 3GBMH 4QAWA 5L6YH 4LSRL 3RZCC 5I82A 3DVFA 1AE6L 4MAYA 1KB5H 2PXYD 4HC1H 3CZJA 2BNQA 3NIDB 5ANME 2DWDB 4POZD 4YC2B 4A6YA 2CLRA 3WIIL 3UJIH 5AW3B 2HVJB 3WI9A 1S7TB 4ZFZA 1WD9A 4UM9D 4J8QA 1BYPA 4KY1H 3SBQA 1INQB 4YGVB 4BK4A 3ZTCC 1T5KA 4NJ9H 4Q2ZA 2FNBA 3ECQA 5A6IA 1J1PH 4JREB 4OLYL 1FV1A 4FULA 1K5WA 4OLXL 5KYWB 1GTFA 1L9TA 4PJ7B 4KVCH 4AQ8A 2UUDH 2HFFB 2BMKB 4JZJC 4P3WA 5I75B 5KN5A 1MREH 5GGVY 1DUZA 5CJQL 5GIRA 2OULB 3D0AA 1ETJA 1JSYA 4JKPL 2JKIS 4HJIA 4U1GC 5IJVB 2OK0H 2KLRA 1E28B 1RD6A 3DIFB 4H8WH 1KG0A 2AK4A 4UI2A 4GLRI 3GUFA 3Q9QA 1GC1L 2EUVA 2W9EH 3O4OC 5D96C 3ML9A 4MSWA 1EHKB 2X89D 4S1DC 3BWUF 1WT5A 1HHHB 1Z9SB 2YUZA 4IU3B 3SDDD 4Z0XB 2QT6A 4DZBB 2HFGL 4NBZB 2VH5H 4S11A 2Q20A 4F7PB 4G9FE 4N0CC 2JKRM 1DBML 2XZCH 4JKLA 5ITFA 4PW4A 2YA2A 3MXVH 1BZ9B 3GHBL 5JQIB 2CRIA 1M6UA 2VDLB 4JDZB 1ZEAL 3FSOA 3JVFC 4TUUA 2BCMA 4OCXL 2IGFH 4KKBD 1SBSL 4WSGA 3ZHLA 1EEZA 1ZCRA 3A6OA 2JI1A 3ZHNA 4WUKH 2HTKC 5DDHB 3UTTA 3CH1A 4PJXA 1TFPA 1IBBA 3QJQB 1NDGB 2IQAB 1FN4A 3O9WA 3Q8BA 1ZGLM 5AZ2H 4JRYB 2ICEC 3EJUA 2Q86B 4HS3A 4WEEA 3FJTA 3CVCA 4KH2A 4K5MA 2GSGB 1IZKA 3S2CA 4LP4A 5AW1B 2WLIB 5IMKA 1LP9E 3EDDA 1F6FB 4LKCA 4XNZC 4EI6A 1F8TH 3MX0B 5TF0A 3VFRA 3UYRL 2HAZA 2HRHA 1FIEA 3EJRA 3LZFH 3HBPA 1LDPL 1TQVA 3IVKB 5GISH 3VGEA 1NKRA 2WINA 5FGCE 1HHIA 2PCFA 3X1NA 3UZEC 2BOBA 3KBHE 1EFXA 4GQ9H 3ZE2F 1AI1H 5IUSA 3VI3E 2VO5A 2XN2A 4YBLB 4V2CB 5G2NA 1MFCL 4ZAKB 2X6UA 2GHWB 4RLDA 4M00A 2X1OA 1X5JA 4WEBL 3WTUA 3IJ7A 2ZYRA 3WNKA 2C3VB 3IDJA 1OPGH 4L37B 3OJDA 1N8OE 4WU5B 4Z7NE 3SDCD 3EDKA 3G9AB 1ASPA 4TSCH 5C0DA 2ZG1A 2OYLA 3VNZA 1AXTL 4XE0A 3S4SG 1IL1A 3ZW3A 2Z4QB 4EN3B 5JHDE 5LNEA 3BUBA 5L6YL 4OFPA 3HFFA 4B60A 3AITA 1CE1L 1BREA 1CFVL 1I8IA 2KT6A 3Q5OA 2FYYB 5DQ9A 2HKFH 1M7IA 1VAHA 1PNDA 2D3NA 3DNKA 4DGIL 1JZDC 1TF4A 4LHUD 1UZ8B 2WO4A 4M7ZC 5DJZB 8PAZA 4K07A 3CGTA 5BVPH 5EA0L 3BQUD 1OAKH 4LVOB 3ULVE 3NA9H 2VL5B 3WJJC 1G9MH 1DJHA 3DVNA 3VH8B 1E6JH 4HHAA 3DBSA 4PRNB 3VFVB 2JELH 5MERA 3QO0B 1HILA 2IWFA 5I1CL 4C54A 5T1LD 5JXED 4YNYB 4WJ5A 1TOXA 3FQRA 4OGXH 3K6IA 1FNFA 2B16A 3BKYL 3I85A 3ZYZA 4Y8AA 1M05B 1GOHA 1MCOH 3FB8A 3DTXB 1TT6A 5I6OA 4I0PC 1KCWA 3RAJH 3VM7A 5JW5B 1MHHB 1AH1A 2M83A 1L5GA 1CBJA 2X4SB 3EYOB 4UIKL 3TV3H 1LO0H 5BOJA 12E8L 4WO4A 3ZLQC 3VDBA 2XV6B 2OL3B 2W9EL 4DGWC 5D72H 2YGOA 3L48A 3ULVL 3CVDA 4M29A 5DZLA 3PDDA 4WCYH 3RI5K 1KELL 5T5FL 5I1JH 3CJJA 1TKWA 2W92A 2XQYK 3IRZA 5LG1A 1CTOA 5KVGH 4XXCA 4JJ5A 5IHBA 2A9AA 1TU2A 3B2XA 4K73A 1KXQA 1O6VA 4WFHD 4GG6F 5CAYB 3DXAD 1CL7L 1T20B 3L4UA 4O51B 4WHDA 5B4MD 3O81A 5C0CD 2X09A 3KYNA 4BA0A 1IEAA 2A73B 3IDNB 1R9FA 4MJ4A 4RMWA 4LBAA 1BYOA 3LKRA 4U1HB 3MKGA 5K9OA 2H8PB 1G9NL 1YHPA 2K4WA 3KBPA 4OM1L 3DWTA 3NSFA 4OJEH 4HC1L 3KYNB 3VAEA 2HLEB 1FH2A 3DX2A 3IETB 2GEEA 1FLRH 4GRWE 5I1EH 1OE3A 3PHSA 4XHJC 1U3NA 4AYSA 3KVPA 1WWBX 4K0OA 4CVZB 3EO1B 5DMIL 5TTRA 1I75A 5EUKB 3U79A 2XFGB 4HPOH 4K2UL 4QXTA 1S3KH 3RY4A 1QNZH 4JO8A 1IGCL 1RURH 3L5IA 3UDWC 3QXDB 3CQQA 4I18B 4J6RH 1NFDA 1H3VA 1PVHA 1KBWA 3KLKA 3KVQA 3OV6A 4JFDD 4L8SB 5D7HA 3LS5L 3SE9H 1MEXH 3MX0A 4HEME 4JLRB 3B7SA 5HYSB 3FO0L 4PCYA 1CIDA 1S46A 2J8HA 5IW3A 3JV5A 1MFAL 3R8BB 3L3DB 3MJ8B 4J8RB 5KAQF 3QI9B 1FFOB 2EIZB 4NP4L 3T0WA 2NR6A 4HU2A 3MBEC 4IKNA 4AMKL 3FH5A 4YK4B 1PD6A 1XX9C 2F61A 4X6BB 3QNXA 3BZEA 1MW3A 4KRPB 1K5NB 3L7EB 3DSNB 4CW1B 5IQOA 3LRSA 4QO1B 5KVFH 4EO5A 4GMTL 2EDXA 2VDOH 5IMMA 2DYSB 1AYOA 5KYYB 2Q7NA 4C47A 3GMRB 5CCKL 5D7LD 2IPTL 4QY8A 1E9PA 5EWIL 1DQIA 1ZHNA 4JKWA 1ACYL 1PX4A 3CVBA 2P8LA 3TEZA 1AZVA 1DEEA 1I1FB 3NJGA 3M07A 4NQVB 5DTFA 2FJFB 2L4OA 2IV9A 3N6YA 3REVA 1QLEB 2XN0A 4HEPG 4LCWA 1WGVA 2ZZUT 2VSCA 3K1KC 3NA9L 1B4RA 4OF5A 2YK1H 1A4JA 3H1ZA 2RQ8A 3AAZA 4K9EH 3CVHH 4D9QD 1WG3A 2VDKL 1UCBL 4JFFD 1QKZL 1QRND 2N59A 4QHPA 2NQCA 2QQQA 1WWWX 4GI9A 5MI0C 2EYTB 2PPDA 3QBTB 2ZWYA 5IKCB 2X4OA 3OGOE 3WJMA 4M7KL 4PJDE 1UWYA 4HALA 4GAAA 4F5CE 4D0BA 2Y1YA 1CD1A 2OTWA 2YKLH 3I6LD 1BIHA 3D30A 4OKDA 5LNGA 1RU9L 1GS6X 1KIQB 5JDJA 4JY4A 3SCMC 1DBKH 4ETQA 3T08A 1ZE3C 5KN5B 3U30C 5I1KL 2BOBB 5GGTH 5HHNB 2JJUA 5I75C 2LTQB 1M7XA 3TJHD 3QZMA 2P5WA 2PYEE 3P0YH 4OKVB 5L4IA 1E8YA 1FBIL 4GW1B 1F3JA 1RV6X 3MV11 4P23B 3S37L 5DJXA 3EHBD 3HTLX 1HHJA 4QRUA 1THAA 3NQIA 2VLJA 1ZTXL 1IT9L 3QDJA 5ESQA 4PJIA 5EEZA 3A4AA 5EF1A 3K72A 3NFNB 4ZO6A 4FE9A 3GJEB 3G5WA 1E90A 4J4PA 2P5WB 4JVPA 2K9UA 3QG6B 2PWGA 3IMUA 4X5XA 5IVXF 5IGXL 3C60C 4FKHA 3S9DB 5DJZA 2JQMA 4Z7UF 4XMPL 4CAGA 3KYOB 2FX8L 4HIHB 4P5SA 4BWUA 4A04A 4L4JA 4ZUSA 1ZVSB 5FF6A 3SE3C 4O58L 4YL9A 3TP4A 4AUJA 4HV8B 4OTXL 3V5KA 4APXA 4DEUA 5IV2B 2ADIA 1DVFD 1DSWA 3VMNA 1I3RB 1WYJA 1NQBA 4YFLI 5I66A 1VEOA 5J3HD 4MS6A 1TVBB 3HKZA 1GIGH 2X4UB 4TKWA 4AL8C 4QYOB 2OXGA 3VFMA 3BH8A 5CJOH 2BY3A 1JGVL 5ICUA 4DH2A 3HRZC 4JGUA 2CO2A 4FGMA 4M03A 5IROA 4ZMPA 2YGPA 1WIUA 1UH2A 2A9BA 3RVTD 2VITA 1E4WH 5DSCA 4NRYA 2Y1AA 5IBLD 4NI6A 3BKYH 4RVBA 1EUTA 2FE0A 2WINB 1SVBA 4D8PB 2PTUA 4POUB 4NNXB 4QHKJ 4YSQA 3KPPA 5J12C 3T6ZA 4ZW8A 4H8WL 1R0AH 1T80A 3VJ6B 1LP9F 3HMXA 1BZQK 2HJFB 2ROYA 3PAYA 3ALPA 3WEMA 4QJ3B 1KFAL 2MNJB 3P02A 1BQLL