1OT6A

Cryotrapped crystal structure of the e46q mutant of photoactive yellow protein under continuous illumination at 110k
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ot6A00
3E4OA 4HIAA 3UB7A 1XFQA 1F98A 1UWNX 2WKQA 1S1ZA 1N9NA 2INWA 4HJ6A 1DP8A 1ODVA 3P7NA 4I3IA 5F68A 2YKFA 3CWFA 4HOIA 1F9IA 3EWKA 3MJQA 2QWSA 3IBRA 1KOUA 4GHIB 4I39A 4WUJA 4XT2A 4HJ3A 1LT0A 4HNBA 1S4RA 1Y28A 2M1CA 3BY9A 2HV1A 3OLOA 1WA9A 2V1BA 2QJ5A 1OJ5A 1P97A 3H82A 4GS9A 4WLAA 5F69A 3UMEA 2I9VA 4R3AA 4HQAA 2Z6DA 1D7EA 3F1NB 3LI8A 4HI4A 5KIZA 4KQDA 3F1OA 4EESA 3HJKA 3BWLA 1OJGA 3F1NA 2PDRA 1OT9A 1DP6A 1LSXA 5EFWA 1OTAA 4GS9B 4EERA 3MQQA 2BASA 3HJIA 2YKHA 2OOLA 1OTDA 4LRZE 1OTBA 3VE3A 5HD3A 3BY8A 2V0WA 4R6LA 2PYPA 5F6AA 1XFNA 4PKYA 3VOLA 2GJ3A 2L4RA 2WKPA 2W0NA 2QKPA 4HP4A 4R70A 5HDCA 5HWTA 3LIBA 4JGQA 3UB6A 5DJUA 5HWVA 4H6JA 1T1BA 4E04A 3FG8A 3IS2A 1XJ3A 2PR5A 4EEUA 3F1PA 3ULFA 1MZUA 2V0UA 3E4QA 3UMDA 1N9LA 2A24A 3T50A 3H82B 3KX0X 4XT2B 1TS0A 4I5SA 1LL8A 2D01A 4L9FA 4DJ2A 1V9ZA 1LSVA 2L1MA 4HP9A 4MN6A 2QJ7A 5TBMA 4HH2A 4WL9A 5J4EA 4MN5A 2VEAA 4EETB 2PD7A 3EEHA 4F3LA 1D06A 5HZHA 3PYPA 4WN5A 4NXEA 1VB6A 3UB9A 4NXBA 3MR0A 5I5LA 2KX6A 1UWPX 4HJ4A 2WKRA 4K08A 1NWZA 4NXFA 2PR6A 4LLOB 4NXGA 2VV8A 3E4PA 3PHYA 2CMNA 3LIFA 5F5YA 3GECA 2R78A 2V1AA 4H6JB 1LSWA 5G4ZA 1DP9A 1T1CA 2ZBBA 3K3CA 2D02A 1G28A 4R38A 1T19A 2PHYA 3D72A 3C2WA 2V9AA 3NOPC 4I3JA 2L0WA 3ICYA 4KUKA 5HSQA 4BBVA 4L9EA 3NJAA 4JGOA 2OWJA 3ZQ5A 1EW0A 2VLGA 2VV7A 3F1PB 3LIAA 3G6OA 4GCZA 4HHDA 4RQ9A 3CLOA 1GSXA 3H7WB 3IS2B 2A24B 3LI9A 2KDKA 4JGPA 2P7JA 3LUQA 4JGRA 2ZOHA 1P0ZA 2JHEA 1XJ6A 2K7SA 3A0VA 3LIDA 3RTYA 4EQ1A 3C8CA 4KUOA 3FC7A 4I3AA 3A0RA 5HWWA 5HD5A 5J7EA 2PD8A 3F1OB 4BBUA 1V9YA 1GSVA 4BBTA 4B9OA 2ZOIA 3B33A 1OTEA 3H7WA 3K3DA 3UE6A 3NOTC 4WF0A 1OT6A 1S1YA 1T18A 2QHKA 3GDIA 4HY8A 4L9GA 5AVEA 1N9OA 3SW1A 4DJ3A 2OWHA 1OTIA 5DKLA 3CAXA 4EW7A 4EEPA 4YWZA 1TS6A 3MQOA 2W27A 2VV6A 3LYXA 5AVFA 5IU1A 3LICA 5IS1A 1XJ4A 3LIEA 1S67L 5J3WA 1X0OA 4HH3A 4M4XA 4PKYG 1S66L 4LRXC 4LPZA 2EA9A 4GW9A 3VE4A 5A8BA 2H28A 3H9WA 3MXQA 1TS7A 2J80A 3NHQA 2Z6CA 4I38A 5HDSA 1DRMA 5TBMB 1JNUA 2PYRA 3NOUC 5G4YA 2JN7A 5HDDA 4GHIA 1XJ2A 2B02A 4LRYC 4F3LB 5DKKA 1S4SA 3RH8B 1TS8A 1T1AA 1UGUA 3UB8A 4EXOA 5DJTA 3MFXA 3A0SA 1BYWA 1GSWA
chains in the Genus database with same CATH superfamily
5HAQA 4JXWA 1GHPA 1I2WA 2HDQA 4R4SA 3KYZA 3M2JA 2P08A 3OLOA 1IOUA 4HQAA 3NECA 4OQIA 3MZDA 1PFLA 3CZDA 4KZ4A 1CEGA 3HCYA 2W3FA 2WKPA 2ZC7A 3BECA 4EBPA 1ZKJA 1L0DA 2W3GA 3C4PA 1BLHA 4R4RA 5EUAA 1NYYA 3SOIA 2V0UA 3T50A 1RP5A 3H82B 2P74A 4QWOA 3WS0A 1P9WA 4L9FA 4QY6A 1LSVA 4MN6A 5HZHA 3PYPA 3LR4A 3SS4A 3CPTB 4WN5A 3MXRA 4EV4A 1DJBA 1H8YA 3D72A 3T1XA 2IWDA 4HEFA 3ZHHA 3TJZC 4CLCA 3IWIA 5E2EA 3PBTA 3UB5P 1MY8A 3OPLA 4E3LA 1NRFA 4MLLA 2KLIA 1GSVA 3B33A 3FYZA 1OTIA 2HJEA 3CAXA 4M3KA 2Y91A 3LIEA 1S67L 5J3WA 2VGJA 5AQBA 3DTEA 1H0MA 2Q0OA 4E3NA 1YMXA 2P04A 2HDRA 4S2NC 1CI8A 3Q7VB 2O0YA 2LB9A 3G4PA 4U0XA 5KSCA 5EM0A 2WUQA 3T4KA 5D3OA 1E3UD 5F68A 2JE5A 3PAGA 5CGSA 2QWSA 3IBRA 2XD5A 4HNBA 1WA9A 3T1SA 1PIOA 4WLAA 3LR5A 1D7EA 3TG9A 5KIZA 2ZQCA 3GR2A 3MS6A 5EPHA 5IT5A 3UO9A 2L4RA 1IELA 4KQQA 5DFXA 2HPBA 3C7UA 1T1BA 2Z2LB 4EBNA 1ONGA 3LO7A 2HP6A 1N9LA 4Y0OA 4WZ4A 2QZ6A 3Q81A 2D01A 1H3QA 5EVIC 1Z6FA 4LCMA 5J4EA 2V2FF 4AFIA 2FFYA 4DF6A 4K08A 4FH2A 4IJGA 1KE4A 3PHYA 3NI9A 4R38A 5CHJA 4K0XA 2AVXA 2J3TD 5DF9A 1EWZA 1SKOA 4EQ1A 5HL6A 3CG5A 3DTIA 4DDYA 2WGIA 5FEGA 2Y2IA 3NOTC 3T4QA 5CECA 4OOMA 3SW1A 4ESPA 1BZAA 5A8BA 2H10A 3BM6A 3M6HA 1TS7A 2O99A 1IKIA 5CRFA 1MC0A 3JVUA 2IA2A 1UWNX 5FEFA 3UPOA 1ODVA 3P7NA 5FSRA 4KG2A 2WK0A 3MXSA 1OJ5A 3JPUA 3TOIA 4DMZA 3F1NB 4KQDA 4MNRA 1MKMA 3O86A 4R1GA 3T4TA 4XUZA 2V0WA 4R70A 2G2WA 1VM1A 2Y79A 4KZBA 4WZ5A 4QD4A 1LLBA 3BFEA 3N8RA 4DKIA 2CC1A 1Y4OA 1VB6A 2Y8HA 5EOOA 1NWZA 2DMWA 4S2PA 4H6JB 3U4LP 1LSWA 3LEZA 4NEED 2V9AA 3AGDA 2LB5A 3A3EA 4Z9QA 3N8LA 1K6SA 4LCLA 2EX9A 4Y17A 5GLCA 3CLOA 4X53A 1I5QA 2K7SA 4GJ4A 4LGWA 4IBRA 2Q9MA 1GA9A 3VP1A 1K57A 3MZEA 4BBTA 1O7EA 1VEUB 3K3DA 4X25A 2QHKA 3IF6B 3PBOA 4U0TA 2Y2NA 1XJ4A 1ZHHB 4B4XA 2PBDP 4X6TA 4B88A 4GW9A 2M7VA 3SH8A 2ZM0A 2XFTA 1NZOA 3KSIA 1K56D 3RH8B 2PRFA 3UB8A 2J8YA 3MJQA 4CJNA 1IFQA 3PTEA 4QPRA 4HOIA 4Y3IA 2ZQ7A 2VA0A 2W1RA 4R3AA 3L7HA 2WKHA 3GSGA 1E25A 3B42A 3VE3A 3IXGA 1SHVA 1KE3A 2WGWA 1KVMA 3VOLA 4DE3A 3EGDC 4WEJA 3FKVA 3T12B 2XA7M 1XA1A 2W3HA 4H8RA 2A3UA 4G3KA 4I5SA 3SS3A 4OONA 4UQIS 4JF5A 1IEMA 3K3CA 3UPNA 5EVIA 2RCXA 1DJCA 1K55C 4ID4A 4WBGA 3WS2A 3LIDA 3NULA 1FCNA 3FPVA 4YFMA 2E8IA 1CI9A 3OC2A 3UE6A 4GLQA 5L2FA 1T18A 3FZCA 4MBHA 3RXXA 3MQOA 3EGXC 4HH3A 4WZ5C 4LRXC 1ES5A 5DVAA 3MSHA 2PYRA 2B18A 3GQZA 3GRJA 3VMAA 1S4SA 5CEDA 1FCMA 3T1RA 2VGLM 4OQ0A 4LENA 4R3BA 2HF6A 3ZFZA 2HP5A 5AQ9A 1TF1A 3T4OA 1YMSA 1K0KA 2V1BA 5FQKA 3H82A 1ZC2A 2MJ6A 1RCJA 3UMEA 2Z6DA 3VSKA 1DP6A 1YAXA 5EFWA 5EE8A 1IKGA 1PWCA 4GZBA 4X69A 1ESIA 2JCHA 4LV1A 4Y15A 4Q0IA 1BULA 2DRWA 5DTKA 1BLSA 4BWIA 4OQGA 2PD7A 3EEHA 3RFBA 4OPZA 3OPHA 3MQ0A 1MWRA 3IF5A 1H8ZA 4KUKA 3DW0A 2XH9A 3NIAA 1GSXA 3H7WB 4JGRA 4OP5A 3HUOA 3W4OA 1N9BA 4DDSA 2EXAA 4QB8A 1OT6A 5HW3A 5AVEA 4KQOA 4G3WA 5LBRA 5U47A 3LYXA 2Z2MB 3KSGA 1X0OA 4PKYG 2JKRM 2JKTM 1TDGA 4A5RA 5TBMB 2XQZA 3N4IA 2O9BA 4OPYA 2DCFA 2WYXA 5E2HA 3RXWA 1XFQA 3G34A 2Y2LA 4WUJA 1Y28A 5JYPA 4X56A 5F1FA 3LI8A 4II7A 1IYSA 2Y2OA 3F1NA 4WEKA 5TFQA 1YLWA 4EERA 3HJIA 4DE1A 3PBNA 2P9VB 1Q2QA 4IVIA 5FQQA 3BLMA 5HDCA 1J9MA 3UB6A 5FI6A 5DTSA 2JC7A 2Y4AA 1MZUA 3CMZA 3E4QA 3SZTA 3KX0X 4O0PA 1LL8A 3PR6A 1YLPA 4OKPA 4E3MA 4CLCE 2O9CA 2ZQDA 2IWBA 3UE3A 4PPRA 4UQIM 4JGOA 3IBJA 4C3QA 4FOFA 3LI9A 2I72A 2P7JA 3LUQA 2ZOHA 1W8QA 4MN7A 3M6BA 3JVVA 1PNEA 4RYEA 3W4QA 1CK3A 3FC7A 4MBKA 2R9XA 2P9VA 2UWXA 4S2IA 3H7WA 3GTCA 3MKFA 1VEUA 3GDIA 4EW7A 1TD5A 5EVEA 5HPFA 1F5MA 2H0YA 4QJGA 3UPPA 2J80A 4Q0JA 2WGVA 4EXOA 4S2LA 5GLDA 4R3JA 1STZA 2XFSA 1XXMA 1PZOA 4XXRA 1BUEA 1F2KA 2VKSA 1PI4A 1BLPA 4BLMA 4OQHA 4DXBA 1PZPA 4P87A 2VGLS 2XR0A 3MKEA 2WKIA 4E3KA 1Y54A 4IEDA 2B5RA 5CEBA 3ZVWA 4P6ZS 1MWUA 1LL9A 3ZNYA 1XKZA 5IHVA 1YLYA 1ES4A 3LEQA 3ZNTA 4H6JA 1JTGA 4B4ZA 5A93A 2PR5A 1G5UA 4C75A 3ISGA 3ULFA 1MPLA 5DF8A 3EQVA 3V67A 4UAAA 3Q1FA 4HP9A 5CX7A 4QHCA 3NY4A 4UHUA 4BENA 4IBXA 2EWVA 3OCNA 2PT7A 4NXGA 1VETA 1E3UA 3LIFA 1PYYA 3DWZA 2K2NA 1L0GA 3JYIA 5DTTA 3ZQ5A 1QMFA 2VLGA 4OLDA 4GN2A 1U60A 3RTYA 1XJ6A 1SDEA 5FAQA 1XGIA 4DRTA 3A0RA 3F1OB 3NC8A 2XSSA 1XA7A 2WGWB 4P6BA 4WF0A 1WYCA 4BMWA 5CTMA 1FILA 5GHXA 4YINA 2Y2GA 1LI0A 2H28A 1ES3A 3PBRA 4CLCD 5KMWA 2IWCA 2ACGA 1P9RA 3W4PA 1K55A 5DJTA 2EX8A 4X68A 2INWA 3NDGA 4HJ6A 2JBFA 2ZMAA 4JXSA 1JWPA 4ZBEA 4GS9A 1W63Q 2I9VA 1ZTUA 3ZG7B 4HI4A 2PBYA 2VJWA 1OTDA 4LRZE 5F6AA 3ZDJA 5GL9A 4S2MA 3IS2A 5FATA 1XJ3A 1ERMA 4ZJ1A 4EWFA 2Y59A 4E3IA 3ITBA 2A24A 3BYDA 3UDIA 4JKTA 1JWZA 3MR0A 2HDSA 2KX6A 3G2YA 3VP4A 1L2SA 2WAEA 1BLCA 1FR6A 4UEYA 1T1CA 5JYOA 4P6ZM 2GNXA 4S2OA 2ZL1A 4O01A 1T19A 2PHYA 3NOPC 3T4LA 4BBVA 1PWDA 4IVKA 1HTZA 2V8FA 1YSPA 3IS2B 4NXBA 2WKEA 2JHEA 2EFUA 2PD8A 3E98A 3UN7A 4BBUA 1V9YA 3P01A 3MF0A 4L9GA 4RA7A 3HLEA 4KZ5A 2GX5A 1TS6A 5L09A 2JKGA 3BW6A 4LFUA 2Y55A 4U3TA 2Z6CA 1GHMA 4HBUA 1JNUA 2DNSA 1W7FA 4PMAA 5HDDA 1UGUA 1LHYA 3LY4A 1BYWA 3UB7A 1KVLA 1GHIA 3V3SA 2WKQA 5HL1A 3VP0A 4N1XA 3UE0A 1YLJA 3QHYA 3HLFA 4X1LA 1YPRA 3UDXA 1DY6A 2UV0E 1L0EA 2H5SA 3LGOA 5FL3A 3S7NA 2HDUA 3IF6A 3N6IA 1OTAA 1XGJA 1PI5A 4JGQA 4Y0TA 1S6RA 3S1YA 3UDFA 2W1TA 4GDNA 5CHMA 5CGWA 3IXBA 4PHTA 2ZMFA 2VEAA 3A3JA 5HAPA 1NJ4A 2VV8A 3E4PA 5A90A 3IX8A 4I3JA 1FQGA 3ICYA 1W8YA 1IYPA 3NJAA 2ZC3B 3F1PB 2ZLYA 3G6OA 5EECA 3C8CA 2VZWA 2GZAA 4E3OA 5J8XA 4NETA 5E2GA 4NKPA 1TVFA 3IQAA 1ES2A 3IWQA 3WS1A 1D1JA 2XLNA 2WZXA 5FQ9A 3QP4A 4M4XA 2BTFP 1NLYA 4I38A 5HDSA 2EFXA 2ZL1B 3ZG5A 1AXBA 3A0SA 4B9OA 3E4OA 1BT5A 4Y7PA 4E6WA 5K5BA 3DWKA 2YKFA 3CWFA 3EWKA 5L10A 2QPNA 5GLAA 4NK3A 4WMCD 4YNRA 2K31A 5FQJA 3HJKA 4GKUA 1XX2A 3QNCA 2W3DA 3Q7ZA 5HD3A 1RGZA 4R6LA 5FDHA 1K54C 2W0NA 3ZG9B 1MWSA 3NDEA 3W8KA 1K57C 1K56A 2EX6A 2NUTC 1H8MA 1HZOA 4DXCA 3WRTA 5EVLA 4F3LA 3FV7A 4FTXA 3LR0A 2FZ0A 5I5LA 2ZM2A 3HVFA 5E43A 3GECA 2R78A 2R9WA 4KZ7A 3MBZA 3VFHA 4DE2A 5I94A 5DF7A 4ZDXA 3N7WA 3BEBA 4KZ8A 2OLVA 2KDKA 1MXOA 5CHUA 3B3XA 3EOIA 4LV3A 3PAEA 3ITAA 2OV5A 4K91A 1K25A 5HFOA 4ZTKA 5DKLA 2WZZA 2W27A 2X02A 4FSFA 3LICA 4DE0A 4KZ9A 2EX2A 4OOLA 2A49A 3QP5A 3NHQA 5CTNA 1AWIA 4HESA 4KZAA 3O87A 3PBQA 1MKIA 2ZMVA 3V3RA 4FUWA 4OVDA 4GDBA 3FWLA 1K38A 4EUVA 3W2ZA 1ZG6A 4GHIB 4ZJ2A 3SS5A 1G6OA 3M2KA 2M1CA 1JVJA 2FFFB 3IXDA 5A91A 5A92A 3Q82A 5HPIA 3F1OA 4EESA 4B93A 1LSXA 4N9LA 4IHQA 3MQQA 2QMIA 4RVAA 1YLTA 4OLGA 2KOIA 1NY0A 1TEMA 5CXWA 2QKPA 3BLSA 4OH0A 2Y2JA 4R23A 3BJNA 1FSWA 1Q2PA 2E8JA 4EEUA 3S7OA 3ZG0A 1PWGA 4GD6A 5KZHA 4GB7A 5M18A 4MDZA 4MN5A 4PM6A 1OMEA 4QY5A 1D06A 3UB9A 5KSHA 3ZG8B 4IUKA 3VV4A 4S2NA 2RL3A 4ME4A 1HVBA 3C2WA 3DTMA 3IH9A 4L9EA 3HL9A 2XD1A 4RQ9A 4KG6A 3VP3A 3V5MA 2J7VA 1KGFA 1VQQA 5J7EA 4Y13A 1E4DA 4E3JA 4JXGA 2FH5A 1OTEA 3HUNA 2OWHA 3RJUA 1G6AA 4FH4A 4GNUA 3VP2A 3BQ8A 4CQHA 3E0YA 1S66L 3CUEA 3R7WB 3MXQA 1DRMA 1PW8A 4UA9A 1WYBA 5GLBA 3TW8A 3IF6C 2X71A 4C6YA 4YWZA 1IYQA 1DP8A 1L3LA 5FQMA 5F82A 5BOHA 3HLCA 2BASA 2YKHA 2PAVP 3VOYA 2ZC5B 1TDLA 1OPXA 3KO6A 3LIBA 3U2AA 4EUZA 3O88A 5TR7A 4E04A 4KQRA 2VGKA 1JTDA 3HLBA 5HAIA 1YSQA 2ZC4B 4O7DA 2PU4A 3GV9A 1SZVA 4WYYA 5HX9A 3SH7A 3NBLA 3OCLA 1G28A 2B95A 2XF3A 4JXVA 1LL5A 5FDSA 1W79A 2Y2PA 4JGPA 3A3DA 3D9YA 2HJ9C 3WS4A 4KUOA 3AGEA 4I3AA 5HWWA 3G31A 1NLZA 3EEAA 4S2KA 1ACFA 2BG1A 4BD0A 3OOVA 4L0LA 4P0MA 3E2KA 4PAUA 3E2LA 1RGYA 3G30A 5IS1A 2VV6A 2JKTI 2JKRI 4FCFA 3P09A 5CGXA 4G3VA 5FI7A 1ONHA 3Q7VA 1IYOA 1QMEA 4ETZA 4BD1A 4GHIA 2ZM8A 1GSWA 4QU3A 4JPMA 1F9IA 4I39A 1CQAA 3C30A 2XDMA 4XUXA 4X55A 1ZG4A 1OT9A 4GS9B 1NYMA 5E2FA 3UY6A 3T4JA 3BY8A 3C7VA 2PYPA 1XFNA 1GCEA 2Y2QA 4MEZA 3IH8A 3R4KA 3VSLA 3S7PA 1EI5A 4RX3A 1XPBA 4Z1WA 4CPKA 3A3FA 1ESUA 3UMDA 2ZQ9A 1V9ZA 4BQMA 1DJAA 4EETB 5CERA 4PM5A 2ZD8A 3C5AA 5AQ7A 3QP8A 2PR6A 4LLOB 2W1TB 2V1AA 2ZBBA 3S4XA 5FA7A 1W63M 2D02A 3NCKA 3IWOA 5M1AA 3D4FA 1GA0A 2VV7A 4GCZA 3BFGA 3V50A 3IX3A 3G35A 1K54A 3ZCZA 2J9OA 3ZVTA 1LI9A 3MZFA 3I7JA 5EVID 2ZC6B 2ZOIA 4KENB 3MFDA 4EU0A 2V20A 3FPWA 4N9KA 3C38A 2EXBA 3D3OA 4DN0A 5EM1A 5AVFA 1VETB 3VOZA 2W3EA 4F94A 4UA6A 5FASA 4YOFA 1N4OA 3NOUC 4LV2A 1EROA 4F3LB 3DBAA 4LRYC 1XJ2A 2C6WB 4RX2A 2ZQAA 1FSYA 2O9AA 3OBFA 4JLFA 3GVBA 3MFXA 4HIAA 4Y2FA 3IXHA 4K0WA 1F98A 5M19A 1H5XA 2G2UA 1KOUA 1LT0A 3CJMA 1J3WA 1YKDA 1P97A 3BFCA 5FAOA 1K4EA 3OPRA 4GOGA 2VX8A 2X01A 1FOFA 3BWLA 1PW1A 5TGFA 4ARZA 3DAVA 1K6RA 3HLDA 3VFFA 3CITA 3KSFA 3S7QA 1OTBA 1XP4A 2GJ3A 1MBLA 4HP4A 1KGGA 5G18A 1NRJA 4E6XA 5AJGA 2XGNA 3FG8A 1KDWA 5FAPA 3L9KA 2BLSA 3T4SA 3KSHA 3MMHA 2XA7S 1BSGA 4JBFA 2J3TC 5L8MA 1G68A 1SKFA 4NXEA 3ZGAB 1KE0A 2WKRA 1CJFA 2V1ZA 3BFDA 1DP9A 4BL2A 2JKFA 4R0QA 4ETXA 2OSUA 4OOYA 2OWJA 3QNBA 3LIAA 4O8GA 1NXYA 5EOEA 3A0VA 4JF6A 3QP2A 2A2LA 1FR1A 4KZ6A 2C5WB 4Y5FA 2HGVA 2G7UA 2OAQ1 3SH9A 3TE8A 3P98A 5AQAA 1N9OA 4DJ3A 3WRZA 4EEPA 2J3WA 1YQSA 4N92A 3ZYTA 2EA9A 1ERQA 4BL3A 2WAFA 3BRMA 2XRNA 4S2JA 2NUPC 2B02A 4LV0A 5EV0A 3OPPA 1SCWA 2QYBA 1S0WA 1PRQA 5GHYA 1CF0A 4PM7A 4UA7A 2HP9A 4I3IA 4XT2A 4OPRA 1YLZA 4Y0UA 1S4RA 2QJ5A 3LR3A 2HZ5A 2V8CA 3N8SA 4ZAMA 4OP8A 3V39A 3HLWA 2OOLA 1YT4A 1FCOA 4PKYA 4P85A 4NG2A 1C3BA 2Y2HA 2WADA 5HWTA 3KYQA 3LFVA 3T1QB 4HBTA 3F1PA 3HBRA 1WE4A 3IHAA 5L07A 4XT2B 1CEFA 4WMCA 4DJ2A 4Q0HA 5TBMA 1MWTA 2QJ7A 4HH2A 4WL9A 5DFYA 2M7UA 3G2ZA 3HUMA 1JWVA 2ZQ8A 4WELA 4HJ4A 4NXFA 3AGFA 4D2OA 1VHMA 2VK3A 2H0TA 5G4ZA 5F5YA 3DTKA 3IHBA 4IUHA 2L0WA 3Q07A 4X1MA 4Q8IA 3K2NA 3IX4A 3TRCA 1EW0A 4HHDA 2EWWA 5F69A 5FI2A 2A24B 1P0ZA 3QP1A 1O07A 3HLGA 5HD5A 1NZUA 3EQUA 4CLCB 3CUEC 1S1YA 3GMWA 3HREA 4KG5A 5IU1A 3LCEA 3O5YA 3IT9A 4MBFA 3LY3A 3FKWA 3VE4A 1M40A 3CPTA 3KYEA 3PBSA 2JN7A 5C5KA 5DKKA 2GDNA 1TS8A 3TSGA 1T1AA 3CI6A 1S1ZA 1N9NA 4MMNA 1M6KA 5F83A 4HJ3A 1BTLA 3BY9A 2HV1A 1ALQA 3O3VA 3C4OA 1A0KA 3B47A 1OJGA 1YM1A 2PDRA 2Y2MA 2OLUA 1SKOB 3UNWA 4ARZB 1I2SA 3CHWP 5DJUA 5HWVA 2J9PA 2Q9NA 4JF4A 5TJJA 3WS5A 1TS0A 2ZJ9A 5EVIB 2L1MA 4ZRRA 1HD8A 4D60A 4PM8A 4OPQA 1UWPX 1K4FA 1KDSA 3R7WA 3PXPA 2CMNA 1W5DA 2Y2KA 3OZHA 5GHZA 5HSQA 5F1GA 1KGEA 4WM9A 4EBLA 1L0FA 3BFFA 5FQIA 3BQAA 3S22A 4KZ3A 4ZJ3A 2OAP1 4PM9A 3A3IA 4CLCC 1SDNA 1Z09A 4HY8A 2XEPA 4FD8A 3UE1A 5MC7A 3QP6A 1HLUP 4EQIA 4LPZA 3H9WA 2XK1A 4MCWA 4GD8A 4BJPA 2XROA 3G32A 1FIKA 3WWXA 2PU2A 5HARA 5G4YA 4N1HA
chains in the Genus database with same CATH topology
3UB7A 2VGLM 2WKQA 2HF6A 1F9IA 4I39A 3C30A 3KYZA 2P08A 1TF1A 3T4OA 3OLOA 2V1BA 1IOUA 3H82A 3UMEA 2MJ6A 4HQAA 2Z6DA 5FL3A 3S7NA 1OT9A 1DP6A 1YAXA 5EFWA 1OTAA 4GS9B 3T4JA 3BY8A 2PYPA 3HCYA 1XFNA 2W3FA 2WKPA 3R4KA 3S7PA 4JGQA 2W3GA 4Z1WA 2V0UA 4Q0IA 2W1TA 3UMDA 3T50A 3H82B 4BWIA 1P9WA 4L9FA 1V9ZA 1LSVA 4MN6A 4PHTA 2ZMFA 2VEAA 4EETB 2PD7A 3EEHA 5HZHA 3RFBA 3PYPA 3LR4A 4WN5A 2PR6A 4LLOB 2VV8A 3E4PA 2W1TB 2V1AA 2ZBBA 3MQ0A 1W63M 2D02A 3D72A 4I3JA 4KUKA 3ICYA 3NJAA 3TJZC 4CLCA 2VV7A 3F1PB 4GCZA 3G6OA 3PBTA 1GSXA 3H7WB 4JGRA 3C8CA 2VZWA 2GZAA 2KLIA 1GSVA 4NKPA 2ZOIA 3B33A 1OT6A 5AVEA 4EU0A 3FPWA 1OTIA 2HJEA 3C38A 3CAXA 3D3OA 4KQOA 4G3WA 5LBRA 4DN0A 3LYXA 5AVFA 3LIEA 1S67L 3KSGA 1X0OA 5J3WA 2W3EA 4M4XA 4PKYG 2JKRM 2JKTM 4YOFA 2P04A 1NLYA 4I38A 5HDSA 5TBMB 3NOUC 4F3LB 3DBAA 4LRYC 1XJ2A 2O9AA 3OBFA 2O0YA 2LB9A 2O9BA 3MFXA 3A0SA 4B9OA 3E4OA 4HIAA 3T4KA 4Y2FA 5K5BA 1XFQA 1F98A 5F68A 2YKFA 3CWFA 3EWKA 2QWSA 3IBRA 1KOUA 4WUJA 1LT0A 4HNBA 1Y28A 1WA9A 1YKDA 1P97A 4WLAA 4YNRA 2K31A 3LI8A 1D7EA 3LR5A 4II7A 5KIZA 2VX8A 3HJKA 3BWLA 3F1NA 4WEKA 4ARZA 4EERA 3HJIA 3CITA 5IT5A 3PBNA 3KSFA 3S7QA 1OTBA 2W3DA 5HD3A 4R6LA 2GJ3A 2L4RA 2W0NA 4HP4A 5HDCA 1NRJA 5DFXA 3UB6A 5AJGA 1T1BA 3FG8A 1MZUA 2NUTC 3E4QA 1N9LA 1H8MA 3KX0X 3KSHA 3T4SA 4O0PA 1LL8A 3MMHA 2D01A 1H3QA 2XA7S 3PR6A 2J3TC 5J4EA 5L8MA 4CLCE 4F3LA 4AFIA 2O9CA 3LR0A 4NXEA 2FZ0A 5I5LA 4K08A 4IJGA 2WKRA 3UE3A 3PHYA 3GECA 2R78A 1DP9A 4R38A 4ETXA 4UQIM 4JGOA 2OWJA 3IBJA 3LIAA 4O8GA 4FOFA 2J3TD 3LI9A 5DF9A 2KDKA 2P7JA 3LUQA 2ZOHA 3A0VA 4MN7A 2A2LA 3JVVA 4EQ1A 3EOIA 5HL6A 3FC7A 4Y5FA 2HGVA 2G7UA 2OAQ1 3TE8A 3H7WA 3NOTC 3T4QA 3GDIA 4OOMA 3SW1A 1N9OA 4DJ3A 5DKLA 4EW7A 4EEPA 2J3WA 2W27A 1TD5A 4FSFA 3LICA 3ZYTA 5HPFA 1F5MA 2EA9A 5A8BA 4OOLA 1TS7A 2J80A 2O99A 3NHQA 4Q0JA 2XRNA 2NUPC 2B02A 2QYBA 3PBQA 1MC0A 2ZMVA 4EXOA 3JVUA 1STZA 2IA2A 1UWNX 1ODVA 3P7NA 4I3IA 4EUVA 3W2ZA 4GHIB 2VKSA 4XT2A 1G6OA 1S4RA 2M1CA 2VGLS 2QJ5A 1OJ5A 3LR3A 5HPIA 4DMZA 3F1NB 4KQDA 3F1OA 4EESA 1MKMA 4B93A 1LSXA 4P6ZS 4IHQA 3MQQA 2OOLA 3T4TA 2V0WA 2KOIA 4PKYA 4R70A 2QKPA 5HWTA 3KYQA 2Y79A 3LFVA 4H6JA 3BJNA 2PR5A 4EEUA 3F1PA 3ULFA 3S7OA 3EQVA 3V67A 4XT2B 4DJ2A 4Q0HA 4HP9A 5TBMA 2QJ7A 4HH2A 4WL9A 4MDZA 4MN5A 5CX7A 1D06A 5DFYA 2M7UA 3UB9A 5KSHA 1VB6A 2Y8HA 4WELA 4HJ4A 1NWZA 4NXFA 2EWVA 4IUKA 1VHMA 2PT7A 2DMWA 3OCNA 4NXGA 3VV4A 5G4ZA 3LIFA 5F5YA 4H6JB 1LSWA 2K2NA 4IUHA 4ME4A 3C2WA 2V9AA 4NEED 2L0WA 4L9EA 3K2NA 2LB5A 3ZQ5A 3TRCA 1EW0A 2VLGA 4HHDA 4RQ9A 2EWWA 3CLOA 5F69A 2A24B 1P0ZA 3RTYA 1XJ6A 2K7SA 4GJ4A 5J7EA 3A0RA 5HD5A 3F1OB 3EQUA 4CLCB 3CUEC 4BBTA 2FH5A 2XSSA 1OTEA 3K3DA 4WF0A 1S1YA 2QHKA 3PBOA 2OWHA 4BMWA 5IU1A 1XJ4A 3BQ8A 1ZHHB 3O5YA 4CQHA 3E0YA 1S66L 3VE4A 4GW9A 3CUEA 3R7WB 2H28A 3MXQA 2M7VA 3PBRA 1DRMA 3PBSA 4CLCD 2JN7A 3TW8A 3KSIA 5DKKA 5C5KA 1P9RA 3RH8B 1TS8A 1T1AA 3UB8A 5DJTA 3MJQA 3CI6A 1IFQA 4QPRA 1S1ZA 1N9NA 2INWA 4HJ6A 1DP8A 4MMNA 4YWZA 4HOIA 4Y3IA 4HJ3A 3BY9A 2HV1A 2VA0A 4GS9A 1W63Q 2W1RA 2I9VA 4R3AA 1ZTUA 4HI4A 3B47A 2VJWA 1OJGA 2PDRA 2BASA 2YKHA 3B42A 1OTDA 4LRZE 3VE3A 5F6AA 3VOLA 4ARZB 1OPXA 3EGDC 3KO6A 3LIBA 4WEJA 3U2AA 5DJUA 5HWVA 4E04A 3IS2A 1XJ3A 2XA7M 5TJJA 2W3HA 2A24A 1TS0A 4G3KA 4I5SA 1YSQA 2L1MA 4ZRRA 3MR0A 2KX6A 1UWPX 4UQIS 3R7WA 3PXPA 2CMNA 4UEYA 3K3CA 1T1CA 4P6ZM 2GNXA 3OCLA 1G28A 4O01A 1T19A 2PHYA 3NOPC 5HSQA 3T4LA 4BBVA 1YSPA 4JGPA 3IS2B 4NXBA 2JHEA 3LIDA 2HJ9C 3BQAA 4KUOA 3FPVA 4I3AA 5HWWA 2OAP1 2PD8A 3E98A 4BBUA 1V9YA 1NLZA 3P01A 3EEAA 3OC2A 3UE6A 4CLCC 4GLQA 3MF0A 1T18A 4L9GA 4HY8A 3OOVA 4L0LA 4PAUA 5MC7A 2GX5A 1TS6A 3MQOA 3EGXC 2VV6A 5IS1A 2JKTI 2JKRI 4HH3A 3BW6A 4LRXC 4G3VA 4LPZA 3H9WA 4MCWA 2Z6CA 4BJPA 2XROA 1JNUA 2PYRA 2B18A 4ETZA 5HDDA 4GHIA 1S4SA 1UGUA 5G4YA 1BYWA 1GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4O A;  4HIA A;  3UB7 A;  1XFQ A;  1F98 A;  1UWN X;  2WKQ A;  1S1Z A;  1N9N A;  2INW A;  4HJ6 A;  1DP8 A;  1ODV A;  3P7N A;  4I3I A;  5F68 A;  2YKF A;  3CWF A;  4HOI A;  1F9I A;  3EWK A;  3MJQ A;  2QWS A;  3IBR A;  1KOU A;  4GHI B;  4I39 A;  4WUJ A;  4XT2 A;  4HJ3 A;  1LT0 A;  4HNB A;  1S4R A;  1Y28 A;  2M1C A;  3BY9 A;  2HV1 A;  3OLO A;  1WA9 A;  2V1B A;  2QJ5 A;  1OJ5 A;  1P97 A;  3H82 A;  4GS9 A;  4WLA A;  5F69 A;  3UME A;  2I9V A;  4R3A A;  4HQA A;  2Z6D A;  1D7E A;  3F1N B;  3LI8 A;  4HI4 A;  5KIZ A;  4KQD A;  3F1O A;  4EES A;  3HJK A;  3BWL A;  1OJG A;  3F1N A;  2PDR A;  1OT9 A;  1DP6 A;  1LSX A;  5EFW A;  1OTA A;  4GS9 B;  4EER A;  3MQQ A;  2BAS A;  3HJI A;  2YKH A;  2OOL A;  1OTD A;  4LRZ E;  1OTB A;  3VE3 A;  5HD3 A;  3BY8 A;  2V0W A;  4R6L A;  2PYP A;  5F6A A;  1XFN A;  4PKY A;  3VOL A;  2GJ3 A;  2L4R A;  2WKP A;  2W0N A;  2QKP A;  4HP4 A;  4R70 A;  5HDC A;  5HWT A;  3LIB A;  4JGQ A;  3UB6 A;  5DJU A;  5HWV A;  4H6J A;  1T1B A;  4E04 A;  3FG8 A;  3IS2 A;  1XJ3 A;  2PR5 A;  4EEU A;  3F1P A;  3ULF A;  1MZU A;  2V0U A;  3E4Q A;  3UMD A;  1N9L A;  2A24 A;  3T50 A;  3H82 B;  3KX0 X;  4XT2 B;  1TS0 A;  4I5S A;  1LL8 A;  2D01 A;  4L9F A;  4DJ2 A;  1V9Z A;  1LSV A;  2L1M A;  4HP9 A;  4MN6 A;  2QJ7 A;  5TBM A;  4HH2 A;  4WL9 A;  5J4E A;  4MN5 A;  2VEA A;  4EET B;  2PD7 A;  3EEH A;  4F3L A;  1D06 A;  5HZH A;  3PYP A;  4WN5 A;  4NXE A;  1VB6 A;  3UB9 A;  4NXB A;  3MR0 A;  5I5L A;  2KX6 A;  1UWP X;  4HJ4 A;  2WKR A;  4K08 A;  1NWZ A;  4NXF A;  2PR6 A;  4LLO B;  4NXG A;  2VV8 A;  3E4P A;  3PHY A;  2CMN A;  3LIF A;  5F5Y A;  3GEC A;  2R78 A;  2V1A A;  4H6J B;  1LSW A;  5G4Z A;  1DP9 A;  1T1C A;  2ZBB A;  3K3C A;  2D02 A;  1G28 A;  4R38 A;  1T19 A;  2PHY A;  3D72 A;  3C2W A;  2V9A A;  3NOP C;  4I3J A;  2L0W A;  3ICY A;  4KUK A;  5HSQ A;  4BBV A;  4L9E A;  3NJA A;  4JGO A;  2OWJ A;  3ZQ5 A;  1EW0 A;  2VLG A;  2VV7 A;  3F1P B;  3LIA A;  3G6O A;  4GCZ A;  4HHD A;  4RQ9 A;  3CLO A;  1GSX A;  3H7W B;  3IS2 B;  2A24 B;  3LI9 A;  2KDK A;  4JGP A;  2P7J A;  3LUQ A;  4JGR A;  2ZOH A;  1P0Z A;  2JHE A;  1XJ6 A;  2K7S A;  3A0V A;  3LID A;  3RTY A;  4EQ1 A;  3C8C A;  4KUO A;  3FC7 A;  4I3A A;  3A0R A;  5HWW A;  5HD5 A;  5J7E A;  2PD8 A;  3F1O B;  4BBU A;  1V9Y A;  1GSV A;  4BBT A;  4B9O A;  2ZOI A;  3B33 A;  1OTE A;  3H7W A;  3K3D A;  3UE6 A;  3NOT C;  4WF0 A;  1OT6 A;  1S1Y A;  1T18 A;  2QHK A;  3GDI A;  4HY8 A;  4L9G A;  5AVE A;  1N9O A;  3SW1 A;  4DJ3 A;  2OWH A;  1OTI A;  5DKL A;  3CAX A;  4EW7 A;  4EEP A;  4YWZ A;  1TS6 A;  3MQO A;  2W27 A;  2VV6 A;  3LYX A;  5AVF A;  5IU1 A;  3LIC A;  5IS1 A;  1XJ4 A;  3LIE A;  1S67 L;  5J3W A;  1X0O A;  4HH3 A;  4M4X A;  4PKY G;  1S66 L;  4LRX C;  4LPZ A;  2EA9 A;  4GW9 A;  3VE4 A;  5A8B A;  2H28 A;  3H9W A;  3MXQ A;  1TS7 A;  2J80 A;  3NHQ A;  2Z6C A;  4I38 A;  5HDS A;  1DRM A;  5TBM B;  1JNU A;  2PYR A;  3NOU C;  5G4Y A;  2JN7 A;  5HDD A;  4GHI A;  1XJ2 A;  2B02 A;  4LRY C;  4F3L B;  5DKK A;  1S4S A;  3RH8 B;  1TS8 A;  1T1A A;  1UGU A;  3UB8 A;  4EXO A;  5DJT A;  3MFX A;  3A0S A;  1BYW A;  1GSW A; 
#chains in the Genus database with same CATH topology
 5HAQ A;  4JXW A;  1GHP A;  1I2W A;  2HDQ A;  4R4S A;  3KYZ A;  3M2J A;  2P08 A;  3OLO A;  1IOU A;  4HQA A;  3NEC A;  4OQI A;  3MZD A;  1PFL A;  3CZD A;  4KZ4 A;  1CEG A;  3HCY A;  2W3F A;  2WKP A;  2ZC7 A;  3BEC A;  4EBP A;  1ZKJ A;  1L0D A;  2W3G A;  3C4P A;  1BLH A;  4R4R A;  5EUA A;  1NYY A;  3SOI A;  2V0U A;  3T50 A;  1RP5 A;  3H82 B;  2P74 A;  4QWO A;  3WS0 A;  1P9W A;  4L9F A;  4QY6 A;  1LSV A;  4MN6 A;  5HZH A;  3PYP A;  3LR4 A;  3SS4 A;  3CPT B;  4WN5 A;  3MXR A;  4EV4 A;  1DJB A;  1H8Y A;  3D72 A;  3T1X A;  2IWD A;  4HEF A;  3ZHH A;  3TJZ C;  4CLC A;  3IWI A;  5E2E A;  3PBT A;  3UB5 P;  1MY8 A;  3OPL A;  4E3L A;  1NRF A;  4MLL A;  2KLI A;  1GSV A;  3B33 A;  3FYZ A;  1OTI A;  2HJE A;  3CAX A;  4M3K A;  2Y91 A;  3LIE A;  1S67 L;  5J3W A;  2VGJ A;  5AQB A;  3DTE A;  1H0M A;  2Q0O A;  4E3N A;  1YMX A;  2P04 A;  2HDR A;  4S2N C;  1CI8 A;  3Q7V B;  2O0Y A;  2LB9 A;  3G4P A;  4U0X A;  5KSC A;  5EM0 A;  2WUQ A;  3T4K A;  5D3O A;  1E3U D;  5F68 A;  2JE5 A;  3PAG A;  5CGS A;  2QWS A;  3IBR A;  2XD5 A;  4HNB A;  1WA9 A;  3T1S A;  1PIO A;  4WLA A;  3LR5 A;  1D7E A;  3TG9 A;  5KIZ A;  2ZQC A;  3GR2 A;  3MS6 A;  5EPH A;  5IT5 A;  3UO9 A;  2L4R A;  1IEL A;  4KQQ A;  5DFX A;  2HPB A;  3C7U A;  1T1B A;  2Z2L B;  4EBN A;  1ONG A;  3LO7 A;  2HP6 A;  1N9L A;  4Y0O A;  4WZ4 A;  2QZ6 A;  3Q81 A;  2D01 A;  1H3Q A;  5EVI C;  1Z6F A;  4LCM A;  5J4E A;  2V2F F;  4AFI A;  2FFY A;  4DF6 A;  4K08 A;  4FH2 A;  4IJG A;  1KE4 A;  3PHY A;  3NI9 A;  4R38 A;  5CHJ A;  4K0X A;  2AVX A;  2J3T D;  5DF9 A;  1EWZ A;  1SKO A;  4EQ1 A;  5HL6 A;  3CG5 A;  3DTI A;  4DDY A;  2WGI A;  5FEG A;  2Y2I A;  3NOT C;  3T4Q A;  5CEC A;  4OOM A;  3SW1 A;  4ESP A;  1BZA A;  5A8B A;  2H10 A;  3BM6 A;  3M6H A;  1TS7 A;  2O99 A;  1IKI A;  5CRF A;  1MC0 A;  3JVU A;  2IA2 A;  1UWN X;  5FEF A;  3UPO A;  1ODV A;  3P7N A;  5FSR A;  4KG2 A;  2WK0 A;  3MXS A;  1OJ5 A;  3JPU A;  3TOI A;  4DMZ A;  3F1N B;  4KQD A;  4MNR A;  1MKM A;  3O86 A;  4R1G A;  3T4T A;  4XUZ A;  2V0W A;  4R70 A;  2G2W A;  1VM1 A;  2Y79 A;  4KZB A;  4WZ5 A;  4QD4 A;  1LLB A;  3BFE A;  3N8R A;  4DKI A;  2CC1 A;  1Y4O A;  1VB6 A;  2Y8H A;  5EOO A;  1NWZ A;  2DMW A;  4S2P A;  4H6J B;  3U4L P;  1LSW A;  3LEZ A;  4NEE D;  2V9A A;  3AGD A;  2LB5 A;  3A3E A;  4Z9Q A;  3N8L A;  1K6S A;  4LCL A;  2EX9 A;  4Y17 A;  5GLC A;  3CLO A;  4X53 A;  1I5Q A;  2K7S A;  4GJ4 A;  4LGW A;  4IBR A;  2Q9M A;  1GA9 A;  3VP1 A;  1K57 A;  3MZE A;  4BBT A;  1O7E A;  1VEU B;  3K3D A;  4X25 A;  2QHK A;  3IF6 B;  3PBO A;  4U0T A;  2Y2N A;  1XJ4 A;  1ZHH B;  4B4X A;  2PBD P;  4X6T A;  4B88 A;  4GW9 A;  2M7V A;  3SH8 A;  2ZM0 A;  2XFT A;  1NZO A;  3KSI A;  1K56 D;  3RH8 B;  2PRF A;  3UB8 A;  2J8Y A;  3MJQ A;  4CJN A;  1IFQ A;  3PTE A;  4QPR A;  4HOI A;  4Y3I A;  2ZQ7 A;  2VA0 A;  2W1R A;  4R3A A;  3L7H A;  2WKH A;  3GSG A;  1E25 A;  3B42 A;  3VE3 A;  3IXG A;  1SHV A;  1KE3 A;  2WGW A;  1KVM A;  3VOL A;  4DE3 A;  3EGD C;  4WEJ A;  3FKV A;  3T12 B;  2XA7 M;  1XA1 A;  2W3H A;  4H8R A;  2A3U A;  4G3K A;  4I5S A;  3SS3 A;  4OON A;  4UQI S;  4JF5 A;  1IEM A;  3K3C A;  3UPN A;  5EVI A;  2RCX A;  1DJC A;  1K55 C;  4ID4 A;  4WBG A;  3WS2 A;  3LID A;  3NUL A;  1FCN A;  3FPV A;  4YFM A;  2E8I A;  1CI9 A;  3OC2 A;  3UE6 A;  4GLQ A;  5L2F A;  1T18 A;  3FZC A;  4MBH A;  3RXX A;  3MQO A;  3EGX C;  4HH3 A;  4WZ5 C;  4LRX C;  1ES5 A;  5DVA A;  3MSH A;  2PYR A;  2B18 A;  3GQZ A;  3GRJ A;  3VMA A;  1S4S A;  5CED A;  1FCM A;  3T1R A;  2VGL M;  4OQ0 A;  4LEN A;  4R3B A;  2HF6 A;  3ZFZ A;  2HP5 A;  5AQ9 A;  1TF1 A;  3T4O A;  1YMS A;  1K0K A;  2V1B A;  5FQK A;  3H82 A;  1ZC2 A;  2MJ6 A;  1RCJ A;  3UME A;  2Z6D A;  3VSK A;  1DP6 A;  1YAX A;  5EFW A;  5EE8 A;  1IKG A;  1PWC A;  4GZB A;  4X69 A;  1ESI A;  2JCH A;  4LV1 A;  4Y15 A;  4Q0I A;  1BUL A;  2DRW A;  5DTK A;  1BLS A;  4BWI A;  4OQG A;  2PD7 A;  3EEH A;  3RFB A;  4OPZ A;  3OPH A;  3MQ0 A;  1MWR A;  3IF5 A;  1H8Z A;  4KUK A;  3DW0 A;  2XH9 A;  3NIA A;  1GSX A;  3H7W B;  4JGR A;  4OP5 A;  3HUO A;  3W4O A;  1N9B A;  4DDS A;  2EXA A;  4QB8 A;  1OT6 A;  5HW3 A;  5AVE A;  4KQO A;  4G3W A;  5LBR A;  5U47 A;  3LYX A;  2Z2M B;  3KSG A;  1X0O A;  4PKY G;  2JKR M;  2JKT M;  1TDG A;  4A5R A;  5TBM B;  2XQZ A;  3N4I A;  2O9B A;  4OPY A;  2DCF A;  2WYX A;  5E2H A;  3RXW A;  1XFQ A;  3G34 A;  2Y2L A;  4WUJ A;  1Y28 A;  5JYP A;  4X56 A;  5F1F A;  3LI8 A;  4II7 A;  1IYS A;  2Y2O A;  3F1N A;  4WEK A;  5TFQ A;  1YLW A;  4EER A;  3HJI A;  4DE1 A;  3PBN A;  2P9V B;  1Q2Q A;  4IVI A;  5FQQ A;  3BLM A;  5HDC A;  1J9M A;  3UB6 A;  5FI6 A;  5DTS A;  2JC7 A;  2Y4A A;  1MZU A;  3CMZ A;  3E4Q A;  3SZT A;  3KX0 X;  4O0P A;  1LL8 A;  3PR6 A;  1YLP A;  4OKP A;  4E3M A;  4CLC E;  2O9C A;  2ZQD A;  2IWB A;  3UE3 A;  4PPR A;  4UQI M;  4JGO A;  3IBJ A;  4C3Q A;  4FOF A;  3LI9 A;  2I72 A;  2P7J A;  3LUQ A;  2ZOH A;  1W8Q A;  4MN7 A;  3M6B A;  3JVV A;  1PNE A;  4RYE A;  3W4Q A;  1CK3 A;  3FC7 A;  4MBK A;  2R9X A;  2P9V A;  2UWX A;  4S2I A;  3H7W A;  3GTC A;  3MKF A;  1VEU A;  3GDI A;  4EW7 A;  1TD5 A;  5EVE A;  5HPF A;  1F5M A;  2H0Y A;  4QJG A;  3UPP A;  2J80 A;  4Q0J A;  2WGV A;  4EXO A;  4S2L A;  5GLD A;  4R3J A;  1STZ A;  2XFS A;  1XXM A;  1PZO A;  4XXR A;  1BUE A;  1F2K A;  2VKS A;  1PI4 A;  1BLP A;  4BLM A;  4OQH A;  4DXB A;  1PZP A;  4P87 A;  2VGL S;  2XR0 A;  3MKE A;  2WKI A;  4E3K A;  1Y54 A;  4IED A;  2B5R A;  5CEB A;  3ZVW A;  4P6Z S;  1MWU A;  1LL9 A;  3ZNY A;  1XKZ A;  5IHV A;  1YLY A;  1ES4 A;  3LEQ A;  3ZNT A;  4H6J A;  1JTG A;  4B4Z A;  5A93 A;  2PR5 A;  1G5U A;  4C75 A;  3ISG A;  3ULF A;  1MPL A;  5DF8 A;  3EQV A;  3V67 A;  4UAA A;  3Q1F A;  4HP9 A;  5CX7 A;  4QHC A;  3NY4 A;  4UHU A;  4BEN A;  4IBX A;  2EWV A;  3OCN A;  2PT7 A;  4NXG A;  1VET A;  1E3U A;  3LIF A;  1PYY A;  3DWZ A;  2K2N A;  1L0G A;  3JYI A;  5DTT A;  3ZQ5 A;  1QMF A;  2VLG A;  4OLD A;  4GN2 A;  1U60 A;  3RTY A;  1XJ6 A;  1SDE A;  5FAQ A;  1XGI A;  4DRT A;  3A0R A;  3F1O B;  3NC8 A;  2XSS A;  1XA7 A;  2WGW B;  4P6B A;  4WF0 A;  1WYC A;  4BMW A;  5CTM A;  1FIL A;  5GHX A;  4YIN A;  2Y2G A;  1LI0 A;  2H28 A;  1ES3 A;  3PBR A;  4CLC D;  5KMW A;  2IWC A;  2ACG A;  1P9R A;  3W4P A;  1K55 A;  5DJT A;  2EX8 A;  4X68 A;  2INW A;  3NDG A;  4HJ6 A;  2JBF A;  2ZMA A;  4JXS A;  1JWP A;  4ZBE A;  4GS9 A;  1W63 Q;  2I9V A;  1ZTU A;  3ZG7 B;  4HI4 A;  2PBY A;  2VJW A;  1OTD A;  4LRZ E;  5F6A A;  3ZDJ A;  5GL9 A;  4S2M A;  3IS2 A;  5FAT A;  1XJ3 A;  1ERM A;  4ZJ1 A;  4EWF A;  2Y59 A;  4E3I A;  3ITB A;  2A24 A;  3BYD A;  3UDI A;  4JKT A;  1JWZ A;  3MR0 A;  2HDS A;  2KX6 A;  3G2Y A;  3VP4 A;  1L2S A;  2WAE A;  1BLC A;  1FR6 A;  4UEY A;  1T1C A;  5JYO A;  4P6Z M;  2GNX A;  4S2O A;  2ZL1 A;  4O01 A;  1T19 A;  2PHY A;  3NOP C;  3T4L A;  4BBV A;  1PWD A;  4IVK A;  1HTZ A;  2V8F A;  1YSP A;  3IS2 B;  4NXB A;  2WKE A;  2JHE A;  2EFU A;  2PD8 A;  3E98 A;  3UN7 A;  4BBU A;  1V9Y A;  3P01 A;  3MF0 A;  4L9G A;  4RA7 A;  3HLE A;  4KZ5 A;  2GX5 A;  1TS6 A;  5L09 A;  2JKG A;  3BW6 A;  4LFU A;  2Y55 A;  4U3T A;  2Z6C A;  1GHM A;  4HBU A;  1JNU A;  2DNS A;  1W7F A;  4PMA A;  5HDD A;  1UGU A;  1LHY A;  3LY4 A;  1BYW A;  3UB7 A;  1KVL A;  1GHI A;  3V3S A;  2WKQ A;  5HL1 A;  3VP0 A;  4N1X A;  3UE0 A;  1YLJ A;  3QHY A;  3HLF A;  4X1L A;  1YPR A;  3UDX A;  1DY6 A;  2UV0 E;  1L0E A;  2H5S A;  3LGO A;  5FL3 A;  3S7N A;  2HDU A;  3IF6 A;  3N6I A;  1OTA A;  1XGJ A;  1PI5 A;  4JGQ A;  4Y0T A;  1S6R A;  3S1Y A;  3UDF A;  2W1T A;  4GDN A;  5CHM A;  5CGW A;  3IXB A;  4PHT A;  2ZMF A;  2VEA A;  3A3J A;  5HAP A;  1NJ4 A;  2VV8 A;  3E4P A;  5A90 A;  3IX8 A;  4I3J A;  1FQG A;  3ICY A;  1W8Y A;  1IYP A;  3NJA A;  2ZC3 B;  3F1P B;  2ZLY A;  3G6O A;  5EEC A;  3C8C A;  2VZW A;  2GZA A;  4E3O A;  5J8X A;  4NET A;  5E2G A;  4NKP A;  1TVF A;  3IQA A;  1ES2 A;  3IWQ A;  3WS1 A;  1D1J A;  2XLN A;  2WZX A;  5FQ9 A;  3QP4 A;  4M4X A;  2BTF P;  1NLY A;  4I38 A;  5HDS A;  2EFX A;  2ZL1 B;  3ZG5 A;  1AXB A;  3A0S A;  4B9O A;  3E4O A;  1BT5 A;  4Y7P A;  4E6W A;  5K5B A;  3DWK A;  2YKF A;  3CWF A;  3EWK A;  5L10 A;  2QPN A;  5GLA A;  4NK3 A;  4WMC D;  4YNR A;  2K31 A;  5FQJ A;  3HJK A;  4GKU A;  1XX2 A;  3QNC A;  2W3D A;  3Q7Z A;  5HD3 A;  1RGZ A;  4R6L A;  5FDH A;  1K54 C;  2W0N A;  3ZG9 B;  1MWS A;  3NDE A;  3W8K A;  1K57 C;  1K56 A;  2EX6 A;  2NUT C;  1H8M A;  1HZO A;  4DXC A;  3WRT A;  5EVL A;  4F3L A;  3FV7 A;  4FTX A;  3LR0 A;  2FZ0 A;  5I5L A;  2ZM2 A;  3HVF A;  5E43 A;  3GEC A;  2R78 A;  2R9W A;  4KZ7 A;  3MBZ A;  3VFH A;  4DE2 A;  5I94 A;  5DF7 A;  4ZDX A;  3N7W A;  3BEB A;  4KZ8 A;  2OLV A;  2KDK A;  1MXO A;  5CHU A;  3B3X A;  3EOI A;  4LV3 A;  3PAE A;  3ITA A;  2OV5 A;  4K91 A;  1K25 A;  5HFO A;  4ZTK A;  5DKL A;  2WZZ A;  2W27 A;  2X02 A;  4FSF A;  3LIC A;  4DE0 A;  4KZ9 A;  2EX2 A;  4OOL A;  2A49 A;  3QP5 A;  3NHQ A;  5CTN A;  1AWI A;  4HES A;  4KZA A;  3O87 A;  3PBQ A;  1MKI A;  2ZMV A;  3V3R A;  4FUW A;  4OVD A;  4GDB A;  3FWL A;  1K38 A;  4EUV A;  3W2Z A;  1ZG6 A;  4GHI B;  4ZJ2 A;  3SS5 A;  1G6O A;  3M2K A;  2M1C A;  1JVJ A;  2FFF B;  3IXD A;  5A91 A;  5A92 A;  3Q82 A;  5HPI A;  3F1O A;  4EES A;  4B93 A;  1LSX A;  4N9L A;  4IHQ A;  3MQQ A;  2QMI A;  4RVA A;  1YLT A;  4OLG A;  2KOI A;  1NY0 A;  1TEM A;  5CXW A;  2QKP A;  3BLS A;  4OH0 A;  2Y2J A;  4R23 A;  3BJN A;  1FSW A;  1Q2P A;  2E8J A;  4EEU A;  3S7O A;  3ZG0 A;  1PWG A;  4GD6 A;  5KZH A;  4GB7 A;  5M18 A;  4MDZ A;  4MN5 A;  4PM6 A;  1OME A;  4QY5 A;  1D06 A;  3UB9 A;  5KSH A;  3ZG8 B;  4IUK A;  3VV4 A;  4S2N A;  2RL3 A;  4ME4 A;  1HVB A;  3C2W A;  3DTM A;  3IH9 A;  4L9E A;  3HL9 A;  2XD1 A;  4RQ9 A;  4KG6 A;  3VP3 A;  3V5M A;  2J7V A;  1KGF A;  1VQQ A;  5J7E A;  4Y13 A;  1E4D A;  4E3J A;  4JXG A;  2FH5 A;  1OTE A;  3HUN A;  2OWH A;  3RJU A;  1G6A A;  4FH4 A;  4GNU A;  3VP2 A;  3BQ8 A;  4CQH A;  3E0Y A;  1S66 L;  3CUE A;  3R7W B;  3MXQ A;  1DRM A;  1PW8 A;  4UA9 A;  1WYB A;  5GLB A;  3TW8 A;  3IF6 C;  2X71 A;  4C6Y A;  4YWZ A;  1IYQ A;  1DP8 A;  1L3L A;  5FQM A;  5F82 A;  5BOH A;  3HLC A;  2BAS A;  2YKH A;  2PAV P;  3VOY A;  2ZC5 B;  1TDL A;  1OPX A;  3KO6 A;  3LIB A;  3U2A A;  4EUZ A;  3O88 A;  5TR7 A;  4E04 A;  4KQR A;  2VGK A;  1JTD A;  3HLB A;  5HAI A;  1YSQ A;  2ZC4 B;  4O7D A;  2PU4 A;  3GV9 A;  1SZV A;  4WYY A;  5HX9 A;  3SH7 A;  3NBL A;  3OCL A;  1G28 A;  2B95 A;  2XF3 A;  4JXV A;  1LL5 A;  5FDS A;  1W79 A;  2Y2P A;  4JGP A;  3A3D A;  3D9Y A;  2HJ9 C;  3WS4 A;  4KUO A;  3AGE A;  4I3A A;  5HWW A;  3G31 A;  1NLZ A;  3EEA A;  4S2K A;  1ACF A;  2BG1 A;  4BD0 A;  3OOV A;  4L0L A;  4P0M A;  3E2K A;  4PAU A;  3E2L A;  1RGY A;  3G30 A;  5IS1 A;  2VV6 A;  2JKT I;  2JKR I;  4FCF A;  3P09 A;  5CGX A;  4G3V A;  5FI7 A;  1ONH A;  3Q7V A;  1IYO A;  1QME A;  4ETZ A;  4BD1 A;  4GHI A;  2ZM8 A;  1GSW A;  4QU3 A;  4JPM A;  1F9I A;  4I39 A;  1CQA A;  3C30 A;  2XDM A;  4XUX A;  4X55 A;  1ZG4 A;  1OT9 A;  4GS9 B;  1NYM A;  5E2F A;  3UY6 A;  3T4J A;  3BY8 A;  3C7V A;  2PYP A;  1XFN A;  1GCE A;  2Y2Q A;  4MEZ A;  3IH8 A;  3R4K A;  3VSL A;  3S7P A;  1EI5 A;  4RX3 A;  1XPB A;  4Z1W A;  4CPK A;  3A3F A;  1ESU A;  3UMD A;  2ZQ9 A;  1V9Z A;  4BQM A;  1DJA A;  4EET B;  5CER A;  4PM5 A;  2ZD8 A;  3C5A A;  5AQ7 A;  3QP8 A;  2PR6 A;  4LLO B;  2W1T B;  2V1A A;  2ZBB A;  3S4X A;  5FA7 A;  1W63 M;  2D02 A;  3NCK A;  3IWO A;  5M1A A;  3D4F A;  1GA0 A;  2VV7 A;  4GCZ A;  3BFG A;  3V50 A;  3IX3 A;  3G35 A;  1K54 A;  3ZCZ A;  2J9O A;  3ZVT A;  1LI9 A;  3MZF A;  3I7J A;  5EVI D;  2ZC6 B;  2ZOI A;  4KEN B;  3MFD A;  4EU0 A;  2V20 A;  3FPW A;  4N9K A;  3C38 A;  2EXB A;  3D3O A;  4DN0 A;  5EM1 A;  5AVF A;  1VET B;  3VOZ A;  2W3E A;  4F94 A;  4UA6 A;  5FAS A;  4YOF A;  1N4O A;  3NOU C;  4LV2 A;  1ERO A;  4F3L B;  3DBA A;  4LRY C;  1XJ2 A;  2C6W B;  4RX2 A;  2ZQA A;  1FSY A;  2O9A A;  3OBF A;  4JLF A;  3GVB A;  3MFX A;  4HIA A;  4Y2F A;  3IXH A;  4K0W A;  1F98 A;  5M19 A;  1H5X A;  2G2U A;  1KOU A;  1LT0 A;  3CJM A;  1J3W A;  1YKD A;  1P97 A;  3BFC A;  5FAO A;  1K4E A;  3OPR A;  4GOG A;  2VX8 A;  2X01 A;  1FOF A;  3BWL A;  1PW1 A;  5TGF A;  4ARZ A;  3DAV A;  1K6R A;  3HLD A;  3VFF A;  3CIT A;  3KSF A;  3S7Q A;  1OTB A;  1XP4 A;  2GJ3 A;  1MBL A;  4HP4 A;  1KGG A;  5G18 A;  1NRJ A;  4E6X A;  5AJG A;  2XGN A;  3FG8 A;  1KDW A;  5FAP A;  3L9K A;  2BLS A;  3T4S A;  3KSH A;  3MMH A;  2XA7 S;  1BSG A;  4JBF A;  2J3T C;  5L8M A;  1G68 A;  1SKF A;  4NXE A;  3ZGA B;  1KE0 A;  2WKR A;  1CJF A;  2V1Z A;  3BFD A;  1DP9 A;  4BL2 A;  2JKF A;  4R0Q A;  4ETX A;  2OSU A;  4OOY A;  2OWJ A;  3QNB A;  3LIA A;  4O8G A;  1NXY A;  5EOE A;  3A0V A;  4JF6 A;  3QP2 A;  2A2L A;  1FR1 A;  4KZ6 A;  2C5W B;  4Y5F A;  2HGV A;  2G7U A;  2OAQ 1;  3SH9 A;  3TE8 A;  3P98 A;  5AQA A;  1N9O A;  4DJ3 A;  3WRZ A;  4EEP A;  2J3W A;  1YQS A;  4N92 A;  3ZYT A;  2EA9 A;  1ERQ A;  4BL3 A;  2WAF A;  3BRM A;  2XRN A;  4S2J A;  2NUP C;  2B02 A;  4LV0 A;  5EV0 A;  3OPP A;  1SCW A;  2QYB A;  1S0W A;  1PRQ A;  5GHY A;  1CF0 A;  4PM7 A;  4UA7 A;  2HP9 A;  4I3I A;  4XT2 A;  4OPR A;  1YLZ A;  4Y0U A;  1S4R A;  2QJ5 A;  3LR3 A;  2HZ5 A;  2V8C A;  3N8S A;  4ZAM A;  4OP8 A;  3V39 A;  3HLW A;  2OOL A;  1YT4 A;  1FCO A;  4PKY A;  4P85 A;  4NG2 A;  1C3B A;  2Y2H A;  2WAD A;  5HWT A;  3KYQ A;  3LFV A;  3T1Q B;  4HBT A;  3F1P A;  3HBR A;  1WE4 A;  3IHA A;  5L07 A;  4XT2 B;  1CEF A;  4WMC A;  4DJ2 A;  4Q0H A;  5TBM A;  1MWT A;  2QJ7 A;  4HH2 A;  4WL9 A;  5DFY A;  2M7U A;  3G2Z A;  3HUM A;  1JWV A;  2ZQ8 A;  4WEL A;  4HJ4 A;  4NXF A;  3AGF A;  4D2O A;  1VHM A;  2VK3 A;  2H0T A;  5G4Z A;  5F5Y A;  3DTK A;  3IHB A;  4IUH A;  2L0W A;  3Q07 A;  4X1M A;  4Q8I A;  3K2N A;  3IX4 A;  3TRC A;  1EW0 A;  4HHD A;  2EWW A;  5F69 A;  5FI2 A;  2A24 B;  1P0Z A;  3QP1 A;  1O07 A;  3HLG A;  5HD5 A;  1NZU A;  3EQU A;  4CLC B;  3CUE C;  1S1Y A;  3GMW A;  3HRE A;  4KG5 A;  5IU1 A;  3LCE A;  3O5Y A;  3IT9 A;  4MBF A;  3LY3 A;  3FKW A;  3VE4 A;  1M40 A;  3CPT A;  3KYE A;  3PBS A;  2JN7 A;  5C5K A;  5DKK A;  2GDN A;  1TS8 A;  3TSG A;  1T1A A;  3CI6 A;  1S1Z A;  1N9N A;  4MMN A;  1M6K A;  5F83 A;  4HJ3 A;  1BTL A;  3BY9 A;  2HV1 A;  1ALQ A;  3O3V A;  3C4O A;  1A0K A;  3B47 A;  1OJG A;  1YM1 A;  2PDR A;  2Y2M A;  2OLU A;  1SKO B;  3UNW A;  4ARZ B;  1I2S A;  3CHW P;  5DJU A;  5HWV A;  2J9P A;  2Q9N A;  4JF4 A;  5TJJ A;  3WS5 A;  1TS0 A;  2ZJ9 A;  5EVI B;  2L1M A;  4ZRR A;  1HD8 A;  4D60 A;  4PM8 A;  4OPQ A;  1UWP X;  1K4F A;  1KDS A;  3R7W A;  3PXP A;  2CMN A;  1W5D A;  2Y2K A;  3OZH A;  5GHZ A;  5HSQ A;  5F1G A;  1KGE A;  4WM9 A;  4EBL A;  1L0F A;  3BFF A;  5FQI A;  3BQA A;  3S22 A;  4KZ3 A;  4ZJ3 A;  2OAP 1;  4PM9 A;  3A3I A;  4CLC C;  1SDN A;  1Z09 A;  4HY8 A;  2XEP A;  4FD8 A;  3UE1 A;  5MC7 A;  3QP6 A;  1HLU P;  4EQI A;  4LPZ A;  3H9W A;  2XK1 A;  4MCW A;  4GD8 A;  4BJP A;  2XRO A;  3G32 A;  1FIK A;  3WWX A;  2PU2 A;  5HAR A;  5G4Y A;  4N1H A; 
#chains in the Genus database with same CATH homology
 3UB7 A;  2VGL M;  2WKQ A;  2HF6 A;  1F9I A;  4I39 A;  3C30 A;  3KYZ A;  2P08 A;  1TF1 A;  3T4O A;  3OLO A;  2V1B A;  1IOU A;  3H82 A;  3UME A;  2MJ6 A;  4HQA A;  2Z6D A;  5FL3 A;  3S7N A;  1OT9 A;  1DP6 A;  1YAX A;  5EFW A;  1OTA A;  4GS9 B;  3T4J A;  3BY8 A;  2PYP A;  3HCY A;  1XFN A;  2W3F A;  2WKP A;  3R4K A;  3S7P A;  4JGQ A;  2W3G A;  4Z1W A;  2V0U A;  4Q0I A;  2W1T A;  3UMD A;  3T50 A;  3H82 B;  4BWI A;  1P9W A;  4L9F A;  1V9Z A;  1LSV A;  4MN6 A;  4PHT A;  2ZMF A;  2VEA A;  4EET B;  2PD7 A;  3EEH A;  5HZH A;  3RFB A;  3PYP A;  3LR4 A;  4WN5 A;  2PR6 A;  4LLO B;  2VV8 A;  3E4P A;  2W1T B;  2V1A A;  2ZBB A;  3MQ0 A;  1W63 M;  2D02 A;  3D72 A;  4I3J A;  4KUK A;  3ICY A;  3NJA A;  3TJZ C;  4CLC A;  2VV7 A;  3F1P B;  4GCZ A;  3G6O A;  3PBT A;  1GSX A;  3H7W B;  4JGR A;  3C8C A;  2VZW A;  2GZA A;  2KLI A;  1GSV A;  4NKP A;  2ZOI A;  3B33 A;  1OT6 A;  5AVE A;  4EU0 A;  3FPW A;  1OTI A;  2HJE A;  3C38 A;  3CAX A;  3D3O A;  4KQO A;  4G3W A;  5LBR A;  4DN0 A;  3LYX A;  5AVF A;  3LIE A;  1S67 L;  3KSG A;  1X0O A;  5J3W A;  2W3E A;  4M4X A;  4PKY G;  2JKR M;  2JKT M;  4YOF A;  2P04 A;  1NLY A;  4I38 A;  5HDS A;  5TBM B;  3NOU C;  4F3L B;  3DBA A;  4LRY C;  1XJ2 A;  2O9A A;  3OBF A;  2O0Y A;  2LB9 A;  2O9B A;  3MFX A;  3A0S A;  4B9O A;  3E4O A;  4HIA A;  3T4K A;  4Y2F A;  5K5B A;  1XFQ A;  1F98 A;  5F68 A;  2YKF A;  3CWF A;  3EWK A;  2QWS A;  3IBR A;  1KOU A;  4WUJ A;  1LT0 A;  4HNB A;  1Y28 A;  1WA9 A;  1YKD A;  1P97 A;  4WLA A;  4YNR A;  2K31 A;  3LI8 A;  1D7E A;  3LR5 A;  4II7 A;  5KIZ A;  2VX8 A;  3HJK A;  3BWL A;  3F1N A;  4WEK A;  4ARZ A;  4EER A;  3HJI A;  3CIT A;  5IT5 A;  3PBN A;  3KSF A;  3S7Q A;  1OTB A;  2W3D A;  5HD3 A;  4R6L A;  2GJ3 A;  2L4R A;  2W0N A;  4HP4 A;  5HDC A;  1NRJ A;  5DFX A;  3UB6 A;  5AJG A;  1T1B A;  3FG8 A;  1MZU A;  2NUT C;  3E4Q A;  1N9L A;  1H8M A;  3KX0 X;  3KSH A;  3T4S A;  4O0P A;  1LL8 A;  3MMH A;  2D01 A;  1H3Q A;  2XA7 S;  3PR6 A;  2J3T C;  5J4E A;  5L8M A;  4CLC E;  4F3L A;  4AFI A;  2O9C A;  3LR0 A;  4NXE A;  2FZ0 A;  5I5L A;  4K08 A;  4IJG A;  2WKR A;  3UE3 A;  3PHY A;  3GEC A;  2R78 A;  1DP9 A;  4R38 A;  4ETX A;  4UQI M;  4JGO A;  2OWJ A;  3IBJ A;  3LIA A;  4O8G A;  4FOF A;  2J3T D;  3LI9 A;  5DF9 A;  2KDK A;  2P7J A;  3LUQ A;  2ZOH A;  3A0V A;  4MN7 A;  2A2L A;  3JVV A;  4EQ1 A;  3EOI A;  5HL6 A;  3FC7 A;  4Y5F A;  2HGV A;  2G7U A;  2OAQ 1;  3TE8 A;  3H7W A;  3NOT C;  3T4Q A;  3GDI A;  4OOM A;  3SW1 A;  1N9O A;  4DJ3 A;  5DKL A;  4EW7 A;  4EEP A;  2J3W A;  2W27 A;  1TD5 A;  4FSF A;  3LIC A;  3ZYT A;  5HPF A;  1F5M A;  2EA9 A;  5A8B A;  4OOL A;  1TS7 A;  2J80 A;  2O99 A;  3NHQ A;  4Q0J A;  2XRN A;  2NUP C;  2B02 A;  2QYB A;  3PBQ A;  1MC0 A;  2ZMV A;  4EXO A;  3JVU A;  1STZ A;  2IA2 A;  1UWN X;  1ODV A;  3P7N A;  4I3I A;  4EUV A;  3W2Z A;  4GHI B;  2VKS A;  4XT2 A;  1G6O A;  1S4R A;  2M1C A;  2VGL S;  2QJ5 A;  1OJ5 A;  3LR3 A;  5HPI A;  4DMZ A;  3F1N B;  4KQD A;  3F1O A;  4EES A;  1MKM A;  4B93 A;  1LSX A;  4P6Z S;  4IHQ A;  3MQQ A;  2OOL A;  3T4T A;  2V0W A;  2KOI A;  4PKY A;  4R70 A;  2QKP A;  5HWT A;  3KYQ A;  2Y79 A;  3LFV A;  4H6J A;  3BJN A;  2PR5 A;  4EEU A;  3F1P A;  3ULF A;  3S7O A;  3EQV A;  3V67 A;  4XT2 B;  4DJ2 A;  4Q0H A;  4HP9 A;  5TBM A;  2QJ7 A;  4HH2 A;  4WL9 A;  4MDZ A;  4MN5 A;  5CX7 A;  1D06 A;  5DFY A;  2M7U A;  3UB9 A;  5KSH A;  1VB6 A;  2Y8H A;  4WEL A;  4HJ4 A;  1NWZ A;  4NXF A;  2EWV A;  4IUK A;  1VHM A;  2PT7 A;  2DMW A;  3OCN A;  4NXG A;  3VV4 A;  5G4Z A;  3LIF A;  5F5Y A;  4H6J B;  1LSW A;  2K2N A;  4IUH A;  4ME4 A;  3C2W A;  2V9A A;  4NEE D;  2L0W A;  4L9E A;  3K2N A;  2LB5 A;  3ZQ5 A;  3TRC A;  1EW0 A;  2VLG A;  4HHD A;  4RQ9 A;  2EWW A;  3CLO A;  5F69 A;  2A24 B;  1P0Z A;  3RTY A;  1XJ6 A;  2K7S A;  4GJ4 A;  5J7E A;  3A0R A;  5HD5 A;  3F1O B;  3EQU A;  4CLC B;  3CUE C;  4BBT A;  2FH5 A;  2XSS A;  1OTE A;  3K3D A;  4WF0 A;  1S1Y A;  2QHK A;  3PBO A;  2OWH A;  4BMW A;  5IU1 A;  1XJ4 A;  3BQ8 A;  1ZHH B;  3O5Y A;  4CQH A;  3E0Y A;  1S66 L;  3VE4 A;  4GW9 A;  3CUE A;  3R7W B;  2H28 A;  3MXQ A;  2M7V A;  3PBR A;  1DRM A;  3PBS A;  4CLC D;  2JN7 A;  3TW8 A;  3KSI A;  5DKK A;  5C5K A;  1P9R A;  3RH8 B;  1TS8 A;  1T1A A;  3UB8 A;  5DJT A;  3MJQ A;  3CI6 A;  1IFQ A;  4QPR A;  1S1Z A;  1N9N A;  2INW A;  4HJ6 A;  1DP8 A;  4MMN A;  4YWZ A;  4HOI A;  4Y3I A;  4HJ3 A;  3BY9 A;  2HV1 A;  2VA0 A;  4GS9 A;  1W63 Q;  2W1R A;  2I9V A;  4R3A A;  1ZTU A;  4HI4 A;  3B47 A;  2VJW A;  1OJG A;  2PDR A;  2BAS A;  2YKH A;  3B42 A;  1OTD A;  4LRZ E;  3VE3 A;  5F6A A;  3VOL A;  4ARZ B;  1OPX A;  3EGD C;  3KO6 A;  3LIB A;  4WEJ A;  3U2A A;  5DJU A;  5HWV A;  4E04 A;  3IS2 A;  1XJ3 A;  2XA7 M;  5TJJ A;  2W3H A;  2A24 A;  1TS0 A;  4G3K A;  4I5S A;  1YSQ A;  2L1M A;  4ZRR A;  3MR0 A;  2KX6 A;  1UWP X;  4UQI S;  3R7W A;  3PXP A;  2CMN A;  4UEY A;  3K3C A;  1T1C A;  4P6Z M;  2GNX A;  3OCL A;  1G28 A;  4O01 A;  1T19 A;  2PHY A;  3NOP C;  5HSQ A;  3T4L A;  4BBV A;  1YSP A;  4JGP A;  3IS2 B;  4NXB A;  2JHE A;  3LID A;  2HJ9 C;  3BQA A;  4KUO A;  3FPV A;  4I3A A;  5HWW A;  2OAP 1;  2PD8 A;  3E98 A;  4BBU A;  1V9Y A;  1NLZ A;  3P01 A;  3EEA A;  3OC2 A;  3UE6 A;  4CLC C;  4GLQ A;  3MF0 A;  1T18 A;  4L9G A;  4HY8 A;  3OOV A;  4L0L A;  4PAU A;  5MC7 A;  2GX5 A;  1TS6 A;  3MQO A;  3EGX C;  2VV6 A;  5IS1 A;  2JKT I;  2JKR I;  4HH3 A;  3BW6 A;  4LRX C;  4G3V A;  4LPZ A;  3H9W A;  4MCW A;  2Z6C A;  4BJP A;  2XRO A;  1JNU A;  2PYR A;  2B18 A;  4ETZ A;  5HDD A;  4GHI A;  1S4S A;  1UGU A;  5G4Y A;  1BYW A;  1GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...