1OT6A

Cryotrapped crystal structure of the e46q mutant of photoactive yellow protein under continuous illumination at 110k
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ot6A00
5J4EA 4YWZA 4EEPA 1DP6A 2B02A 2PR6A 2Z6DA 5DKKA 2VLGA 2V9AA 2V0UA 5EFWA 3FC7A 2L4RA 3PHYA 3A0SA 4GHIB 1UGUA 4E04A 1KOUA 2PYRA 1OTDA 1T18A 4H6JB 4F3LB 1LSWA 4EEUA 4GS9A 5J7EA 1XFQA 4HJ4A 1TS0A 4NXBA 1T1BA 4LRXC 2ZBBA 2JN7A 4EESA 4WLAA 3UE6A 4JGOA 1ODVA 5AVFA 4R6LA 3FG8A 2I9VA 5IU1A 1N9NA 4HOIA 3GDIA 1LT0A 3F1NB 3MR0A 2H28A 2WKRA 3VE4A 5F6AA 2WKQA 3H82B 3C8CA 1S4RA 4LRYC 2YKFA 3GECA 1OTAA 3IS2B 4DJ3A 2V1BA 1D7EA 3BY8A 3E4OA 3A0RA 3UMEA 1D06A 1XJ3A 3LIDA 1LL8A 3IBRA 2M1CA 4HP4A 4B9OA 3BWLA 1T1CA 3G6OA 1JNUA 4I5SA 2QHKA 3UB9A 2ZOHA 3ZQ5A 1T1AA 3F1PA 2GJ3A 3PYPA 3OLOA 2BASA 5KIZA 3NOUC 5I5LA 2L0WA 4R3AA 2JHEA 2V1AA 4XT2A 3H7WA 1S66L 3VE3A 4EQ1A 4GS9B 5DJTA 4HNBA 4JGQA 3LI8A 4PKYG 4I38A 1EW0A 4GCZA 5HZHA 3KX0X 3VOLA 4L9EA 4R38A 5HWVA 1DRMA 3NOPC 3SW1A 5A8BA 1S1ZA 1TS6A 5TBMB 2A24A 2PHYA 5F68A 4MN6A 3MJQA 1OT9A 2J80A 1Y28A 1OT6A 5DKLA 4RQ9A 5IS1A 2W0NA 5HD5A 2OWHA 2W27A 4EETB 3LIBA 4EW7A 4HH3A 1NWZA 2VV8A 4HIAA 2INWA 3E4PA 2PDRA 4H6JA 5HWWA 3LYXA 4I3JA 3UMDA 5HSQA 1DP9A 3LICA 4HQAA 5F5YA 2VEAA 4L9GA 1V9ZA 5HWTA 3MQOA 3F1OA 4K08A 1V9YA 2OOLA 1OTBA 3D72A 4KUOA 1TS8A 4HI4A 1S67L 3HJIA 3EWKA 3T50A 1S1YA 2PYPA 4WL9A 2V0WA 5G4YA 1XJ2A 4BBVA 4PKYA 3CLOA 3H9WA 2L1MA 1X0OA 2PR5A 5AVEA 1WA9A 1OTIA 2KX6A 1XJ6A 4HJ6A 3P7NA 3RH8B 5J3WA 4HP9A 3F1NA 2P7JA 2WKPA 3LIAA 4MN5A 2YKHA 1DP8A 3BY9A 3H7WB 4XT2B 4BBTA 3HJKA 3MFXA 1N9LA 3H82A 1VB6A 3ICYA 4KQDA 1N9OA 1S4SA 2D02A 3LIEA 1P97A 1GSXA 2PD7A 2D01A 1LSXA 4KUKA 5G4ZA 3LIFA 3RTYA 3ULFA 1BYWA 4DJ2A 3NHQA 3UB6A 3MXQA 2PD8A 1GSWA 2VV6A 1UWPX 1OTEA 4R70A 4LRZE 4EERA 1OJ5A 3C2WA 3NJAA 1TS7A 1XJ4A 3A0VA 4M4XA 4EXOA 1G28A 4I39A 4BBUA 4WF0A 4NXFA 2VV7A 5F69A 3EEHA 4I3AA 4HJ3A 4HH2A 1GSVA 5HDCA 5HDSA 3F1OB 4I3IA 3CAXA 4GHIA 3NOTC 4NXEA 5DJUA 5TBMA 3K3CA 4F3LA 4JGRA 4L9FA 1OJGA 2QJ5A 2Z6CA 2QKPA 3UB7A 2HV1A 4HY8A 3UB8A 3E4QA 2KDKA 3F1PB 3LI9A 1P0ZA 4JGPA 4HHDA 2QWSA 4GW9A 3LUQA 2QJ7A 2ZOIA 2EA9A 2OWJA 4LPZA 2K7SA 1LSVA 2CMNA 1F9IA 1F98A 2R78A 5HDDA 1UWNX 3IS2A 4NXGA 4WN5A 3B33A 3K3DA 4WUJA 1T19A 1MZUA 3MQQA 1XFNA 4LLOB 2A24B 3CWFA 5HD3A
chains in the Genus database with same CATH superfamily
3SH8A 5J4EA 1ZKJA 4IHQA 1ACFA 4NKPA 1FILA 4QJGA 3CPTB 3WS2A 3DWZA 5EVEA 1YKDA 3N8RA 5DKKA 2VLGA 3T4KA 1RCJA 4DDYA 1PWCA 4BENA 5HAPA 2P9VA 3S7QA 3ZCZA 4YFMA 1K57C 3BFDA 3N4IA 4X69A 4JXGA 4CLCD 3WS4A 3UPOA 1L2SA 1Z09A 4GHIB 4WZ4A 5FQJA 1KGFA 2CC1A 2AVXA 2ACGA 2PYRA 1T18A 1JWZA 3PBQA 5GLCA 3L9KA 2K31A 4CLCC 1DJCA 4GS9A 3BYDA 1QMEA 1TS0A 5EV0A 3UDIA 1HLUP 4GJ4A 3L7HA 2ZQ7A 5FQKA 4D60A 4FH4A 4JGOA 5AVFA 2EX9A 4KQQA 1K57A 2I9VA 3M6BA 3GSGA 2WGWA 5IU1A 3M6HA 1YQSA 4X25A 5FI6A 1NJ4A 3GDIA 3MR0A 1D1JA 1YSPA 1JVJA 2WKRA 4WEJA 5DTSA 4IJGA 4CLCA 3H82B 3LEQA 3I7JA 1S4RA 4Y0OA 3LY4A 3E0YA 4GKUA 5EECA 3PXPA 4P6BA 1WE4A 3WWXA 4DJ3A 1TD5A 2Q0OA 2V1BA 1S6RA 4O8GA 2P08A 4ID4A 1K25A 3DW0A 3A0RA 1DJAA 4L0LA 3HLFA 4OQ0A 4HP4A 3ITAA 4GLQA 4B9OA 3G6OA 5F1GA 1JNUA 2HDSA 3ZYTA 4XUXA 3Q07A 4I5SA 2E8IA 2XA7M 3TRCA 4DKIA 4BLMA 1T1AA 3F1PA 2VX8A 2GJ3A 3VOZA 1K56A 4OOYA 4OLGA 1KVLA 3NOUC 4KENB 3HLWA 4ZJ3A 1VETA 1NZUA 3KSGA 3LY3A 2JC7A 3HLBA 2ZM0A 4DF6A 1P9RA 3H7WA 1WYBA 5FAOA 2WZZA 3SOIA 2HDRA 3SZTA 2W3FA 3UPNA 2XGNA 4PKYG 5EE8A 3PTEA 3Q1FA 4MEZA 4GCZA 2ZJ9A 4S2OA 5FDSA 1DRMA 3SW1A 1KVMA 5A8BA 3V3SA 2A24A 3DTIA 1ES5A 3C38A 4MN6A 2DCFA 3UPPA 3V50A 5HAQA 3O5YA 1K0KA 2WZXA 2J80A 2OV5A 4C75A 5CRFA 1KE3A 4X56A 2A49A 4JXVA 3E2LA 5DKLA 4QU3A 3BFFA 3NC8A 3TOIA 3PBOA 4WMCD 5IS1A 1Y54A 3MMHA 4UQIS 2V1ZA 2OWHA 5HD5A 2W27A 4EETB 4LGWA 4EW7A 2J3WA 1YLWA 5KSCA 2H10A 4NG2A 3LR0A 3VFHA 2H0TA 3E4PA 3UE3A 1J9MA 2ZC7A 2Y59A 4GDBA 3UMDA 3LICA 3QP5A 4KZ5A 5DFXA 2VEAA 4O01A 3G34A 1H8MA 2V20A 1BUEA 1YLZA 3VP1A 3BLSA 4KUOA 4HI4A 2DRWA 3MQ0A 4ZBEA 1W8QA 2A2LA 1S1YA 1FSWA 3QP1A 5G4YA 4R3BA 4BBVA 2Q9MA 2L1MA 2ZMFA 2Z2MB 3ZVTA 4FSFA 1X0OA 4E3OA 5G18A 1IELA 1WA9A 3OPLA 4HJ6A 1XJ6A 2E8JA 3IBJA 4GDNA 3O87A 1M6KA 1IKIA 3F1NA 4BMWA 4LV3A 4MN5A 1K4EA 2ZQCA 4XT2B 1H5XA 4BBTA 3EQVA 1P9WA 3MFXA 2VGLS 1VB6A 3ICYA 4MLLA 3KSHA 3PR6A 1N9OA 1SKOB 1MWRA 1LSXA 4KUKA 5DFYA 3R7WA 4OVDA 2ZD8A 3U4LP 3NHQA 3K2NA 1I2WA 1FIKA 4R70A 1EI5A 1K4FA 4LRZE 4EERA 1NLZA 4OKPA 3BW6A 1OJ5A 4HBUA 4Q0JA 1CEGA 5DTKA 5HFOA 3MS6A 1LI9A 3T4OA 3FWLA 5F69A 3SS3A 3EEHA 1QMFA 1BLCA 2H5SA 1BLSA 3IXGA 4H8RA 1M40A 3F1OB 3A3EA 3G32A 2I72A 1A0KA 3CAXA 3ITBA 2ZLYA 2EWWA 2B18A 4GD6A 5FATA 1L0GA 5TBMA 3OBFA 1W63M 1BZAA 1PWGA 2Y55A 3GQZA 1G6AA 4ZTKA 4FOFA 1FCNA 1ES4A 4JF6A 4ETZA 4GD8A 1FOFA 1E4DA 4B4ZA 2LB9A 2KDKA 4U0XA 3ZNYA 2FFYA 4JGPA 1IYOA 3QHYA 4HHDA 3T4LA 1YMXA 2XQZA 4GW9A 3LUQA 5CGSA 3PBTA 5FASA 2GX5A 2HDQA 3NI9A 2OWJA 4G3VA 5A93A 3TW8A 2K7SA 2CMNA 2W1TA 5MC7A 2JKTM 4N1HA 1GA9A 3KO6A 4G3KA 4DXCA 4R23A 1F98A 2R78A 4WN5A 5CTNA 1W63Q 1MWSA 2UWXA 1BT5A 3IX3A 2Y2GA 3FKWA 2XF3A 3V3RA 2K2NA 1T19A 3MQQA 3PAGA 4P85A 5HX9A 1KE4A 3VP3A 4NEED 1Y4OA 3A3JA 5GHXA 2J3TD 3G2YA 4M3KA 4DE0A 3C4OA 1L3LA 2WKIA 2BG1A 1EWZA 3MXSA 2WGIA 3IHBA 4JKTA 2JBFA 2FFFB 1Q2PA 1ERQA 2XSSA 4X53A 3MZDA 1OPXA 4KZ8A 2ZC4B 5A91A 3DAVA 2G2UA 2PBYA 4E04A 5EM1A 1FCMA 1OTDA 4H6JB 3CMZA 3TJZC 3P09A 5GLAA 4F3LB 1LSWA 4EEUA 1XFQA 2WUQA 4HJ4A 3OCNA 4IUKA 5TJJA 4ARZB 4GOGA 3T1XA 4WELA 2QYBA 1T1BA 2ZBBA 1E25A 4EUZA 3D9YA 2HP9A 1VQQA 3VP4A 4KZAA 1LL9A 5FEFA 3VOYA 4S2NC 5D3OA 1BTLA 3FG8A 2Y4AA 3Q7VA 1YPRA 3UE1A 4HOIA 4JF4A 1W5DA 2IA2A 3IF6C 4Y0TA 4FCFA 2IWBA 4QPRA 2JKTI 4WBGA 1JWPA 1SKFA 4OQHA 2V8CA 3ZHHA 2J9OA 4N92A 4OONA 2JKRM 1BSGA 5L10A 4S2PA 3NIAA 2YKFA 4EBNA 3RXXA 1TVFA 3BY8A 2WKEA 2KLIA 3E4OA 3O3VA 1RGZA 1LL8A 3IBRA 2M1CA 3VP0A 1VM1A 3BLMA 1YSQA 3EEAA 4S2NA 2QHKA 2EX6A 4BQMA 4C3QA 3TSGA 3UB9A 2ZOHA 3IF6A 5FQMA 1PWDA 3OLOA 2P9VB 3VSLA 5I5LA 5A90A 1G5UA 1MBLA 2VGJA 2JKGA 4JXSA 2ZQ8A 3G35A 2V1AA 3VE3A 1O7EA 5AQAA 2ZQ9A 5IHVA 4GS9B 3W4OA 3LI8A 4MBFA 3C7VA 3E2KA 4U0TA 5LBRA 5HWVA 2V8FA 3NCKA 2VJWA 4IVIA 2PHYA 4KQOA 1YAXA 4MBHA 2PT7A 2O9CA 1O07A 3CPTA 3MJQA 1ERMA 3OPPA 1Y28A 3T4SA 2Y2IA 4ETXA 3AGEA 4KZBA 3V5MA 3LO7A 3G4PA 1TF1A 2QZ6A 1IFQA 2HJ9C 4MCWA 2EWVA 4R4SA 2PU2A 3SH7A 3UDFA 4KG2A 1L0DA 2JKRI 1MWUA 4RVAA 1K56D 3PAEA 3G2ZA 3HL9A 1MKMA 4GB7A 1W79A 4CLCB 1PFLA 3FYZA 4BD1A 2INWA 5FQIA 3TG9A 2B5RA 3UB5P 3LYXA 4I3JA 4WEKA 3DBAA 3V39A 5K5BA 1V9ZA 5HWTA 1OTBA 3D72A 1JTGA 4S2JA 3EWKA 1XPBA 2HP6A 3T50A 1NY0A 3BQAA 1JTDA 3OOVA 2V0WA 4QD4A 5E2EA 1SCWA 1I5QA 3OPRA 5E2GA 3G30A 3IXDA 5AVEA 5M1AA 3RH8B 1VETB 5J3WA 2M7UA 2P7JA 3BEBA 3LIAA 2HPBA 2YKHA 3A3FA 1DP8A 5HPIA 5CX7A 2EFXA 1ZTUA 3H7WB 4IVKA 5EVID 1H3QA 3SH9A 5E2FA 3H82A 4RX2A 4R4RA 4KQDA 1S4SA 2X02A 1VEUB 4WM9A 4OOMA 3WS5A 4YOFA 1GSXA 3MZFA 3KYQA 5EVIC 3OZHA 4D2OA 2X01A 1K38A 5G4ZA 3W4QA 3LIFA 5KZHA 3ULFA 3ZG7B 3IWIA 2Z2LB 1BYWA 5GHYA 5HW3A 3AGDA 1GSWA 2VK3A 3LR3A 3MXRA 1MPLA 1GCEA 1IEMA 2C5WB 3ZGAB 2ZM8A 3OC2A 5L8MA 1CK3A 1TS7A 1XJ4A 4EXOA 4M4XA 2XRNA 4OPRA 5TGFA 1G28A 1S0WA 3NDGA 3Q81A 3LR4A 3IX4A 4ZJ2A 1CI9A 4I3AA 4II7A 1TDGA 4HJ3A 5EVIA 1HVBA 3QP2A 2G2WA 4CPKA 1K6SA 3CJMA 1ZHHB 3S7OA 3KYZA 3P01A 5HPFA 3NOTC 4PM5A 4Y13A 5JYOA 1GHIA 3C5AA 3VFFA 1ESUA 3ZNTA 4JGRA 5E43A 1MC0A 4Q8IA 4NETA 1OJGA 2JKFA 3SS5A 2H0YA 2HP5A 3B47A 4CQHA 2Y8HA 2QKPA 4N9KA 1PI4A 4XXRA 4JXWA 1PZPA 1F5MA 2Y2KA 4G3WA 3MBZA 3UB8A 4IUHA 3IF5A 3E4QA 1P0ZA 4HBTA 4RYEA 3S7NA 5CHMA 5GLDA 2J7VA 2QMIA 3EOIA 1ZC2A 4OH0A 2ZL1B 4R1GA 5JYPA 5EM0A 2QWSA 1IYPA 1KGEA 4S2KA 5BOHA 4AFIA 4QY5A 3WRZA 2EA9A 2W3GA 4LPZA 3R7WB 3SS4A 3C30A 1KDWA 3T1QB 2Y2PA 1AXBA 3M2JA 4O0PA 1F9IA 5HDDA 3IS2A 1U60A 1HZOA 4MN7A 3IH8A 1KE0A 4LLOB 3BFGA 4HESA 4FUWA 3ISGA 2Y2OA 3W8KA 4YWZA 4EEPA 4E3LA 4MMNA 2O99A 5EOEA 3O86A 2B02A 3QP8A 5FI7A 2PR6A 2V9AA 2ZC6B 4KZ9A 5L09A 3JPUA 1CI8A 2V0UA 4JPMA 1AWIA 5FAPA 5DF8A 4QY6A 3N8SA 1KGGA 5EPHA 3GMWA 3S1YA 2L4RA 3A0SA 4Z9QA 3PBRA 1G6OA 4DRTA 4S2IA 5HAIA 3FPWA 1F2KA 3OCLA 2IWDA 3HUMA 4EQIA 3LFVA 4BL2A 3CG5A 4LCMA 4LV0A 3B3XA 3S7PA 4RX3A 2WK0A 4FD8A 5U47A 4OP8A 4WLAA 3UE6A 3CITA 5HARA 2XFSA 1EROA 1ODVA 4UEYA 4R6LA 4P87A 1CEFA 3N7WA 3DTKA 1N9NA 1ONGA 2BLSA 1LT0A 3GTCA 4S2LA 2O0YA 1XGIA 2OAQ1 2NUPC 2Y2LA 2ZM2A 5F6AA 1WYCA 2WKQA 3BJNA 1FCOA 3C8CA 3AGFA 4LRYC 3GECA 1XGJA 2A3UA 2VGKA 3NECA 3MKFA 2PAVP 1FR6A 3MKEA 1NZOA 2WKHA 1D06A 1XJ3A 3LIDA 4U3TA 3IH9A 3M2KA 5AJGA 3BWLA 1FQGA 1PNEA 4BL3A 4B93A 4X1MA 4LV1A 4Y0UA 1ZG6A 3LEZA 4PM6A 2BASA 1MY8A 3UY6A 4Y15A 4CLCE 3T4JA 2L0WA 1YT4A 3LGOA 1K54C 2VZWA 2JHEA 1CJFA 2M7VA 1NRJA 4OOLA 5DF7A 4DMZA 3BM6A 4B88A 4PAUA 3JVVA 4MBKA 4BD0A 2ZMVA 3KSFA 5KSHA 4I38A 1EW0A 3UE0A 5DTTA 1XXMA 5HZHA 3KX0X 2HZ5A 3NBLA 4PMAA 4L9EA 5FA7A 1N9BA 4R38A 1S1ZA 5F68A 5CERA 2XFTA 2FH5A 4E3MA 3UO9A 1YLYA 5CEBA 5FQQA 1OT9A 4Q0HA 1PIOA 1XA7A 4GZBA 4KQRA 3HLGA 1K54A 1OT6A 2HJEA 2ZC3B 1J3WA 3D4FA 4RQ9A 3BECA 5CGWA 4PM8A 3WS0A 1PZOA 2W0NA 5EVLA 3IXBA 5M18A 1LL5A 1W8YA 4EUVA 5CECA 3T1SA 4OLDA 4HH3A 2XR0A 3NY4A 1HD8A 3VSKA 3CI6A 1SHVA 1SDEA 2X71A 1PW1A 2PDRA 3T4QA 4H6JA 5HSQA 3ZDJA 4MDZA 5F5YA 5FEGA 4FTXA 3MQOA 4K08A 1V9YA 3HCYA 1TS8A 2GNXA 4ARZA 4E3KA 5AQ7A 1NYMA 4EU0A 3WRTA 2PYPA 4WL9A 2W3HA 4PKYA 2W1RA 3H9WA 2J9PA 2BTFP 3RFBA 2XDMA 3EGDC 3W2ZA 4UQIM 2PR5A 2PRFA 1OTIA 2KX6A 2XEPA 1FSYA 1GHPA 1HTZA 4HP9A 2XD5A 4KG6A 4MNRA 2O9BA 4XUZA 1SZVA 2DMWA 1N9LA 2PU4A 4LENA 1I2SA 3LIEA 1YLPA 3HLDA 3JVUA 2MJ6A 1P97A 4PM9A 2PD7A 3RTYA 1MWTA 4DJ2A 1CF0A 4A5RA 2VV6A 5CEDA 1UWPX 3QP6A 4R0QA 3ZG9B 3C2WA 3NJAA 1PW8A 4KZ7A 3A0VA 4E3JA 4PHTA 4Y7PA 1TEMA 2VGLM 1TDLA 4ZRRA 2GZAA 2JE5A 4NXFA 2VV7A 2WGWB 2Y79A 4HH2A 1GSVA 2UV0E 5GL9A 5HDSA 3BFCA 2EXAA 4I3IA 1L0FA 4GHIA 2EX2A 2P04A 3KYEA 5DJUA 5I94A 2C6WB 1FR1A 1GHMA 4DDSA 3QNCA 2OLUA 2QJ5A 3PBNA 3HUOA 3IXHA 2ZC5B 4B4XA 3ZFZA 4OPZA 3C4PA 4QB8A 2XD1A 3F1PB 3LI9A 4UA6A 2XK1A 1ESIA 4JF5A 4X68A 1H8ZA 3QP4A 1OMEA 4P6ZS 3RJUA 3LCEA 3IWQA 2FZ0A 5M19A 2ZOIA 2VA0A 2EXBA 1LSVA 1IYQA 1DY6A 3R4KA 2OAP1 2ZMAA 1UWNX 4NXGA 5TFQA 3B33A 4N1XA 3HLCA 1STZA 1XFNA 4NK3A 2A24B 5HD3A 2O9AA 1RGYA 1DP6A 3PBSA 1KDSA 2Z6DA 4IBRA 4OPQA 1H8YA 1YMSA 4Y3IA 2XROA 3G31A 4E6WA 2B95A 4E6XA 3OPHA 5EVIB 2Y2HA 3MF0A 5EFWA 3FC7A 3PHYA 1XKZA 1VEUA 1XA1A 3TE8A 4Q0IA 4JLFA 5HL6A 1ONHA 1UGUA 1SDNA 1KOUA 1K55C 1H0MA 5F1FA 3UNWA 4IEDA 2J8YA 4EWFA 1Z6FA 3MFDA 2NUTC 5J7EA 3T12B 1MXOA 3GVBA 1LI0A 4DE3A 2QPNA 3N6IA 1LLBA 4NXBA 2P74A 3CZDA 4LRXC 5FQ9A 1IOUA 2JN7A 3EQUA 5CHJA 4EESA 4UHUA 4LFUA 2WAEA 1IKGA 5A92A 3UN7A 4E3NA 2IWCA 2ZQAA 4LCLA 4KZ3A 1CQAA 5J8XA 3F1NB 5IT5A 2H28A 5FAQA 1K55A 4GNUA 5FSRA 3GRJA 3VE4A 2DNSA 4OQGA 2VKSA 5CTMA 1OTAA 3IS2B 3BRMA 1YLTA 1D7EA 4E3IA 1NXYA 3UMEA 4OP5A 1XX2A 2WAFA 1T1CA 3O88A 3BFEA 4WMCA 3WS1A 1XP4A 3N8LA 3ZQ5A 4PM7A 3PYPA 3UDXA 1E3UD 4HEFA 5KIZA 5HL1A 5EOOA 5E2HA 2OSUA 2ZL1A 1N4OA 4R3AA 3KSIA 3QNBA 1PYYA 3IX8A 5CGXA 3NDEA 4XT2A 2WADA 1S66L 4UA9A 1ZG4A 4UAAA 4EQ1A 2WYXA 3MSHA 4EBPA 5DJTA 3DTMA 4HNBA 4JGQA 1VHMA 1SKOA 3U2AA 5EUAA 3VOLA 5L07A 4KZ6A 3NOPC 1TS6A 5TBMB 4OPYA 3P98A 2RCXA 2HGVA 4RA7A 3HLEA 5DF9A 3VP2A 3GR2A 2WGVA 1BULA 2JCHA 4X1LA 2Y91A 5FDHA 2V2FF 3MZEA 4K0WA 4S2MA 4CJNA 3BQ8A 3HBRA 3C7UA 1K6RA 2Y2JA 4X55A 5F82A 4Y2FA 5DVAA 1E3UA 2Y2NA 2XH9A 4WYYA 4DE1A 3LIBA 4KZ4A 1Q2QA 3E98A 4BJPA 1NWZA 5L2FA 2VV8A 2XA7S 4IBXA 3S22A 3T1RA 2R9XA 4HIAA 5HWWA 1ALQA 3CHWP 1DP9A 1ES2A 4HQAA 5AQBA 3Q7ZA 4L9GA 5GHZA 1PI5A 3F1OA 2OOLA 4UA7A 2GDNA 1IYSA 2W1TB 1S67L 1BLPA 3HJIA 1G68A 4X6TA 1RP5A 5GLBA 1DJBA 1XJ2A 5FI2A 1L0EA 3CLOA 2EX8A 3IQAA 1BLHA 4JBFA 1NRFA 4DN0A 5F83A 3P7NA 3IHAA 2R9WA 2WKPA 3VV4A 3S4XA 1C3BA 1YLJA 3BY9A 1YM1A 3HJKA 3DWKA 3Q82A 4FH2A 5KMWA 2D02A 4ZAMA 4Z1WA 4K91A 2PBDP 4P0MA 3HVFA 1W7FA 4N9LA 4OQIA 3EGXC 2D01A 4KG5A 4ZJ1A 4O7DA 3IWOA 3UB6A 2Q9NA 3MXQA 2PD8A 4DE2A 1OTEA 3A3IA 4K0XA 4P6ZM 4F94A 3ZVWA 5AQ9A 4C6YA 2J3TC 4ZDXA 3ZG5A 4EBLA 1ES3A 5TR7A 4I39A 4BBUA 4WZ5C 4WF0A 3Q7VB 3V67A 2XLNA 4ME4A 3GV9A 2ZQDA 2EFUA 4QWOA 3LR5A 5HDCA 1LHYA 4DXBA 2OLVA 3W4PA 3HUNA 2W3EA 2G7UA 1PRQA 3VMAA 3FPVA 2Y2MA 4R3JA 4NXEA 4Y5FA 3FKVA 3FV7A 4PPRA 3K3CA 4F3LA 4L9FA 1NYYA 3FZCA 2HDUA 4BWIA 3D3OA 4YNRA 4YINA 2Z6CA 3T4TA 2RL3A 3RXWA 4LV2A 3UB7A 3ZG0A 1MKIA 4WZ5A 3B42A 3CUEC 1JWVA 2HV1A 4HY8A 3IF6B 3JYIA 2W3DA 3IT9A 4EV4A 5CHUA 3NULA 2QJ7A 5FL3A 3ZG8B 2KOIA 3HREA 3DTEA 4QHCA 5C5KA 2Y2QA 1GA0A 5CXWA 2HF6A 4Y17A 3K3DA 4ESPA 4WUJA 2LB5A 1MZUA 3A3DA 3CWFA 4GN2A 3CUEA 1NLYA
chains in the Genus database with same CATH topology
5J4EA 4IHQA 4YWZA 4NEED 4EEPA 4NKPA 2J3TD 4MMNA 2O99A 1DP6A 3PBSA 2B02A 1YKDA 2PR6A 2Z6DA 5DKKA 2VLGA 3T4KA 2V9AA 4Y3IA 2XROA 2XSSA 2V0UA 3S7QA 3MF0A 5EFWA 3FC7A 4CLCD 2L4RA 3PHYA 3A0SA 1OPXA 3TE8A 4Q0IA 4GHIB 3PBRA 5HL6A 1G6OA 1UGUA 4E04A 1KOUA 2PYRA 3FPWA 1OTDA 1T18A 4H6JB 3PBQA 3TJZC 3OCLA 4F3LB 3LFVA 2K31A 4CLCC 1LSWA 4EEUA 4GS9A 2NUTC 5J7EA 1XFQA 3S7PA 4HJ4A 3OCNA 4IUKA 5TJJA 4ARZB 1TS0A 4NXBA 4WELA 2QYBA 4GJ4A 1T1BA 4LRXC 2ZBBA 1IOUA 2JN7A 3EQUA 4EESA 4WLAA 3UE6A 3CITA 4JGOA 1ODVA 5AVFA 4UEYA 4R6LA 3FG8A 2I9VA 5IU1A 1N9NA 4HOIA 2IA2A 3GDIA 1LT0A 3F1NB 5IT5A 3MR0A 1YSPA 2H28A 4QPRA 2WKRA 2JKTI 2O0YA 4WEJA 2OAQ1 2NUPC 3VE4A 4IJGA 5F6AA 2WKQA 4CLCA 3BJNA 3H82B 3C8CA 1S4RA 2JKRM 2VKSA 3E0YA 3PXPA 4LRYC 2YKFA 3GECA 1OTAA 3IS2B 4DJ3A 1TD5A 2V1BA 4O8GA 2P08A 1D7EA 3BY8A 2KLIA 3E4OA 3A0RA 3UMEA 1D06A 1XJ3A 3LIDA 4L0LA 1LL8A 3IBRA 2M1CA 4HP4A 5AJGA 4GLQA 4B9OA 3BWLA 1T1CA 1YSQA 3G6OA 3EEAA 1JNUA 3ZYTA 4B93A 4I5SA 2QHKA 2XA7M 3TRCA 3UB9A 2ZOHA 3ZQ5A 1T1AA 3F1PA 2VX8A 2GJ3A 3PYPA 3OLOA 2BASA 5KIZA 3NOUC 4CLCE 5I5LA 3T4JA 2L0WA 2VZWA 3KSGA 4R3AA 2JHEA 2M7VA 3KSIA 1NRJA 4OOLA 1P9RA 2V1AA 3H7WA 1S66L 4XT2A 4DMZA 3VE3A 4PAUA 4EQ1A 3JVVA 2W3FA 2ZMVA 3KSFA 4GS9B 5DJTA 4HNBA 4JGQA 5KSHA 3LI8A 1VHMA 3U2AA 4PKYG 4I38A 1EW0A 4GCZA 5HZHA 3KX0X 3VOLA 5LBRA 4L9EA 4R38A 5HWVA 1DRMA 3NOPC 3SW1A 5A8BA 2VJWA 1S1ZA 1TS6A 5TBMB 2A24A 2PHYA 4KQOA 1YAXA 5F68A 3C38A 2HGVA 5DF9A 2FH5A 2PT7A 4MN6A 2O9CA 3O5YA 3MJQA 1OT9A 4Q0HA 2J80A 1Y28A 3T4SA 4ETXA 1OT6A 3BQ8A 5DKLA 2HJEA 4RQ9A 1TF1A 3PBOA 1IFQA 5IS1A 2HJ9C 3MMHA 4UQIS 4Y2FA 2W0NA 4MCWA 2OWHA 5HD5A 2EWVA 2W27A 4EETB 4EUVA 2JKRI 3LIBA 4EW7A 2J3WA 4HH3A 1MKMA 3E98A 4CLCB 4BJPA 3CI6A 1NWZA 3LR0A 2VV8A 2XA7S 2INWA 4HIAA 3E4PA 3UE3A 2PDRA 3T4QA 4H6JA 5HWWA 3LYXA 4I3JA 4WEKA 3UMDA 5HSQA 1DP9A 3DBAA 4MDZA 3LICA 4HQAA 5DFXA 5F5YA 2VEAA 5K5BA 4L9GA 1V9ZA 4O01A 1H8MA 5HWTA 3MQOA 3F1OA 4K08A 1V9YA 2OOLA 1OTBA 3HCYA 3D72A 4KUOA 1TS8A 2W1TB 4HI4A 1S67L 2GNXA 3MQ0A 4ARZA 3HJIA 3EWKA 3T50A 2A2LA 3BQAA 4EU0A 1S1YA 3OOVA 2PYPA 4WL9A 2W3HA 2V0WA 5G4YA 1XJ2A 4BBVA 4PKYA 2W1RA 3CLOA 3H9WA 2L1MA 2ZMFA 3RFBA 3EGDC 3W2ZA 4FSFA 1X0OA 4UQIM 2PR5A 4DN0A 5AVEA 1WA9A 1OTIA 2KX6A 1XJ6A 3IBJA 4HJ6A 3P7NA 3RH8B 5J3WA 2M7UA 4HP9A 3F1NA 2P7JA 4BMWA 2WKPA 3VV4A 2O9BA 3LIAA 4MN5A 2YKHA 5HPIA 1DP8A 5CX7A 3BY9A 1ZTUA 3H7WB 4XT2B 4BBTA 3EQVA 1P9WA 3HJKA 1H3QA 3MFXA 2VGLS 2DMWA 1N9LA 3H82A 1VB6A 3ICYA 4KQDA 3KSHA 3PR6A 1N9OA 1S4SA 2D02A 3LIEA 4Z1WA 3JVUA 4OOMA 2MJ6A 4YOFA 1P97A 1GSXA 2PD7A 3EGXC 3KYQA 2D01A 1LSXA 4KUKA 5DFYA 5G4ZA 3R7WA 3LIFA 3RTYA 3ULFA 1BYWA 4DJ2A 3NHQA 3UB6A 3K2NA 3MXQA 2PD8A 1GSWA 2VV6A 3LR3A 1UWPX 1OTEA 4R70A 4LRZE 4EERA 1NLZA 3BW6A 4P6ZM 1OJ5A 4Q0JA 3C2WA 3OC2A 2J3TC 3NJAA 5L8MA 1TS7A 1XJ4A 3A0VA 4M4XA 2XRNA 4EXOA 4PHTA 3T4OA 1G28A 4I39A 4BBUA 2VGLM 4ZRRA 3LR4A 4WF0A 2GZAA 4NXFA 2VV7A 5F69A 3V67A 4ME4A 3EEHA 4I3AA 4II7A 2Y79A 4HJ3A 4HH2A 1GSVA 3LR5A 5HDCA 5HDSA 3F1OB 2W3EA 2G7UA 4I3IA 1ZHHB 3S7OA 3KYZA 3P01A 3FPVA 3CAXA 5HPFA 4GHIA 3NOTC 2P04A 2EWWA 4NXEA 2B18A 4Y5FA 5DJUA 5TBMA 3OBFA 3K3CA 1W63M 4F3LA 4JGRA 4L9FA 1MC0A 1OJGA 4BWIA 3D3OA 4YNRA 3B47A 2QJ5A 3PBNA 2Z6CA 4FOFA 4CQHA 2Y8HA 2QKPA 3T4TA 4ETZA 1F5MA 3UB7A 3B42A 4G3WA 3CUEC 2HV1A 4HY8A 3UB8A 4IUHA 2LB9A 3E4QA 2KDKA 3F1PB 3LI9A 1P0ZA 4JGPA 3S7NA 4HHDA 3T4LA 3EOIA 2W3DA 4P6ZS 2QWSA 4GW9A 3LUQA 2QJ7A 5FL3A 2FZ0A 3PBTA 4AFIA 2GX5A 2ZOIA 2EA9A 2KOIA 2VA0A 2OWJA 2W3GA 4G3VA 4LPZA 3TW8A 2K7SA 3R7WB 1LSVA 2W1TA 2CMNA 5C5KA 2JKTM 3C30A 5MC7A 3R4KA 2OAP1 3KO6A 4O0PA 4G3KA 1F9IA 1F98A 2R78A 5HDDA 1UWNX 3IS2A 4NXGA 1W63Q 3B33A 4WN5A 2HF6A 4MN7A 3K3DA 2K2NA 4WUJA 1T19A 2LB5A 1MZUA 1STZA 1XFNA 3MQQA 4LLOB 3CWFA 2A24B 3CUEA 1NLYA 5HD3A 2O9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J4E A;  4YWZ A;  4EEP A;  1DP6 A;  2B02 A;  2PR6 A;  2Z6D A;  5DKK A;  2VLG A;  2V9A A;  2V0U A;  5EFW A;  3FC7 A;  2L4R A;  3PHY A;  3A0S A;  4GHI B;  1UGU A;  4E04 A;  1KOU A;  2PYR A;  1OTD A;  1T18 A;  4H6J B;  4F3L B;  1LSW A;  4EEU A;  4GS9 A;  5J7E A;  1XFQ A;  4HJ4 A;  1TS0 A;  4NXB A;  1T1B A;  4LRX C;  2ZBB A;  2JN7 A;  4EES A;  4WLA A;  3UE6 A;  4JGO A;  1ODV A;  5AVF A;  4R6L A;  3FG8 A;  2I9V A;  5IU1 A;  1N9N A;  4HOI A;  3GDI A;  1LT0 A;  3F1N B;  3MR0 A;  2H28 A;  2WKR A;  3VE4 A;  5F6A A;  2WKQ A;  3H82 B;  3C8C A;  1S4R A;  4LRY C;  2YKF A;  3GEC A;  1OTA A;  3IS2 B;  4DJ3 A;  2V1B A;  1D7E A;  3BY8 A;  3E4O A;  3A0R A;  3UME A;  1D06 A;  1XJ3 A;  3LID A;  1LL8 A;  3IBR A;  2M1C A;  4HP4 A;  4B9O A;  3BWL A;  1T1C A;  3G6O A;  1JNU A;  4I5S A;  2QHK A;  3UB9 A;  2ZOH A;  3ZQ5 A;  1T1A A;  3F1P A;  2GJ3 A;  3PYP A;  3OLO A;  2BAS A;  5KIZ A;  3NOU C;  5I5L A;  2L0W A;  4R3A A;  2JHE A;  2V1A A;  4XT2 A;  3H7W A;  1S66 L;  3VE3 A;  4EQ1 A;  4GS9 B;  5DJT A;  4HNB A;  4JGQ A;  3LI8 A;  4PKY G;  4I38 A;  1EW0 A;  4GCZ A;  5HZH A;  3KX0 X;  3VOL A;  4L9E A;  4R38 A;  5HWV A;  1DRM A;  3NOP C;  3SW1 A;  5A8B A;  1S1Z A;  1TS6 A;  5TBM B;  2A24 A;  2PHY A;  5F68 A;  4MN6 A;  3MJQ A;  1OT9 A;  2J80 A;  1Y28 A;  1OT6 A;  5DKL A;  4RQ9 A;  5IS1 A;  2W0N A;  5HD5 A;  2OWH A;  2W27 A;  4EET B;  3LIB A;  4EW7 A;  4HH3 A;  1NWZ A;  2VV8 A;  4HIA A;  2INW A;  3E4P A;  2PDR A;  4H6J A;  5HWW A;  3LYX A;  4I3J A;  3UMD A;  5HSQ A;  1DP9 A;  3LIC A;  4HQA A;  5F5Y A;  2VEA A;  4L9G A;  1V9Z A;  5HWT A;  3MQO A;  3F1O A;  4K08 A;  1V9Y A;  2OOL A;  1OTB A;  3D72 A;  4KUO A;  1TS8 A;  4HI4 A;  1S67 L;  3HJI A;  3EWK A;  3T50 A;  1S1Y A;  2PYP A;  4WL9 A;  2V0W A;  5G4Y A;  1XJ2 A;  4BBV A;  4PKY A;  3CLO A;  3H9W A;  2L1M A;  1X0O A;  2PR5 A;  5AVE A;  1WA9 A;  1OTI A;  2KX6 A;  1XJ6 A;  4HJ6 A;  3P7N A;  3RH8 B;  5J3W A;  4HP9 A;  3F1N A;  2P7J A;  2WKP A;  3LIA A;  4MN5 A;  2YKH A;  1DP8 A;  3BY9 A;  3H7W B;  4XT2 B;  4BBT A;  3HJK A;  3MFX A;  1N9L A;  3H82 A;  1VB6 A;  3ICY A;  4KQD A;  1N9O A;  1S4S A;  2D02 A;  3LIE A;  1P97 A;  1GSX A;  2PD7 A;  2D01 A;  1LSX A;  4KUK A;  5G4Z A;  3LIF A;  3RTY A;  3ULF A;  1BYW A;  4DJ2 A;  3NHQ A;  3UB6 A;  3MXQ A;  2PD8 A;  1GSW A;  2VV6 A;  1UWP X;  1OTE A;  4R70 A;  4LRZ E;  4EER A;  1OJ5 A;  3C2W A;  3NJA A;  1TS7 A;  1XJ4 A;  3A0V A;  4M4X A;  4EXO A;  1G28 A;  4I39 A;  4BBU A;  4WF0 A;  4NXF A;  2VV7 A;  5F69 A;  3EEH A;  4I3A A;  4HJ3 A;  4HH2 A;  1GSV A;  5HDC A;  5HDS A;  3F1O B;  4I3I A;  3CAX A;  4GHI A;  3NOT C;  4NXE A;  5DJU A;  5TBM A;  3K3C A;  4F3L A;  4JGR A;  4L9F A;  1OJG A;  2QJ5 A;  2Z6C A;  2QKP A;  3UB7 A;  2HV1 A;  4HY8 A;  3UB8 A;  3E4Q A;  2KDK A;  3F1P B;  3LI9 A;  1P0Z A;  4JGP A;  4HHD A;  2QWS A;  4GW9 A;  3LUQ A;  2QJ7 A;  2ZOI A;  2EA9 A;  2OWJ A;  4LPZ A;  2K7S A;  1LSV A;  2CMN A;  1F9I A;  1F98 A;  2R78 A;  5HDD A;  1UWN X;  3IS2 A;  4NXG A;  4WN5 A;  3B33 A;  3K3D A;  4WUJ A;  1T19 A;  1MZU A;  3MQQ A;  1XFN A;  4LLO B;  2A24 B;  3CWF A;  5HD3 A; 
#chains in the Genus database with same CATH topology
 3SH8 A;  5J4E A;  1ZKJ A;  4IHQ A;  1ACF A;  4NKP A;  1FIL A;  4QJG A;  3CPT B;  3WS2 A;  3DWZ A;  5EVE A;  1YKD A;  3N8R A;  5DKK A;  2VLG A;  3T4K A;  1RCJ A;  4DDY A;  1PWC A;  4BEN A;  5HAP A;  2P9V A;  3S7Q A;  3ZCZ A;  4YFM A;  1K57 C;  3BFD A;  3N4I A;  4X69 A;  4JXG A;  4CLC D;  3WS4 A;  3UPO A;  1L2S A;  1Z09 A;  4GHI B;  4WZ4 A;  5FQJ A;  1KGF A;  2CC1 A;  2AVX A;  2ACG A;  2PYR A;  1T18 A;  1JWZ A;  3PBQ A;  5GLC A;  3L9K A;  2K31 A;  4CLC C;  1DJC A;  4GS9 A;  3BYD A;  1QME A;  1TS0 A;  5EV0 A;  3UDI A;  1HLU P;  4GJ4 A;  3L7H A;  2ZQ7 A;  5FQK A;  4D60 A;  4FH4 A;  4JGO A;  5AVF A;  2EX9 A;  4KQQ A;  1K57 A;  2I9V A;  3M6B A;  3GSG A;  2WGW A;  5IU1 A;  3M6H A;  1YQS A;  4X25 A;  5FI6 A;  1NJ4 A;  3GDI A;  3MR0 A;  1D1J A;  1YSP A;  1JVJ A;  2WKR A;  4WEJ A;  5DTS A;  4IJG A;  4CLC A;  3H82 B;  3LEQ A;  3I7J A;  1S4R A;  4Y0O A;  3LY4 A;  3E0Y A;  4GKU A;  5EEC A;  3PXP A;  4P6B A;  1WE4 A;  3WWX A;  4DJ3 A;  1TD5 A;  2Q0O A;  2V1B A;  1S6R A;  4O8G A;  2P08 A;  4ID4 A;  1K25 A;  3DW0 A;  3A0R A;  1DJA A;  4L0L A;  3HLF A;  4OQ0 A;  4HP4 A;  3ITA A;  4GLQ A;  4B9O A;  3G6O A;  5F1G A;  1JNU A;  2HDS A;  3ZYT A;  4XUX A;  3Q07 A;  4I5S A;  2E8I A;  2XA7 M;  3TRC A;  4DKI A;  4BLM A;  1T1A A;  3F1P A;  2VX8 A;  2GJ3 A;  3VOZ A;  1K56 A;  4OOY A;  4OLG A;  1KVL A;  3NOU C;  4KEN B;  3HLW A;  4ZJ3 A;  1VET A;  1NZU A;  3KSG A;  3LY3 A;  2JC7 A;  3HLB A;  2ZM0 A;  4DF6 A;  1P9R A;  3H7W A;  1WYB A;  5FAO A;  2WZZ A;  3SOI A;  2HDR A;  3SZT A;  2W3F A;  3UPN A;  2XGN A;  4PKY G;  5EE8 A;  3PTE A;  3Q1F A;  4MEZ A;  4GCZ A;  2ZJ9 A;  4S2O A;  5FDS A;  1DRM A;  3SW1 A;  1KVM A;  5A8B A;  3V3S A;  2A24 A;  3DTI A;  1ES5 A;  3C38 A;  4MN6 A;  2DCF A;  3UPP A;  3V50 A;  5HAQ A;  3O5Y A;  1K0K A;  2WZX A;  2J80 A;  2OV5 A;  4C75 A;  5CRF A;  1KE3 A;  4X56 A;  2A49 A;  4JXV A;  3E2L A;  5DKL A;  4QU3 A;  3BFF A;  3NC8 A;  3TOI A;  3PBO A;  4WMC D;  5IS1 A;  1Y54 A;  3MMH A;  4UQI S;  2V1Z A;  2OWH A;  5HD5 A;  2W27 A;  4EET B;  4LGW A;  4EW7 A;  2J3W A;  1YLW A;  5KSC A;  2H10 A;  4NG2 A;  3LR0 A;  3VFH A;  2H0T A;  3E4P A;  3UE3 A;  1J9M A;  2ZC7 A;  2Y59 A;  4GDB A;  3UMD A;  3LIC A;  3QP5 A;  4KZ5 A;  5DFX A;  2VEA A;  4O01 A;  3G34 A;  1H8M A;  2V20 A;  1BUE A;  1YLZ A;  3VP1 A;  3BLS A;  4KUO A;  4HI4 A;  2DRW A;  3MQ0 A;  4ZBE A;  1W8Q A;  2A2L A;  1S1Y A;  1FSW A;  3QP1 A;  5G4Y A;  4R3B A;  4BBV A;  2Q9M A;  2L1M A;  2ZMF A;  2Z2M B;  3ZVT A;  4FSF A;  1X0O A;  4E3O A;  5G18 A;  1IEL A;  1WA9 A;  3OPL A;  4HJ6 A;  1XJ6 A;  2E8J A;  3IBJ A;  4GDN A;  3O87 A;  1M6K A;  1IKI A;  3F1N A;  4BMW A;  4LV3 A;  4MN5 A;  1K4E A;  2ZQC A;  4XT2 B;  1H5X A;  4BBT A;  3EQV A;  1P9W A;  3MFX A;  2VGL S;  1VB6 A;  3ICY A;  4MLL A;  3KSH A;  3PR6 A;  1N9O A;  1SKO B;  1MWR A;  1LSX A;  4KUK A;  5DFY A;  3R7W A;  4OVD A;  2ZD8 A;  3U4L P;  3NHQ A;  3K2N A;  1I2W A;  1FIK A;  4R70 A;  1EI5 A;  1K4F A;  4LRZ E;  4EER A;  1NLZ A;  4OKP A;  3BW6 A;  1OJ5 A;  4HBU A;  4Q0J A;  1CEG A;  5DTK A;  5HFO A;  3MS6 A;  1LI9 A;  3T4O A;  3FWL A;  5F69 A;  3SS3 A;  3EEH A;  1QMF A;  1BLC A;  2H5S A;  1BLS A;  3IXG A;  4H8R A;  1M40 A;  3F1O B;  3A3E A;  3G32 A;  2I72 A;  1A0K A;  3CAX A;  3ITB A;  2ZLY A;  2EWW A;  2B18 A;  4GD6 A;  5FAT A;  1L0G A;  5TBM A;  3OBF A;  1W63 M;  1BZA A;  1PWG A;  2Y55 A;  3GQZ A;  1G6A A;  4ZTK A;  4FOF A;  1FCN A;  1ES4 A;  4JF6 A;  4ETZ A;  4GD8 A;  1FOF A;  1E4D A;  4B4Z A;  2LB9 A;  2KDK A;  4U0X A;  3ZNY A;  2FFY A;  4JGP A;  1IYO A;  3QHY A;  4HHD A;  3T4L A;  1YMX A;  2XQZ A;  4GW9 A;  3LUQ A;  5CGS A;  3PBT A;  5FAS A;  2GX5 A;  2HDQ A;  3NI9 A;  2OWJ A;  4G3V A;  5A93 A;  3TW8 A;  2K7S A;  2CMN A;  2W1T A;  5MC7 A;  2JKT M;  4N1H A;  1GA9 A;  3KO6 A;  4G3K A;  4DXC A;  4R23 A;  1F98 A;  2R78 A;  4WN5 A;  5CTN A;  1W63 Q;  1MWS A;  2UWX A;  1BT5 A;  3IX3 A;  2Y2G A;  3FKW A;  2XF3 A;  3V3R A;  2K2N A;  1T19 A;  3MQQ A;  3PAG A;  4P85 A;  5HX9 A;  1KE4 A;  3VP3 A;  4NEE D;  1Y4O A;  3A3J A;  5GHX A;  2J3T D;  3G2Y A;  4M3K A;  4DE0 A;  3C4O A;  1L3L A;  2WKI A;  2BG1 A;  1EWZ A;  3MXS A;  2WGI A;  3IHB A;  4JKT A;  2JBF A;  2FFF B;  1Q2P A;  1ERQ A;  2XSS A;  4X53 A;  3MZD A;  1OPX A;  4KZ8 A;  2ZC4 B;  5A91 A;  3DAV A;  2G2U A;  2PBY A;  4E04 A;  5EM1 A;  1FCM A;  1OTD A;  4H6J B;  3CMZ A;  3TJZ C;  3P09 A;  5GLA A;  4F3L B;  1LSW A;  4EEU A;  1XFQ A;  2WUQ A;  4HJ4 A;  3OCN A;  4IUK A;  5TJJ A;  4ARZ B;  4GOG A;  3T1X A;  4WEL A;  2QYB A;  1T1B A;  2ZBB A;  1E25 A;  4EUZ A;  3D9Y A;  2HP9 A;  1VQQ A;  3VP4 A;  4KZA A;  1LL9 A;  5FEF A;  3VOY A;  4S2N C;  5D3O A;  1BTL A;  3FG8 A;  2Y4A A;  3Q7V A;  1YPR A;  3UE1 A;  4HOI A;  4JF4 A;  1W5D A;  2IA2 A;  3IF6 C;  4Y0T A;  4FCF A;  2IWB A;  4QPR A;  2JKT I;  4WBG A;  1JWP A;  1SKF A;  4OQH A;  2V8C A;  3ZHH A;  2J9O A;  4N92 A;  4OON A;  2JKR M;  1BSG A;  5L10 A;  4S2P A;  3NIA A;  2YKF A;  4EBN A;  3RXX A;  1TVF A;  3BY8 A;  2WKE A;  2KLI A;  3E4O A;  3O3V A;  1RGZ A;  1LL8 A;  3IBR A;  2M1C A;  3VP0 A;  1VM1 A;  3BLM A;  1YSQ A;  3EEA A;  4S2N A;  2QHK A;  2EX6 A;  4BQM A;  4C3Q A;  3TSG A;  3UB9 A;  2ZOH A;  3IF6 A;  5FQM A;  1PWD A;  3OLO A;  2P9V B;  3VSL A;  5I5L A;  5A90 A;  1G5U A;  1MBL A;  2VGJ A;  2JKG A;  4JXS A;  2ZQ8 A;  3G35 A;  2V1A A;  3VE3 A;  1O7E A;  5AQA A;  2ZQ9 A;  5IHV A;  4GS9 B;  3W4O A;  3LI8 A;  4MBF A;  3C7V A;  3E2K A;  4U0T A;  5LBR A;  5HWV A;  2V8F A;  3NCK A;  2VJW A;  4IVI A;  2PHY A;  4KQO A;  1YAX A;  4MBH A;  2PT7 A;  2O9C A;  1O07 A;  3CPT A;  3MJQ A;  1ERM A;  3OPP A;  1Y28 A;  3T4S A;  2Y2I A;  4ETX A;  3AGE A;  4KZB A;  3V5M A;  3LO7 A;  3G4P A;  1TF1 A;  2QZ6 A;  1IFQ A;  2HJ9 C;  4MCW A;  2EWV A;  4R4S A;  2PU2 A;  3SH7 A;  3UDF A;  4KG2 A;  1L0D A;  2JKR I;  1MWU A;  4RVA A;  1K56 D;  3PAE A;  3G2Z A;  3HL9 A;  1MKM A;  4GB7 A;  1W79 A;  4CLC B;  1PFL A;  3FYZ A;  4BD1 A;  2INW A;  5FQI A;  3TG9 A;  2B5R A;  3UB5 P;  3LYX A;  4I3J A;  4WEK A;  3DBA A;  3V39 A;  5K5B A;  1V9Z A;  5HWT A;  1OTB A;  3D72 A;  1JTG A;  4S2J A;  3EWK A;  1XPB A;  2HP6 A;  3T50 A;  1NY0 A;  3BQA A;  1JTD A;  3OOV A;  2V0W A;  4QD4 A;  5E2E A;  1SCW A;  1I5Q A;  3OPR A;  5E2G A;  3G30 A;  3IXD A;  5AVE A;  5M1A A;  3RH8 B;  1VET B;  5J3W A;  2M7U A;  2P7J A;  3BEB A;  3LIA A;  2HPB A;  2YKH A;  3A3F A;  1DP8 A;  5HPI A;  5CX7 A;  2EFX A;  1ZTU A;  3H7W B;  4IVK A;  5EVI D;  1H3Q A;  3SH9 A;  5E2F A;  3H82 A;  4RX2 A;  4R4R A;  4KQD A;  1S4S A;  2X02 A;  1VEU B;  4WM9 A;  4OOM A;  3WS5 A;  4YOF A;  1GSX A;  3MZF A;  3KYQ A;  5EVI C;  3OZH A;  4D2O A;  2X01 A;  1K38 A;  5G4Z A;  3W4Q A;  3LIF A;  5KZH A;  3ULF A;  3ZG7 B;  3IWI A;  2Z2L B;  1BYW A;  5GHY A;  5HW3 A;  3AGD A;  1GSW A;  2VK3 A;  3LR3 A;  3MXR A;  1MPL A;  1GCE A;  1IEM A;  2C5W B;  3ZGA B;  2ZM8 A;  3OC2 A;  5L8M A;  1CK3 A;  1TS7 A;  1XJ4 A;  4EXO A;  4M4X A;  2XRN A;  4OPR A;  5TGF A;  1G28 A;  1S0W A;  3NDG A;  3Q81 A;  3LR4 A;  3IX4 A;  4ZJ2 A;  1CI9 A;  4I3A A;  4II7 A;  1TDG A;  4HJ3 A;  5EVI A;  1HVB A;  3QP2 A;  2G2W A;  4CPK A;  1K6S A;  3CJM A;  1ZHH B;  3S7O A;  3KYZ A;  3P01 A;  5HPF A;  3NOT C;  4PM5 A;  4Y13 A;  5JYO A;  1GHI A;  3C5A A;  3VFF A;  1ESU A;  3ZNT A;  4JGR A;  5E43 A;  1MC0 A;  4Q8I A;  4NET A;  1OJG A;  2JKF A;  3SS5 A;  2H0Y A;  2HP5 A;  3B47 A;  4CQH A;  2Y8H A;  2QKP A;  4N9K A;  1PI4 A;  4XXR A;  4JXW A;  1PZP A;  1F5M A;  2Y2K A;  4G3W A;  3MBZ A;  3UB8 A;  4IUH A;  3IF5 A;  3E4Q A;  1P0Z A;  4HBT A;  4RYE A;  3S7N A;  5CHM A;  5GLD A;  2J7V A;  2QMI A;  3EOI A;  1ZC2 A;  4OH0 A;  2ZL1 B;  4R1G A;  5JYP A;  5EM0 A;  2QWS A;  1IYP A;  1KGE A;  4S2K A;  5BOH A;  4AFI A;  4QY5 A;  3WRZ A;  2EA9 A;  2W3G A;  4LPZ A;  3R7W B;  3SS4 A;  3C30 A;  1KDW A;  3T1Q B;  2Y2P A;  1AXB A;  3M2J A;  4O0P A;  1F9I A;  5HDD A;  3IS2 A;  1U60 A;  1HZO A;  4MN7 A;  3IH8 A;  1KE0 A;  4LLO B;  3BFG A;  4HES A;  4FUW A;  3ISG A;  2Y2O A;  3W8K A;  4YWZ A;  4EEP A;  4E3L A;  4MMN A;  2O99 A;  5EOE A;  3O86 A;  2B02 A;  3QP8 A;  5FI7 A;  2PR6 A;  2V9A A;  2ZC6 B;  4KZ9 A;  5L09 A;  3JPU A;  1CI8 A;  2V0U A;  4JPM A;  1AWI A;  5FAP A;  5DF8 A;  4QY6 A;  3N8S A;  1KGG A;  5EPH A;  3GMW A;  3S1Y A;  2L4R A;  3A0S A;  4Z9Q A;  3PBR A;  1G6O A;  4DRT A;  4S2I A;  5HAI A;  3FPW A;  1F2K A;  3OCL A;  2IWD A;  3HUM A;  4EQI A;  3LFV A;  4BL2 A;  3CG5 A;  4LCM A;  4LV0 A;  3B3X A;  3S7P A;  4RX3 A;  2WK0 A;  4FD8 A;  5U47 A;  4OP8 A;  4WLA A;  3UE6 A;  3CIT A;  5HAR A;  2XFS A;  1ERO A;  1ODV A;  4UEY A;  4R6L A;  4P87 A;  1CEF A;  3N7W A;  3DTK A;  1N9N A;  1ONG A;  2BLS A;  1LT0 A;  3GTC A;  4S2L A;  2O0Y A;  1XGI A;  2OAQ 1;  2NUP C;  2Y2L A;  2ZM2 A;  5F6A A;  1WYC A;  2WKQ A;  3BJN A;  1FCO A;  3C8C A;  3AGF A;  4LRY C;  3GEC A;  1XGJ A;  2A3U A;  2VGK A;  3NEC A;  3MKF A;  2PAV P;  1FR6 A;  3MKE A;  1NZO A;  2WKH A;  1D06 A;  1XJ3 A;  3LID A;  4U3T A;  3IH9 A;  3M2K A;  5AJG A;  3BWL A;  1FQG A;  1PNE A;  4BL3 A;  4B93 A;  4X1M A;  4LV1 A;  4Y0U A;  1ZG6 A;  3LEZ A;  4PM6 A;  2BAS A;  1MY8 A;  3UY6 A;  4Y15 A;  4CLC E;  3T4J A;  2L0W A;  1YT4 A;  3LGO A;  1K54 C;  2VZW A;  2JHE A;  1CJF A;  2M7V A;  1NRJ A;  4OOL A;  5DF7 A;  4DMZ A;  3BM6 A;  4B88 A;  4PAU A;  3JVV A;  4MBK A;  4BD0 A;  2ZMV A;  3KSF A;  5KSH A;  4I38 A;  1EW0 A;  3UE0 A;  5DTT A;  1XXM A;  5HZH A;  3KX0 X;  2HZ5 A;  3NBL A;  4PMA A;  4L9E A;  5FA7 A;  1N9B A;  4R38 A;  1S1Z A;  5F68 A;  5CER A;  2XFT A;  2FH5 A;  4E3M A;  3UO9 A;  1YLY A;  5CEB A;  5FQQ A;  1OT9 A;  4Q0H A;  1PIO A;  1XA7 A;  4GZB A;  4KQR A;  3HLG A;  1K54 A;  1OT6 A;  2HJE A;  2ZC3 B;  1J3W A;  3D4F A;  4RQ9 A;  3BEC A;  5CGW A;  4PM8 A;  3WS0 A;  1PZO A;  2W0N A;  5EVL A;  3IXB A;  5M18 A;  1LL5 A;  1W8Y A;  4EUV A;  5CEC A;  3T1S A;  4OLD A;  4HH3 A;  2XR0 A;  3NY4 A;  1HD8 A;  3VSK A;  3CI6 A;  1SHV A;  1SDE A;  2X71 A;  1PW1 A;  2PDR A;  3T4Q A;  4H6J A;  5HSQ A;  3ZDJ A;  4MDZ A;  5F5Y A;  5FEG A;  4FTX A;  3MQO A;  4K08 A;  1V9Y A;  3HCY A;  1TS8 A;  2GNX A;  4ARZ A;  4E3K A;  5AQ7 A;  1NYM A;  4EU0 A;  3WRT A;  2PYP A;  4WL9 A;  2W3H A;  4PKY A;  2W1R A;  3H9W A;  2J9P A;  2BTF P;  3RFB A;  2XDM A;  3EGD C;  3W2Z A;  4UQI M;  2PR5 A;  2PRF A;  1OTI A;  2KX6 A;  2XEP A;  1FSY A;  1GHP A;  1HTZ A;  4HP9 A;  2XD5 A;  4KG6 A;  4MNR A;  2O9B A;  4XUZ A;  1SZV A;  2DMW A;  1N9L A;  2PU4 A;  4LEN A;  1I2S A;  3LIE A;  1YLP A;  3HLD A;  3JVU A;  2MJ6 A;  1P97 A;  4PM9 A;  2PD7 A;  3RTY A;  1MWT A;  4DJ2 A;  1CF0 A;  4A5R A;  2VV6 A;  5CED A;  1UWP X;  3QP6 A;  4R0Q A;  3ZG9 B;  3C2W A;  3NJA A;  1PW8 A;  4KZ7 A;  3A0V A;  4E3J A;  4PHT A;  4Y7P A;  1TEM A;  2VGL M;  1TDL A;  4ZRR A;  2GZA A;  2JE5 A;  4NXF A;  2VV7 A;  2WGW B;  2Y79 A;  4HH2 A;  1GSV A;  2UV0 E;  5GL9 A;  5HDS A;  3BFC A;  2EXA A;  4I3I A;  1L0F A;  4GHI A;  2EX2 A;  2P04 A;  3KYE A;  5DJU A;  5I94 A;  2C6W B;  1FR1 A;  1GHM A;  4DDS A;  3QNC A;  2OLU A;  2QJ5 A;  3PBN A;  3HUO A;  3IXH A;  2ZC5 B;  4B4X A;  3ZFZ A;  4OPZ A;  3C4P A;  4QB8 A;  2XD1 A;  3F1P B;  3LI9 A;  4UA6 A;  2XK1 A;  1ESI A;  4JF5 A;  4X68 A;  1H8Z A;  3QP4 A;  1OME A;  4P6Z S;  3RJU A;  3LCE A;  3IWQ A;  2FZ0 A;  5M19 A;  2ZOI A;  2VA0 A;  2EXB A;  1LSV A;  1IYQ A;  1DY6 A;  3R4K A;  2OAP 1;  2ZMA A;  1UWN X;  4NXG A;  5TFQ A;  3B33 A;  4N1X A;  3HLC A;  1STZ A;  1XFN A;  4NK3 A;  2A24 B;  5HD3 A;  2O9A A;  1RGY A;  1DP6 A;  3PBS A;  1KDS A;  2Z6D A;  4IBR A;  4OPQ A;  1H8Y A;  1YMS A;  4Y3I A;  2XRO A;  3G31 A;  4E6W A;  2B95 A;  4E6X A;  3OPH A;  5EVI B;  2Y2H A;  3MF0 A;  5EFW A;  3FC7 A;  3PHY A;  1XKZ A;  1VEU A;  1XA1 A;  3TE8 A;  4Q0I A;  4JLF A;  5HL6 A;  1ONH A;  1UGU A;  1SDN A;  1KOU A;  1K55 C;  1H0M A;  5F1F A;  3UNW A;  4IED A;  2J8Y A;  4EWF A;  1Z6F A;  3MFD A;  2NUT C;  5J7E A;  3T12 B;  1MXO A;  3GVB A;  1LI0 A;  4DE3 A;  2QPN A;  3N6I A;  1LLB A;  4NXB A;  2P74 A;  3CZD A;  4LRX C;  5FQ9 A;  1IOU A;  2JN7 A;  3EQU A;  5CHJ A;  4EES A;  4UHU A;  4LFU A;  2WAE A;  1IKG A;  5A92 A;  3UN7 A;  4E3N A;  2IWC A;  2ZQA A;  4LCL A;  4KZ3 A;  1CQA A;  5J8X A;  3F1N B;  5IT5 A;  2H28 A;  5FAQ A;  1K55 A;  4GNU A;  5FSR A;  3GRJ A;  3VE4 A;  2DNS A;  4OQG A;  2VKS A;  5CTM A;  1OTA A;  3IS2 B;  3BRM A;  1YLT A;  1D7E A;  4E3I A;  1NXY A;  3UME A;  4OP5 A;  1XX2 A;  2WAF A;  1T1C A;  3O88 A;  3BFE A;  4WMC A;  3WS1 A;  1XP4 A;  3N8L A;  3ZQ5 A;  4PM7 A;  3PYP A;  3UDX A;  1E3U D;  4HEF A;  5KIZ A;  5HL1 A;  5EOO A;  5E2H A;  2OSU A;  2ZL1 A;  1N4O A;  4R3A A;  3KSI A;  3QNB A;  1PYY A;  3IX8 A;  5CGX A;  3NDE A;  4XT2 A;  2WAD A;  1S66 L;  4UA9 A;  1ZG4 A;  4UAA A;  4EQ1 A;  2WYX A;  3MSH A;  4EBP A;  5DJT A;  3DTM A;  4HNB A;  4JGQ A;  1VHM A;  1SKO A;  3U2A A;  5EUA A;  3VOL A;  5L07 A;  4KZ6 A;  3NOP C;  1TS6 A;  5TBM B;  4OPY A;  3P98 A;  2RCX A;  2HGV A;  4RA7 A;  3HLE A;  5DF9 A;  3VP2 A;  3GR2 A;  2WGV A;  1BUL A;  2JCH A;  4X1L A;  2Y91 A;  5FDH A;  2V2F F;  3MZE A;  4K0W A;  4S2M A;  4CJN A;  3BQ8 A;  3HBR A;  3C7U A;  1K6R A;  2Y2J A;  4X55 A;  5F82 A;  4Y2F A;  5DVA A;  1E3U A;  2Y2N A;  2XH9 A;  4WYY A;  4DE1 A;  3LIB A;  4KZ4 A;  1Q2Q A;  3E98 A;  4BJP A;  1NWZ A;  5L2F A;  2VV8 A;  2XA7 S;  4IBX A;  3S22 A;  3T1R A;  2R9X A;  4HIA A;  5HWW A;  1ALQ A;  3CHW P;  1DP9 A;  1ES2 A;  4HQA A;  5AQB A;  3Q7Z A;  4L9G A;  5GHZ A;  1PI5 A;  3F1O A;  2OOL A;  4UA7 A;  2GDN A;  1IYS A;  2W1T B;  1S67 L;  1BLP A;  3HJI A;  1G68 A;  4X6T A;  1RP5 A;  5GLB A;  1DJB A;  1XJ2 A;  5FI2 A;  1L0E A;  3CLO A;  2EX8 A;  3IQA A;  1BLH A;  4JBF A;  1NRF A;  4DN0 A;  5F83 A;  3P7N A;  3IHA A;  2R9W A;  2WKP A;  3VV4 A;  3S4X A;  1C3B A;  1YLJ A;  3BY9 A;  1YM1 A;  3HJK A;  3DWK A;  3Q82 A;  4FH2 A;  5KMW A;  2D02 A;  4ZAM A;  4Z1W A;  4K91 A;  2PBD P;  4P0M A;  3HVF A;  1W7F A;  4N9L A;  4OQI A;  3EGX C;  2D01 A;  4KG5 A;  4ZJ1 A;  4O7D A;  3IWO A;  3UB6 A;  2Q9N A;  3MXQ A;  2PD8 A;  4DE2 A;  1OTE A;  3A3I A;  4K0X A;  4P6Z M;  4F94 A;  3ZVW A;  5AQ9 A;  4C6Y A;  2J3T C;  4ZDX A;  3ZG5 A;  4EBL A;  1ES3 A;  5TR7 A;  4I39 A;  4BBU A;  4WZ5 C;  4WF0 A;  3Q7V B;  3V67 A;  2XLN A;  4ME4 A;  3GV9 A;  2ZQD A;  2EFU A;  4QWO A;  3LR5 A;  5HDC A;  1LHY A;  4DXB A;  2OLV A;  3W4P A;  3HUN A;  2W3E A;  2G7U A;  1PRQ A;  3VMA A;  3FPV A;  2Y2M A;  4R3J A;  4NXE A;  4Y5F A;  3FKV A;  3FV7 A;  4PPR A;  3K3C A;  4F3L A;  4L9F A;  1NYY A;  3FZC A;  2HDU A;  4BWI A;  3D3O A;  4YNR A;  4YIN A;  2Z6C A;  3T4T A;  2RL3 A;  3RXW A;  4LV2 A;  3UB7 A;  3ZG0 A;  1MKI A;  4WZ5 A;  3B42 A;  3CUE C;  1JWV A;  2HV1 A;  4HY8 A;  3IF6 B;  3JYI A;  2W3D A;  3IT9 A;  4EV4 A;  5CHU A;  3NUL A;  2QJ7 A;  5FL3 A;  3ZG8 B;  2KOI A;  3HRE A;  3DTE A;  4QHC A;  5C5K A;  2Y2Q A;  1GA0 A;  5CXW A;  2HF6 A;  4Y17 A;  3K3D A;  4ESP A;  4WUJ A;  2LB5 A;  1MZU A;  3A3D A;  3CWF A;  4GN2 A;  3CUE A;  1NLY A; 
#chains in the Genus database with same CATH homology
 5J4E A;  4IHQ A;  4YWZ A;  4NEE D;  4EEP A;  4NKP A;  2J3T D;  4MMN A;  2O99 A;  1DP6 A;  3PBS A;  2B02 A;  1YKD A;  2PR6 A;  2Z6D A;  5DKK A;  2VLG A;  3T4K A;  2V9A A;  4Y3I A;  2XRO A;  2XSS A;  2V0U A;  3S7Q A;  3MF0 A;  5EFW A;  3FC7 A;  4CLC D;  2L4R A;  3PHY A;  3A0S A;  1OPX A;  3TE8 A;  4Q0I A;  4GHI B;  3PBR A;  5HL6 A;  1G6O A;  1UGU A;  4E04 A;  1KOU A;  2PYR A;  3FPW A;  1OTD A;  1T18 A;  4H6J B;  3PBQ A;  3TJZ C;  3OCL A;  4F3L B;  3LFV A;  2K31 A;  4CLC C;  1LSW A;  4EEU A;  4GS9 A;  2NUT C;  5J7E A;  1XFQ A;  3S7P A;  4HJ4 A;  3OCN A;  4IUK A;  5TJJ A;  4ARZ B;  1TS0 A;  4NXB A;  4WEL A;  2QYB A;  4GJ4 A;  1T1B A;  4LRX C;  2ZBB A;  1IOU A;  2JN7 A;  3EQU A;  4EES A;  4WLA A;  3UE6 A;  3CIT A;  4JGO A;  1ODV A;  5AVF A;  4UEY A;  4R6L A;  3FG8 A;  2I9V A;  5IU1 A;  1N9N A;  4HOI A;  2IA2 A;  3GDI A;  1LT0 A;  3F1N B;  5IT5 A;  3MR0 A;  1YSP A;  2H28 A;  4QPR A;  2WKR A;  2JKT I;  2O0Y A;  4WEJ A;  2OAQ 1;  2NUP C;  3VE4 A;  4IJG A;  5F6A A;  2WKQ A;  4CLC A;  3BJN A;  3H82 B;  3C8C A;  1S4R A;  2JKR M;  2VKS A;  3E0Y A;  3PXP A;  4LRY C;  2YKF A;  3GEC A;  1OTA A;  3IS2 B;  4DJ3 A;  1TD5 A;  2V1B A;  4O8G A;  2P08 A;  1D7E A;  3BY8 A;  2KLI A;  3E4O A;  3A0R A;  3UME A;  1D06 A;  1XJ3 A;  3LID A;  4L0L A;  1LL8 A;  3IBR A;  2M1C A;  4HP4 A;  5AJG A;  4GLQ A;  4B9O A;  3BWL A;  1T1C A;  1YSQ A;  3G6O A;  3EEA A;  1JNU A;  3ZYT A;  4B93 A;  4I5S A;  2QHK A;  2XA7 M;  3TRC A;  3UB9 A;  2ZOH A;  3ZQ5 A;  1T1A A;  3F1P A;  2VX8 A;  2GJ3 A;  3PYP A;  3OLO A;  2BAS A;  5KIZ A;  3NOU C;  4CLC E;  5I5L A;  3T4J A;  2L0W A;  2VZW A;  3KSG A;  4R3A A;  2JHE A;  2M7V A;  3KSI A;  1NRJ A;  4OOL A;  1P9R A;  2V1A A;  3H7W A;  1S66 L;  4XT2 A;  4DMZ A;  3VE3 A;  4PAU A;  4EQ1 A;  3JVV A;  2W3F A;  2ZMV A;  3KSF A;  4GS9 B;  5DJT A;  4HNB A;  4JGQ A;  5KSH A;  3LI8 A;  1VHM A;  3U2A A;  4PKY G;  4I38 A;  1EW0 A;  4GCZ A;  5HZH A;  3KX0 X;  3VOL A;  5LBR A;  4L9E A;  4R38 A;  5HWV A;  1DRM A;  3NOP C;  3SW1 A;  5A8B A;  2VJW A;  1S1Z A;  1TS6 A;  5TBM B;  2A24 A;  2PHY A;  4KQO A;  1YAX A;  5F68 A;  3C38 A;  2HGV A;  5DF9 A;  2FH5 A;  2PT7 A;  4MN6 A;  2O9C A;  3O5Y A;  3MJQ A;  1OT9 A;  4Q0H A;  2J80 A;  1Y28 A;  3T4S A;  4ETX A;  1OT6 A;  3BQ8 A;  5DKL A;  2HJE A;  4RQ9 A;  1TF1 A;  3PBO A;  1IFQ A;  5IS1 A;  2HJ9 C;  3MMH A;  4UQI S;  4Y2F A;  2W0N A;  4MCW A;  2OWH A;  5HD5 A;  2EWV A;  2W27 A;  4EET B;  4EUV A;  2JKR I;  3LIB A;  4EW7 A;  2J3W A;  4HH3 A;  1MKM A;  3E98 A;  4CLC B;  4BJP A;  3CI6 A;  1NWZ A;  3LR0 A;  2VV8 A;  2XA7 S;  2INW A;  4HIA A;  3E4P A;  3UE3 A;  2PDR A;  3T4Q A;  4H6J A;  5HWW A;  3LYX A;  4I3J A;  4WEK A;  3UMD A;  5HSQ A;  1DP9 A;  3DBA A;  4MDZ A;  3LIC A;  4HQA A;  5DFX A;  5F5Y A;  2VEA A;  5K5B A;  4L9G A;  1V9Z A;  4O01 A;  1H8M A;  5HWT A;  3MQO A;  3F1O A;  4K08 A;  1V9Y A;  2OOL A;  1OTB A;  3HCY A;  3D72 A;  4KUO A;  1TS8 A;  2W1T B;  4HI4 A;  1S67 L;  2GNX A;  3MQ0 A;  4ARZ A;  3HJI A;  3EWK A;  3T50 A;  2A2L A;  3BQA A;  4EU0 A;  1S1Y A;  3OOV A;  2PYP A;  4WL9 A;  2W3H A;  2V0W A;  5G4Y A;  1XJ2 A;  4BBV A;  4PKY A;  2W1R A;  3CLO A;  3H9W A;  2L1M A;  2ZMF A;  3RFB A;  3EGD C;  3W2Z A;  4FSF A;  1X0O A;  4UQI M;  2PR5 A;  4DN0 A;  5AVE A;  1WA9 A;  1OTI A;  2KX6 A;  1XJ6 A;  3IBJ A;  4HJ6 A;  3P7N A;  3RH8 B;  5J3W A;  2M7U A;  4HP9 A;  3F1N A;  2P7J A;  4BMW A;  2WKP A;  3VV4 A;  2O9B A;  3LIA A;  4MN5 A;  2YKH A;  5HPI A;  1DP8 A;  5CX7 A;  3BY9 A;  1ZTU A;  3H7W B;  4XT2 B;  4BBT A;  3EQV A;  1P9W A;  3HJK A;  1H3Q A;  3MFX A;  2VGL S;  2DMW A;  1N9L A;  3H82 A;  1VB6 A;  3ICY A;  4KQD A;  3KSH A;  3PR6 A;  1N9O A;  1S4S A;  2D02 A;  3LIE A;  4Z1W A;  3JVU A;  4OOM A;  2MJ6 A;  4YOF A;  1P97 A;  1GSX A;  2PD7 A;  3EGX C;  3KYQ A;  2D01 A;  1LSX A;  4KUK A;  5DFY A;  5G4Z A;  3R7W A;  3LIF A;  3RTY A;  3ULF A;  1BYW A;  4DJ2 A;  3NHQ A;  3UB6 A;  3K2N A;  3MXQ A;  2PD8 A;  1GSW A;  2VV6 A;  3LR3 A;  1UWP X;  1OTE A;  4R70 A;  4LRZ E;  4EER A;  1NLZ A;  3BW6 A;  4P6Z M;  1OJ5 A;  4Q0J A;  3C2W A;  3OC2 A;  2J3T C;  3NJA A;  5L8M A;  1TS7 A;  1XJ4 A;  3A0V A;  4M4X A;  2XRN A;  4EXO A;  4PHT A;  3T4O A;  1G28 A;  4I39 A;  4BBU A;  2VGL M;  4ZRR A;  3LR4 A;  4WF0 A;  2GZA A;  4NXF A;  2VV7 A;  5F69 A;  3V67 A;  4ME4 A;  3EEH A;  4I3A A;  4II7 A;  2Y79 A;  4HJ3 A;  4HH2 A;  1GSV A;  3LR5 A;  5HDC A;  5HDS A;  3F1O B;  2W3E A;  2G7U A;  4I3I A;  1ZHH B;  3S7O A;  3KYZ A;  3P01 A;  3FPV A;  3CAX A;  5HPF A;  4GHI A;  3NOT C;  2P04 A;  2EWW A;  4NXE A;  2B18 A;  4Y5F A;  5DJU A;  5TBM A;  3OBF A;  3K3C A;  1W63 M;  4F3L A;  4JGR A;  4L9F A;  1MC0 A;  1OJG A;  4BWI A;  3D3O A;  4YNR A;  3B47 A;  2QJ5 A;  3PBN A;  2Z6C A;  4FOF A;  4CQH A;  2Y8H A;  2QKP A;  3T4T A;  4ETZ A;  1F5M A;  3UB7 A;  3B42 A;  4G3W A;  3CUE C;  2HV1 A;  4HY8 A;  3UB8 A;  4IUH A;  2LB9 A;  3E4Q A;  2KDK A;  3F1P B;  3LI9 A;  1P0Z A;  4JGP A;  3S7N A;  4HHD A;  3T4L A;  3EOI A;  2W3D A;  4P6Z S;  2QWS A;  4GW9 A;  3LUQ A;  2QJ7 A;  5FL3 A;  2FZ0 A;  3PBT A;  4AFI A;  2GX5 A;  2ZOI A;  2EA9 A;  2KOI A;  2VA0 A;  2OWJ A;  2W3G A;  4G3V A;  4LPZ A;  3TW8 A;  2K7S A;  3R7W B;  1LSV A;  2W1T A;  2CMN A;  5C5K A;  2JKT M;  3C30 A;  5MC7 A;  3R4K A;  2OAP 1;  3KO6 A;  4O0P A;  4G3K A;  1F9I A;  1F98 A;  2R78 A;  5HDD A;  1UWN X;  3IS2 A;  4NXG A;  1W63 Q;  3B33 A;  4WN5 A;  2HF6 A;  4MN7 A;  3K3D A;  2K2N A;  4WUJ A;  1T19 A;  2LB5 A;  1MZU A;  1STZ A;  1XFN A;  3MQQ A;  4LLO B;  3CWF A;  2A24 B;  3CUE A;  1NLY A;  5HD3 A;  2O9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...