1OT6A

Cryotrapped crystal structure of the e46q mutant of photoactive yellow protein under continuous illumination at 110k
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ot6A00
1TS0A 2PR5A 3MXQA 3LIFA 2ZOHA 1TS8A 5DKKA 4I5SA 5DJUA 3T50A 1GSWA 1S1ZA 2PYPA 1LSXA 4JGQA 5J3WA 1S1YA 3H7WA 5HD5A 3LIBA 4DJ3A 4WF0A 4EEPA 3UE6A 2WKRA 3H9WA 3PYPA 1BYWA 1LSVA 1V9ZA 4KUKA 3BY8A 4WN5A 2B02A 3F1OB 3CAXA 3G6OA 2QHKA 3F1NA 3K3DA 4HI4A 4R6LA 2VEAA 3UB8A 5J7EA 2VV8A 3E4QA 4E04A 2Z6DA 3EWKA 1F9IA 5I5LA 1OJGA 2QKPA 1XJ4A 4HH2A 3E4PA 3LIDA 1DP6A 2V1AA 3A0RA 3RH8B 1Y28A 1XJ2A 2W27A 1OTIA 3IS2A 2PD8A 3LUQA 3UB7A 2PHYA 1OTBA 4BBVA 1F98A 3EEHA 3FG8A 4HH3A 4R3AA 3MR0A 1TS7A 4GCZA 2BASA 3MJQA 4EERA 5J4EA 2CMNA 2V1BA 2YKHA 3LIAA 3LICA 4HP9A 4I3AA 5G4ZA 2HV1A 4NXBA 5G4YA 1LSWA 1X0OA 2QWSA 4PKYG 4HNBA 3UB6A 2VLGA 2KDKA 4LLOB 3H7WB 1EW0A 2KX6A 4I3IA 5IU1A 5AVFA 4EESA 3A0VA 1S67L 2QJ7A 1OT9A 3C2WA 3IS2B 4HJ3A 1LT0A 5HWTA 4JGOA 3F1NB 1S66L 1XJ6A 1TS6A 4H6JA 4DJ2A 1OTDA 1NWZA 1DRMA 2W0NA 2V0WA 2I9VA 2R78A 5F6AA 2D01A 1T1CA 4EXOA 4F3LA 4XT2A 3LYXA 2L0WA 4GHIB 3LIEA 4JGPA 2A24A 1V9YA 3NOPC 3MFXA 3F1PA 5HD3A 4GS9B 4K08A 2JN7A 2YKFA 4MN6A 1S4SA 4XT2B 2OWHA 5A8BA 4LRYC 2K7SA 4EW7A 1G28A 3BY9A 5F68A 3F1PB 5HWWA 4H6JB 3CWFA 2H28A 3GDIA 4GHIA 1LL8A 1OTEA 4WL9A 3RTYA 2JHEA 3UMEA 4EEUA 5AVEA 3MQQA 4KUOA 1T1AA 4GS9A 4NXGA 4WUJA 5HDDA 2PDRA 3MQOA 2A24B 4LRXC 5F5YA 2INWA 4I39A 3SW1A 2WKQA 2QJ5A 1VB6A 3ICYA 2GJ3A 1KOUA 4YWZA 4M4XA 4R38A 2M1CA 3P7NA 1DP8A 2PR6A 5HDCA 4LPZA 4HHDA 1N9LA 5TBMA 3LI9A 3ZQ5A 1T19A 5KIZA 2EA9A 2OWJA 5TBMB 1T18A 4HY8A 1XFNA 4I38A 1UGUA 5HSQA 1OJ5A 3FC7A 1UWNX 2VV6A 2V9AA 3A0SA 3K3CA 4HQAA 4I3JA 1XJ3A 2L1MA 2P7JA 2ZBBA 2ZOIA 5EFWA 3HJKA 1OTAA 4HOIA 1MZUA 2WKPA 4L9EA 2D02A 3GECA 2L4RA 2OOLA 3D72A 3VE3A 4BBTA 5HDSA 3UB9A 1UWPX 3NOTC 4L9FA 4JGRA 4B9OA 3IBRA 3PHYA 3CLOA 4KQDA 4L9GA 2PYRA 1ODVA 3NJAA 1S4RA 1GSXA 1D06A 4HJ4A 1T1BA 3NHQA 4HJ6A 1N9OA 2VV7A 4MN5A 3VE4A 5DKLA 3E4OA 4GW9A 1XFQA 3KX0X 5HZHA 4BBUA 1WA9A 4HP4A 4RQ9A 1P97A 4R70A 5DJTA 1GSVA 2V0UA 2Z6CA 3ULFA 3B33A 3F1OA 3BWLA 3UMDA 4HIAA 3H82B 4NXEA 2J80A 3LI8A 1JNUA 5HWVA 3VOLA 4PKYA 1N9NA 4WLAA 5F69A 3HJIA 4NXFA 1OT6A 1DP9A 2PD7A 3H82A 4EETB 1P0ZA 4LRZE 4EQ1A 1D7EA 3NOUC 4F3LB 5IS1A 3OLOA 3C8CA
chains in the Genus database with same CATH superfamily
3Q81A 5MC7A 2W3FA 1NYYA 3N4IA 5DTTA 2A2LA 1LSVA 2ZC5B 4KUKA 4WN5A 3BY8A 4CQHA 4UA7A 5HAIA 4ZTKA 3E4QA 5FQKA 2QKPA 4HH2A 3HLEA 3ZG9B 3VP2A 5IT5A 1WYBA 3LUQA 3UB7A 4BBVA 2BLSA 3EEHA 1MPLA 1XGJA 2CMNA 4ARZB 2VK3A 5AJGA 3VE4A 1DJCA 1FSYA 5FQMA 4GN2A 5TFQA 5A93A 3PR6A 4EBNA 5KSCA 2H5SA 1KDWA 1NYMA 1FOFA 3Q1FA 4JXWA 1CI8A 4RX2A 5HD3A 2XH9A 4UA9A 5A8BA 4EW7A 3GTCA 2JCHA 2H0YA 4NXGA 1IELA 3NBLA 3MKEA 1BLSA 1FSWA 4LPZA 1G6OA 2WGIA 3T1RA 1QMFA 3IH8A 1FQGA 4Y0OA 3UO9A 1F5MA 2K2NA 4K0XA 4DDYA 3IBRA 1K55C 2FFYA 2PYRA 3NHQA 4DE3A 3OPHA 5DKLA 3N7WA 4OPRA 4RQ9A 4E3JA 2UV0E 4KQOA 5DJTA 2PT7A 3B33A 4S2PA 2J80A 1L3LA 3DW0A 4EETB 2ZM2A 4F3LB 1D7EA 3RTYA 2HZ5A 5AQ9A 3WWXA 3T1QB 2HP6A 2I72A 3BM6A 4QB8A 5GLDA 3AGEA 2EXBA 4HI4A 5J7EA 1MKMA 2XF3A 3PAEA 4IUHA 1L0FA 1W8QA 2HDUA 3OPRA 5CGWA 4PM8A 1JWZA 1ES2A 1VEUA 5FI7A 1Q2QA 1TDGA 1C3BA 4ARZA 3UDFA 1E3UA 4EERA 1LSWA 2ZM8A 2EXAA 1FCOA 1H0MA 3VP3A 4R4SA 1EWZA 4G3WA 1XJ6A 1OTDA 1DRMA 3A3IA 1PYYA 4PPRA 5TJJA 3KYZA 2Y55A 4XT2B 4JF5A 4EQIA 4WMCD 5DTSA 5KMWA 4H6JB 3O86A 1LL8A 5CHUA 4KZ8A 1H8YA 2PRFA 2EX2A 4UAAA 3ZVTA 3HREA 4M4XA 2M1CA 4HHDA 3NY4A 1BUEA 2G2UA 3B3XA 4FSFA 3DTEA 3UPNA 1K6SA 1XFNA 3CZDA 5E2FA 2XRNA 1VETA 3W4PA 5TGFA 1LLBA 4CLCB 2OOLA 3T4TA 3ZG5A 3HL9A 4L9GA 1YSQA 4EESA 5HPFA 4GDNA 4QJGA 3QP6A 1YLJA 1ES4A 3BFEA 2ZQ9A 3LR4A 5DVAA 4R4RA 4L0LA 1PWGA 2KOIA 1P9RA 3GQZA 1N9BA 1YKDA 2JKGA 1YLWA 3T50A 5E2HA 5HD5A 3UNWA 4B4XA 4AFIA 1TF1A 4Z9QA 3CAXA 3IBJA 5BOHA 3E4PA 1K0KA 1YT4A 2Q9MA 1GA9A 1F98A 4R3AA 2JKRI 3C4PA 1W8YA 3OCLA 4PKYG 1NZOA 2IA2A 2GNXA 3MQ0A 1G68A 3OOVA 4MBKA 5HWTA 3SH7A 3LEZA 5FASA 1IYSA 3QHYA 3WS1A 5DFXA 1TD5A 4XT2A 2OLUA 4NEED 2Y79A 3IWOA 4JF6A 3T4JA 1BLHA 4XUZA 2H10A 3BY9A 5CTNA 4Y5FA 1SKOB 2XROA 1I5QA 2V20A 2E8JA 2Y2PA 3WS0A 4FOFA 5F1GA 3WRZA 4NETA 3P01A 3ZQ5A 1PWCA 1SKFA 2HGVA 5FEFA 2OWJA 2VKSA 5M18A 3RXXA 4Q0HA 2M7VA 5CEDA 4GOGA 3ZG0A 1LL5A 1MZUA 5C5KA 3N8RA 1ACFA 1UWPX 2V8FA 4WEJA 2ZMVA 3CLOA 4E3IA 2VV7A 4BBUA 4ZJ2A 2VGJA 1YSPA 3ZG8B 3A3FA 5HWVA 2WGVA 3NOUC 1PFLA 4XXRA 5GLBA 4GLQA 5DKKA 2PYPA 1ES5A 4YOFA 4WF0A 3PYPA 1CEFA 4LCLA 3M2JA 3TW8A 2AVXA 2ZQDA 5A90A 2Z6DA 3EWKA 3GR2A 1TEMA 3CMZA 3ZFZA 3VP4A 3UPPA 2R9WA 4DDSA 5DTKA 1K25A 3EQUA 3QP8A 4I3AA 4S2LA 4EUVA 5G4ZA 4NXBA 4KQQA 2Y8HA 5EVIA 1H8MA 5CTMA 5IU1A 4IBXA 2W3GA 3MXSA 3CUEC 3F1NB 2ZQ8A 2V0WA 1GHMA 2D01A 1KGEA 4OH0A 1PNEA 4FH2A 2XDMA 3SZTA 4PAUA 3SOIA 1S4SA 1AXBA 4LRYC 3SH9A 5CX7A 5FI6A 1FCNA 1IKGA 3BECA 5L10A 1BSGA 4G3KA 3DWKA 3VFFA 5F5YA 4GZBA 2ZD8A 4LENA 3OZHA 2OSUA 2VGLS 4MDZA 2PR6A 5HDCA 2BG1A 4ZJ3A 5E2GA 4OPQA 4KG6A 5HSQA 1AWIA 3IHBA 4QU3A 5EFWA 1OTAA 2NUPC 4KZ7A 4DF6A 5TR7A 1ODVA 1D06A 1DJAA 2Y2MA 1E25A 2XFTA 1WA9A 4OPYA 4Y17A 1IOUA 3R7WB 3HBRA 3BWLA 5EM1A 4ETXA 3NECA 5FEGA 1KVLA 2HPBA 4B88A 2VX8A 2J8YA 2PD7A 3M6BA 2Q0OA 2ZOHA 4I5SA 2J7VA 4LV3A 1GSWA 4P0MA 4DJ3A 5FAPA 4O7DA 4O01A 4X55A 3VOZA 2XSSA 3N6IA 2HDRA 5EOEA 2X71A 2JKTM 3NI9A 5J8XA 2Y91A 5HPIA 3N8SA 3N8LA 3MR0A 3T4KA 3CUEA 3C38A 3LICA 3BQ8A 4HEFA 3TSGA 1EW0A 2KX6A 4NKPA 4HJ3A 2VGKA 4A5RA 3T4LA 1I2SA 5FDHA 3HVFA 2ZL1A 2B18A 2WZXA 4GHIB 1NZUA 3HCYA 3LCEA 3MKFA 5HW3A 1YMXA 3E0YA 3ICYA 4LCMA 1ALQA 1W7FA 4DRTA 3IX8A 4Y0UA 4OONA 2JBFA 3BFCA 1UGUA 1HD8A 1J3WA 3VP1A 2V9AA 1NRJA 4LGWA 3P98A 3UE3A 4X25A 2Z2MB 1HLUP 4IUKA 3UB5P 1K56A 3NJAA 1PW1A 1NJ4A 3UN7A 3KX0X 4Z1WA 4HBUA 3H82B 1IKIA 2IWBA 5L8MA 3FKVA 1CK3A 3IX3A 3LIFA 3A3EA 1CEGA 4KZAA 3H9WA 4P6BA 1ESIA 5K5BA 3UY6A 1F9IA 2P04A 1JWPA 2DRWA 1Y28A 4IVIA 2HP9A 4E3MA 2WZZA 1K38A 4X69A 3Q07A 1HVBA 3FZCA 5G4YA 2O9CA 2JKFA 3EQVA 1SDNA 2EX6A 3CPTA 3WRTA 3SS3A 1NXYA 4DMZA 4S2NA 4P87A 3G35A 5FA7A 1V9YA 3ZYTA 4JXSA 2JN7A 4KZ6A 1IYOA 4WM9A 3PAGA 4FTXA 3BYDA 3CWFA 3HLGA 2ZLYA 4MMNA 2O99A 2INWA 3BLMA 2P74A 4R0QA 3DAVA 3UE0A 1JVJA 2Y2NA 1M40A 3MMHA 3D9YA 2M7UA 1FILA 4OQGA 2L4RA 4BBTA 3ZNTA 4Y0TA 4B9OA 1VEUB 4HJ4A 4MN5A 3KYEA 4OVDA 1NLYA 3TJZC 2WADA 2V0UA 2Z2LB 3KYQA 4MBHA 4WLAA 1CF0A 2VZWA 3VP0A 4Y13A 2PR5A 3T1XA 4S2JA 1RGYA 2HP5A 4GB7A 3EEAA 5L2FA 1FR1A 3L9KA 4E04A 4C3QA 4LV0A 2ZMFA 4XUXA 3A0RA 3IS2A 4BWIA 2PHYA 4S2IA 2UWXA 3FKWA 4DKIA 4UQIS 2Y2QA 1J9MA 2ACGA 2KDKA 1MWUA 4I3IA 2WK0A 3ITAA 1PZOA 3EGDC 4OOMA 3KSGA 4DE1A 4JXGA 1NWZA 1YM1A 1VQQA 3WS2A 3D4FA 1E3UD 4PM7A 5GL9A 3KSHA 1WE4A 4GHIA 3HLFA 5L09A 4WUJA 3S7NA 4LRXC 2XA7M 4YWZA 3P7NA 3TG9A 1I2WA 1N9LA 2VA0A 4KZBA 4Y2FA 3W2ZA 3GMWA 1H5XA 2PU2A 5HFOA 4B4ZA 4X53A 1L0DA 1E4DA 5GHYA 2L1MA 4H8RA 2D02A 5GHXA 3P09A 2RCXA 5AQBA 4MLLA 5EM0A 1GSXA 1N4OA 1YPRA 2B95A 4HIAA 2PAVP 2WKEA 3BW6A 4WYYA 2VJWA 5J3WA 3QNBA 1CQAA 4BMWA 1V9ZA 2B02A 3G6OA 4IHQA 1O7EA 5CGXA 3B42A 5F1FA 3FPVA 2H0TA 1OJGA 3MF0A 3S7PA 1OTBA 1RP5A 4P6ZM 5FL3A 3T4SA 1K4FA 3MJQA 5DF7A 2V2FF 1KE4A 3OCNA 4II7A 2G7UA 2JC7A 3UDXA 2MJ6A 3G32A 1K56D 3HUOA 3IWIA 1NY0A 5FAQA 2A24A 5KSHA 1KE3A 4GS9B 4K08A 4MCWA 5F68A 2ZL1B 4EUZA 4UHUA 2ZC7A 3HLDA 5A91A 1K55A 2JHEA 4GS9A 1P9WA 1BT5A 2A24B 3LY4A 4I39A 2A49A 3TOIA 2GJ3A 2XGNA 5IHVA 3CJMA 1GA0A 2HJEA 4I38A 3O3VA 3OBFA 5AQAA 1XJ3A 4I3JA 2ZOIA 3WS5A 3JYIA 2EFXA 2PBDP 1BLPA 4Q8IA 1S4RA 4ESPA 1T1BA 3G34A 3W4QA 3E4OA 1OPXA 3IHAA 2XD5A 1P97A 2HF6A 4IBRA 2BTFP 4CLCC 4N9KA 5F69A 3WS4A 3A3DA 3EGXC 3C30A 1DP9A 4KZ3A 2W3EA 3DBAA 4LRZE 3S22A 3LR0A 1TS8A 3HLBA 3H7WA 3LIBA 4EBLA 3VMAA 2HDSA 4D60A 5F83A 3CHWP 4YNRA 1XJ4A 3LIDA 4NK3A 2W27A 2JKTI 1BTLA 2LB9A 4ZRRA 4OQHA 3LIAA 1X0OA 2GDNA 2XR0A 4HNBA 4D2OA 3V39A 5AVFA 3MZEA 5CGSA 1IYPA 4YFMA 3GRJA 3BQAA 1ONGA 3IXDA 2I9VA 2X02A 2L0WA 1FCMA 3NOPC 1YLZA 2OWHA 4FCFA 3IXBA 2K7SA 2XQZA 3IX4A 4MEZA 1EI5A 3UMEA 1MXOA 2GZAA 1CJFA 2P9VB 3V67A 4BL3A 4DXBA 3NC8A 3UPOA 1K4EA 4M3KA 1EROA 2WUQA 4QPRA 3U2AA 3BJNA 2A3UA 3NCKA 4L9EA 3GECA 1XKZA 4QY6A 2Y2OA 1H8ZA 1ZKJA 4R23A 3LR3A 1MBLA 5FQIA 5F82A 2GX5A 1GSVA 3R4KA 3UMDA 2R9XA 2W3HA 4NXFA 2IWDA 3NDGA 5I94A 2O0YA 3C8CA 1TS0A 4OOYA 1PW8A 3VFHA 5EVID 1S1YA 1YQSA 5G18A 1YAXA 4OP8A 1BYWA 4X1MA 5FATA 3Q82A 1ERQA 4R6LA 2VEAA 3JVVA 4Y15A 2PD8A 3FG8A 4R3BA 1TS7A 4MNRA 1RCJA 2RL3A 2OAP1 3C7VA 4GD6A 4OPZA 3V3RA 4F3LA 3IXHA 3LIEA 2VGLM 5FQ9A 3F1PA 2YKFA 3HLCA 3O88A 4GD8A 4ID4A 2ZJ9A 4HESA 3F1PB 5HL1A 2ZQCA 5HDDA 1WYCA 1SHVA 3V50A 2E8IA 1ERMA 4KENB 4R38A 3LI9A 3Q7VA 1T19A 3CPTB 3IQAA 4GJ4A 4DXCA 3O5YA 2J9OA 3C4OA 2P7JA 4JLFA 3E2KA 1DY6A 4PHTA 1PI5A 3AGDA 4KQDA 3FPWA 3MS6A 2LB5A 1N9OA 2OLVA 2XK1A 3ZVWA 4F94A 1PRQA 3OPPA 5AQ7A 5U47A 4BQMA 1K57A 4OLDA 4LLOB 1W63Q 1HZOA 3VSLA 2WKRA 3MBZA 3B47A 3F1OB 1D1JA 3K3DA 3V3SA 2QMIA 5I5LA 4N9LA 1L0GA 5FQJA 3JPUA 2O9AA 3T1SA 4ME4A 4PM6A 2DMWA 2J3WA 3FWLA 1S67L 1SDEA 3IS2B 4BL2A 3CI6A 4EV4A 3LFVA 4CLCD 5KZHA 2P9VA 4H6JA 3V5MA 1CI9A 2C5WB 2R78A 2HJ9C 5F6AA 3BLSA 3LYXA 1NRFA 3MFXA 1LI0A 3KO6A 5M19A 2OAQ1 4U0TA 5HAPA 2JE5A 4WBGA 5AVEA 1KE0A 5DF9A 3LEQA 4WELA 4KZ9A 4E3NA 2XFSA 4RVAA 4GKUA 2ZC4B 3DWZA 5DF8A 3D3OA 3S1YA 3SS5A 4HY8A 3VSKA 1XA1A 2FFFB 3BEBA 3W8KA 4E6WA 2VV6A 5JYPA 3D72A 4O0PA 2WYXA 1Y54A 1XGIA 1ESUA 2XD1A 4K0WA 5HZHA 4C75A 4GW9A 1FR6A 2Y2GA 1STZA 3FYZA 1BZAA 3MXRA 3PBSA 5GLAA 2ZMAA 4EQ1A 5IS1A 3OLOA 4MBFA 5L07A 3MZFA 2P08A 1W79A 3RFBA 1LSXA 4EEPA 4CLCA 4ZJ1A 1W5DA 3R7WA 3HUNA 4JKTA 4FUWA 3RH8B 1DP6A 4R1GA 2WAFA 3Q7VB 2WGWB 4BJPA 1ZHHB 2EFUA 1Y4OA 2BASA 5J4EA 4S2KA 1NLZA 4DE0A 3EOIA 3UB6A 1XX2A 1S6RA 4JBFA 4JGOA 5EVLA 5EVEA 4P6ZS 4EXOA 2WKIA 1YLYA 4WZ5A 4ZDXA 1YLTA 2WKHA 5HWWA 4WL9A 2QYBA 2Y2IA 4ETZA 4KUOA 3MQQA 3IT9A 3GVBA 1TDLA 5EECA 1ZG4A 1DP8A 4Q0IA 4JPMA 2EX8A 1G5UA 4U0XA 3A0SA 3K3CA 3G31A 3BRMA 2PBYA 1G6AA 2ZQ7A 3UB9A 3NOTC 3PBOA 1L2SA 4HJ6A 4EU0A 5HAQA 5CXWA 2Y4AA 4NXEA 4BD1A 3LI8A 2W1TB 3VOYA 3HJIA 2Y59A 4NG2A 2J3TC 2Y2HA 4WZ4A 1JWVA 1ES3A 5DJUA 2QZ6A 3UE6A 3PBNA 1K54C 3ZHHA 3ZG7B 4WZ5C 1LL9A 4N1HA 4PM9A 1TVFA 1OTIA 4KG5A 4S2NC 1HTZA 3S7OA 4GCZA 3RJUA 3PBQA 1ZC2A 2QWSA 1KVMA 3KSIA 4PM5A 4WEKA 3A3JA 2G2WA 1TS6A 4DJ2A 5HL6A 5DFYA 2W0NA 3HUMA 4PMAA 2XA7S 3C7UA 4ZBEA 1KGFA 3DTIA 1MC0A 2QPNA 1G28A 2H28A 1OTEA 4DE2A 4EEUA 1O07A 5HX9A 2PDRA 4LV2A 4U3TA 1VETB 2QJ5A 3SH8A 3KSFA 2NUTC 3IF6A 3LGOA 3QP5A 4UA6A 1ZG6A 2ZQAA 1UWNX 3LR5A 4HOIA 4FH4A 4EBPA 5EOOA 4S2MA 3NDEA 2WAEA 3T4OA 3F1OA 4RYEA 5CECA 3IF6C 2V8CA 3G2ZA 4PKYA 3DTKA 4CJNA 1F2KA 3NULA 2PU4A 4Y7PA 2EX9A 3W4OA 1FIKA 4GNUA 3OPLA 1ZTUA 2QHKA 4O8GA 5CRFA 2Q9NA 1GCEA 2Y2LA 4X56A 5EVIB 1U60A 2W1RA 4QY5A 3O87A 5FAOA 2VLGA 1RGZA 1Z09A 5EUAA 4X1LA 1BLCA 3C5AA 4IVKA 1VHMA 5FDSA 1ONHA 1XPBA 2XEPA 3T12B 2EWWA 1VM1A 3PXPA 1IEMA 3Q7ZA 4GDBA 4E3OA 4Q0JA 2FZ0A 3QP2A 3NIAA 5M1AA 4Y3IA 1XXMA 1A0KA 2FH5A 2J3TD 4QD4A 2OV5A 3CITA 3BFFA 3ITBA 5EV0A 4E6XA 3G30A 3FC7A 3HLWA 4HQAA 3L7HA 3MFDA 2JKRM 3S7QA 4JGRA 1JTDA 2J9PA 4QWOA 5E2EA 2Z6CA 5D3OA 4WMCA 4JXVA 4OLGA 3I7JA 4KG2A 3UDIA 1SZVA 3MXQA 3IH9A 5FI2A 4B93A 1MWTA 4JGQA 4RA7A 3E2LA 4EWFA 2CC1A 3F1NA 2W3DA 4OKPA 2IWCA 5CEBA 4LFUA 2DCFA 1DJBA 4CLCE 4S2OA 5FSRA 1LHYA 2Y2JA 4LV1A 2ZC3B 4C6YA 1K54A 1PIOA 2HV1A 5CHJA 3QNCA 5EE8A 1GHPA 3IF6B 4HBTA 3H7WB 3K2NA 4OOLA 4MN7A 4QHCA 5EVIC 1LT0A 3PTEA 1S66L 1K57C 4YINA 5GLCA 3S4XA 3M2KA 2Y2KA 3DTMA 3BFDA 2EWVA 4X68A 1QMEA 3FV7A 4RX3A 4BENA 2KLIA 1Q2PA 4R3JA 4IJGA 4BLMA 5JYOA 5TBMA 1PI4A 5E43A 1XA7A 3QP1A 4OQ0A 3T4QA 1OJ5A 1MWRA 1MWSA 3ZGAB 3HJKA 3LY3A 3VE3A 1H3QA 2O9BA 3JVUA 1L0EA 3ZCZA 1XFQA 3QP4A 1GHIA 3E98A 3CG5A 4HP4A 3ZNYA 4E3LA 3ULFA 3IF5A 3U4LP 4OP5A 1JNUA 1Z6FA 3VOLA 1MKIA 5LBRA 3H82A 3MSHA 4BD0A 1BULA 4UQIM 4G3VA 2DNSA 2W1TA 1S1ZA 2K31A 4ZAMA 1M6KA 4FD8A 3UB8A 2VV8A 3TE8A 2V1ZA 3G4PA 2V1AA 1XJ2A 4K91A 4IEDA 4HH3A 3RXWA 3G2YA 2V1BA 2YKHA 4N1XA 4HP9A 4KZ4A 5A92A 2ZC6B 3A0VA 2QJ7A 1OT9A 5CHMA 1IFQA 3C2WA 3M6HA 1XP4A 3AGFA 3VV4A 3LO7A 5CERA 4P85A 3OC2A 1K6RA 1OMEA 4OQIA 4KQRA 1T1CA 2HDQA 3TRCA 4JGPA 3ZDJA 4CPKA 5GHZA 4MN6A 1PWDA 3GDIA 1SCWA 1T1AA 5FQQA 1IYQA 3BFGA 4DN0A 3MQOA 1YLPA 3SW1A 2WKQA 3ISGA 1VB6A 2XLNA 1KOUA 5EPHA 4JF4A 2X01A 1W63M 4KZ5A 5KIZA 3GV9A 2B5RA 1LI9A 4X6TA 2EA9A 1MY8A 5TBMB 1T18A 3SS4A 1JTGA 2C6WB 3UE1A 2ZM0A 3IWQA 2WGWA 2ZBBA 1KDSA 1KGGA 2WKPA 4N92A 4UEYA 5HDSA 4L9FA 3PHYA 5HARA 1S0WA 1SKOA 3PBTA 4E3KA 4R70A 3PBRA 1YMSA 3IXGA 1N9NA 1OT6A 3MZDA 1PZPA 1P0ZA 3GSGA
chains in the Genus database with same CATH topology
3LR0A 2ZOHA 1TS8A 2W3FA 5MC7A 4I5SA 5DJUA 1GSWA 4DJ3A 3H7WA 3LIBA 3UE6A 2A2LA 1LSVA 4KUKA 4WN5A 3BY8A 4O01A 3PBNA 4CQHA 2XSSA 3E4QA 2JKTM 2QKPA 4YNRA 1XJ4A 4HH2A 3LIDA 5IT5A 2W27A 1OTIA 3LUQA 3UB7A 4BBVA 2JKTI 5HPIA 3EEHA 2LB9A 3MR0A 4ZRRA 3S7OA 4GCZA 3T4KA 3PBQA 2CMNA 3CUEA 3C38A 3LIAA 3BQ8A 3LICA 4ARZB 5AJGA 3VE4A 1X0OA 2QWSA 4HNBA 3KSIA 1EW0A 2KX6A 4NKPA 5AVFA 4HJ3A 4WEKA 3T4LA 3BQAA 3PR6A 1TS6A 4DJ2A 5HL6A 5DFYA 2W0NA 2I9VA 2B18A 2XA7S 2L0WA 4GHIB 3NOPC 5HD3A 2OWHA 1MC0A 3HCYA 5A8BA 4EW7A 2K7SA 1G28A 2H28A 1OTEA 3UMEA 4EEUA 4NXGA 2PDRA 2GZAA 3V67A 2QJ5A 3E0YA 3ICYA 4LPZA 1G6OA 3KSFA 2NUTC 1UGUA 1UWNX 3LR5A 2V9AA 4QPRA 1NRJA 3U2AA 1F5MA 3BJNA 3UE3A 4HOIA 4L9EA 2K2NA 3GECA 4IUKA 3IBRA 2PYRA 3NJAA 3NHQA 3LR3A 5DKLA 3KX0X 4RQ9A 4Z1WA 5DJTA 4KQOA 2GX5A 1GSVA 2PT7A 3T4OA 3B33A 3F1OA 3R4KA 3UMDA 3H82B 2J80A 2W3HA 4PKYA 4NXFA 5L8MA 4EETB 4F3LB 1D7EA 2O0YA 3C8CA 1TS0A 3RTYA 3LIFA 1S1YA 1ZTUA 1YAXA 3H9WA 1BYWA 5K5BA 2QHKA 4HI4A 5J7EA 1MKMA 4R6LA 2VEAA 3JVVA 4IUHA 1F9IA 4O8GA 2P04A 1Y28A 2PD8A 4ARZA 3FG8A 1TS7A 4EERA 2W1RA 5G4YA 1LSWA 2O9CA 2VLGA 2OAP1 3EQVA 4G3WA 1XJ6A 1OTDA 4DMZA 1DRMA 1VHMA 4F3LA 3LIEA 2VGLM 1V9YA 3ZYTA 2EWWA 3F1PA 5TJJA 2JN7A 2YKFA 3KYZA 3PXPA 4XT2B 3F1PB 4Q0JA 4H6JB 3CWFA 2FZ0A 1LL8A 4MMNA 2O99A 5HDDA 4Y3IA 2INWA 4M4XA 4R38A 2M1CA 2FH5A 2J3TD 4HHDA 3LI9A 1T19A 3CITA 4FSFA 4GJ4A 3MMHA 1XFNA 3O5YA 2M7UA 3FC7A 4HQAA 2XRNA 2P7JA 4CLCB 2JKRM 2L4RA 2OOLA 3S7QA 3T4TA 4BBTA 4PHTA 4JGRA 4B9OA 4KQDA 3FPWA 4L9GA 2LB5A 1YSQA 4HJ4A 4MN5A 4EESA 1N9OA 5HPFA 1NLYA 3TJZC 2V0UA 2Z6CA 3KYQA 3LR4A 4WLAA 2VZWA 4L0LA 2KOIA 1P9RA 4LLOB 2PR5A 3MXQA 4B93A 1YKDA 3T50A 4JGQA 1W63Q 5HD5A 2WKRA 4AFIA 3B47A 1TF1A 3EEAA 3F1OB 3CAXA 3F1NA 2W3DA 3K3DA 3IBJA 4E04A 2ZMFA 5I5LA 3E4PA 3A0RA 4CLCE 3IS2A 4BWIA 2PHYA 1F98A 4UQIS 4R3AA 2JKRI 2O9AA 4ME4A 2HV1A 3OCLA 4PKYG 2DMWA 2IA2A 2KDKA 3H7WB 2GNXA 3K2NA 3MQ0A 4I3IA 4OOLA 2J3WA 3EGDC 3OOVA 1S67L 4MN7A 4OOMA 3IS2B 3KSGA 3CI6A 1LT0A 5HWTA 3LFVA 4CLCD 1S66L 4H6JA 1NWZA 2R78A 5F6AA 2HJ9C 5DFXA 1TD5A 4XT2A 3LYXA 4NEED 2Y79A 3MFXA 3KO6A 3T4JA 2OAQ1 3KSHA 3BY9A 4GHIA 2EWVA 4Y5FA 2XROA 5AVEA 4WUJA 3S7NA 5DF9A 4LRXC 2KLIA 4FOFA 4IJGA 2XA7M 3P01A 4WELA 4YWZA 3P7NA 4Y2FA 1N9LA 2VA0A 5TBMA 3ZQ5A 3W2ZA 2HGVA 3D3OA 2OWJA 2VKSA 4HY8A 3T4QA 1OJ5A 2VV6A 4Q0HA 2L1MA 2M7VA 3HJKA 1MZUA 5C5KA 2D02A 3D72A 3VE3A 4O0PA 1UWPX 4WEJA 2ZMVA 3CLOA 1H3QA 2O9BA 3JVUA 1GSXA 5HZHA 2VV7A 4GW9A 1XFQA 4BBUA 3E98A 4HP4A 1YSPA 3ULFA 4HIAA 1STZA 1JNUA 5HWVA 3VOLA 3PBSA 5LBRA 4EQ1A 3H82A 5IS1A 3NOUC 3OLOA 4GLQA 4UQIM 5DKKA 4G3VA 3BW6A 2P08A 2W1TA 1S1ZA 3RFBA 2PYPA 1LSXA 2VJWA 5J3WA 2K31A 4YOFA 4WF0A 4EEPA 4CLCA 4BMWA 3PYPA 1V9ZA 2B02A 3G6OA 4IHQA 3UB8A 3R7WA 3TW8A 3B42A 2VV8A 2Z6DA 3EWKA 3FPVA 3TE8A 1OJGA 3MF0A 3RH8B 1DP6A 2V1AA 1XJ2A 3S7PA 1OTBA 4BJPA 1ZHHB 4P6ZM 4HH3A 5FL3A 3EQUA 3T4SA 2BASA 3MJQA 5J4EA 4I3AA 2V1BA 2YKHA 4HP9A 1NLZA 5G4ZA 4EUVA 4NXBA 2Y8HA 3EOIA 3UB6A 1H8MA 5IU1A 3OCNA 4II7A 3A0VA 2QJ7A 1OT9A 2G7UA 1IFQA 2W3GA 3C2WA 3VV4A 4JGOA 3CUEC 2MJ6A 3F1NB 3OC2A 2V0WA 2D01A 4P6ZS 1T1CA 4EXOA 3TRCA 4JGPA 2A24A 5KSHA 4GS9B 4K08A 4MCWA 4PAUA 4MN6A 1S4SA 4LRYC 5F68A 5CX7A 5HWWA 4WL9A 3GDIA 2QYBA 2JHEA 4ETZA 3MQQA 4G3KA 1T1AA 4GS9A 1P9WA 4KUOA 4DN0A 3MQOA 2A24B 5F5YA 4I39A 3SW1A 2WKQA 1VB6A 2GJ3A 1KOUA 2VGLS 4MDZA 1DP8A 2PR6A 5HDCA 1W63M 4Q0IA 5KIZA 2EA9A 5TBMB 1T18A 2HJEA 4I38A 5HSQA 3OBFA 3A0SA 3K3CA 4I3JA 1XJ3A 5EFWA 2ZOIA 2ZBBA 1OTAA 2NUPC 2WKPA 4UEYA 5HDSA 3UB9A 3NOTC 4L9FA 3PHYA 3PBOA 1ODVA 1S4RA 4HJ6A 1D06A 4EU0A 1T1BA 3PBTA 3E4OA 1OPXA 1WA9A 1IOUA 3R7WB 1P97A 4R70A 2HF6A 3PBRA 3BWLA 4NXEA 3LI8A 4CLCC 2W1TB 4ETXA 1N9NA 5F69A 3HJIA 3EGXC 1OT6A 3C30A 1DP9A 2J3TC 2VX8A 2PD7A 2W3EA 1P0ZA 3DBAA 4LRZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS0 A;  2PR5 A;  3MXQ A;  3LIF A;  2ZOH A;  1TS8 A;  5DKK A;  4I5S A;  5DJU A;  3T50 A;  1GSW A;  1S1Z A;  2PYP A;  1LSX A;  4JGQ A;  5J3W A;  1S1Y A;  3H7W A;  5HD5 A;  3LIB A;  4DJ3 A;  4WF0 A;  4EEP A;  3UE6 A;  2WKR A;  3H9W A;  3PYP A;  1BYW A;  1LSV A;  1V9Z A;  4KUK A;  3BY8 A;  4WN5 A;  2B02 A;  3F1O B;  3CAX A;  3G6O A;  2QHK A;  3F1N A;  3K3D A;  4HI4 A;  4R6L A;  2VEA A;  3UB8 A;  5J7E A;  2VV8 A;  3E4Q A;  4E04 A;  2Z6D A;  3EWK A;  1F9I A;  5I5L A;  1OJG A;  2QKP A;  1XJ4 A;  4HH2 A;  3E4P A;  3LID A;  1DP6 A;  2V1A A;  3A0R A;  3RH8 B;  1Y28 A;  1XJ2 A;  2W27 A;  1OTI A;  3IS2 A;  2PD8 A;  3LUQ A;  3UB7 A;  2PHY A;  1OTB A;  4BBV A;  1F98 A;  3EEH A;  3FG8 A;  4HH3 A;  4R3A A;  3MR0 A;  1TS7 A;  4GCZ A;  2BAS A;  3MJQ A;  4EER A;  5J4E A;  2CMN A;  2V1B A;  2YKH A;  3LIA A;  3LIC A;  4HP9 A;  4I3A A;  5G4Z A;  2HV1 A;  4NXB A;  5G4Y A;  1LSW A;  1X0O A;  2QWS A;  4PKY G;  4HNB A;  3UB6 A;  2VLG A;  2KDK A;  4LLO B;  3H7W B;  1EW0 A;  2KX6 A;  4I3I A;  5IU1 A;  5AVF A;  4EES A;  3A0V A;  1S67 L;  2QJ7 A;  1OT9 A;  3C2W A;  3IS2 B;  4HJ3 A;  1LT0 A;  5HWT A;  4JGO A;  3F1N B;  1S66 L;  1XJ6 A;  1TS6 A;  4H6J A;  4DJ2 A;  1OTD A;  1NWZ A;  1DRM A;  2W0N A;  2V0W A;  2I9V A;  2R78 A;  5F6A A;  2D01 A;  1T1C A;  4EXO A;  4F3L A;  4XT2 A;  3LYX A;  2L0W A;  4GHI B;  3LIE A;  4JGP A;  2A24 A;  1V9Y A;  3NOP C;  3MFX A;  3F1P A;  5HD3 A;  4GS9 B;  4K08 A;  2JN7 A;  2YKF A;  4MN6 A;  1S4S A;  4XT2 B;  2OWH A;  5A8B A;  4LRY C;  2K7S A;  4EW7 A;  1G28 A;  3BY9 A;  5F68 A;  3F1P B;  5HWW A;  4H6J B;  3CWF A;  2H28 A;  3GDI A;  4GHI A;  1LL8 A;  1OTE A;  4WL9 A;  3RTY A;  2JHE A;  3UME A;  4EEU A;  5AVE A;  3MQQ A;  4KUO A;  1T1A A;  4GS9 A;  4NXG A;  4WUJ A;  5HDD A;  2PDR A;  3MQO A;  2A24 B;  4LRX C;  5F5Y A;  2INW A;  4I39 A;  3SW1 A;  2WKQ A;  2QJ5 A;  1VB6 A;  3ICY A;  2GJ3 A;  1KOU A;  4YWZ A;  4M4X A;  4R38 A;  2M1C A;  3P7N A;  1DP8 A;  2PR6 A;  5HDC A;  4LPZ A;  4HHD A;  1N9L A;  5TBM A;  3LI9 A;  3ZQ5 A;  1T19 A;  5KIZ A;  2EA9 A;  2OWJ A;  5TBM B;  1T18 A;  4HY8 A;  1XFN A;  4I38 A;  1UGU A;  5HSQ A;  1OJ5 A;  3FC7 A;  1UWN X;  2VV6 A;  2V9A A;  3A0S A;  3K3C A;  4HQA A;  4I3J A;  1XJ3 A;  2L1M A;  2P7J A;  2ZBB A;  2ZOI A;  5EFW A;  3HJK A;  1OTA A;  4HOI A;  1MZU A;  2WKP A;  4L9E A;  2D02 A;  3GEC A;  2L4R A;  2OOL A;  3D72 A;  3VE3 A;  4BBT A;  5HDS A;  3UB9 A;  1UWP X;  3NOT C;  4L9F A;  4JGR A;  4B9O A;  3IBR A;  3PHY A;  3CLO A;  4KQD A;  4L9G A;  2PYR A;  1ODV A;  3NJA A;  1S4R A;  1GSX A;  1D06 A;  4HJ4 A;  1T1B A;  3NHQ A;  4HJ6 A;  1N9O A;  2VV7 A;  4MN5 A;  3VE4 A;  5DKL A;  3E4O A;  4GW9 A;  1XFQ A;  3KX0 X;  5HZH A;  4BBU A;  1WA9 A;  4HP4 A;  4RQ9 A;  1P97 A;  4R70 A;  5DJT A;  1GSV A;  2V0U A;  2Z6C A;  3ULF A;  3B33 A;  3F1O A;  3BWL A;  3UMD A;  4HIA A;  3H82 B;  4NXE A;  2J80 A;  3LI8 A;  1JNU A;  5HWV A;  3VOL A;  4PKY A;  1N9N A;  4WLA A;  5F69 A;  3HJI A;  4NXF A;  1OT6 A;  1DP9 A;  2PD7 A;  3H82 A;  4EET B;  1P0Z A;  4LRZ E;  4EQ1 A;  1D7E A;  3NOU C;  4F3L B;  5IS1 A;  3OLO A;  3C8C A; 
#chains in the Genus database with same CATH topology
 3Q81 A;  5MC7 A;  2W3F A;  1NYY A;  3N4I A;  5DTT A;  2A2L A;  1LSV A;  2ZC5 B;  4KUK A;  4WN5 A;  3BY8 A;  4CQH A;  4UA7 A;  5HAI A;  4ZTK A;  3E4Q A;  5FQK A;  2QKP A;  4HH2 A;  3HLE A;  3ZG9 B;  3VP2 A;  5IT5 A;  1WYB A;  3LUQ A;  3UB7 A;  4BBV A;  2BLS A;  3EEH A;  1MPL A;  1XGJ A;  2CMN A;  4ARZ B;  2VK3 A;  5AJG A;  3VE4 A;  1DJC A;  1FSY A;  5FQM A;  4GN2 A;  5TFQ A;  5A93 A;  3PR6 A;  4EBN A;  5KSC A;  2H5S A;  1KDW A;  1NYM A;  1FOF A;  3Q1F A;  4JXW A;  1CI8 A;  4RX2 A;  5HD3 A;  2XH9 A;  4UA9 A;  5A8B A;  4EW7 A;  3GTC A;  2JCH A;  2H0Y A;  4NXG A;  1IEL A;  3NBL A;  3MKE A;  1BLS A;  1FSW A;  4LPZ A;  1G6O A;  2WGI A;  3T1R A;  1QMF A;  3IH8 A;  1FQG A;  4Y0O A;  3UO9 A;  1F5M A;  2K2N A;  4K0X A;  4DDY A;  3IBR A;  1K55 C;  2FFY A;  2PYR A;  3NHQ A;  4DE3 A;  3OPH A;  5DKL A;  3N7W A;  4OPR A;  4RQ9 A;  4E3J A;  2UV0 E;  4KQO A;  5DJT A;  2PT7 A;  3B33 A;  4S2P A;  2J80 A;  1L3L A;  3DW0 A;  4EET B;  2ZM2 A;  4F3L B;  1D7E A;  3RTY A;  2HZ5 A;  5AQ9 A;  3WWX A;  3T1Q B;  2HP6 A;  2I72 A;  3BM6 A;  4QB8 A;  5GLD A;  3AGE A;  2EXB A;  4HI4 A;  5J7E A;  1MKM A;  2XF3 A;  3PAE A;  4IUH A;  1L0F A;  1W8Q A;  2HDU A;  3OPR A;  5CGW A;  4PM8 A;  1JWZ A;  1ES2 A;  1VEU A;  5FI7 A;  1Q2Q A;  1TDG A;  1C3B A;  4ARZ A;  3UDF A;  1E3U A;  4EER A;  1LSW A;  2ZM8 A;  2EXA A;  1FCO A;  1H0M A;  3VP3 A;  4R4S A;  1EWZ A;  4G3W A;  1XJ6 A;  1OTD A;  1DRM A;  3A3I A;  1PYY A;  4PPR A;  5TJJ A;  3KYZ A;  2Y55 A;  4XT2 B;  4JF5 A;  4EQI A;  4WMC D;  5DTS A;  5KMW A;  4H6J B;  3O86 A;  1LL8 A;  5CHU A;  4KZ8 A;  1H8Y A;  2PRF A;  2EX2 A;  4UAA A;  3ZVT A;  3HRE A;  4M4X A;  2M1C A;  4HHD A;  3NY4 A;  1BUE A;  2G2U A;  3B3X A;  4FSF A;  3DTE A;  3UPN A;  1K6S A;  1XFN A;  3CZD A;  5E2F A;  2XRN A;  1VET A;  3W4P A;  5TGF A;  1LLB A;  4CLC B;  2OOL A;  3T4T A;  3ZG5 A;  3HL9 A;  4L9G A;  1YSQ A;  4EES A;  5HPF A;  4GDN A;  4QJG A;  3QP6 A;  1YLJ A;  1ES4 A;  3BFE A;  2ZQ9 A;  3LR4 A;  5DVA A;  4R4R A;  4L0L A;  1PWG A;  2KOI A;  1P9R A;  3GQZ A;  1N9B A;  1YKD A;  2JKG A;  1YLW A;  3T50 A;  5E2H A;  5HD5 A;  3UNW A;  4B4X A;  4AFI A;  1TF1 A;  4Z9Q A;  3CAX A;  3IBJ A;  5BOH A;  3E4P A;  1K0K A;  1YT4 A;  2Q9M A;  1GA9 A;  1F98 A;  4R3A A;  2JKR I;  3C4P A;  1W8Y A;  3OCL A;  4PKY G;  1NZO A;  2IA2 A;  2GNX A;  3MQ0 A;  1G68 A;  3OOV A;  4MBK A;  5HWT A;  3SH7 A;  3LEZ A;  5FAS A;  1IYS A;  3QHY A;  3WS1 A;  5DFX A;  1TD5 A;  4XT2 A;  2OLU A;  4NEE D;  2Y79 A;  3IWO A;  4JF6 A;  3T4J A;  1BLH A;  4XUZ A;  2H10 A;  3BY9 A;  5CTN A;  4Y5F A;  1SKO B;  2XRO A;  1I5Q A;  2V20 A;  2E8J A;  2Y2P A;  3WS0 A;  4FOF A;  5F1G A;  3WRZ A;  4NET A;  3P01 A;  3ZQ5 A;  1PWC A;  1SKF A;  2HGV A;  5FEF A;  2OWJ A;  2VKS A;  5M18 A;  3RXX A;  4Q0H A;  2M7V A;  5CED A;  4GOG A;  3ZG0 A;  1LL5 A;  1MZU A;  5C5K A;  3N8R A;  1ACF A;  1UWP X;  2V8F A;  4WEJ A;  2ZMV A;  3CLO A;  4E3I A;  2VV7 A;  4BBU A;  4ZJ2 A;  2VGJ A;  1YSP A;  3ZG8 B;  3A3F A;  5HWV A;  2WGV A;  3NOU C;  1PFL A;  4XXR A;  5GLB A;  4GLQ A;  5DKK A;  2PYP A;  1ES5 A;  4YOF A;  4WF0 A;  3PYP A;  1CEF A;  4LCL A;  3M2J A;  3TW8 A;  2AVX A;  2ZQD A;  5A90 A;  2Z6D A;  3EWK A;  3GR2 A;  1TEM A;  3CMZ A;  3ZFZ A;  3VP4 A;  3UPP A;  2R9W A;  4DDS A;  5DTK A;  1K25 A;  3EQU A;  3QP8 A;  4I3A A;  4S2L A;  4EUV A;  5G4Z A;  4NXB A;  4KQQ A;  2Y8H A;  5EVI A;  1H8M A;  5CTM A;  5IU1 A;  4IBX A;  2W3G A;  3MXS A;  3CUE C;  3F1N B;  2ZQ8 A;  2V0W A;  1GHM A;  2D01 A;  1KGE A;  4OH0 A;  1PNE A;  4FH2 A;  2XDM A;  3SZT A;  4PAU A;  3SOI A;  1S4S A;  1AXB A;  4LRY C;  3SH9 A;  5CX7 A;  5FI6 A;  1FCN A;  1IKG A;  3BEC A;  5L10 A;  1BSG A;  4G3K A;  3DWK A;  3VFF A;  5F5Y A;  4GZB A;  2ZD8 A;  4LEN A;  3OZH A;  2OSU A;  2VGL S;  4MDZ A;  2PR6 A;  5HDC A;  2BG1 A;  4ZJ3 A;  5E2G A;  4OPQ A;  4KG6 A;  5HSQ A;  1AWI A;  3IHB A;  4QU3 A;  5EFW A;  1OTA A;  2NUP C;  4KZ7 A;  4DF6 A;  5TR7 A;  1ODV A;  1D06 A;  1DJA A;  2Y2M A;  1E25 A;  2XFT A;  1WA9 A;  4OPY A;  4Y17 A;  1IOU A;  3R7W B;  3HBR A;  3BWL A;  5EM1 A;  4ETX A;  3NEC A;  5FEG A;  1KVL A;  2HPB A;  4B88 A;  2VX8 A;  2J8Y A;  2PD7 A;  3M6B A;  2Q0O A;  2ZOH A;  4I5S A;  2J7V A;  4LV3 A;  1GSW A;  4P0M A;  4DJ3 A;  5FAP A;  4O7D A;  4O01 A;  4X55 A;  3VOZ A;  2XSS A;  3N6I A;  2HDR A;  5EOE A;  2X71 A;  2JKT M;  3NI9 A;  5J8X A;  2Y91 A;  5HPI A;  3N8S A;  3N8L A;  3MR0 A;  3T4K A;  3CUE A;  3C38 A;  3LIC A;  3BQ8 A;  4HEF A;  3TSG A;  1EW0 A;  2KX6 A;  4NKP A;  4HJ3 A;  2VGK A;  4A5R A;  3T4L A;  1I2S A;  5FDH A;  3HVF A;  2ZL1 A;  2B18 A;  2WZX A;  4GHI B;  1NZU A;  3HCY A;  3LCE A;  3MKF A;  5HW3 A;  1YMX A;  3E0Y A;  3ICY A;  4LCM A;  1ALQ A;  1W7F A;  4DRT A;  3IX8 A;  4Y0U A;  4OON A;  2JBF A;  3BFC A;  1UGU A;  1HD8 A;  1J3W A;  3VP1 A;  2V9A A;  1NRJ A;  4LGW A;  3P98 A;  3UE3 A;  4X25 A;  2Z2M B;  1HLU P;  4IUK A;  3UB5 P;  1K56 A;  3NJA A;  1PW1 A;  1NJ4 A;  3UN7 A;  3KX0 X;  4Z1W A;  4HBU A;  3H82 B;  1IKI A;  2IWB A;  5L8M A;  3FKV A;  1CK3 A;  3IX3 A;  3LIF A;  3A3E A;  1CEG A;  4KZA A;  3H9W A;  4P6B A;  1ESI A;  5K5B A;  3UY6 A;  1F9I A;  2P04 A;  1JWP A;  2DRW A;  1Y28 A;  4IVI A;  2HP9 A;  4E3M A;  2WZZ A;  1K38 A;  4X69 A;  3Q07 A;  1HVB A;  3FZC A;  5G4Y A;  2O9C A;  2JKF A;  3EQV A;  1SDN A;  2EX6 A;  3CPT A;  3WRT A;  3SS3 A;  1NXY A;  4DMZ A;  4S2N A;  4P87 A;  3G35 A;  5FA7 A;  1V9Y A;  3ZYT A;  4JXS A;  2JN7 A;  4KZ6 A;  1IYO A;  4WM9 A;  3PAG A;  4FTX A;  3BYD A;  3CWF A;  3HLG A;  2ZLY A;  4MMN A;  2O99 A;  2INW A;  3BLM A;  2P74 A;  4R0Q A;  3DAV A;  3UE0 A;  1JVJ A;  2Y2N A;  1M40 A;  3MMH A;  3D9Y A;  2M7U A;  1FIL A;  4OQG A;  2L4R A;  4BBT A;  3ZNT A;  4Y0T A;  4B9O A;  1VEU B;  4HJ4 A;  4MN5 A;  3KYE A;  4OVD A;  1NLY A;  3TJZ C;  2WAD A;  2V0U A;  2Z2L B;  3KYQ A;  4MBH A;  4WLA A;  1CF0 A;  2VZW A;  3VP0 A;  4Y13 A;  2PR5 A;  3T1X A;  4S2J A;  1RGY A;  2HP5 A;  4GB7 A;  3EEA A;  5L2F A;  1FR1 A;  3L9K A;  4E04 A;  4C3Q A;  4LV0 A;  2ZMF A;  4XUX A;  3A0R A;  3IS2 A;  4BWI A;  2PHY A;  4S2I A;  2UWX A;  3FKW A;  4DKI A;  4UQI S;  2Y2Q A;  1J9M A;  2ACG A;  2KDK A;  1MWU A;  4I3I A;  2WK0 A;  3ITA A;  1PZO A;  3EGD C;  4OOM A;  3KSG A;  4DE1 A;  4JXG A;  1NWZ A;  1YM1 A;  1VQQ A;  3WS2 A;  3D4F A;  1E3U D;  4PM7 A;  5GL9 A;  3KSH A;  1WE4 A;  4GHI A;  3HLF A;  5L09 A;  4WUJ A;  3S7N A;  4LRX C;  2XA7 M;  4YWZ A;  3P7N A;  3TG9 A;  1I2W A;  1N9L A;  2VA0 A;  4KZB A;  4Y2F A;  3W2Z A;  3GMW A;  1H5X A;  2PU2 A;  5HFO A;  4B4Z A;  4X53 A;  1L0D A;  1E4D A;  5GHY A;  2L1M A;  4H8R A;  2D02 A;  5GHX A;  3P09 A;  2RCX A;  5AQB A;  4MLL A;  5EM0 A;  1GSX A;  1N4O A;  1YPR A;  2B95 A;  4HIA A;  2PAV P;  2WKE A;  3BW6 A;  4WYY A;  2VJW A;  5J3W A;  3QNB A;  1CQA A;  4BMW A;  1V9Z A;  2B02 A;  3G6O A;  4IHQ A;  1O7E A;  5CGX A;  3B42 A;  5F1F A;  3FPV A;  2H0T A;  1OJG A;  3MF0 A;  3S7P A;  1OTB A;  1RP5 A;  4P6Z M;  5FL3 A;  3T4S A;  1K4F A;  3MJQ A;  5DF7 A;  2V2F F;  1KE4 A;  3OCN A;  4II7 A;  2G7U A;  2JC7 A;  3UDX A;  2MJ6 A;  3G32 A;  1K56 D;  3HUO A;  3IWI A;  1NY0 A;  5FAQ A;  2A24 A;  5KSH A;  1KE3 A;  4GS9 B;  4K08 A;  4MCW A;  5F68 A;  2ZL1 B;  4EUZ A;  4UHU A;  2ZC7 A;  3HLD A;  5A91 A;  1K55 A;  2JHE A;  4GS9 A;  1P9W A;  1BT5 A;  2A24 B;  3LY4 A;  4I39 A;  2A49 A;  3TOI A;  2GJ3 A;  2XGN A;  5IHV A;  3CJM A;  1GA0 A;  2HJE A;  4I38 A;  3O3V A;  3OBF A;  5AQA A;  1XJ3 A;  4I3J A;  2ZOI A;  3WS5 A;  3JYI A;  2EFX A;  2PBD P;  1BLP A;  4Q8I A;  1S4R A;  4ESP A;  1T1B A;  3G34 A;  3W4Q A;  3E4O A;  1OPX A;  3IHA A;  2XD5 A;  1P97 A;  2HF6 A;  4IBR A;  2BTF P;  4CLC C;  4N9K A;  5F69 A;  3WS4 A;  3A3D A;  3EGX C;  3C30 A;  1DP9 A;  4KZ3 A;  2W3E A;  3DBA A;  4LRZ E;  3S22 A;  3LR0 A;  1TS8 A;  3HLB A;  3H7W A;  3LIB A;  4EBL A;  3VMA A;  2HDS A;  4D60 A;  5F83 A;  3CHW P;  4YNR A;  1XJ4 A;  3LID A;  4NK3 A;  2W27 A;  2JKT I;  1BTL A;  2LB9 A;  4ZRR A;  4OQH A;  3LIA A;  1X0O A;  2GDN A;  2XR0 A;  4HNB A;  4D2O A;  3V39 A;  5AVF A;  3MZE A;  5CGS A;  1IYP A;  4YFM A;  3GRJ A;  3BQA A;  1ONG A;  3IXD A;  2I9V A;  2X02 A;  2L0W A;  1FCM A;  3NOP C;  1YLZ A;  2OWH A;  4FCF A;  3IXB A;  2K7S A;  2XQZ A;  3IX4 A;  4MEZ A;  1EI5 A;  3UME A;  1MXO A;  2GZA A;  1CJF A;  2P9V B;  3V67 A;  4BL3 A;  4DXB A;  3NC8 A;  3UPO A;  1K4E A;  4M3K A;  1ERO A;  2WUQ A;  4QPR A;  3U2A A;  3BJN A;  2A3U A;  3NCK A;  4L9E A;  3GEC A;  1XKZ A;  4QY6 A;  2Y2O A;  1H8Z A;  1ZKJ A;  4R23 A;  3LR3 A;  1MBL A;  5FQI A;  5F82 A;  2GX5 A;  1GSV A;  3R4K A;  3UMD A;  2R9X A;  2W3H A;  4NXF A;  2IWD A;  3NDG A;  5I94 A;  2O0Y A;  3C8C A;  1TS0 A;  4OOY A;  1PW8 A;  3VFH A;  5EVI D;  1S1Y A;  1YQS A;  5G18 A;  1YAX A;  4OP8 A;  1BYW A;  4X1M A;  5FAT A;  3Q82 A;  1ERQ A;  4R6L A;  2VEA A;  3JVV A;  4Y15 A;  2PD8 A;  3FG8 A;  4R3B A;  1TS7 A;  4MNR A;  1RCJ A;  2RL3 A;  2OAP 1;  3C7V A;  4GD6 A;  4OPZ A;  3V3R A;  4F3L A;  3IXH A;  3LIE A;  2VGL M;  5FQ9 A;  3F1P A;  2YKF A;  3HLC A;  3O88 A;  4GD8 A;  4ID4 A;  2ZJ9 A;  4HES A;  3F1P B;  5HL1 A;  2ZQC A;  5HDD A;  1WYC A;  1SHV A;  3V50 A;  2E8I A;  1ERM A;  4KEN B;  4R38 A;  3LI9 A;  3Q7V A;  1T19 A;  3CPT B;  3IQA A;  4GJ4 A;  4DXC A;  3O5Y A;  2J9O A;  3C4O A;  2P7J A;  4JLF A;  3E2K A;  1DY6 A;  4PHT A;  1PI5 A;  3AGD A;  4KQD A;  3FPW A;  3MS6 A;  2LB5 A;  1N9O A;  2OLV A;  2XK1 A;  3ZVW A;  4F94 A;  1PRQ A;  3OPP A;  5AQ7 A;  5U47 A;  4BQM A;  1K57 A;  4OLD A;  4LLO B;  1W63 Q;  1HZO A;  3VSL A;  2WKR A;  3MBZ A;  3B47 A;  3F1O B;  1D1J A;  3K3D A;  3V3S A;  2QMI A;  5I5L A;  4N9L A;  1L0G A;  5FQJ A;  3JPU A;  2O9A A;  3T1S A;  4ME4 A;  4PM6 A;  2DMW A;  2J3W A;  3FWL A;  1S67 L;  1SDE A;  3IS2 B;  4BL2 A;  3CI6 A;  4EV4 A;  3LFV A;  4CLC D;  5KZH A;  2P9V A;  4H6J A;  3V5M A;  1CI9 A;  2C5W B;  2R78 A;  2HJ9 C;  5F6A A;  3BLS A;  3LYX A;  1NRF A;  3MFX A;  1LI0 A;  3KO6 A;  5M19 A;  2OAQ 1;  4U0T A;  5HAP A;  2JE5 A;  4WBG A;  5AVE A;  1KE0 A;  5DF9 A;  3LEQ A;  4WEL A;  4KZ9 A;  4E3N A;  2XFS A;  4RVA A;  4GKU A;  2ZC4 B;  3DWZ A;  5DF8 A;  3D3O A;  3S1Y A;  3SS5 A;  4HY8 A;  3VSK A;  1XA1 A;  2FFF B;  3BEB A;  3W8K A;  4E6W A;  2VV6 A;  5JYP A;  3D72 A;  4O0P A;  2WYX A;  1Y54 A;  1XGI A;  1ESU A;  2XD1 A;  4K0W A;  5HZH A;  4C75 A;  4GW9 A;  1FR6 A;  2Y2G A;  1STZ A;  3FYZ A;  1BZA A;  3MXR A;  3PBS A;  5GLA A;  2ZMA A;  4EQ1 A;  5IS1 A;  3OLO A;  4MBF A;  5L07 A;  3MZF A;  2P08 A;  1W79 A;  3RFB A;  1LSX A;  4EEP A;  4CLC A;  4ZJ1 A;  1W5D A;  3R7W A;  3HUN A;  4JKT A;  4FUW A;  3RH8 B;  1DP6 A;  4R1G A;  2WAF A;  3Q7V B;  2WGW B;  4BJP A;  1ZHH B;  2EFU A;  1Y4O A;  2BAS A;  5J4E A;  4S2K A;  1NLZ A;  4DE0 A;  3EOI A;  3UB6 A;  1XX2 A;  1S6R A;  4JBF A;  4JGO A;  5EVL A;  5EVE A;  4P6Z S;  4EXO A;  2WKI A;  1YLY A;  4WZ5 A;  4ZDX A;  1YLT A;  2WKH A;  5HWW A;  4WL9 A;  2QYB A;  2Y2I A;  4ETZ A;  4KUO A;  3MQQ A;  3IT9 A;  3GVB A;  1TDL A;  5EEC A;  1ZG4 A;  1DP8 A;  4Q0I A;  4JPM A;  2EX8 A;  1G5U A;  4U0X A;  3A0S A;  3K3C A;  3G31 A;  3BRM A;  2PBY A;  1G6A A;  2ZQ7 A;  3UB9 A;  3NOT C;  3PBO A;  1L2S A;  4HJ6 A;  4EU0 A;  5HAQ A;  5CXW A;  2Y4A A;  4NXE A;  4BD1 A;  3LI8 A;  2W1T B;  3VOY A;  3HJI A;  2Y59 A;  4NG2 A;  2J3T C;  2Y2H A;  4WZ4 A;  1JWV A;  1ES3 A;  5DJU A;  2QZ6 A;  3UE6 A;  3PBN A;  1K54 C;  3ZHH A;  3ZG7 B;  4WZ5 C;  1LL9 A;  4N1H A;  4PM9 A;  1TVF A;  1OTI A;  4KG5 A;  4S2N C;  1HTZ A;  3S7O A;  4GCZ A;  3RJU A;  3PBQ A;  1ZC2 A;  2QWS A;  1KVM A;  3KSI A;  4PM5 A;  4WEK A;  3A3J A;  2G2W A;  1TS6 A;  4DJ2 A;  5HL6 A;  5DFY A;  2W0N A;  3HUM A;  4PMA A;  2XA7 S;  3C7U A;  4ZBE A;  1KGF A;  3DTI A;  1MC0 A;  2QPN A;  1G28 A;  2H28 A;  1OTE A;  4DE2 A;  4EEU A;  1O07 A;  5HX9 A;  2PDR A;  4LV2 A;  4U3T A;  1VET B;  2QJ5 A;  3SH8 A;  3KSF A;  2NUT C;  3IF6 A;  3LGO A;  3QP5 A;  4UA6 A;  1ZG6 A;  2ZQA A;  1UWN X;  3LR5 A;  4HOI A;  4FH4 A;  4EBP A;  5EOO A;  4S2M A;  3NDE A;  2WAE A;  3T4O A;  3F1O A;  4RYE A;  5CEC A;  3IF6 C;  2V8C A;  3G2Z A;  4PKY A;  3DTK A;  4CJN A;  1F2K A;  3NUL A;  2PU4 A;  4Y7P A;  2EX9 A;  3W4O A;  1FIK A;  4GNU A;  3OPL A;  1ZTU A;  2QHK A;  4O8G A;  5CRF A;  2Q9N A;  1GCE A;  2Y2L A;  4X56 A;  5EVI B;  1U60 A;  2W1R A;  4QY5 A;  3O87 A;  5FAO A;  2VLG A;  1RGZ A;  1Z09 A;  5EUA A;  4X1L A;  1BLC A;  3C5A A;  4IVK A;  1VHM A;  5FDS A;  1ONH A;  1XPB A;  2XEP A;  3T12 B;  2EWW A;  1VM1 A;  3PXP A;  1IEM A;  3Q7Z A;  4GDB A;  4E3O A;  4Q0J A;  2FZ0 A;  3QP2 A;  3NIA A;  5M1A A;  4Y3I A;  1XXM A;  1A0K A;  2FH5 A;  2J3T D;  4QD4 A;  2OV5 A;  3CIT A;  3BFF A;  3ITB A;  5EV0 A;  4E6X A;  3G30 A;  3FC7 A;  3HLW A;  4HQA A;  3L7H A;  3MFD A;  2JKR M;  3S7Q A;  4JGR A;  1JTD A;  2J9P A;  4QWO A;  5E2E A;  2Z6C A;  5D3O A;  4WMC A;  4JXV A;  4OLG A;  3I7J A;  4KG2 A;  3UDI A;  1SZV A;  3MXQ A;  3IH9 A;  5FI2 A;  4B93 A;  1MWT A;  4JGQ A;  4RA7 A;  3E2L A;  4EWF A;  2CC1 A;  3F1N A;  2W3D A;  4OKP A;  2IWC A;  5CEB A;  4LFU A;  2DCF A;  1DJB A;  4CLC E;  4S2O A;  5FSR A;  1LHY A;  2Y2J A;  4LV1 A;  2ZC3 B;  4C6Y A;  1K54 A;  1PIO A;  2HV1 A;  5CHJ A;  3QNC A;  5EE8 A;  1GHP A;  3IF6 B;  4HBT A;  3H7W B;  3K2N A;  4OOL A;  4MN7 A;  4QHC A;  5EVI C;  1LT0 A;  3PTE A;  1S66 L;  1K57 C;  4YIN A;  5GLC A;  3S4X A;  3M2K A;  2Y2K A;  3DTM A;  3BFD A;  2EWV A;  4X68 A;  1QME A;  3FV7 A;  4RX3 A;  4BEN A;  2KLI A;  1Q2P A;  4R3J A;  4IJG A;  4BLM A;  5JYO A;  5TBM A;  1PI4 A;  5E43 A;  1XA7 A;  3QP1 A;  4OQ0 A;  3T4Q A;  1OJ5 A;  1MWR A;  1MWS A;  3ZGA B;  3HJK A;  3LY3 A;  3VE3 A;  1H3Q A;  2O9B A;  3JVU A;  1L0E A;  3ZCZ A;  1XFQ A;  3QP4 A;  1GHI A;  3E98 A;  3CG5 A;  4HP4 A;  3ZNY A;  4E3L A;  3ULF A;  3IF5 A;  3U4L P;  4OP5 A;  1JNU A;  1Z6F A;  3VOL A;  1MKI A;  5LBR A;  3H82 A;  3MSH A;  4BD0 A;  1BUL A;  4UQI M;  4G3V A;  2DNS A;  2W1T A;  1S1Z A;  2K31 A;  4ZAM A;  1M6K A;  4FD8 A;  3UB8 A;  2VV8 A;  3TE8 A;  2V1Z A;  3G4P A;  2V1A A;  1XJ2 A;  4K91 A;  4IED A;  4HH3 A;  3RXW A;  3G2Y A;  2V1B A;  2YKH A;  4N1X A;  4HP9 A;  4KZ4 A;  5A92 A;  2ZC6 B;  3A0V A;  2QJ7 A;  1OT9 A;  5CHM A;  1IFQ A;  3C2W A;  3M6H A;  1XP4 A;  3AGF A;  3VV4 A;  3LO7 A;  5CER A;  4P85 A;  3OC2 A;  1K6R A;  1OME A;  4OQI A;  4KQR A;  1T1C A;  2HDQ A;  3TRC A;  4JGP A;  3ZDJ A;  4CPK A;  5GHZ A;  4MN6 A;  1PWD A;  3GDI A;  1SCW A;  1T1A A;  5FQQ A;  1IYQ A;  3BFG A;  4DN0 A;  3MQO A;  1YLP A;  3SW1 A;  2WKQ A;  3ISG A;  1VB6 A;  2XLN A;  1KOU A;  5EPH A;  4JF4 A;  2X01 A;  1W63 M;  4KZ5 A;  5KIZ A;  3GV9 A;  2B5R A;  1LI9 A;  4X6T A;  2EA9 A;  1MY8 A;  5TBM B;  1T18 A;  3SS4 A;  1JTG A;  2C6W B;  3UE1 A;  2ZM0 A;  3IWQ A;  2WGW A;  2ZBB A;  1KDS A;  1KGG A;  2WKP A;  4N92 A;  4UEY A;  5HDS A;  4L9F A;  3PHY A;  5HAR A;  1S0W A;  1SKO A;  3PBT A;  4E3K A;  4R70 A;  3PBR A;  1YMS A;  3IXG A;  1N9N A;  1OT6 A;  3MZD A;  1PZP A;  1P0Z A;  3GSG A; 
#chains in the Genus database with same CATH homology
 3LR0 A;  2ZOH A;  1TS8 A;  2W3F A;  5MC7 A;  4I5S A;  5DJU A;  1GSW A;  4DJ3 A;  3H7W A;  3LIB A;  3UE6 A;  2A2L A;  1LSV A;  4KUK A;  4WN5 A;  3BY8 A;  4O01 A;  3PBN A;  4CQH A;  2XSS A;  3E4Q A;  2JKT M;  2QKP A;  4YNR A;  1XJ4 A;  4HH2 A;  3LID A;  5IT5 A;  2W27 A;  1OTI A;  3LUQ A;  3UB7 A;  4BBV A;  2JKT I;  5HPI A;  3EEH A;  2LB9 A;  3MR0 A;  4ZRR A;  3S7O A;  4GCZ A;  3T4K A;  3PBQ A;  2CMN A;  3CUE A;  3C38 A;  3LIA A;  3BQ8 A;  3LIC A;  4ARZ B;  5AJG A;  3VE4 A;  1X0O A;  2QWS A;  4HNB A;  3KSI A;  1EW0 A;  2KX6 A;  4NKP A;  5AVF A;  4HJ3 A;  4WEK A;  3T4L A;  3BQA A;  3PR6 A;  1TS6 A;  4DJ2 A;  5HL6 A;  5DFY A;  2W0N A;  2I9V A;  2B18 A;  2XA7 S;  2L0W A;  4GHI B;  3NOP C;  5HD3 A;  2OWH A;  1MC0 A;  3HCY A;  5A8B A;  4EW7 A;  2K7S A;  1G28 A;  2H28 A;  1OTE A;  3UME A;  4EEU A;  4NXG A;  2PDR A;  2GZA A;  3V67 A;  2QJ5 A;  3E0Y A;  3ICY A;  4LPZ A;  1G6O A;  3KSF A;  2NUT C;  1UGU A;  1UWN X;  3LR5 A;  2V9A A;  4QPR A;  1NRJ A;  3U2A A;  1F5M A;  3BJN A;  3UE3 A;  4HOI A;  4L9E A;  2K2N A;  3GEC A;  4IUK A;  3IBR A;  2PYR A;  3NJA A;  3NHQ A;  3LR3 A;  5DKL A;  3KX0 X;  4RQ9 A;  4Z1W A;  5DJT A;  4KQO A;  2GX5 A;  1GSV A;  2PT7 A;  3T4O A;  3B33 A;  3F1O A;  3R4K A;  3UMD A;  3H82 B;  2J80 A;  2W3H A;  4PKY A;  4NXF A;  5L8M A;  4EET B;  4F3L B;  1D7E A;  2O0Y A;  3C8C A;  1TS0 A;  3RTY A;  3LIF A;  1S1Y A;  1ZTU A;  1YAX A;  3H9W A;  1BYW A;  5K5B A;  2QHK A;  4HI4 A;  5J7E A;  1MKM A;  4R6L A;  2VEA A;  3JVV A;  4IUH A;  1F9I A;  4O8G A;  2P04 A;  1Y28 A;  2PD8 A;  4ARZ A;  3FG8 A;  1TS7 A;  4EER A;  2W1R A;  5G4Y A;  1LSW A;  2O9C A;  2VLG A;  2OAP 1;  3EQV A;  4G3W A;  1XJ6 A;  1OTD A;  4DMZ A;  1DRM A;  1VHM A;  4F3L A;  3LIE A;  2VGL M;  1V9Y A;  3ZYT A;  2EWW A;  3F1P A;  5TJJ A;  2JN7 A;  2YKF A;  3KYZ A;  3PXP A;  4XT2 B;  3F1P B;  4Q0J A;  4H6J B;  3CWF A;  2FZ0 A;  1LL8 A;  4MMN A;  2O99 A;  5HDD A;  4Y3I A;  2INW A;  4M4X A;  4R38 A;  2M1C A;  2FH5 A;  2J3T D;  4HHD A;  3LI9 A;  1T19 A;  3CIT A;  4FSF A;  4GJ4 A;  3MMH A;  1XFN A;  3O5Y A;  2M7U A;  3FC7 A;  4HQA A;  2XRN A;  2P7J A;  4CLC B;  2JKR M;  2L4R A;  2OOL A;  3S7Q A;  3T4T A;  4BBT A;  4PHT A;  4JGR A;  4B9O A;  4KQD A;  3FPW A;  4L9G A;  2LB5 A;  1YSQ A;  4HJ4 A;  4MN5 A;  4EES A;  1N9O A;  5HPF A;  1NLY A;  3TJZ C;  2V0U A;  2Z6C A;  3KYQ A;  3LR4 A;  4WLA A;  2VZW A;  4L0L A;  2KOI A;  1P9R A;  4LLO B;  2PR5 A;  3MXQ A;  4B93 A;  1YKD A;  3T50 A;  4JGQ A;  1W63 Q;  5HD5 A;  2WKR A;  4AFI A;  3B47 A;  1TF1 A;  3EEA A;  3F1O B;  3CAX A;  3F1N A;  2W3D A;  3K3D A;  3IBJ A;  4E04 A;  2ZMF A;  5I5L A;  3E4P A;  3A0R A;  4CLC E;  3IS2 A;  4BWI A;  2PHY A;  1F98 A;  4UQI S;  4R3A A;  2JKR I;  2O9A A;  4ME4 A;  2HV1 A;  3OCL A;  4PKY G;  2DMW A;  2IA2 A;  2KDK A;  3H7W B;  2GNX A;  3K2N A;  3MQ0 A;  4I3I A;  4OOL A;  2J3W A;  3EGD C;  3OOV A;  1S67 L;  4MN7 A;  4OOM A;  3IS2 B;  3KSG A;  3CI6 A;  1LT0 A;  5HWT A;  3LFV A;  4CLC D;  1S66 L;  4H6J A;  1NWZ A;  2R78 A;  5F6A A;  2HJ9 C;  5DFX A;  1TD5 A;  4XT2 A;  3LYX A;  4NEE D;  2Y79 A;  3MFX A;  3KO6 A;  3T4J A;  2OAQ 1;  3KSH A;  3BY9 A;  4GHI A;  2EWV A;  4Y5F A;  2XRO A;  5AVE A;  4WUJ A;  3S7N A;  5DF9 A;  4LRX C;  2KLI A;  4FOF A;  4IJG A;  2XA7 M;  3P01 A;  4WEL A;  4YWZ A;  3P7N A;  4Y2F A;  1N9L A;  2VA0 A;  5TBM A;  3ZQ5 A;  3W2Z A;  2HGV A;  3D3O A;  2OWJ A;  2VKS A;  4HY8 A;  3T4Q A;  1OJ5 A;  2VV6 A;  4Q0H A;  2L1M A;  2M7V A;  3HJK A;  1MZU A;  5C5K A;  2D02 A;  3D72 A;  3VE3 A;  4O0P A;  1UWP X;  4WEJ A;  2ZMV A;  3CLO A;  1H3Q A;  2O9B A;  3JVU A;  1GSX A;  5HZH A;  2VV7 A;  4GW9 A;  1XFQ A;  4BBU A;  3E98 A;  4HP4 A;  1YSP A;  3ULF A;  4HIA A;  1STZ A;  1JNU A;  5HWV A;  3VOL A;  3PBS A;  5LBR A;  4EQ1 A;  3H82 A;  5IS1 A;  3NOU C;  3OLO A;  4GLQ A;  4UQI M;  5DKK A;  4G3V A;  3BW6 A;  2P08 A;  2W1T A;  1S1Z A;  3RFB A;  2PYP A;  1LSX A;  2VJW A;  5J3W A;  2K31 A;  4YOF A;  4WF0 A;  4EEP A;  4CLC A;  4BMW A;  3PYP A;  1V9Z A;  2B02 A;  3G6O A;  4IHQ A;  3UB8 A;  3R7W A;  3TW8 A;  3B42 A;  2VV8 A;  2Z6D A;  3EWK A;  3FPV A;  3TE8 A;  1OJG A;  3MF0 A;  3RH8 B;  1DP6 A;  2V1A A;  1XJ2 A;  3S7P A;  1OTB A;  4BJP A;  1ZHH B;  4P6Z M;  4HH3 A;  5FL3 A;  3EQU A;  3T4S A;  2BAS A;  3MJQ A;  5J4E A;  4I3A A;  2V1B A;  2YKH A;  4HP9 A;  1NLZ A;  5G4Z A;  4EUV A;  4NXB A;  2Y8H A;  3EOI A;  3UB6 A;  1H8M A;  5IU1 A;  3OCN A;  4II7 A;  3A0V A;  2QJ7 A;  1OT9 A;  2G7U A;  1IFQ A;  2W3G A;  3C2W A;  3VV4 A;  4JGO A;  3CUE C;  2MJ6 A;  3F1N B;  3OC2 A;  2V0W A;  2D01 A;  4P6Z S;  1T1C A;  4EXO A;  3TRC A;  4JGP A;  2A24 A;  5KSH A;  4GS9 B;  4K08 A;  4MCW A;  4PAU A;  4MN6 A;  1S4S A;  4LRY C;  5F68 A;  5CX7 A;  5HWW A;  4WL9 A;  3GDI A;  2QYB A;  2JHE A;  4ETZ A;  3MQQ A;  4G3K A;  1T1A A;  4GS9 A;  1P9W A;  4KUO A;  4DN0 A;  3MQO A;  2A24 B;  5F5Y A;  4I39 A;  3SW1 A;  2WKQ A;  1VB6 A;  2GJ3 A;  1KOU A;  2VGL S;  4MDZ A;  1DP8 A;  2PR6 A;  5HDC A;  1W63 M;  4Q0I A;  5KIZ A;  2EA9 A;  5TBM B;  1T18 A;  2HJE A;  4I38 A;  5HSQ A;  3OBF A;  3A0S A;  3K3C A;  4I3J A;  1XJ3 A;  5EFW A;  2ZOI A;  2ZBB A;  1OTA A;  2NUP C;  2WKP A;  4UEY A;  5HDS A;  3UB9 A;  3NOT C;  4L9F A;  3PHY A;  3PBO A;  1ODV A;  1S4R A;  4HJ6 A;  1D06 A;  4EU0 A;  1T1B A;  3PBT A;  3E4O A;  1OPX A;  1WA9 A;  1IOU A;  3R7W B;  1P97 A;  4R70 A;  2HF6 A;  3PBR A;  3BWL A;  4NXE A;  3LI8 A;  4CLC C;  2W1T B;  4ETX A;  1N9N A;  5F69 A;  3HJI A;  3EGX C;  1OT6 A;  3C30 A;  1DP9 A;  2J3T C;  2VX8 A;  2PD7 A;  2W3E A;  1P0Z A;  3DBA A;  4LRZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...