1OT6A

Cryotrapped crystal structure of the e46q mutant of photoactive yellow protein under continuous illumination at 110k
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ot6A00
4JGQA 4HOIA 5IU1A 1LSWA 4HH2A 3UMDA 4KUKA 1LL8A 1NWZA 3CWFA 2PD8A 4GW9A 5AVEA 5DJTA 4LPZA 4MN5A 1N9LA 4EW7A 1DP6A 3A0VA 4E04A 2H28A 4HJ6A 4L9GA 2KX6A 3MR0A 3GECA 1N9OA 2QKPA 2R78A 1D7EA 4JGOA 4BBTA 4YWZA 1X0OA 3BY8A 4L9FA 4XT2A 3LIDA 1OT9A 1XJ3A 3H82A 5F69A 5HWWA 4GS9B 2GJ3A 1EW0A 3F1PB 5HSQA 3GDIA 5DKLA 3ICYA 4WUJA 3SW1A 1OTAA 5J3WA 5G4ZA 3UE6A 5J4EA 3C8CA 1OTDA 3MQOA 1OJ5A 4LRZE 1TS0A 4I3JA 1F98A 4MN6A 3H7WB 3MXQA 3KX0X 4KUOA 1DP8A 5TBMB 4I5SA 1T19A 3BY9A 4BBUA 5HDSA 4M4XA 4L9EA 2Z6CA 3UB8A 3ULFA 3K3DA 3MFXA 3F1OB 3NOPC 3E4PA 1N9NA 3IS2B 3FG8A 4JGRA 4EXOA 2D01A 5F5YA 1OT6A 4R38A 3CLOA 4EQ1A 4GHIB 4WLAA 1XJ4A 4LLOB 1G28A 4I3IA 3VE4A 4HH3A 4GS9A 3F1PA 3NHQA 4F3LB 1GSXA 1UWPX 3B33A 3A0SA 3E4QA 4NXEA 5HD3A 2K7SA 2PR5A 1XFNA 1ODVA 3LIFA 1TS8A 2V0UA 1T1BA 2W0NA 3H7WA 5TBMA 1OTBA 1LT0A 1OTIA 4HHDA 3IBRA 3D72A 3F1NB 3PHYA 3P7NA 5HWVA 1S4SA 3LI8A 1S4RA 1T18A 3IS2A 1TS6A 5F68A 3UB9A 1TS7A 2D02A 4HJ3A 2L1MA 1OJGA 2OWJA 4EETB 2VV6A 1LSXA 2JN7A 3LUQA 4LRYC 4GHIA 2ZOHA 4EERA 5KIZA 4HQAA 3C2WA 4RQ9A 4F3LA 1VB6A 4WF0A 1KOUA 3EWKA 2QJ5A 3LIEA 4LRXC 2Z6DA 2V1BA 3UMEA 1T1CA 4R3AA 5HD5A 2YKFA 2BASA 2KDKA 2PDRA 4NXBA 4KQDA 2VEAA 3FC7A 2V9AA 3HJKA 2V0WA 4PKYA 4B9OA 2L4RA 4GCZA 3LICA 4I3AA 3F1NA 2PYRA 3LYXA 3OLOA 2PD7A 4WN5A 1V9YA 3G6OA 5A8BA 5IS1A 4HIAA 3PYPA 5DJUA 2QJ7A 2P7JA 4HP4A 2ZOIA 1DP9A 4H6JB 5EFWA 3ZQ5A 4BBVA 1OTEA 1GSWA 3UB7A 3MJQA 3K3CA 2M1CA 4DJ2A 2YKHA 3RH8B 4HY8A 2WKPA 1S1ZA 3UB6A 2ZBBA 1XFQA 4R6LA 1T1AA 1S66L 2I9VA 2A24B 2OWHA 1JNUA 4K08A 2PYPA 3BWLA 4I38A 1P0ZA 3CAXA 4HP9A 2OOLA 3E4OA 4NXGA 2VLGA 4EEUA 2V1AA 5G4YA 2WKRA 3F1OA 1XJ6A 1D06A 2L0WA 5I5LA 2QHKA 4DJ3A 2INWA 1V9ZA 5HWTA 2WKQA 5AVFA 3NJAA 3VOLA 3H9WA 2JHEA 1GSVA 4NXFA 3HJIA 4PKYG 3EEHA 2B02A 5HDDA 2EA9A 1LSVA 1S1YA 4H6JA 4HI4A 3NOTC 4HNBA 4I39A 4HJ4A 3LIBA 3VE3A 3MQQA 5HZHA 4R70A 5F6AA 1P97A 5DKKA 1UWNX 5HDCA 2QWSA 2A24A 1Y28A 4XT2B 3A0RA 1MZUA 2HV1A 3RTYA 3H82B 1WA9A 1UGUA 1S67L 2VV7A 3NOUC 1XJ2A 3LI9A 4JGPA 4EEPA 2J80A 5J7EA 2PHYA 2CMNA 3T50A 3LIAA 2PR6A 2W27A 1F9IA 4EESA 1BYWA 2VV8A 4WL9A 1DRMA
chains in the Genus database with same CATH superfamily
2B95A 5CHUA 4HOIA 4UEYA 1E4DA 3FWLA 1BLSA 5EVEA 3HLCA 3OZHA 3UMDA 1LL8A 1N4OA 3NBLA 1HTZA 5AVEA 1NJ4A 1DJAA 1G6AA 5HL1A 3IWOA 3MF0A 4N9LA 2H28A 4L9GA 5FAOA 2KX6A 3BM6A 2XFSA 4PM9A 4Y2FA 3V39A 2R78A 4QJGA 4QU3A 4BBTA 4YWZA 1HZOA 3BY8A 3LIDA 1YLYA 1FR6A 5TFQA 1SKFA 1K55C 3DWKA 3TJZC 2Q9MA 5F69A 1EW0A 2XQZA 1ZG6A 3D9YA 3P01A 3FYZA 5CRFA 3MQOA 1OJ5A 4LRZE 2GX5A 1XPBA 2O9BA 5E43A 3KSIA 2Y4AA 4KUOA 1DP8A 5U47A 1ES5A 4JF5A 4S2JA 3BFDA 5FSRA 4KQOA 5CERA 4WMCA 1PWGA 4WELA 1ERQA 3N6IA 5AQAA 1ALQA 3UPNA 3TSGA 2OLUA 3N8SA 5TR7A 1VETA 2XLNA 4E3MA 2MJ6A 3N4IA 4GLQA 2WUQA 4EXOA 5EVID 3DTMA 4EQ1A 2EWVA 4M3KA 1J3WA 4PM8A 2VA0A 4LLOB 4QHCA 4I3IA 3NI9A 3VE4A 4F94A 4GD6A 1IFQA 4DE3A 1GSXA 4KZ3A 1UWPX 3B33A 3A0SA 3VP0A 2K7SA 4R4RA 4QB8A 4ZTKA 2A49A 2ZMAA 4UAAA 3NCKA 1KE4A 3Q7VB 1TS8A 1SZVA 2V0UA 2J3TD 2HZ5A 1OTBA 1BULA 5FQQA 3IBRA 2JKRM 1KVMA 3HL9A 1MKIA 3F1NB 2WGVA 5CHMA 4ZJ3A 3UNWA 3CITA 3PHYA 4JPMA 5L10A 3P7NA 3ZNYA 2ACGA 1I2SA 3GMWA 3ITBA 4S2NA 3ZG7B 2UV0E 3C7UA 3B47A 2ZQ8A 3UB9A 2D02A 5CGXA 3MKFA 2OWJA 2VV6A 1F2KA 5CTMA 1FCNA 1W63M 3IWQA 2ZD8A 2ZMFA 4GHIA 4Q0HA 3OOVA 3GR2A 2EXAA 2C6WB 2O9AA 3D4FA 1W5DA 2OAQ1 2Y2HA 4ARZA 3ZGAB 4LGWA 4DXBA 4DDYA 4JXWA 1VB6A 2V1BA 3UMEA 1T1CA 2XROA 1XXMA 1MWRA 5HARA 3JVUA 3IF6C 1JWVA 1S6RA 3ZG5A 4KZ9A 3FPWA 2YKFA 3TOIA 4P85A 4KQDA 3BLSA 3FC7A 1J9MA 4G3KA 2JKRI 3EEAA 2WGIA 3DTIA 1NY0A 3LICA 1H0MA 3LYXA 4WN5A 1V9YA 5A8BA 4G3WA 3AGEA 4BMWA 3OPRA 3HLGA 2Y2GA 3ZQ5A 3SOIA 3HCYA 5J8XA 3JYIA 3O86A 4Y3IA 1XGIA 3CPTA 5CEBA 5HFOA 3UB7A 5KZHA 3MJQA 3K3CA 3WS5A 2R9WA 3NDGA 3T1QB 4XUXA 2K31A 3RH8B 2ZM0A 2E8IA 3MBZA 5A93A 1XFQA 1DJBA 2B5RA 4R6LA 4OP5A 2IA2A 4FOFA 3RXXA 5CECA 2A24B 1FR1A 3ZDJA 4DRTA 4IBRA 3DAVA 1AWIA 1H8YA 3BWLA 4I38A 1P0ZA 5CGWA 2OOLA 3QP5A 4U0TA 3FKWA 4E3KA 3CG5A 2V1AA 4EUZA 5BOHA 3U4LP 2GDNA 4Q0JA 4CLCD 1D06A 5HX9A 2L0WA 2HP5A 3CJMA 5I94A 3RJUA 4YFMA 4R3BA 5EVLA 2OAP1 3SZTA 5FI7A 2W3GA 2ZQDA 3IXGA 4Y17A 2V8FA 4NXFA 2ZLYA 3EEHA 2W1RA 1GCEA 1S1YA 1PWDA 3T4OA 2XGNA 3NOTC 2ZM2A 3T4TA 2VKSA 2ZQCA 1NXYA 4B93A 4OOYA 3B3XA 5L07A 4B88A 3EQVA 5HZHA 2Y2IA 2XF3A 5F6AA 2Y2QA 1ZKJA 4LCMA 1P97A 1BT5A 3O5YA 1VQQA 5A91A 5M18A 4XT2B 4OPYA 5AJGA 1GHMA 3IHAA 4ETXA 5L8MA 1M6KA 3IH9A 5HAPA 3NOUC 1YKDA 1XJ2A 4BD0A 4OLDA 3BFEA 2UWXA 1VEUA 2XA7M 3HBRA 4GJ4A 4X25A 1CK3A 1LI9A 3ZHHA 4WL9A 2XFTA 1Q2QA 5E2EA 4WEJA 3ITAA 3O88A 4MCWA 1BLHA 5DF9A 1LSWA 4HH2A 4KUKA 1WE4A 5HAQA 4OOLA 1SDEA 1HD8A 3NECA 2P9VA 2PD8A 4MDZA 5CGSA 3T4SA 4GW9A 1I2WA 1SDNA 1H3QA 1XA7A 4LPZA 1N9LA 1DP6A 4K91A 4GDNA 1NYYA 1RGYA 4GNUA 3LR5A 1IOUA 1CQAA 1N9OA 2QKPA 3G35A 1OPXA 2PT7A 4JGOA 1NLYA 3P09A 5FEFA 4L9FA 1E3UD 2ZMVA 3Q7ZA 5HWWA 1CEGA 3W8KA 4GS9B 2GJ3A 4UA6A 3WRZA 4UA7A 1PZPA 5HSQA 3GDIA 4HBUA 3CPTB 5J4EA 1BLCA 3PBOA 2HDRA 3C38A 4FUWA 1TS0A 4C6YA 3OC2A 1F98A 2ZQ7A 3H7WB 3MXQA 3KX0X 3LEZA 5TBMB 2HDQA 4I5SA 1TVFA 1P9WA 3D3OA 3A3IA 2O99A 3ZG9B 5HDSA 2WZXA 4M4XA 3A3JA 4L9EA 3QP4A 1SKOA 1L0GA 1LL5A 1RP5A 4Y15A 3ULFA 2M7VA 3NULA 3K3DA 2HF6A 1PI4A 3NOPC 4OP8A 2HJEA 3E4PA 3G31A 4FCFA 3QP8A 2FFYA 5EVIA 3QP1A 4S2NC 1MWUA 3EQUA 3FG8A 3O87A 3TG9A 4KZ7A 4B4XA 2PU4A 2D01A 1OT6A 1L0FA 3G30A 3IH8A 1MY8A 3ZCZA 2H5SA 5FASA 4MNRA 4Y0OA 3E2LA 4HESA 4BQMA 5TGFA 5FEGA 4BL3A 2Z2MB 3F1PA 4X56A 3LGOA 4NXEA 1XFNA 3LY3A 5A92A 3LCEA 3LIFA 3FV7A 1W7FA 4ID4A 3OPHA 5DFYA 4L0LA 3D72A 1XX2A 1NYMA 4S2OA 1KVLA 2Y55A 1S4SA 4JXGA 3LI8A 2ZL1A 1H8ZA 1S4RA 2GZAA 4JKTA 3IS2A 4MEZA 4Y0UA 1FCOA 3SH9A 1KDSA 1MBLA 2L1MA 1ZHHB 1LSXA 5DTKA 2JN7A 2ZC4B 3EOIA 5FQ9A 4LRYC 3S1YA 1MC0A 3BJNA 5GLDA 4QPRA 4E3JA 5E2GA 4PM6A 4KENB 2I72A 2WADA 2FFFB 4F3LA 4N9KA 1Z09A 3UDXA 3EWKA 2A3UA 3LIEA 2EXBA 5E2FA 1Q2PA 5DVAA 4LRXC 4OPQA 2JKGA 3UDIA 4LV0A 3IF5A 3IF6B 2Y2KA 4DE0A 3HLDA 4MBHA 2XEPA 3FZCA 2DNSA 2QZ6A 2M7UA 1L0EA 2BASA 1VM1A 2Y2PA 3ZYTA 2PDRA 3UPOA 4NXBA 4UA9A 2VK3A 3V5MA 1IYQA 2B18A 1XKZA 5CX7A 3GTCA 4QY6A 2PYRA 2XR0A 2EX6A 2ZJ9A 5IS1A 3L7HA 1PNEA 4HP4A 2ZOIA 4IVIA 1DP9A 3PBQA 2X02A 2JKTM 4DMZA 1G5UA 3UB5P 4HEFA 2DCFA 2JKFA 4PM5A 2W1TB 1QMFA 3HLWA 2WK0A 1RCJA 1S1ZA 4OLGA 3E2KA 4GZBA 2V8CA 1T1AA 1JTDA 4IUKA 4JF6A 3VMAA 1SKOB 1JNUA 4K08A 4OQGA 2WZZA 2X01A 1KGGA 5F1FA 4KZ8A 4X1MA 3LY4A 3E4OA 3CZDA 4EWFA 2VLGA 4EEUA 2PU2A 4CLCA 5G4YA 3IBJA 5IHVA 3G34A 1XJ6A 4R0QA 2OLVA 5DF8A 3PAEA 3WS4A 3PBRA 1V9ZA 4EQIA 5HWTA 2WKQA 5AVFA 4FH2A 3VOLA 3LR3A 2Y8HA 3LO7A 2B02A 5HDDA 2EA9A 2VGJA 1LSVA 3QP6A 5D3OA 2XD5A 4H6JA 2JKTI 3V50A 3MQQA 3UY6A 5GL9A 1HVBA 3V67A 2QWSA 3IQAA 3C7VA 1JWZA 3ISGA 4PMAA 5GHZA 1MZUA 2WYXA 4RVAA 3T4JA 4GOGA 4R23A 3FKVA 3OBFA 3WWXA 1MWTA 1AXBA 3MZFA 4EEPA 5G18A 5J7EA 1ONGA 3OPPA 5FAQA 4Q0IA 3LIAA 2PR6A 2W27A 2DMWA 3PBSA 1GHPA 3HVFA 3OCNA 3N7WA 4JGQA 1IKIA 3ZNTA 4X1LA 5IU1A 3I7JA 2PAVP 4S2KA 5GHXA 4R1GA 1WYBA 5TJJA 1NWZA 3CWFA 4RA7A 1VETB 1PFLA 3BFGA 1QMEA 3N8RA 5DJTA 3VP2A 3A0VA 2X71A 1Y4OA 4HJ6A 1K38A 2KLIA 2OV5A 5EVIC 1E3UA 1D7EA 3KYEA 5EOOA 4DE1A 1X0OA 1IEMA 2HDUA 4KG2A 4G3VA 4GN2A 2ZC3B 3H82A 4AFIA 2PBDP 2QPNA 5KSCA 1I5QA 2WAEA 3WRTA 3Q1FA 3QNBA 3ICYA 3SW1A 1NZOA 2WKEA 4OQIA 1L3LA 1OTAA 3TW8A 3S4XA 1BLPA 3CUEA 1OTDA 1KGFA 2J7VA 3BQAA 4Y5FA 3BLMA 2DRWA 4I3JA 2V2FF 4MN6A 3NIAA 3W4OA 3UE1A 1PIOA 4KG5A 2EX2A 4Y0TA 3LR4A 2VZWA 1CI8A 4IJGA 1ZTUA 2K2NA 4OQHA 4Z9QA 3U2AA 3C30A 4C3QA 4X68A 2WGWA 4R4SA 3A3EA 1XA1A 3MFXA 1MPLA 3M2JA 3MMHA 1N9NA 4E6WA 2R9XA 5AQ7A 4DE2A 4JGRA 3T1RA 4R3JA 4BWIA 4GHIB 4WLAA 1VHMA 2VGLS 1XJ4A 4EUVA 3GQZA 4ARZB 4KZ4A 4DKIA 2XK1A 5HPFA 1G28A 4NEED 4BENA 3NHQA 1MWSA 3MKEA 4HBTA 4IEDA 3C5AA 1IYOA 3HLBA 5C5KA 1TD5A 4MBKA 5HD3A 1CJFA 2PR5A 3K2NA 5CXWA 4N92A 4ZJ2A 3GVBA 3HUOA 1ODVA 4P87A 4FTXA 1KDWA 2JCHA 2E8JA 2VGLM 3TE8A 2W0NA 1LLBA 4S2LA 3IHBA 4GD8A 5EE8A 1LT0A 3KO6A 4OPZA 1P9RA 1FQGA 3BYDA 4WZ5A 3T12B 1MXOA 1JTGA 4YINA 5HWVA 3DWZA 4FSFA 1JVJA 3R4KA 3KYZA 5L2FA 1TS6A 5F68A 4E6XA 1TS7A 4OQ0A 1YLJA 5KMWA 4WBGA 1OJGA 4EETB 2KOIA 3LUQA 2ZQ9A 4K0XA 5JYOA 4JBFA 3S22A 5EECA 2ZOHA 4OOMA 1SHVA 4EERA 2H0TA 4MMNA 1KGEA 3SS4A 1K6RA 5KIZA 1BUEA 2VX8A 2QJ5A 2AVXA 4C75A 3E0YA 5HL6A 1TEMA 3T4KA 2Z6DA 2J9PA 3G4PA 3VOZA 4R3AA 1ESIA 1LI0A 1O07A 3MSHA 2EX8A 3Q7VA 5FATA 3W4PA 3T4LA 4CLCC 5LBRA 1ERMA 4QWOA 3UO9A 4KG6A 4LV3A 1PRQA 2W3EA 4DF6A 2VEAA 2EWWA 2IWDA 3IT9A 3CHWP 3UN7A 4PKYA 2L4RA 3RXWA 4GCZA 1Z6FA 3F1NA 2PD7A 2WAFA 3G6OA 1BSGA 3HLEA 2P08A 4BJPA 5DJUA 1BZAA 1K56D 4ZBEA 4BLMA 1ZC2A 5CTNA 1FCMA 4BBVA 4BD1A 4X6TA 1FSYA 1GSWA 2M1CA 3RFBA 3W2ZA 3NDEA 3SS3A 5DFXA 3BQ8A 2BLSA 4HY8A 2WKPA 1ES3A 2VJWA 1G6OA 2ZBBA 4CJNA 1PYYA 3OCLA 1EROA 2I9VA 2HGVA 2WKIA 1Y54A 3BFCA 3CAXA 2WGWB 3AGFA 1NRJA 4NXGA 3N8LA 5EOEA 1ES4A 3BW6A 4ZDXA 2WKRA 1K57A 3F1OA 4U0XA 5FI6A 1VEUB 4DJ3A 2INWA 4OONA 4U3TA 2XH9A 3NJAA 1STZA 2XD1A 4E3OA 2ZQAA 3VV4A 1GSVA 3IX4A 2EFUA 1YLTA 4UQIS 3HJIA 4PKYG 5GLCA 4ME4A 3JVVA 5F83A 3FPVA 3QNCA 3UE3A 2P9VB 4ZJ1A 2BTFP 2NUPC 3WS2A 4I39A 1GHIA 4HJ4A 2CC1A 2Y59A 1K6SA 2C5WB 2JE5A 3VE3A 4EU0A 4P6BA 1ZG4A 3ZVWA 1NZUA 4Z1WA 1BTLA 1ONHA 3DBAA 3QP2A 4UQIM 1TDGA 1SCWA 1L0DA 2RL3A 3PBTA 5HDCA 4DN0A 3GRJA 2A24A 1Y28A 4WEKA 1NRFA 3T1SA 4IBXA 2NUTC 2HV1A 1K54A 4KZBA 3RTYA 1WA9A 2RCXA 1UGUA 1YMXA 3BECA 5FDSA 5EUAA 3M2KA 1CI9A 1YLWA 3HREA 3ZG8B 4YOFA 3IXDA 3MQ0A 2J80A 1FIKA 4RX2A 2QMIA 3ZFZA 1PZOA 4EBLA 3CUEC 3IX8A 2G2WA 3S7OA 4ESPA 1D1JA 1GA9A 5L09A 4O7DA 3V3SA 3GV9A 4PHTA 2V1ZA 3BRMA 2IWCA 1TDLA 5M19A 5DF7A 2J3WA 4UHUA 3HUNA 3WS0A 2FZ0A 4S2PA 3S7PA 1PI5A 4PAUA 1K4FA 4MN5A 3LR0A 4B4ZA 4EW7A 2O9CA 2P74A 3SS5A 4E04A 1YLZA 3MFDA 3G2ZA 1RGZA 3T1XA 1L2SA 5EVIB 2H10A 4N1HA 4MN7A 3MR0A 4WYYA 4RX3A 3GECA 2W3HA 5IT5A 1EWZA 1F5MA 1W63Q 5K5BA 5FQMA 5EM1A 4S2IA 1LHYA 1OMEA 3LFVA 4XT2A 2IWBA 2W3FA 3M6HA 2P04A 1OT9A 4PPRA 1XJ3A 2Y2NA 1YLPA 4QD4A 1YSQA 3EGXC 4RYEA 3F1PB 5FQKA 4LV1A 2GNXA 5DKLA 4WUJA 1IKGA 5JYPA 3OPLA 5J3WA 5G4ZA 3UE6A 4DXCA 3C8CA 2ZM8A 4IVKA 4Y13A 1LL9A 1FILA 1CEFA 2Q0OA 4NKPA 1HLUP 4FD8A 5FL3A 3BEBA 3BFFA 1T19A 3BY9A 4BBUA 4LV2A 5HPIA 3WS1A 3VOYA 2ZC6B 5FI2A 1YQSA 1ACFA 1FOFA 4X55A 3EGDC 2Z6CA 1PW1A 4P0MA 4WMCD 3UB8A 2G7UA 2FH5A 2VGKA 5DTSA 4KQQA 5FAPA 2J8YA 4MLLA 4WZ5C 1IYSA 2ZL1B 3F1OB 4LFUA 3MS6A 1TF1A 3IS2B 4E3IA 4XUZA 2BG1A 1G68A 5GHYA 3E98A 5F5YA 3R7WA 5F82A 4R38A 3CLOA 5M1AA 3GSGA 1GA0A 3S7NA 1K55A 4D2OA 2ZC7A 1K0KA 4WZ4A 2Y2OA 1N9BA 4KZ5A 4E3NA 4HH3A 4GS9A 3G2YA 3VFFA 4F3LB 3SH8A 4ETZA 3E4QA 1M40A 3VP4A 1IYPA 4IUHA 2XDMA 4LCLA 3HLFA 4X53A 5AQBA 2LB5A 1T1BA 4JXSA 3UE0A 3H7WA 1H5XA 3IXHA 3Q07A 2Y2LA 5TBMA 3Q82A 3JPUA 5EPHA 1OTIA 4HHDA 4JXVA 4Q8IA 2JC7A 1IELA 1YSPA 4KZ6A 3ZVTA 1CF0A 1XP4A 4CLCE 1O7EA 4KQRA 4OPRA 4OVDA 1MKMA 3VP1A 5KSHA 1T18A 1PW8A 5EM0A 4CPKA 4GKUA 2XRNA 4NK3A 2Y79A 5E2HA 3KSFA 4EV4A 3VSLA 4EBPA 4HJ3A 3MXSA 4K0WA 3SH7A 3KSGA 1EI5A 2J3TC 3T4QA 5FQJA 2Q9NA 1YM1A 5EV0A 2W3DA 1U60A 3A3FA 4GB7A 4HQAA 5DTTA 3C4PA 3C2WA 1KE3A 4RQ9A 4WF0A 4N1XA 1KOUA 1C3BA 5A90A 1KE0A 4P6ZS 4A5RA 4D60A 2A2LA 3MZDA 4CLCB 3PR6A 5AQ9A 3AGDA 5HW3A 3P98A 5HD5A 5F1GA 1K57C 2KDKA 1K4EA 2JBFA 2XA7S 1ESUA 3M6BA 2HP9A 4BL2A 3MXRA 2V9AA 3HJKA 2V0WA 4FH4A 5GLAA 2H0YA 2V20A 4B9OA 3VP3A 4I3AA 2XSSA 4P6ZM 3OLOA 1W8YA 5FQIA 1K56A 3TRCA 3IX3A 4HIAA 1YPRA 3PYPA 4O0PA 4E3LA 2QJ7A 2P7JA 3G32A 1XGJA 1YMSA 4H6JB 5EFWA 4OH0A 1OTEA 2Y2JA 3IWIA 4IHQA 3UPPA 3KYQA 4QY5A 4DDSA 4DJ2A 2YKHA 1H8MA 4O8GA 5FDHA 3UDFA 3Q81A 3UB6A 5CHJA 2OSUA 4NETA 2ZC5B 1S66L 2OWHA 2Z2LB 4II7A 1NLZA 4Y7PA 2PYPA 2PRFA 2HP6A 5GLBA 4HP9A 1K54C 5CEDA 3IF6A 3CMZA 2LB9A 1PWCA 1DJCA 1DY6A 1WYCA 3PTEA 1S0WA 2Y2MA 1W8QA 3R7WB 1ES2A 3HUMA 4WM9A 4ZAMA 5I5LA 2QHKA 4S2MA 2WKHA 1JWPA 3MZEA 3V3RA 3VSKA 4CQHA 3W4QA 3H9WA 3L9KA 2JHEA 4JLFA 5MC7A 3B42A 2Y91A 2HPBA 3NC8A 4ZRRA 3QHYA 1W79A 1A0KA 2EX9A 3DTKA 3PAGA 4HI4A 3C4OA 1E25A 4HNBA 2EFXA 2QYBA 2W1TA 3LIBA 4YNRA 3DW0A 3NY4A 4H8RA 2J9OA 2HDSA 2O0YA 2G2UA 4R70A 1K25A 4O01A 5DKKA 1UWNX 1YAXA 5HAIA 1FSWA 3S7QA 3DTEA 4EBNA 4NG2A 4OKPA 3A0RA 4X69A 3PBNA 3O3VA 4XXRA 3PXPA 3H82B 1S67L 3LEQA 4KZAA 2VV7A 2PBYA 3CI6A 4PM7A 3LI9A 4JGPA 3IXBA 3VFHA 2PHYA 2CMNA 1YT4A 3T50A 4JF4A 1F9IA 3A3DA 3ZG0A 5FA7A 4GDBA 4EESA 4LENA 4MBFA 1BYWA 2HJ9C 2VV8A 1DRMA 3KSHA
chains in the Genus database with same CATH topology
4MCWA 4JGQA 4HOIA 4UEYA 5IU1A 5DF9A 4PHTA 1LSWA 4HH2A 3UMDA 4KUKA 1LL8A 5TJJA 1NWZA 2J3WA 3CWFA 4OOLA 2FZ0A 4MDZA 2PD8A 3S7PA 3T4SA 4GW9A 4PAUA 5AVEA 1H3QA 5DJTA 4LPZA 4MN5A 3LR0A 1N9LA 4EW7A 1DP6A 2O9CA 3A0VA 3MF0A 4E04A 2H28A 4HJ6A 4L9GA 2KLIA 2KX6A 3LR5A 1IOUA 4MN7A 3MR0A 3GECA 2W3HA 5IT5A 1F5MA 1N9OA 4Y2FA 1W63Q 5K5BA 2QKPA 2R78A 1D7EA 1OPXA 2PT7A 4JGOA 4BBTA 1NLYA 4YWZA 3LFVA 1X0OA 3BY8A 2W3FA 4L9FA 3LIDA 4XT2A 2P04A 1OT9A 1XJ3A 3TJZC 2ZMVA 4G3VA 3H82A 4AFIA 5F69A 1YSQA 5HWWA 3EGXC 4GS9B 2GJ3A 1EW0A 3F1PB 5HSQA 3GDIA 2GNXA 5DKLA 3ICYA 4WUJA 3SW1A 3P01A 1OTAA 3TW8A 5J3WA 5G4ZA 3UE6A 5J4EA 3C8CA 3CUEA 3PBOA 1OTDA 3MQOA 3BQAA 1OJ5A 4Y5FA 3C38A 4LRZE 2GX5A 1TS0A 4NKPA 2O9BA 4I3JA 3OC2A 5FL3A 3KSIA 1F98A 4MN6A 3H7WB 3MXQA 3KX0X 4KUOA 1DP8A 5TBMB 4I5SA 1T19A 3BY9A 1P9WA 3D3OA 4BBUA 3LR4A 2O99A 5HPIA 2VZWA 5HDSA 4KQOA 4IJGA 4M4XA 4L9EA 1ZTUA 2K2NA 3EGDC 4WELA 2Z6CA 3U2AA 3UB8A 2G7UA 3C30A 2FH5A 3ULFA 2M7VA 3K3DA 3MFXA 2HF6A 3F1OB 3NOPC 2HJEA 2MJ6A 3E4PA 3MMHA 1N9NA 1TF1A 3IS2B 4GLQA 3EQUA 3FG8A 4JGRA 4EXOA 3E98A 2D01A 5F5YA 3R7WA 1OT6A 4R38A 3CLOA 4EQ1A 4BWIA 3S7NA 2EWVA 4GHIB 4WLAA 1VHMA 2VGLS 1XJ4A 4EUVA 4ARZB 2VA0A 5HPFA 4LLOB 1G28A 4I3IA 3VE4A 4HH3A 4NEED 4GS9A 3F1PA 3NHQA 4F3LB 1IFQA 1GSXA 1UWPX 3B33A 5C5KA 1TD5A 3A0SA 3E4QA 4NXEA 5HD3A 4ETZA 2K7SA 2PR5A 1XFNA 3K2NA 4IUHA 1ODVA 3LIFA 1TS8A 2V0UA 2LB5A 1T1BA 2J3TD 2VGLM 3TE8A 2W0NA 3H7WA 5DFYA 5TBMA 1OTBA 1LT0A 1OTIA 4HHDA 4L0LA 3IBRA 3KO6A 2JKRM 3D72A 1YSPA 3F1NB 1P9RA 4CLCE 3CITA 3PHYA 3P7NA 5HWVA 1S4SA 1MKMA 3LI8A 4FSFA 1S4RA 3R4KA 3KYZA 5KSHA 1T18A 2GZAA 3IS2A 1TS6A 2XRNA 3B47A 5F68A 2Y79A 3UB9A 3KSFA 1TS7A 2D02A 4HJ3A 2L1MA 1OJGA 1ZHHB 2OWJA 3KSGA 2VV6A 1LSXA 4EETB 2JN7A 2KOIA 3LUQA 3EOIA 4LRYC 1W63M 4GHIA 2ZMFA 4Q0HA 1MC0A 2J3TC 3BJNA 3OOVA 4QPRA 2ZOHA 4OOMA 3T4QA 2O9AA 4EERA 2OAQ1 4MMNA 4ARZA 2W3DA 5KIZA 4HQAA 3C2WA 4RQ9A 4F3LA 1VB6A 4WF0A 1KOUA 2VX8A 3EWKA 2QJ5A 3LIEA 4P6ZS 4LRXC 3E0YA 5HL6A 3T4KA 2A2LA 2Z6DA 2V1BA 3UMEA 1T1CA 4R3AA 4CLCB 3PR6A 2XROA 3JVUA 3T4LA 4CLCC 5HD5A 2M7UA 5LBRA 3FPWA 2YKFA 2BASA 2KDKA 2XA7S 3ZYTA 2PDRA 4NXBA 4KQDA 2W3EA 2VEAA 2B18A 3FC7A 2EWWA 2V9AA 3HJKA 5CX7A 2V0WA 4G3KA 2JKRI 3EEAA 4PKYA 4B9OA 2L4RA 4GCZA 3LICA 4I3AA 3F1NA 2PYRA 2XSSA 3LYXA 3OLOA 4P6ZM 2PD7A 4WN5A 1V9YA 3G6OA 3TRCA 5A8BA 5IS1A 4HIAA 4G3WA 2P08A 3PYPA 4O0PA 5DJUA 4BJPA 2QJ7A 2P7JA 4HP4A 2ZOIA 1DP9A 3PBQA 4BMWA 4H6JB 5EFWA 3ZQ5A 4BBVA 1OTEA 2JKTM 3HCYA 4Y3IA 4DMZA 1GSWA 4IHQA 3UB7A 3MJQA 3K3CA 2M1CA 2W1TB 3KYQA 3RFBA 3W2ZA 5DFXA 4DJ2A 2YKHA 1H8MA 2K31A 3BQ8A 4O8GA 3RH8B 4HY8A 2WKPA 2VJWA 1S1ZA 3UB6A 1G6OA 2ZBBA 1XFQA 4R6LA 1T1AA 4IUKA 3OCLA 2IA2A 1S66L 4FOFA 2I9VA 2HGVA 2A24B 2OWHA 4II7A 1JNUA 4K08A 1NLZA 2PYPA 3BWLA 4I38A 1P0ZA 3CAXA 4HP9A 2OOLA 3E4OA 1NRJA 4NXGA 2LB9A 2VLGA 4EEUA 4CLCA 2V1AA 3BW6A 5G4YA 3IBJA 2WKRA 3F1OA 1XJ6A 4Q0JA 4CLCD 1D06A 2L0WA 3R7WB 5I5LA 2QHKA 4DJ3A 3PBRA 2INWA 1V9ZA 2OAP1 5HWTA 2WKQA 5AVFA 2W3GA 3NJAA 3VOLA 1STZA 4CQHA 3H9WA 3VV4A 2JHEA 1GSVA 3LR3A 4NXFA 4UQIS 5MC7A 3B42A 3HJIA 4PKYG 3EEHA 2Y8HA 2B02A 5HDDA 4ZRRA 2EA9A 2W1RA 1LSVA 4ME4A 3JVVA 1S1YA 3T4OA 3UE3A 3FPVA 4H6JA 4HI4A 2NUPC 3NOTC 4HNBA 4I39A 2JKTI 2VKSA 3T4TA 4HJ4A 2QYBA 2W1TA 3LIBA 4B93A 4YNRA 3VE3A 3MQQA 3EQVA 4EU0A 5HZHA 2O0YA 4Z1WA 4R70A 5F6AA 4O01A 1P97A 3DBAA 5DKKA 4UQIM 1UWNX 1YAXA 5HDCA 4DN0A 3PBTA 3O5YA 3S7QA 3V67A 2QWSA 2A24A 1Y28A 4WEKA 4XT2B 3A0RA 5AJGA 3PBNA 2NUTC 1MZUA 2HV1A 3RTYA 3PXPA 4ETXA 3H82B 5L8MA 3T4JA 1WA9A 1UGUA 1S67L 2VV7A 3NOUC 1YKDA 3OBFA 3CI6A 1XJ2A 4YOFA 3LI9A 4JGPA 4EEPA 3MQ0A 2J80A 5J7EA 2PHYA 2CMNA 4Q0IA 3LIAA 3T50A 2PR6A 2W27A 1F9IA 2DMWA 3PBSA 2XA7M 4GJ4A 3CUEC 4EESA 3OCNA 1BYWA 2HJ9C 2VV8A 4WL9A 1DRMA 3S7OA 3KSHA 4WEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGQ A;  4HOI A;  5IU1 A;  1LSW A;  4HH2 A;  3UMD A;  4KUK A;  1LL8 A;  1NWZ A;  3CWF A;  2PD8 A;  4GW9 A;  5AVE A;  5DJT A;  4LPZ A;  4MN5 A;  1N9L A;  4EW7 A;  1DP6 A;  3A0V A;  4E04 A;  2H28 A;  4HJ6 A;  4L9G A;  2KX6 A;  3MR0 A;  3GEC A;  1N9O A;  2QKP A;  2R78 A;  1D7E A;  4JGO A;  4BBT A;  4YWZ A;  1X0O A;  3BY8 A;  4L9F A;  4XT2 A;  3LID A;  1OT9 A;  1XJ3 A;  3H82 A;  5F69 A;  5HWW A;  4GS9 B;  2GJ3 A;  1EW0 A;  3F1P B;  5HSQ A;  3GDI A;  5DKL A;  3ICY A;  4WUJ A;  3SW1 A;  1OTA A;  5J3W A;  5G4Z A;  3UE6 A;  5J4E A;  3C8C A;  1OTD A;  3MQO A;  1OJ5 A;  4LRZ E;  1TS0 A;  4I3J A;  1F98 A;  4MN6 A;  3H7W B;  3MXQ A;  3KX0 X;  4KUO A;  1DP8 A;  5TBM B;  4I5S A;  1T19 A;  3BY9 A;  4BBU A;  5HDS A;  4M4X A;  4L9E A;  2Z6C A;  3UB8 A;  3ULF A;  3K3D A;  3MFX A;  3F1O B;  3NOP C;  3E4P A;  1N9N A;  3IS2 B;  3FG8 A;  4JGR A;  4EXO A;  2D01 A;  5F5Y A;  1OT6 A;  4R38 A;  3CLO A;  4EQ1 A;  4GHI B;  4WLA A;  1XJ4 A;  4LLO B;  1G28 A;  4I3I A;  3VE4 A;  4HH3 A;  4GS9 A;  3F1P A;  3NHQ A;  4F3L B;  1GSX A;  1UWP X;  3B33 A;  3A0S A;  3E4Q A;  4NXE A;  5HD3 A;  2K7S A;  2PR5 A;  1XFN A;  1ODV A;  3LIF A;  1TS8 A;  2V0U A;  1T1B A;  2W0N A;  3H7W A;  5TBM A;  1OTB A;  1LT0 A;  1OTI A;  4HHD A;  3IBR A;  3D72 A;  3F1N B;  3PHY A;  3P7N A;  5HWV A;  1S4S A;  3LI8 A;  1S4R A;  1T18 A;  3IS2 A;  1TS6 A;  5F68 A;  3UB9 A;  1TS7 A;  2D02 A;  4HJ3 A;  2L1M A;  1OJG A;  2OWJ A;  4EET B;  2VV6 A;  1LSX A;  2JN7 A;  3LUQ A;  4LRY C;  4GHI A;  2ZOH A;  4EER A;  5KIZ A;  4HQA A;  3C2W A;  4RQ9 A;  4F3L A;  1VB6 A;  4WF0 A;  1KOU A;  3EWK A;  2QJ5 A;  3LIE A;  4LRX C;  2Z6D A;  2V1B A;  3UME A;  1T1C A;  4R3A A;  5HD5 A;  2YKF A;  2BAS A;  2KDK A;  2PDR A;  4NXB A;  4KQD A;  2VEA A;  3FC7 A;  2V9A A;  3HJK A;  2V0W A;  4PKY A;  4B9O A;  2L4R A;  4GCZ A;  3LIC A;  4I3A A;  3F1N A;  2PYR A;  3LYX A;  3OLO A;  2PD7 A;  4WN5 A;  1V9Y A;  3G6O A;  5A8B A;  5IS1 A;  4HIA A;  3PYP A;  5DJU A;  2QJ7 A;  2P7J A;  4HP4 A;  2ZOI A;  1DP9 A;  4H6J B;  5EFW A;  3ZQ5 A;  4BBV A;  1OTE A;  1GSW A;  3UB7 A;  3MJQ A;  3K3C A;  2M1C A;  4DJ2 A;  2YKH A;  3RH8 B;  4HY8 A;  2WKP A;  1S1Z A;  3UB6 A;  2ZBB A;  1XFQ A;  4R6L A;  1T1A A;  1S66 L;  2I9V A;  2A24 B;  2OWH A;  1JNU A;  4K08 A;  2PYP A;  3BWL A;  4I38 A;  1P0Z A;  3CAX A;  4HP9 A;  2OOL A;  3E4O A;  4NXG A;  2VLG A;  4EEU A;  2V1A A;  5G4Y A;  2WKR A;  3F1O A;  1XJ6 A;  1D06 A;  2L0W A;  5I5L A;  2QHK A;  4DJ3 A;  2INW A;  1V9Z A;  5HWT A;  2WKQ A;  5AVF A;  3NJA A;  3VOL A;  3H9W A;  2JHE A;  1GSV A;  4NXF A;  3HJI A;  4PKY G;  3EEH A;  2B02 A;  5HDD A;  2EA9 A;  1LSV A;  1S1Y A;  4H6J A;  4HI4 A;  3NOT C;  4HNB A;  4I39 A;  4HJ4 A;  3LIB A;  3VE3 A;  3MQQ A;  5HZH A;  4R70 A;  5F6A A;  1P97 A;  5DKK A;  1UWN X;  5HDC A;  2QWS A;  2A24 A;  1Y28 A;  4XT2 B;  3A0R A;  1MZU A;  2HV1 A;  3RTY A;  3H82 B;  1WA9 A;  1UGU A;  1S67 L;  2VV7 A;  3NOU C;  1XJ2 A;  3LI9 A;  4JGP A;  4EEP A;  2J80 A;  5J7E A;  2PHY A;  2CMN A;  3T50 A;  3LIA A;  2PR6 A;  2W27 A;  1F9I A;  4EES A;  1BYW A;  2VV8 A;  4WL9 A;  1DRM A; 
#chains in the Genus database with same CATH topology
 2B95 A;  5CHU A;  4HOI A;  4UEY A;  1E4D A;  3FWL A;  1BLS A;  5EVE A;  3HLC A;  3OZH A;  3UMD A;  1LL8 A;  1N4O A;  3NBL A;  1HTZ A;  5AVE A;  1NJ4 A;  1DJA A;  1G6A A;  5HL1 A;  3IWO A;  3MF0 A;  4N9L A;  2H28 A;  4L9G A;  5FAO A;  2KX6 A;  3BM6 A;  2XFS A;  4PM9 A;  4Y2F A;  3V39 A;  2R78 A;  4QJG A;  4QU3 A;  4BBT A;  4YWZ A;  1HZO A;  3BY8 A;  3LID A;  1YLY A;  1FR6 A;  5TFQ A;  1SKF A;  1K55 C;  3DWK A;  3TJZ C;  2Q9M A;  5F69 A;  1EW0 A;  2XQZ A;  1ZG6 A;  3D9Y A;  3P01 A;  3FYZ A;  5CRF A;  3MQO A;  1OJ5 A;  4LRZ E;  2GX5 A;  1XPB A;  2O9B A;  5E43 A;  3KSI A;  2Y4A A;  4KUO A;  1DP8 A;  5U47 A;  1ES5 A;  4JF5 A;  4S2J A;  3BFD A;  5FSR A;  4KQO A;  5CER A;  4WMC A;  1PWG A;  4WEL A;  1ERQ A;  3N6I A;  5AQA A;  1ALQ A;  3UPN A;  3TSG A;  2OLU A;  3N8S A;  5TR7 A;  1VET A;  2XLN A;  4E3M A;  2MJ6 A;  3N4I A;  4GLQ A;  2WUQ A;  4EXO A;  5EVI D;  3DTM A;  4EQ1 A;  2EWV A;  4M3K A;  1J3W A;  4PM8 A;  2VA0 A;  4LLO B;  4QHC A;  4I3I A;  3NI9 A;  3VE4 A;  4F94 A;  4GD6 A;  1IFQ A;  4DE3 A;  1GSX A;  4KZ3 A;  1UWP X;  3B33 A;  3A0S A;  3VP0 A;  2K7S A;  4R4R A;  4QB8 A;  4ZTK A;  2A49 A;  2ZMA A;  4UAA A;  3NCK A;  1KE4 A;  3Q7V B;  1TS8 A;  1SZV A;  2V0U A;  2J3T D;  2HZ5 A;  1OTB A;  1BUL A;  5FQQ A;  3IBR A;  2JKR M;  1KVM A;  3HL9 A;  1MKI A;  3F1N B;  2WGV A;  5CHM A;  4ZJ3 A;  3UNW A;  3CIT A;  3PHY A;  4JPM A;  5L10 A;  3P7N A;  3ZNY A;  2ACG A;  1I2S A;  3GMW A;  3ITB A;  4S2N A;  3ZG7 B;  2UV0 E;  3C7U A;  3B47 A;  2ZQ8 A;  3UB9 A;  2D02 A;  5CGX A;  3MKF A;  2OWJ A;  2VV6 A;  1F2K A;  5CTM A;  1FCN A;  1W63 M;  3IWQ A;  2ZD8 A;  2ZMF A;  4GHI A;  4Q0H A;  3OOV A;  3GR2 A;  2EXA A;  2C6W B;  2O9A A;  3D4F A;  1W5D A;  2OAQ 1;  2Y2H A;  4ARZ A;  3ZGA B;  4LGW A;  4DXB A;  4DDY A;  4JXW A;  1VB6 A;  2V1B A;  3UME A;  1T1C A;  2XRO A;  1XXM A;  1MWR A;  5HAR A;  3JVU A;  3IF6 C;  1JWV A;  1S6R A;  3ZG5 A;  4KZ9 A;  3FPW A;  2YKF A;  3TOI A;  4P85 A;  4KQD A;  3BLS A;  3FC7 A;  1J9M A;  4G3K A;  2JKR I;  3EEA A;  2WGI A;  3DTI A;  1NY0 A;  3LIC A;  1H0M A;  3LYX A;  4WN5 A;  1V9Y A;  5A8B A;  4G3W A;  3AGE A;  4BMW A;  3OPR A;  3HLG A;  2Y2G A;  3ZQ5 A;  3SOI A;  3HCY A;  5J8X A;  3JYI A;  3O86 A;  4Y3I A;  1XGI A;  3CPT A;  5CEB A;  5HFO A;  3UB7 A;  5KZH A;  3MJQ A;  3K3C A;  3WS5 A;  2R9W A;  3NDG A;  3T1Q B;  4XUX A;  2K31 A;  3RH8 B;  2ZM0 A;  2E8I A;  3MBZ A;  5A93 A;  1XFQ A;  1DJB A;  2B5R A;  4R6L A;  4OP5 A;  2IA2 A;  4FOF A;  3RXX A;  5CEC A;  2A24 B;  1FR1 A;  3ZDJ A;  4DRT A;  4IBR A;  3DAV A;  1AWI A;  1H8Y A;  3BWL A;  4I38 A;  1P0Z A;  5CGW A;  2OOL A;  3QP5 A;  4U0T A;  3FKW A;  4E3K A;  3CG5 A;  2V1A A;  4EUZ A;  5BOH A;  3U4L P;  2GDN A;  4Q0J A;  4CLC D;  1D06 A;  5HX9 A;  2L0W A;  2HP5 A;  3CJM A;  5I94 A;  3RJU A;  4YFM A;  4R3B A;  5EVL A;  2OAP 1;  3SZT A;  5FI7 A;  2W3G A;  2ZQD A;  3IXG A;  4Y17 A;  2V8F A;  4NXF A;  2ZLY A;  3EEH A;  2W1R A;  1GCE A;  1S1Y A;  1PWD A;  3T4O A;  2XGN A;  3NOT C;  2ZM2 A;  3T4T A;  2VKS A;  2ZQC A;  1NXY A;  4B93 A;  4OOY A;  3B3X A;  5L07 A;  4B88 A;  3EQV A;  5HZH A;  2Y2I A;  2XF3 A;  5F6A A;  2Y2Q A;  1ZKJ A;  4LCM A;  1P97 A;  1BT5 A;  3O5Y A;  1VQQ A;  5A91 A;  5M18 A;  4XT2 B;  4OPY A;  5AJG A;  1GHM A;  3IHA A;  4ETX A;  5L8M A;  1M6K A;  3IH9 A;  5HAP A;  3NOU C;  1YKD A;  1XJ2 A;  4BD0 A;  4OLD A;  3BFE A;  2UWX A;  1VEU A;  2XA7 M;  3HBR A;  4GJ4 A;  4X25 A;  1CK3 A;  1LI9 A;  3ZHH A;  4WL9 A;  2XFT A;  1Q2Q A;  5E2E A;  4WEJ A;  3ITA A;  3O88 A;  4MCW A;  1BLH A;  5DF9 A;  1LSW A;  4HH2 A;  4KUK A;  1WE4 A;  5HAQ A;  4OOL A;  1SDE A;  1HD8 A;  3NEC A;  2P9V A;  2PD8 A;  4MDZ A;  5CGS A;  3T4S A;  4GW9 A;  1I2W A;  1SDN A;  1H3Q A;  1XA7 A;  4LPZ A;  1N9L A;  1DP6 A;  4K91 A;  4GDN A;  1NYY A;  1RGY A;  4GNU A;  3LR5 A;  1IOU A;  1CQA A;  1N9O A;  2QKP A;  3G35 A;  1OPX A;  2PT7 A;  4JGO A;  1NLY A;  3P09 A;  5FEF A;  4L9F A;  1E3U D;  2ZMV A;  3Q7Z A;  5HWW A;  1CEG A;  3W8K A;  4GS9 B;  2GJ3 A;  4UA6 A;  3WRZ A;  4UA7 A;  1PZP A;  5HSQ A;  3GDI A;  4HBU A;  3CPT B;  5J4E A;  1BLC A;  3PBO A;  2HDR A;  3C38 A;  4FUW A;  1TS0 A;  4C6Y A;  3OC2 A;  1F98 A;  2ZQ7 A;  3H7W B;  3MXQ A;  3KX0 X;  3LEZ A;  5TBM B;  2HDQ A;  4I5S A;  1TVF A;  1P9W A;  3D3O A;  3A3I A;  2O99 A;  3ZG9 B;  5HDS A;  2WZX A;  4M4X A;  3A3J A;  4L9E A;  3QP4 A;  1SKO A;  1L0G A;  1LL5 A;  1RP5 A;  4Y15 A;  3ULF A;  2M7V A;  3NUL A;  3K3D A;  2HF6 A;  1PI4 A;  3NOP C;  4OP8 A;  2HJE A;  3E4P A;  3G31 A;  4FCF A;  3QP8 A;  2FFY A;  5EVI A;  3QP1 A;  4S2N C;  1MWU A;  3EQU A;  3FG8 A;  3O87 A;  3TG9 A;  4KZ7 A;  4B4X A;  2PU4 A;  2D01 A;  1OT6 A;  1L0F A;  3G30 A;  3IH8 A;  1MY8 A;  3ZCZ A;  2H5S A;  5FAS A;  4MNR A;  4Y0O A;  3E2L A;  4HES A;  4BQM A;  5TGF A;  5FEG A;  4BL3 A;  2Z2M B;  3F1P A;  4X56 A;  3LGO A;  4NXE A;  1XFN A;  3LY3 A;  5A92 A;  3LCE A;  3LIF A;  3FV7 A;  1W7F A;  4ID4 A;  3OPH A;  5DFY A;  4L0L A;  3D72 A;  1XX2 A;  1NYM A;  4S2O A;  1KVL A;  2Y55 A;  1S4S A;  4JXG A;  3LI8 A;  2ZL1 A;  1H8Z A;  1S4R A;  2GZA A;  4JKT A;  3IS2 A;  4MEZ A;  4Y0U A;  1FCO A;  3SH9 A;  1KDS A;  1MBL A;  2L1M A;  1ZHH B;  1LSX A;  5DTK A;  2JN7 A;  2ZC4 B;  3EOI A;  5FQ9 A;  4LRY C;  3S1Y A;  1MC0 A;  3BJN A;  5GLD A;  4QPR A;  4E3J A;  5E2G A;  4PM6 A;  4KEN B;  2I72 A;  2WAD A;  2FFF B;  4F3L A;  4N9K A;  1Z09 A;  3UDX A;  3EWK A;  2A3U A;  3LIE A;  2EXB A;  5E2F A;  1Q2P A;  5DVA A;  4LRX C;  4OPQ A;  2JKG A;  3UDI A;  4LV0 A;  3IF5 A;  3IF6 B;  2Y2K A;  4DE0 A;  3HLD A;  4MBH A;  2XEP A;  3FZC A;  2DNS A;  2QZ6 A;  2M7U A;  1L0E A;  2BAS A;  1VM1 A;  2Y2P A;  3ZYT A;  2PDR A;  3UPO A;  4NXB A;  4UA9 A;  2VK3 A;  3V5M A;  1IYQ A;  2B18 A;  1XKZ A;  5CX7 A;  3GTC A;  4QY6 A;  2PYR A;  2XR0 A;  2EX6 A;  2ZJ9 A;  5IS1 A;  3L7H A;  1PNE A;  4HP4 A;  2ZOI A;  4IVI A;  1DP9 A;  3PBQ A;  2X02 A;  2JKT M;  4DMZ A;  1G5U A;  3UB5 P;  4HEF A;  2DCF A;  2JKF A;  4PM5 A;  2W1T B;  1QMF A;  3HLW A;  2WK0 A;  1RCJ A;  1S1Z A;  4OLG A;  3E2K A;  4GZB A;  2V8C A;  1T1A A;  1JTD A;  4IUK A;  4JF6 A;  3VMA A;  1SKO B;  1JNU A;  4K08 A;  4OQG A;  2WZZ A;  2X01 A;  1KGG A;  5F1F A;  4KZ8 A;  4X1M A;  3LY4 A;  3E4O A;  3CZD A;  4EWF A;  2VLG A;  4EEU A;  2PU2 A;  4CLC A;  5G4Y A;  3IBJ A;  5IHV A;  3G34 A;  1XJ6 A;  4R0Q A;  2OLV A;  5DF8 A;  3PAE A;  3WS4 A;  3PBR A;  1V9Z A;  4EQI A;  5HWT A;  2WKQ A;  5AVF A;  4FH2 A;  3VOL A;  3LR3 A;  2Y8H A;  3LO7 A;  2B02 A;  5HDD A;  2EA9 A;  2VGJ A;  1LSV A;  3QP6 A;  5D3O A;  2XD5 A;  4H6J A;  2JKT I;  3V50 A;  3MQQ A;  3UY6 A;  5GL9 A;  1HVB A;  3V67 A;  2QWS A;  3IQA A;  3C7V A;  1JWZ A;  3ISG A;  4PMA A;  5GHZ A;  1MZU A;  2WYX A;  4RVA A;  3T4J A;  4GOG A;  4R23 A;  3FKV A;  3OBF A;  3WWX A;  1MWT A;  1AXB A;  3MZF A;  4EEP A;  5G18 A;  5J7E A;  1ONG A;  3OPP A;  5FAQ A;  4Q0I A;  3LIA A;  2PR6 A;  2W27 A;  2DMW A;  3PBS A;  1GHP A;  3HVF A;  3OCN A;  3N7W A;  4JGQ A;  1IKI A;  3ZNT A;  4X1L A;  5IU1 A;  3I7J A;  2PAV P;  4S2K A;  5GHX A;  4R1G A;  1WYB A;  5TJJ A;  1NWZ A;  3CWF A;  4RA7 A;  1VET B;  1PFL A;  3BFG A;  1QME A;  3N8R A;  5DJT A;  3VP2 A;  3A0V A;  2X71 A;  1Y4O A;  4HJ6 A;  1K38 A;  2KLI A;  2OV5 A;  5EVI C;  1E3U A;  1D7E A;  3KYE A;  5EOO A;  4DE1 A;  1X0O A;  1IEM A;  2HDU A;  4KG2 A;  4G3V A;  4GN2 A;  2ZC3 B;  3H82 A;  4AFI A;  2PBD P;  2QPN A;  5KSC A;  1I5Q A;  2WAE A;  3WRT A;  3Q1F A;  3QNB A;  3ICY A;  3SW1 A;  1NZO A;  2WKE A;  4OQI A;  1L3L A;  1OTA A;  3TW8 A;  3S4X A;  1BLP A;  3CUE A;  1OTD A;  1KGF A;  2J7V A;  3BQA A;  4Y5F A;  3BLM A;  2DRW A;  4I3J A;  2V2F F;  4MN6 A;  3NIA A;  3W4O A;  3UE1 A;  1PIO A;  4KG5 A;  2EX2 A;  4Y0T A;  3LR4 A;  2VZW A;  1CI8 A;  4IJG A;  1ZTU A;  2K2N A;  4OQH A;  4Z9Q A;  3U2A A;  3C30 A;  4C3Q A;  4X68 A;  2WGW A;  4R4S A;  3A3E A;  1XA1 A;  3MFX A;  1MPL A;  3M2J A;  3MMH A;  1N9N A;  4E6W A;  2R9X A;  5AQ7 A;  4DE2 A;  4JGR A;  3T1R A;  4R3J A;  4BWI A;  4GHI B;  4WLA A;  1VHM A;  2VGL S;  1XJ4 A;  4EUV A;  3GQZ A;  4ARZ B;  4KZ4 A;  4DKI A;  2XK1 A;  5HPF A;  1G28 A;  4NEE D;  4BEN A;  3NHQ A;  1MWS A;  3MKE A;  4HBT A;  4IED A;  3C5A A;  1IYO A;  3HLB A;  5C5K A;  1TD5 A;  4MBK A;  5HD3 A;  1CJF A;  2PR5 A;  3K2N A;  5CXW A;  4N92 A;  4ZJ2 A;  3GVB A;  3HUO A;  1ODV A;  4P87 A;  4FTX A;  1KDW A;  2JCH A;  2E8J A;  2VGL M;  3TE8 A;  2W0N A;  1LLB A;  4S2L A;  3IHB A;  4GD8 A;  5EE8 A;  1LT0 A;  3KO6 A;  4OPZ A;  1P9R A;  1FQG A;  3BYD A;  4WZ5 A;  3T12 B;  1MXO A;  1JTG A;  4YIN A;  5HWV A;  3DWZ A;  4FSF A;  1JVJ A;  3R4K A;  3KYZ A;  5L2F A;  1TS6 A;  5F68 A;  4E6X A;  1TS7 A;  4OQ0 A;  1YLJ A;  5KMW A;  4WBG A;  1OJG A;  4EET B;  2KOI A;  3LUQ A;  2ZQ9 A;  4K0X A;  5JYO A;  4JBF A;  3S22 A;  5EEC A;  2ZOH A;  4OOM A;  1SHV A;  4EER A;  2H0T A;  4MMN A;  1KGE A;  3SS4 A;  1K6R A;  5KIZ A;  1BUE A;  2VX8 A;  2QJ5 A;  2AVX A;  4C75 A;  3E0Y A;  5HL6 A;  1TEM A;  3T4K A;  2Z6D A;  2J9P A;  3G4P A;  3VOZ A;  4R3A A;  1ESI A;  1LI0 A;  1O07 A;  3MSH A;  2EX8 A;  3Q7V A;  5FAT A;  3W4P A;  3T4L A;  4CLC C;  5LBR A;  1ERM A;  4QWO A;  3UO9 A;  4KG6 A;  4LV3 A;  1PRQ A;  2W3E A;  4DF6 A;  2VEA A;  2EWW A;  2IWD A;  3IT9 A;  3CHW P;  3UN7 A;  4PKY A;  2L4R A;  3RXW A;  4GCZ A;  1Z6F A;  3F1N A;  2PD7 A;  2WAF A;  3G6O A;  1BSG A;  3HLE A;  2P08 A;  4BJP A;  5DJU A;  1BZA A;  1K56 D;  4ZBE A;  4BLM A;  1ZC2 A;  5CTN A;  1FCM A;  4BBV A;  4BD1 A;  4X6T A;  1FSY A;  1GSW A;  2M1C A;  3RFB A;  3W2Z A;  3NDE A;  3SS3 A;  5DFX A;  3BQ8 A;  2BLS A;  4HY8 A;  2WKP A;  1ES3 A;  2VJW A;  1G6O A;  2ZBB A;  4CJN A;  1PYY A;  3OCL A;  1ERO A;  2I9V A;  2HGV A;  2WKI A;  1Y54 A;  3BFC A;  3CAX A;  2WGW B;  3AGF A;  1NRJ A;  4NXG A;  3N8L A;  5EOE A;  1ES4 A;  3BW6 A;  4ZDX A;  2WKR A;  1K57 A;  3F1O A;  4U0X A;  5FI6 A;  1VEU B;  4DJ3 A;  2INW A;  4OON A;  4U3T A;  2XH9 A;  3NJA A;  1STZ A;  2XD1 A;  4E3O A;  2ZQA A;  3VV4 A;  1GSV A;  3IX4 A;  2EFU A;  1YLT A;  4UQI S;  3HJI A;  4PKY G;  5GLC A;  4ME4 A;  3JVV A;  5F83 A;  3FPV A;  3QNC A;  3UE3 A;  2P9V B;  4ZJ1 A;  2BTF P;  2NUP C;  3WS2 A;  4I39 A;  1GHI A;  4HJ4 A;  2CC1 A;  2Y59 A;  1K6S A;  2C5W B;  2JE5 A;  3VE3 A;  4EU0 A;  4P6B A;  1ZG4 A;  3ZVW A;  1NZU A;  4Z1W A;  1BTL A;  1ONH A;  3DBA A;  3QP2 A;  4UQI M;  1TDG A;  1SCW A;  1L0D A;  2RL3 A;  3PBT A;  5HDC A;  4DN0 A;  3GRJ A;  2A24 A;  1Y28 A;  4WEK A;  1NRF A;  3T1S A;  4IBX A;  2NUT C;  2HV1 A;  1K54 A;  4KZB A;  3RTY A;  1WA9 A;  2RCX A;  1UGU A;  1YMX A;  3BEC A;  5FDS A;  5EUA A;  3M2K A;  1CI9 A;  1YLW A;  3HRE A;  3ZG8 B;  4YOF A;  3IXD A;  3MQ0 A;  2J80 A;  1FIK A;  4RX2 A;  2QMI A;  3ZFZ A;  1PZO A;  4EBL A;  3CUE C;  3IX8 A;  2G2W A;  3S7O A;  4ESP A;  1D1J A;  1GA9 A;  5L09 A;  4O7D A;  3V3S A;  3GV9 A;  4PHT A;  2V1Z A;  3BRM A;  2IWC A;  1TDL A;  5M19 A;  5DF7 A;  2J3W A;  4UHU A;  3HUN A;  3WS0 A;  2FZ0 A;  4S2P A;  3S7P A;  1PI5 A;  4PAU A;  1K4F A;  4MN5 A;  3LR0 A;  4B4Z A;  4EW7 A;  2O9C A;  2P74 A;  3SS5 A;  4E04 A;  1YLZ A;  3MFD A;  3G2Z A;  1RGZ A;  3T1X A;  1L2S A;  5EVI B;  2H10 A;  4N1H A;  4MN7 A;  3MR0 A;  4WYY A;  4RX3 A;  3GEC A;  2W3H A;  5IT5 A;  1EWZ A;  1F5M A;  1W63 Q;  5K5B A;  5FQM A;  5EM1 A;  4S2I A;  1LHY A;  1OME A;  3LFV A;  4XT2 A;  2IWB A;  2W3F A;  3M6H A;  2P04 A;  1OT9 A;  4PPR A;  1XJ3 A;  2Y2N A;  1YLP A;  4QD4 A;  1YSQ A;  3EGX C;  4RYE A;  3F1P B;  5FQK A;  4LV1 A;  2GNX A;  5DKL A;  4WUJ A;  1IKG A;  5JYP A;  3OPL A;  5J3W A;  5G4Z A;  3UE6 A;  4DXC A;  3C8C A;  2ZM8 A;  4IVK A;  4Y13 A;  1LL9 A;  1FIL A;  1CEF A;  2Q0O A;  4NKP A;  1HLU P;  4FD8 A;  5FL3 A;  3BEB A;  3BFF A;  1T19 A;  3BY9 A;  4BBU A;  4LV2 A;  5HPI A;  3WS1 A;  3VOY A;  2ZC6 B;  5FI2 A;  1YQS A;  1ACF A;  1FOF A;  4X55 A;  3EGD C;  2Z6C A;  1PW1 A;  4P0M A;  4WMC D;  3UB8 A;  2G7U A;  2FH5 A;  2VGK A;  5DTS A;  4KQQ A;  5FAP A;  2J8Y A;  4MLL A;  4WZ5 C;  1IYS A;  2ZL1 B;  3F1O B;  4LFU A;  3MS6 A;  1TF1 A;  3IS2 B;  4E3I A;  4XUZ A;  2BG1 A;  1G68 A;  5GHY A;  3E98 A;  5F5Y A;  3R7W A;  5F82 A;  4R38 A;  3CLO A;  5M1A A;  3GSG A;  1GA0 A;  3S7N A;  1K55 A;  4D2O A;  2ZC7 A;  1K0K A;  4WZ4 A;  2Y2O A;  1N9B A;  4KZ5 A;  4E3N A;  4HH3 A;  4GS9 A;  3G2Y A;  3VFF A;  4F3L B;  3SH8 A;  4ETZ A;  3E4Q A;  1M40 A;  3VP4 A;  1IYP A;  4IUH A;  2XDM A;  4LCL A;  3HLF A;  4X53 A;  5AQB A;  2LB5 A;  1T1B A;  4JXS A;  3UE0 A;  3H7W A;  1H5X A;  3IXH A;  3Q07 A;  2Y2L A;  5TBM A;  3Q82 A;  3JPU A;  5EPH A;  1OTI A;  4HHD A;  4JXV A;  4Q8I A;  2JC7 A;  1IEL A;  1YSP A;  4KZ6 A;  3ZVT A;  1CF0 A;  1XP4 A;  4CLC E;  1O7E A;  4KQR A;  4OPR A;  4OVD A;  1MKM A;  3VP1 A;  5KSH A;  1T18 A;  1PW8 A;  5EM0 A;  4CPK A;  4GKU A;  2XRN A;  4NK3 A;  2Y79 A;  5E2H A;  3KSF A;  4EV4 A;  3VSL A;  4EBP A;  4HJ3 A;  3MXS A;  4K0W A;  3SH7 A;  3KSG A;  1EI5 A;  2J3T C;  3T4Q A;  5FQJ A;  2Q9N A;  1YM1 A;  5EV0 A;  2W3D A;  1U60 A;  3A3F A;  4GB7 A;  4HQA A;  5DTT A;  3C4P A;  3C2W A;  1KE3 A;  4RQ9 A;  4WF0 A;  4N1X A;  1KOU A;  1C3B A;  5A90 A;  1KE0 A;  4P6Z S;  4A5R A;  4D60 A;  2A2L A;  3MZD A;  4CLC B;  3PR6 A;  5AQ9 A;  3AGD A;  5HW3 A;  3P98 A;  5HD5 A;  5F1G A;  1K57 C;  2KDK A;  1K4E A;  2JBF A;  2XA7 S;  1ESU A;  3M6B A;  2HP9 A;  4BL2 A;  3MXR A;  2V9A A;  3HJK A;  2V0W A;  4FH4 A;  5GLA A;  2H0Y A;  2V20 A;  4B9O A;  3VP3 A;  4I3A A;  2XSS A;  4P6Z M;  3OLO A;  1W8Y A;  5FQI A;  1K56 A;  3TRC A;  3IX3 A;  4HIA A;  1YPR A;  3PYP A;  4O0P A;  4E3L A;  2QJ7 A;  2P7J A;  3G32 A;  1XGJ A;  1YMS A;  4H6J B;  5EFW A;  4OH0 A;  1OTE A;  2Y2J A;  3IWI A;  4IHQ A;  3UPP A;  3KYQ A;  4QY5 A;  4DDS A;  4DJ2 A;  2YKH A;  1H8M A;  4O8G A;  5FDH A;  3UDF A;  3Q81 A;  3UB6 A;  5CHJ A;  2OSU A;  4NET A;  2ZC5 B;  1S66 L;  2OWH A;  2Z2L B;  4II7 A;  1NLZ A;  4Y7P A;  2PYP A;  2PRF A;  2HP6 A;  5GLB A;  4HP9 A;  1K54 C;  5CED A;  3IF6 A;  3CMZ A;  2LB9 A;  1PWC A;  1DJC A;  1DY6 A;  1WYC A;  3PTE A;  1S0W A;  2Y2M A;  1W8Q A;  3R7W B;  1ES2 A;  3HUM A;  4WM9 A;  4ZAM A;  5I5L A;  2QHK A;  4S2M A;  2WKH A;  1JWP A;  3MZE A;  3V3R A;  3VSK A;  4CQH A;  3W4Q A;  3H9W A;  3L9K A;  2JHE A;  4JLF A;  5MC7 A;  3B42 A;  2Y91 A;  2HPB A;  3NC8 A;  4ZRR A;  3QHY A;  1W79 A;  1A0K A;  2EX9 A;  3DTK A;  3PAG A;  4HI4 A;  3C4O A;  1E25 A;  4HNB A;  2EFX A;  2QYB A;  2W1T A;  3LIB A;  4YNR A;  3DW0 A;  3NY4 A;  4H8R A;  2J9O A;  2HDS A;  2O0Y A;  2G2U A;  4R70 A;  1K25 A;  4O01 A;  5DKK A;  1UWN X;  1YAX A;  5HAI A;  1FSW A;  3S7Q A;  3DTE A;  4EBN A;  4NG2 A;  4OKP A;  3A0R A;  4X69 A;  3PBN A;  3O3V A;  4XXR A;  3PXP A;  3H82 B;  1S67 L;  3LEQ A;  4KZA A;  2VV7 A;  2PBY A;  3CI6 A;  4PM7 A;  3LI9 A;  4JGP A;  3IXB A;  3VFH A;  2PHY A;  2CMN A;  1YT4 A;  3T50 A;  4JF4 A;  1F9I A;  3A3D A;  3ZG0 A;  5FA7 A;  4GDB A;  4EES A;  4LEN A;  4MBF A;  1BYW A;  2HJ9 C;  2VV8 A;  1DRM A;  3KSH A; 
#chains in the Genus database with same CATH homology
 4MCW A;  4JGQ A;  4HOI A;  4UEY A;  5IU1 A;  5DF9 A;  4PHT A;  1LSW A;  4HH2 A;  3UMD A;  4KUK A;  1LL8 A;  5TJJ A;  1NWZ A;  2J3W A;  3CWF A;  4OOL A;  2FZ0 A;  4MDZ A;  2PD8 A;  3S7P A;  3T4S A;  4GW9 A;  4PAU A;  5AVE A;  1H3Q A;  5DJT A;  4LPZ A;  4MN5 A;  3LR0 A;  1N9L A;  4EW7 A;  1DP6 A;  2O9C A;  3A0V A;  3MF0 A;  4E04 A;  2H28 A;  4HJ6 A;  4L9G A;  2KLI A;  2KX6 A;  3LR5 A;  1IOU A;  4MN7 A;  3MR0 A;  3GEC A;  2W3H A;  5IT5 A;  1F5M A;  1N9O A;  4Y2F A;  1W63 Q;  5K5B A;  2QKP A;  2R78 A;  1D7E A;  1OPX A;  2PT7 A;  4JGO A;  4BBT A;  1NLY A;  4YWZ A;  3LFV A;  1X0O A;  3BY8 A;  2W3F A;  4L9F A;  3LID A;  4XT2 A;  2P04 A;  1OT9 A;  1XJ3 A;  3TJZ C;  2ZMV A;  4G3V A;  3H82 A;  4AFI A;  5F69 A;  1YSQ A;  5HWW A;  3EGX C;  4GS9 B;  2GJ3 A;  1EW0 A;  3F1P B;  5HSQ A;  3GDI A;  2GNX A;  5DKL A;  3ICY A;  4WUJ A;  3SW1 A;  3P01 A;  1OTA A;  3TW8 A;  5J3W A;  5G4Z A;  3UE6 A;  5J4E A;  3C8C A;  3CUE A;  3PBO A;  1OTD A;  3MQO A;  3BQA A;  1OJ5 A;  4Y5F A;  3C38 A;  4LRZ E;  2GX5 A;  1TS0 A;  4NKP A;  2O9B A;  4I3J A;  3OC2 A;  5FL3 A;  3KSI A;  1F98 A;  4MN6 A;  3H7W B;  3MXQ A;  3KX0 X;  4KUO A;  1DP8 A;  5TBM B;  4I5S A;  1T19 A;  3BY9 A;  1P9W A;  3D3O A;  4BBU A;  3LR4 A;  2O99 A;  5HPI A;  2VZW A;  5HDS A;  4KQO A;  4IJG A;  4M4X A;  4L9E A;  1ZTU A;  2K2N A;  3EGD C;  4WEL A;  2Z6C A;  3U2A A;  3UB8 A;  2G7U A;  3C30 A;  2FH5 A;  3ULF A;  2M7V A;  3K3D A;  3MFX A;  2HF6 A;  3F1O B;  3NOP C;  2HJE A;  2MJ6 A;  3E4P A;  3MMH A;  1N9N A;  1TF1 A;  3IS2 B;  4GLQ A;  3EQU A;  3FG8 A;  4JGR A;  4EXO A;  3E98 A;  2D01 A;  5F5Y A;  3R7W A;  1OT6 A;  4R38 A;  3CLO A;  4EQ1 A;  4BWI A;  3S7N A;  2EWV A;  4GHI B;  4WLA A;  1VHM A;  2VGL S;  1XJ4 A;  4EUV A;  4ARZ B;  2VA0 A;  5HPF A;  4LLO B;  1G28 A;  4I3I A;  3VE4 A;  4HH3 A;  4NEE D;  4GS9 A;  3F1P A;  3NHQ A;  4F3L B;  1IFQ A;  1GSX A;  1UWP X;  3B33 A;  5C5K A;  1TD5 A;  3A0S A;  3E4Q A;  4NXE A;  5HD3 A;  4ETZ A;  2K7S A;  2PR5 A;  1XFN A;  3K2N A;  4IUH A;  1ODV A;  3LIF A;  1TS8 A;  2V0U A;  2LB5 A;  1T1B A;  2J3T D;  2VGL M;  3TE8 A;  2W0N A;  3H7W A;  5DFY A;  5TBM A;  1OTB A;  1LT0 A;  1OTI A;  4HHD A;  4L0L A;  3IBR A;  3KO6 A;  2JKR M;  3D72 A;  1YSP A;  3F1N B;  1P9R A;  4CLC E;  3CIT A;  3PHY A;  3P7N A;  5HWV A;  1S4S A;  1MKM A;  3LI8 A;  4FSF A;  1S4R A;  3R4K A;  3KYZ A;  5KSH A;  1T18 A;  2GZA A;  3IS2 A;  1TS6 A;  2XRN A;  3B47 A;  5F68 A;  2Y79 A;  3UB9 A;  3KSF A;  1TS7 A;  2D02 A;  4HJ3 A;  2L1M A;  1OJG A;  1ZHH B;  2OWJ A;  3KSG A;  2VV6 A;  1LSX A;  4EET B;  2JN7 A;  2KOI A;  3LUQ A;  3EOI A;  4LRY C;  1W63 M;  4GHI A;  2ZMF A;  4Q0H A;  1MC0 A;  2J3T C;  3BJN A;  3OOV A;  4QPR A;  2ZOH A;  4OOM A;  3T4Q A;  2O9A A;  4EER A;  2OAQ 1;  4MMN A;  4ARZ A;  2W3D A;  5KIZ A;  4HQA A;  3C2W A;  4RQ9 A;  4F3L A;  1VB6 A;  4WF0 A;  1KOU A;  2VX8 A;  3EWK A;  2QJ5 A;  3LIE A;  4P6Z S;  4LRX C;  3E0Y A;  5HL6 A;  3T4K A;  2A2L A;  2Z6D A;  2V1B A;  3UME A;  1T1C A;  4R3A A;  4CLC B;  3PR6 A;  2XRO A;  3JVU A;  3T4L A;  4CLC C;  5HD5 A;  2M7U A;  5LBR A;  3FPW A;  2YKF A;  2BAS A;  2KDK A;  2XA7 S;  3ZYT A;  2PDR A;  4NXB A;  4KQD A;  2W3E A;  2VEA A;  2B18 A;  3FC7 A;  2EWW A;  2V9A A;  3HJK A;  5CX7 A;  2V0W A;  4G3K A;  2JKR I;  3EEA A;  4PKY A;  4B9O A;  2L4R A;  4GCZ A;  3LIC A;  4I3A A;  3F1N A;  2PYR A;  2XSS A;  3LYX A;  3OLO A;  4P6Z M;  2PD7 A;  4WN5 A;  1V9Y A;  3G6O A;  3TRC A;  5A8B A;  5IS1 A;  4HIA A;  4G3W A;  2P08 A;  3PYP A;  4O0P A;  5DJU A;  4BJP A;  2QJ7 A;  2P7J A;  4HP4 A;  2ZOI A;  1DP9 A;  3PBQ A;  4BMW A;  4H6J B;  5EFW A;  3ZQ5 A;  4BBV A;  1OTE A;  2JKT M;  3HCY A;  4Y3I A;  4DMZ A;  1GSW A;  4IHQ A;  3UB7 A;  3MJQ A;  3K3C A;  2M1C A;  2W1T B;  3KYQ A;  3RFB A;  3W2Z A;  5DFX A;  4DJ2 A;  2YKH A;  1H8M A;  2K31 A;  3BQ8 A;  4O8G A;  3RH8 B;  4HY8 A;  2WKP A;  2VJW A;  1S1Z A;  3UB6 A;  1G6O A;  2ZBB A;  1XFQ A;  4R6L A;  1T1A A;  4IUK A;  3OCL A;  2IA2 A;  1S66 L;  4FOF A;  2I9V A;  2HGV A;  2A24 B;  2OWH A;  4II7 A;  1JNU A;  4K08 A;  1NLZ A;  2PYP A;  3BWL A;  4I38 A;  1P0Z A;  3CAX A;  4HP9 A;  2OOL A;  3E4O A;  1NRJ A;  4NXG A;  2LB9 A;  2VLG A;  4EEU A;  4CLC A;  2V1A A;  3BW6 A;  5G4Y A;  3IBJ A;  2WKR A;  3F1O A;  1XJ6 A;  4Q0J A;  4CLC D;  1D06 A;  2L0W A;  3R7W B;  5I5L A;  2QHK A;  4DJ3 A;  3PBR A;  2INW A;  1V9Z A;  2OAP 1;  5HWT A;  2WKQ A;  5AVF A;  2W3G A;  3NJA A;  3VOL A;  1STZ A;  4CQH A;  3H9W A;  3VV4 A;  2JHE A;  1GSV A;  3LR3 A;  4NXF A;  4UQI S;  5MC7 A;  3B42 A;  3HJI A;  4PKY G;  3EEH A;  2Y8H A;  2B02 A;  5HDD A;  4ZRR A;  2EA9 A;  2W1R A;  1LSV A;  4ME4 A;  3JVV A;  1S1Y A;  3T4O A;  3UE3 A;  3FPV A;  4H6J A;  4HI4 A;  2NUP C;  3NOT C;  4HNB A;  4I39 A;  2JKT I;  2VKS A;  3T4T A;  4HJ4 A;  2QYB A;  2W1T A;  3LIB A;  4B93 A;  4YNR A;  3VE3 A;  3MQQ A;  3EQV A;  4EU0 A;  5HZH A;  2O0Y A;  4Z1W A;  4R70 A;  5F6A A;  4O01 A;  1P97 A;  3DBA A;  5DKK A;  4UQI M;  1UWN X;  1YAX A;  5HDC A;  4DN0 A;  3PBT A;  3O5Y A;  3S7Q A;  3V67 A;  2QWS A;  2A24 A;  1Y28 A;  4WEK A;  4XT2 B;  3A0R A;  5AJG A;  3PBN A;  2NUT C;  1MZU A;  2HV1 A;  3RTY A;  3PXP A;  4ETX A;  3H82 B;  5L8M A;  3T4J A;  1WA9 A;  1UGU A;  1S67 L;  2VV7 A;  3NOU C;  1YKD A;  3OBF A;  3CI6 A;  1XJ2 A;  4YOF A;  3LI9 A;  4JGP A;  4EEP A;  3MQ0 A;  2J80 A;  5J7E A;  2PHY A;  2CMN A;  4Q0I A;  3LIA A;  3T50 A;  2PR6 A;  2W27 A;  1F9I A;  2DMW A;  3PBS A;  2XA7 M;  4GJ4 A;  3CUE C;  4EES A;  3OCN A;  1BYW A;  2HJ9 C;  2VV8 A;  4WL9 A;  1DRM A;  3S7O A;  3KSH A;  4WEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...