1OTAA

E46q mutant of photoactive yellow protein, p63 at 295k
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otaA00
1TS8A 1UWPX 5EFWA 3NHQA 3VE3A 1LL8A 4EEPA 1LSVA 1XJ3A 4PKYG 2J80A 3LIEA 2OWJA 4HH2A 3A0SA 2L1MA 1NWZA 3CWFA 3KX0X 3G6OA 2QJ5A 2PR5A 3HJKA 1TS0A 1P0ZA 3GDIA 1D06A 4NXGA 4JGPA 5DJTA 5HWWA 2QKPA 1S67L 1N9NA 2YKHA 1UWNX 1X0OA 1ODVA 4LLOB 1F9IA 1LSWA 3EEHA 4EW7A 2JHEA 1XJ4A 5F68A 4BBUA 2VV8A 3BY9A 3MJQA 1OTAA 4LRZE 4KQDA 2M1CA 3P7NA 2OOLA 2V1AA 1LT0A 5A8BA 3LIAA 3BY8A 3IBRA 3ZQ5A 4JGOA 1OJGA 2QJ7A 3UMEA 1XJ6A 5G4ZA 3CAXA 2PHYA 2EA9A 4E04A 4JGQA 4EQ1A 3C8CA 5J3WA 4MN5A 4WN5A 3UB6A 3H9WA 5DJUA 4EEUA 5F6AA 4F3LA 4YWZA 1OTIA 2L4RA 3LICA 2W27A 2VLGA 5HWTA 1T1BA 3LUQA 4HH3A 3H7WB 4K08A 4WL9A 2W0NA 4H6JB 3ULFA 2V0UA 1JNUA 4HJ3A 5HDCA 2INWA 4RQ9A 4HP4A 5F69A 3NOUC 4R3AA 3UB9A 4XT2A 4HOIA 5DKLA 4DJ2A 3IS2B 3MXQA 1S4RA 2OWHA 3F1NB 1TS6A 5HDDA 2HV1A 2R78A 5HDSA 3RH8B 3F1OA 2V9AA 4LRYC 4F3LB 4KUKA 4I3IA 4I38A 1GSVA 1T1AA 3E4OA 2D01A 1XJ2A 4WUJA 5TBMB 4LPZA 3C2WA 3NOTC 1LSXA 2V1BA 2PYPA 3VE4A 4EERA 2BASA 3LIBA 3H82A 1F98A 5J4EA 4JGRA 3LI8A 2QHKA 1OTBA 4M4XA 1GSWA 3FG8A 4XT2B 4NXBA 2A24A 1KOUA 4HQAA 2KDKA 4PKYA 1V9ZA 1G28A 1DP6A 1P97A 2K7SA 1OTEA 3FC7A 4DJ3A 5G4YA 2Z6CA 1S66L 2D02A 2GJ3A 4HJ6A 2ZBBA 4HJ4A 2P7JA 1OT6A 3MQQA 3SW1A 5KIZA 3K3CA 2PDRA 4KUOA 2VV6A 1S1YA 2PD8A 2WKQA 3LI9A 1S4SA 2YKFA 4BBVA 5DKKA 1N9LA 1DRMA 3A0RA 4GS9A 1VB6A 1V9YA 1XFQA 2WKRA 4I3JA 1EW0A 3OLOA 4L9FA 4R70A 2Z6DA 4GHIA 3UMDA 3F1PA 5I5LA 1UGUA 5HSQA 4NXFA 5IU1A 1MZUA 3A0VA 4GCZA 3RTYA 4R6LA 1D7EA 3MR0A 5F5YA 3B33A 1N9OA 4EESA 5HWVA 2ZOIA 1XFNA 3BWLA 2PR6A 4NXEA 5HD3A 4L9GA 4I5SA 3ICYA 3E4PA 4HP9A 2PD7A 1OTDA 1S1ZA 4GS9B 3PYPA 1WA9A 4WF0A 1GSXA 3EWKA 3HJIA 2PYRA 1OJ5A 4GHIB 2JN7A 2V0WA 4R38A 3F1PB 3LYXA 4HHDA 3UE6A 5HZHA 3D72A 4HI4A 4WLAA 1BYWA 4EXOA 3LIDA 4I39A 4HIAA 3K3DA 3T50A 3F1OB 1OT9A 3E4QA 1DP8A 2L0WA 3H7WA 3NOPC 4MN6A 3VOLA 4H6JA 3LIFA 3MFXA 5AVEA 4GW9A 1T18A 5J7EA 3UB8A 1DP9A 2VEAA 2B02A 3MQOA 4HY8A 1T1CA 4I3AA 2VV7A 5HD5A 3IS2A 1T19A 3NJAA 3F1NA 3H82B 4EETB 3GECA 1Y28A 4L9EA 4LRXC 3UB7A 5IS1A 2A24B 2I9VA 2QWSA 1TS7A 2WKPA 4B9OA 5AVFA 2H28A 3CLOA 5TBMA 3PHYA 2KX6A 2CMNA 4HNBA 4BBTA 2ZOHA
chains in the Genus database with same CATH superfamily
1TS8A 2GZAA 4ESPA 3A3FA 1MY8A 3VE3A 1IKIA 3EGXC 2Y2QA 5FQMA 1WYCA 2J80A 4S2NC 1BT5A 1G5UA 2OWJA 4HH2A 4JF5A 1NWZA 4BWIA 3DTEA 5EVLA 2Z2LB 5HFOA 4WMCD 3GDIA 4LCLA 1PNEA 3O87A 3ZG5A 3LR5A 5A91A 4LFUA 4OPZA 4WELA 4B4XA 1CI9A 1N9NA 3ZYTA 5CHUA 4LLOB 4PPRA 5MC7A 1HZOA 1F9IA 3VSLA 4OQ0A 4OLGA 2XLNA 2JHEA 1Y54A 5F68A 2XFSA 4U3TA 4BJPA 2WADA 1OTAA 1I5QA 3JYIA 5TGFA 3U2AA 3P7NA 3PBNA 4UA9A 2XA7S 3ZGAB 2XEPA 4EUZA 1MXOA 3T4OA 1U60A 2HDSA 3BY8A 5F82A 1KGFA 4AFIA 4N9KA 2M7UA 1SCWA 2O9BA 1NZUA 2QJ7A 4RA7A 1XJ6A 2EX9A 1TD5A 4EQ1A 2HGVA 2J9PA 3OCNA 4MN5A 4R4SA 4P6BA 3O3VA 4EEUA 4EWFA 4CLCB 4ID4A 3R7WA 3Q07A 4S2IA 3S4XA 4DF6A 4JF6A 2Y2KA 2G2UA 2W0NA 4H6JB 4NEED 3ULFA 1IYQA 3D3OA 1ERQA 1JNUA 5J8XA 5CEDA 5HL6A 5E2EA 5E2GA 1K54A 4DE0A 5A90A 4QB8A 1VM1A 5F69A 3M6HA 1RCJA 1BUEA 2GX5A 4HOIA 5DKLA 4EV4A 3LGOA 5DFXA 5L07A 5JYOA 1XA7A 2HDUA 4Y3IA 1HTZA 2VGJA 4IUHA 4OP8A 5HDDA 2R78A 1FQGA 3KSGA 3GTCA 4DE2A 1YMXA 4F3LB 3SH9A 4DDYA 1EWZA 4YOFA 3ZG0A 2HDRA 3BYDA 1XJ2A 4HBUA 4GB7A 3N8RA 1KGEA 5TBMB 3VOYA 2P74A 1PRQA 1MPLA 2BASA 3QNCA 3IXBA 5EVIC 3LIBA 4FH4A 1F98A 1L3LA 1Y4OA 3E98A 3LI8A 2QHKA 4E3LA 3T4SA 3PBSA 3W4PA 4UA6A 2VJWA 5CHJA 2AVXA 4DKIA 3V39A 2K7SA 3W2ZA 1PWGA 4QJGA 4DXBA 3ZG7B 3HLGA 5C5KA 2G7UA 3NI9A 4KZAA 3OCLA 1K4EA 2ZBBA 3P01A 2DCFA 2P7JA 1FCNA 3MBZA 3MQQA 2IWDA 4WYYA 3JVUA 3CG5A 1JWZA 2VV6A 3BFDA 2XA7M 5FAQA 3EOIA 1S4SA 3HCYA 4BBVA 3LO7A 3OPRA 5FQJA 4IEDA 1OPXA 4ZAMA 3T1RA 1Q2PA 4NKPA 1ES5A 4H8RA 4CPKA 1H8YA 1Z6FA 1K55C 3HLDA 2MJ6A 5I5LA 2J3TD 1Q2QA 3A0VA 4K91A 3HREA 1H0MA 3SH8A 2OLUA 4LENA 2A49A 4R6LA 1BULA 2J7VA 1D7EA 4YINA 3MR0A 4DDSA 4OH0A 1N9OA 1F2KA 5HWVA 5I94A 2QZ6A 2ZOIA 3TSGA 2M7VA 3FZCA 2KOIA 2XK1A 3ZCZA 5EVIA 3S7PA 1G6AA 4QHCA 3MS6A 4I5SA 1W63Q 3UB5P 3E0YA 4O01A 4GS9B 3PYPA 4WF0A 2P08A 3IXGA 3EWKA 3IF6B 2XDMA 4S2LA 3CITA 2BLSA 1XA1A 3IX8A 5EE8A 1FR6A 2JN7A 3UPPA 4X1LA 3LYXA 3BQ8A 5CERA 3UE6A 1WYBA 4KZ8A 4UEYA 5EPHA 3UNWA 2Q9NA 3CUEC 1FIKA 3F1OB 2WGVA 3ZNYA 2L0WA 3BLMA 3H7WA 1VEUB 2WGIA 4Y15A 3BFEA 1YKDA 4E3KA 3A3EA 4RX2A 1FR1A 5U47A 3VFFA 1MWRA 4P6ZS 1MWUA 4ZBEA 1K55A 1CK3A 3LY3A 3D4FA 4CJNA 2QPNA 3IX3A 2B02A 3LEZA 3MQOA 4HY8A 3IBJA 1FILA 4KG5A 2ZL1A 4IUKA 5A92A 1T19A 4BMWA 4E3IA 3F1NA 1JTGA 3LR0A 4EETB 4R0QA 4L9EA 3HUOA 2G2WA 3GRJA 2ZC5B 4LRXC 1MKMA 3UB7A 4Y17A 5E2FA 2A24B 2WYXA 4S2OA 3IWQA 2HP6A 4KZ9A 2HPBA 3Q82A 4EUVA 4GJ4A 1W8YA 3C5AA 4B9OA 1TEMA 2ZM2A 3G34A 3RJUA 5AVFA 4BD0A 4R4RA 2CMNA 4X1MA 3ZNTA 1BZAA 3CMZA 1LL8A 3VP3A 3PBRA 2EX8A 2CC1A 4EEPA 3LR4A 3C4OA 4ME4A 4B4ZA 3ITAA 2C6WB 3MQ0A 5L10A 3EEAA 1CEGA 3IX4A 2BG1A 1ERMA 3S22A 1VETA 3CPTA 3P09A 3C4PA 4G3KA 2JKRI 4NXGA 4MCWA 4JGPA 5DJTA 1W63M 3IT9A 4GDNA 1UWNX 1X0OA 1ODVA 4ZRRA 2PT7A 4MMNA 4QD4A 4GKUA 3LFVA 4GOGA 1LSWA 4X69A 3R4KA 2VX8A 5CTMA 2Q0OA 1L0EA 2ACGA 3MFDA 2VV8A 3BY9A 3SOIA 1PYYA 2EX2A 1YAXA 5CX7A 1JVJA 5KMWA 2M1CA 1D1JA 5GLBA 2V1AA 4KG6A 3WS4A 3LR3A 3LIAA 5A8BA 2X01A 4G3WA 5EOOA 2WZZA 3SS4A 3FWLA 2JCHA 3IBRA 3BFCA 4GLQA 3QP4A 2V8CA 2W3HA 3G2YA 3UMEA 4WZ5C 4PM5A 2ZQ9A 1ZHHB 4BL3A 2PHYA 4MBKA 3WS1A 1JWVA 1WE4A 5EVID 3M6BA 4OKPA 1YMSA 1HVBA 4WN5A 3UB6A 5FDSA 3KYZA 2PU2A 5F6AA 4II7A 2EXBA 2Q9MA 5AQ7A 4YWZA 2ZC7A 1XXMA 1GHPA 2W27A 2ZMFA 2FZ0A 2FFFB 3CI6A 3LUQA 3PAGA 1GA0A 4WL9A 3V5MA 2V0UA 3FYZA 3BECA 4UA7A 1DJCA 4ZDXA 4HJ3A 3SS5A 4ARZA 4QY6A 3B3XA 4R1GA 4RQ9A 4U0TA 2FFYA 3V3RA 4R3AA 4XT2A 1K6SA 2VA0A 3IS2B 1ES2A 4LV2A 3Q81A 1TS6A 1C3BA 2HV1A 4NG2A 3RH8B 4MNRA 5FATA 4BD1A 1K54C 1XX2A 5FSRA 1TVFA 2GDNA 4ZTKA 1P9WA 2OV5A 4OONA 1IFQA 3QP5A 4F94A 2OSUA 4LV3A 5AQBA 2ZJ9A 3C2WA 2Y2GA 1IKGA 2HDQA 2V1BA 2PYPA 3NIAA 4WZ5A 3T4JA 3WRZA 2WKHA 4Y13A 1STZA 3H82A 3T4QA 3SS3A 4M4XA 2IA2A 1SKFA 3FG8A 1HLUP 4WZ4A 1H8ZA 2WK0A 2ZQDA 4NXBA 3UE3A 4WEJA 1K0KA 4BENA 4OOMA 5EOEA 1G28A 1P97A 1ZG6A 2VGLM 1BSGA 5G4YA 2XD1A 4FUWA 5CXWA 4PM8A 4DMZA 5M1AA 3DTKA 3UDFA 2D02A 4HEFA 2GJ3A 2EWWA 4E6WA 1YLYA 3SW1A 1ZKJA 3DW0A 2PD8A 1IYSA 5GHZA 1L0GA 3RXWA 2WGWB 1ZC2A 2OAP1 1YLJA 5HL1A 2H10A 2YKFA 5DKKA 1DRMA 4FOFA 2Y79A 5EUAA 4I3JA 1EW0A 3PBQA 2J3WA 5CGWA 3KO6A 1E4DA 3HUNA 3G31A 4N1XA 4B88A 5FA7A 1ESUA 3F1PA 3BRMA 3SH7A 5LBRA 3BLSA 5HSQA 1ZG4A 4NXFA 5IU1A 1MZUA 4OQHA 2VZWA 4PMAA 3K2NA 1AWIA 5CGSA 2WUQA 4P85A 2NUPC 4Q0HA 1YLTA 1ES3A 1GCEA 4EESA 2Y91A 3FPWA 2H5SA 1XFNA 3BWLA 4E3MA 5TJJA 3OC2A 4NXEA 1G6OA 5HD3A 4MDZA 2PU4A 3ISGA 2PD7A 1OTDA 1YLWA 1M6KA 2C5WB 1WA9A 1GSXA 2XH9A 1DJAA 3HJIA 3TOIA 2JKGA 3C38A 2V0WA 3ZDJA 4HHDA 3Q1FA 1NYYA 3UPNA 5FASA 1VQQA 3D72A 2EFUA 2K31A 3Q7VA 2W1TB 3G35A 4HIAA 2R9WA 3QP2A 3ZFZA 4CLCA 4X55A 3BQAA 2VGKA 1NJ4A 2JKTM 1EI5A 3T50A 1SKOA 4JXWA 2ZD8A 2VK3A 3NOPC 3JVVA 4H6JA 2P9VA 3LIFA 3MFXA 3MXSA 4KZ5A 1CJFA 3AGEA 3S1YA 3N8SA 2ZQCA 5FEGA 4N92A 3OPLA 1OMEA 4E3NA 5FEFA 4ETXA 4C3QA 5HD5A 3T1SA 1IYOA 1PW8A 1S0WA 3NJAA 4JLFA 3HLEA 3GECA 4Q0IA 1Y28A 5KSHA 3HBRA 3JPUA 1J3WA 2ZQ8A 4LV0A 3NECA 2QWSA 5CTNA 3IWOA 2XFTA 1TS7A 5E43A 3O86A 5TBMA 4E6XA 2KX6A 4EBNA 5DTKA 1SDNA 3KSHA 4BBTA 2Y8HA 4DXCA 1S6RA 1MBLA 2Y2LA 2PBYA 3C30A 5EM1A 2ZQ7A 1LSVA 1XJ3A 4GDBA 4PM6A 4FD8A 2PAVP 1SDEA 4GN2A 2NUTC 3GR2A 3KSFA 3A0SA 1GHMA 2L1MA 1YT4A 3G6OA 1TDLA 2QJ5A 4JPMA 1NZOA 1G68A 1MC0A 2PR5A 2WKEA 1TS0A 4XXRA 1CF0A 1W5DA 1P0ZA 4Y0UA 3ZHHA 2JE5A 1RP5A 1D06A 3B42A 4OP5A 5HWWA 1XGJA 4M3KA 1S67L 2XRNA 1NY0A 2YKHA 2ZMVA 4O7DA 3EEHA 4A5RA 3P98A 3LCEA 4HESA 3NULA 4Y0TA 2VKSA 1XP4A 3MJQA 4R23A 1IELA 2XQZA 4KQDA 4C6YA 5HW3A 2OOLA 2X02A 3WS5A 5GLCA 3ZVTA 5FQQA 3HL9A 3PR6A 5L09A 4OPQA 1PI4A 3NC8A 3RXXA 3A3DA 3ZQ5A 1N9BA 1QMFA 5FI6A 2O99A 3HLWA 3CPTB 4C75A 4EBLA 4QU3A 3D9YA 3CAXA 1Z09A 4ZJ2A 2EA9A 1FCMA 2OLVA 3FKVA 4E04A 4JGQA 3C8CA 5CGXA 5CECA 3FV7A 3BJNA 5HAIA 4RX3A 5AQ9A 3LEQA 3PAEA 3MSHA 2JKRM 1PZPA 2QYBA 1FCOA 2W3GA 3E2KA 4FSFA 2L4RA 3LICA 1H3QA 2VLGA 3S7OA 5HWTA 1ONGA 4B93A 4HH3A 3CHWP 2FH5A 4K08A 3IQAA 3PXPA 5A93A 3IF6A 2ZLYA 3QP6A 3BFFA 1CEFA 2JC7A 1QMEA 2O9CA 1PI5A 1KGGA 1ALQA 3IXHA 3ZG9B 3AGDA 2O9AA 5EM0A 4HP4A 2W3EA 1RGYA 3UB9A 1NLZA 1H5XA 1S4RA 1L0FA 4P0MA 4E3OA 2UV0E 3VSKA 4Y2FA 3PBTA 4OPRA 3F1OA 2V9AA 3VP2A 1I2SA 2KLIA 4KUKA 1VEUA 2HJ9C 4I3IA 4I38A 2WAFA 2WKIA 1GSVA 1J9MA 1W7FA 3E4OA 2XF3A 1YM1A 5F83A 2VGLS 5FI7A 3DWZA 3V3SA 2WAEA 3NOTC 3OPHA 4KENB 3E2LA 1PWCA 5JYPA 3MKFA 3VE4A 4EERA 4BL2A 2DNSA 5J4EA 4JGRA 1OTBA 1GSWA 4XT2B 1K57A 1SHVA 3IHBA 1K6RA 3UE0A 3CZDA 2ZMAA 2A24A 1KDSA 1KOUA 2A2LA 5FAPA 2KDKA 4PKYA 3UPOA 4DE3A 1IEMA 2BTFP 4DJ3A 1GA9A 2ZQAA 2HP5A 5CRFA 4JXVA 4DN0A 4CQHA 4R3JA 4OOLA 3WRTA 2P04A 4HJ6A 4PM7A 4UHUA 1OT6A 4O8GA 2LB5A 4KQOA 2PDRA 4KZBA 5DF8A 1FSYA 5EECA 4RVAA 5KSCA 1W79A 4FCFA 1BLCA 5HAPA 3A0RA 3OOVA 2DMWA 3DWKA 5DTSA 3N4IA 3VP1A 2WKRA 1W8QA 4S2KA 4QPRA 1KVLA 3OLOA 4L9FA 1BLHA 4IVKA 1VHMA 3UO9A 3IHAA 4R70A 5GLAA 3C7VA 2Z6DA 4GHIA 1UGUA 4X53A 2IWBA 4UAAA 5GLDA 4S2JA 3VV4A 1NLYA 2V20A 1GHIA 2Y55A 3W8KA 4X25A 5DF9A 5F5YA 1ES4A 4UQIM 1BTLA 4Q0JA 3R7WB 3G2ZA 4XUXA 4L9GA 3QNBA 3EQVA 5GHXA 3NDEA 4NETA 3VP4A 2B95A 2HP9A 1LL9A 2HF6A 3SZTA 1PIOA 3T4KA 2PYRA 1OJ5A 1PZOA 4GD6A 3FPVA 1EROA 4R38A 1E25A 3F1PB 3WS2A 2ZM8A 3HUMA 1IYPA 1YLPA 1TDGA 3WWXA 4PAUA 4EU0A 4WLAA 5FAOA 4EXOA 4IVIA 3LIDA 2HJEA 4I39A 1PWDA 2Y2JA 1PW1A 4KZ4A 3BM6A 5IHVA 5BOHA 1OT9A 3E4QA 3IWIA 5GHYA 3S7QA 4EQIA 1YPRA 4MN6A 3VOLA 4CLCE 3A3IA 4OOYA 1YSQA 3VFHA 1ONHA 5AVEA 3T12B 3V50A 4GNUA 5J7EA 3UB8A 1DP9A 2Y4AA 4Z9QA 4CLCC 1RGZA 2UWXA 4YNRA 4Z1WA 3PTEA 1T1CA 4OVDA 3OPPA 3IS2A 4U0XA 1MKIA 1E3UA 2I72A 3HVFA 2H0YA 3EQUA 3AGFA 1K56A 3Q7VB 5FQIA 5HPFA 3MZDA 2XR0A 3VP0A 5D3OA 4S2NA 2I9VA 3N6IA 3VOZA 1SKOB 2WKPA 3UE1A 4NK3A 2H28A 3CLOA 1JTDA 3ZVWA 4OQIA 2P9VB 2ZOHA 1M40A 1O07A 3G32A 1UWPX 5EFWA 2Y2HA 3NHQA 1LHYA 4QY5A 3MMHA 4PKYG 3OZHA 3M2KA 3LIEA 4KZ6A 2IWCA 2O0YA 3CWFA 3V67A 3KX0X 3HJKA 3W4QA 4HBTA 4KG2A 5L8MA 2EFXA 4K0WA 3NDGA 3N8LA 4N1HA 5G18A 2QKPA 4X68A 1ZTUA 4BQMA 1H8MA 4MBFA 5HARA 3RFBA 3O5YA 2ZC4B 1FOFA 3BEBA 1O7EA 4EW7A 1XJ4A 2WGWA 4D2OA 4R3BA 4EBPA 4KZ7A 5M18A 4BBUA 3T1XA 1NRFA 3IH9A 4LRZE 5EVIB 3QHYA 2HZ5A 1LT0A 3HLBA 4MN7A 4WM9A 3DTIA 2Y2OA 4JF4A 3M2JA 4KQRA 4LV1A 4X6TA 1CQAA 5HX9A 4JGOA 4KQQA 1NYMA 1L0DA 5M19A 1OJGA 1AXBA 5G4ZA 1I2WA 5J3WA 2XD5A 1KDWA 4S2MA 5CEBA 4Y0OA 3NBLA 2EXAA 3H9WA 5E2HA 5DJUA 5L2FA 4IBXA 1PFLA 4F3LA 4IBRA 4DE1A 1YQSA 4MBHA 3N7WA 3C7UA 5TR7A 1OTIA 3DBAA 3T4TA 2V8FA 1T1BA 1HD8A 3MZEA 1LLBA 5DFYA 3H7WB 1BLPA 4OQGA 1YLZA 4X56A 3UDIA 3FKWA 3HLFA 3KYEA 3TG9A 3GV9A 5HDCA 3LY4A 5GL9A 3W4OA 2INWA 2Y2NA 3GQZA 3ITBA 4RYEA 2XROA 1P9RA 3NOUC 2JKTI 2ZL1B 5FI2A 4DJ2A 2W1TA 3MXQA 4JBFA 2OWHA 3F1NB 4GZBA 1KE0A 4MEZA 2DRWA 3IF6C 5HDSA 5FDHA 1F5MA 3A3JA 1IOUA 4LRYC 3NCKA 2Y2IA 2ZC3B 1SZVA 2JKFA 2JBFA 1T1AA 2RCXA 5EV0A 2D01A 1KE3A 4Q8IA 1LI9A 4WUJA 3QP1A 4BLMA 5HPIA 4LCMA 4LPZA 1E3UD 2E8IA 1MWTA 1L2SA 4S2PA 4QWOA 1LSXA 5DVAA 3OBFA 3DTMA 1K56D 5AQAA 1KVMA 2PRFA 3TJZC 2V2FF 2XSSA 2Z2MB 3NY4A 1XGIA 4E3JA 3B47A 3L9KA 4LGWA 1K25A 4HQAA 4OPYA 1V9ZA 4WBGA 1LL5A 1DP6A 1OTEA 3FC7A 1VETB 2R9XA 2Z6CA 1S66L 3ZG8B 4WMCA 3VMAA 3IXDA 1K57C 3L7HA 4HJ4A 2EX6A 3QP8A 3UN7A 5KIZA 3K3CA 4KUOA 4O0PA 2J8YA 1S1YA 3KYQA 2WKQA 2B18A 3LI9A 4OLDA 3TE8A 2ZM0A 3U4LP 1N9LA 2Y2PA 2Y2MA 3EGDC 2B5RA 4GS9A 1VB6A 1V9YA 1XFQA 1ACFA 4JXGA 4UQIS 4JKTA 2WZXA 4WEKA 5DTTA 3UDXA 4K0XA 3UMDA 3O88A 4CLCD 1CI8A 2LB9A 2EWVA 4YFMA 4DRTA 4GCZA 1NXYA 1DJBA 2A3UA 1XPBA 2W3DA 3TW8A 3RTYA 4XUZA 1A0KA 3WS0A 3B33A 5F1FA 3MZFA 4D60A 5IT5A 2PR6A 4GD8A 5K5BA 3G30A 4ZJ1A 3ICYA 3DAVA 3E4PA 4HP9A 1S1ZA 3T4LA 3CUEA 4IJGA 4Y5FA 4FH2A 4FTXA 3IF5A 5TFQA 4ARZB 1LI0A 4GHIB 2X71A 1XKZA 3KSIA 2V1ZA 3MXRA 5HZHA 4G3VA 4HI4A 4PHTA 1MWSA 1BYWA 2J9OA 4IHQA 4ZJ3A 4Y7PA 5CHMA 3K3DA 5FQKA 1K38A 4P87A 1FSWA 3PBOA 1ESIA 3CJMA 3I7JA 1DP8A 5KZHA 3GVBA 3BW6A 2RL3A 5F1GA 5HAQA 2W3FA 5AJGA 2PBDP 4GW9A 1NRJA 3IH8A 2QMIA 2GNXA 2ZC6B 3BFGA 3T1QB 4L0LA 3G4PA 1T18A 2Y59A 5DF7A 5EVEA 2J3TC 2VEAA 1YSPA 3GSGA 5FL3A 1KE4A 3UY6A 4I3AA 1TF1A 2VV7A 4PM9A 1K4FA 1N4OA 1DY6A 3GMWA 3H82B 4ETZA 2OAQ1 3MKEA 1JWPA 5IS1A 1BLSA 2XGNA 2E8JA 4N9LA 5FQ9A 3S7NA 3Q7ZA 4MLLA 4P6ZM 3MF0A 4KZ3A 3TRCA 2H0TA 2W1RA 3PHYA 2K2NA 4HNBA 4JXSA 3HLCA
chains in the Genus database with same CATH topology
1TS8A 2GZAA 1UWPX 5EFWA 3NHQA 3VE3A 1LL8A 3C30A 3MMHA 3PBRA 4EEPA 3LR4A 1LSVA 1XJ3A 3EGXC 4ME4A 4PKYG 2J80A 2NUTC 3LIEA 2OWJA 3KSFA 4HH2A 3A0SA 3MQ0A 2L1MA 1NWZA 2O0YA 3EEAA 3CWFA 3V67A 3KX0X 3G6OA 2QJ5A 4BWIA 1MC0A 2PR5A 3HJKA 1TS0A 1P0ZA 3GDIA 5L8MA 4G3KA 1D06A 3B42A 2JKRI 4NXGA 4MCWA 4JGPA 5DJTA 1W63M 3LR5A 5HWWA 2QKPA 1ZTUA 4WELA 1S67L 2XRNA 1N9NA 3ZYTA 2YKHA 1UWNX 1H8MA 1X0OA 1ODVA 4LLOB 4ZRRA 2ZMVA 3RFBA 5MC7A 3O5YA 1F9IA 2PT7A 4MMNA 3LFVA 1LSWA 3EEHA 3R4KA 2VX8A 2JHEA 1XJ4A 5F68A 4EW7A 4BBUA 4BJPA 2VKSA 2VV8A 3BY9A 3MJQA 1OTAA 4LRZE 1YAXA 4KQDA 5CX7A 2M1CA 3U2AA 3P7NA 2OOLA 2V1AA 3PBNA 1LT0A 5A8BA 3LR3A 2XA7S 3LIAA 3PR6A 4G3WA 4MN7A 3T4OA 3BY8A 4AFIA 3IBRA 2M7UA 3ZQ5A 4JGOA 4GLQA 2O99A 2W3HA 2O9BA 1OJGA 2QJ7A 3UMEA 1XJ6A 5G4ZA 3CAXA 1ZHHB 2PHYA 2EA9A 1TD5A 4E04A 4JGQA 4EQ1A 2HGVA 3C8CA 3OCNA 5J3WA 4MN5A 3BJNA 4WN5A 3UB6A 2JKRM 3H9WA 5DJUA 4EEUA 3KYZA 5F6AA 4II7A 4F3LA 4YWZA 2QYBA 4CLCB 2W3GA 3R7WA 1OTIA 3DBAA 4FSFA 2L4RA 3LICA 2W27A 2ZMFA 1H3QA 3T4TA 2VLGA 3S7OA 5HWTA 2FZ0A 3CI6A 1T1BA 3LUQA 4B93A 4HH3A 2FH5A 3H7WB 4K08A 5DFYA 3PXPA 4WL9A 2W0NA 4H6JB 4NEED 3ULFA 2V0UA 3D3OA 1JNUA 4HJ3A 4ARZA 2O9CA 5HDCA 5HL6A 2O9AA 2INWA 4RQ9A 4HP4A 5F69A 2XROA 1P9RA 2W3EA 3NOUC 2JKTI 4R3AA 3UB9A 4XT2A 2GX5A 1NLZA 4HOIA 5DKLA 4DJ2A 5DFXA 2W1TA 4Y3IA 2VA0A 3IS2B 3MXQA 1S4RA 2OWHA 4IUHA 3F1NB 1TS6A 5HDDA 2HV1A 2R78A 5HDSA 4Y2FA 1F5MA 3KSGA 3PBTA 3RH8B 3F1OA 2V9AA 1IOUA 4LRYC 2KLIA 4F3LB 4KUKA 2HJ9C 4I3IA 4YOFA 4I38A 1GSVA 1T1AA 3E4OA 2D01A 1XJ2A 4WUJA 1P9WA 2VGLS 1IFQA 5TBMB 5HPIA 4LPZA 3C2WA 3NOTC 1LSXA 3OBFA 2V1BA 2PYPA 3VE4A 4EERA 2BASA 3TJZC 3T4JA 1STZA 3LIBA 3H82A 2XSSA 1F98A 3T4QA 5J4EA 4JGRA 3LI8A 3E98A 2QHKA 1OTBA 4M4XA 2IA2A 3T4SA 1GSWA 3FG8A 4XT2B 3PBSA 4NXBA 3B47A 2VJWA 2A24A 3UE3A 4WEJA 1KOUA 4HQAA 2A2LA 4OOMA 2KDKA 4PKYA 1V9ZA 1G28A 1DP6A 1P97A 2K7SA 1OTEA 2VGLM 3FC7A 3W2ZA 4DJ3A 5G4YA 2Z6CA 4DMZA 1S66L 5C5KA 2G7UA 2D02A 4DN0A 4CQHA 4OOLA 3OCLA 2GJ3A 2P04A 2EWWA 4HJ6A 2ZBBA 4HJ4A 3P01A 2P7JA 1OT6A 3MQQA 4O8GA 2LB5A 3SW1A 3JVUA 4KQOA 5KIZA 3K3CA 2PDRA 4KUOA 4O0PA 2VV6A 1S1YA 2PD8A 3KYQA 2XA7M 2WKQA 2B18A 2OAP1 3LI9A 3TE8A 3EOIA 1S4SA 2YKFA 3HCYA 5DKKA 1N9LA 4BBVA 1DRMA 3EGDC 3A0RA 4FOFA 4GS9A 3OOVA 1OPXA 2Y79A 1VB6A 2DMWA 1V9YA 4NKPA 1XFQA 2WKRA 4UQIS 4I3JA 4QPRA 4WEKA 1EW0A 3PBQA 3OLOA 4L9FA 2J3WA 1VHMA 3KO6A 4R70A 2Z6DA 4GHIA 3UMDA 2MJ6A 3F1PA 2J3TD 5I5LA 1UGUA 4CLCD 5LBRA 5HSQA 4NXFA 5IU1A 1MZUA 2LB9A 2EWVA 2VZWA 3A0VA 3K2NA 4GCZA 3VV4A 1NLYA 2NUPC 4Q0HA 2W3DA 3TW8A 3RTYA 4R6LA 1D7EA 3MR0A 5DF9A 5F5YA 3B33A 1N9OA 4EESA 5HWVA 2ZOIA 3FPWA 2M7VA 2KOIA 1XFNA 3BWLA 5TJJA 5IT5A 4UQIM 3S7PA 4Q0JA 3OC2A 2PR6A 4NXEA 1G6OA 3R7WB 5HD3A 5K5BA 4MDZA 4L9GA 4I5SA 1W63Q 3ICYA 3E0YA 3E4PA 4HP9A 2PD7A 1OTDA 1S1ZA 4O01A 4GS9B 3EQVA 3PYPA 3T4LA 1WA9A 4WF0A 3CUEA 1GSXA 2P08A 4IJGA 3EWKA 2HF6A 3HJIA 3CITA 3T4KA 4Y5FA 2PYRA 1OJ5A 4ARZB 3FPVA 3C38A 4GHIB 2JN7A 2V0WA 4R38A 3F1PB 3LYXA 4HHDA 3BQ8A 3KSIA 3UE6A 5HZHA 3D72A 4G3VA 4PAUA 4HI4A 4PHTA 4EU0A 4WLAA 1BYWA 4EXOA 2K31A 3LIDA 4IHQA 2HJEA 2W1TB 4I39A 4HIAA 3K3DA 4CLCA 4UEYA 3CUEC 3PBOA 3BQAA 2JKTM 3T50A 3F1OB 1OT9A 3E4QA 3S7QA 1DP8A 3BW6A 2L0WA 3H7WA 3NOPC 4MN6A 3VOLA 4CLCE 3JVVA 4H6JA 1YSQA 3LIFA 1YKDA 2W3FA 5AJGA 3MFXA 5AVEA 4GW9A 1NRJA 2GNXA 4L0LA 1T18A 5J7EA 3UB8A 4P6ZS 1DP9A 2J3TC 2VEAA 4CLCC 1YSPA 2B02A 4YNRA 4Z1WA 5FL3A 3MQOA 4HY8A 4ETXA 3IBJA 1T1CA 4I3AA 1TF1A 2VV7A 5HD5A 4IUKA 3IS2A 1T19A 3NJAA 4BMWA 3F1NA 3H82B 4EETB 3LR0A 3GECA 4ETZA 4Q0IA 1Y28A 3EQUA 4L9EA 2OAQ1 5HPFA 5KSHA 4LRXC 3UB7A 1MKMA 5IS1A 2A24B 2I9VA 2QWSA 3S7NA 4EUVA 4GJ4A 1TS7A 4P6ZM 3MF0A 2WKPA 4B9OA 3TRCA 5AVFA 2H28A 3CLOA 2W1RA 3PHYA 2K2NA 2KX6A 5TBMA 2CMNA 4HNBA 3KSHA 4BBTA 2ZOHA 2Y8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS8 A;  1UWP X;  5EFW A;  3NHQ A;  3VE3 A;  1LL8 A;  4EEP A;  1LSV A;  1XJ3 A;  4PKY G;  2J80 A;  3LIE A;  2OWJ A;  4HH2 A;  3A0S A;  2L1M A;  1NWZ A;  3CWF A;  3KX0 X;  3G6O A;  2QJ5 A;  2PR5 A;  3HJK A;  1TS0 A;  1P0Z A;  3GDI A;  1D06 A;  4NXG A;  4JGP A;  5DJT A;  5HWW A;  2QKP A;  1S67 L;  1N9N A;  2YKH A;  1UWN X;  1X0O A;  1ODV A;  4LLO B;  1F9I A;  1LSW A;  3EEH A;  4EW7 A;  2JHE A;  1XJ4 A;  5F68 A;  4BBU A;  2VV8 A;  3BY9 A;  3MJQ A;  1OTA A;  4LRZ E;  4KQD A;  2M1C A;  3P7N A;  2OOL A;  2V1A A;  1LT0 A;  5A8B A;  3LIA A;  3BY8 A;  3IBR A;  3ZQ5 A;  4JGO A;  1OJG A;  2QJ7 A;  3UME A;  1XJ6 A;  5G4Z A;  3CAX A;  2PHY A;  2EA9 A;  4E04 A;  4JGQ A;  4EQ1 A;  3C8C A;  5J3W A;  4MN5 A;  4WN5 A;  3UB6 A;  3H9W A;  5DJU A;  4EEU A;  5F6A A;  4F3L A;  4YWZ A;  1OTI A;  2L4R A;  3LIC A;  2W27 A;  2VLG A;  5HWT A;  1T1B A;  3LUQ A;  4HH3 A;  3H7W B;  4K08 A;  4WL9 A;  2W0N A;  4H6J B;  3ULF A;  2V0U A;  1JNU A;  4HJ3 A;  5HDC A;  2INW A;  4RQ9 A;  4HP4 A;  5F69 A;  3NOU C;  4R3A A;  3UB9 A;  4XT2 A;  4HOI A;  5DKL A;  4DJ2 A;  3IS2 B;  3MXQ A;  1S4R A;  2OWH A;  3F1N B;  1TS6 A;  5HDD A;  2HV1 A;  2R78 A;  5HDS A;  3RH8 B;  3F1O A;  2V9A A;  4LRY C;  4F3L B;  4KUK A;  4I3I A;  4I38 A;  1GSV A;  1T1A A;  3E4O A;  2D01 A;  1XJ2 A;  4WUJ A;  5TBM B;  4LPZ A;  3C2W A;  3NOT C;  1LSX A;  2V1B A;  2PYP A;  3VE4 A;  4EER A;  2BAS A;  3LIB A;  3H82 A;  1F98 A;  5J4E A;  4JGR A;  3LI8 A;  2QHK A;  1OTB A;  4M4X A;  1GSW A;  3FG8 A;  4XT2 B;  4NXB A;  2A24 A;  1KOU A;  4HQA A;  2KDK A;  4PKY A;  1V9Z A;  1G28 A;  1DP6 A;  1P97 A;  2K7S A;  1OTE A;  3FC7 A;  4DJ3 A;  5G4Y A;  2Z6C A;  1S66 L;  2D02 A;  2GJ3 A;  4HJ6 A;  2ZBB A;  4HJ4 A;  2P7J A;  1OT6 A;  3MQQ A;  3SW1 A;  5KIZ A;  3K3C A;  2PDR A;  4KUO A;  2VV6 A;  1S1Y A;  2PD8 A;  2WKQ A;  3LI9 A;  1S4S A;  2YKF A;  4BBV A;  5DKK A;  1N9L A;  1DRM A;  3A0R A;  4GS9 A;  1VB6 A;  1V9Y A;  1XFQ A;  2WKR A;  4I3J A;  1EW0 A;  3OLO A;  4L9F A;  4R70 A;  2Z6D A;  4GHI A;  3UMD A;  3F1P A;  5I5L A;  1UGU A;  5HSQ A;  4NXF A;  5IU1 A;  1MZU A;  3A0V A;  4GCZ A;  3RTY A;  4R6L A;  1D7E A;  3MR0 A;  5F5Y A;  3B33 A;  1N9O A;  4EES A;  5HWV A;  2ZOI A;  1XFN A;  3BWL A;  2PR6 A;  4NXE A;  5HD3 A;  4L9G A;  4I5S A;  3ICY A;  3E4P A;  4HP9 A;  2PD7 A;  1OTD A;  1S1Z A;  4GS9 B;  3PYP A;  1WA9 A;  4WF0 A;  1GSX A;  3EWK A;  3HJI A;  2PYR A;  1OJ5 A;  4GHI B;  2JN7 A;  2V0W A;  4R38 A;  3F1P B;  3LYX A;  4HHD A;  3UE6 A;  5HZH A;  3D72 A;  4HI4 A;  4WLA A;  1BYW A;  4EXO A;  3LID A;  4I39 A;  4HIA A;  3K3D A;  3T50 A;  3F1O B;  1OT9 A;  3E4Q A;  1DP8 A;  2L0W A;  3H7W A;  3NOP C;  4MN6 A;  3VOL A;  4H6J A;  3LIF A;  3MFX A;  5AVE A;  4GW9 A;  1T18 A;  5J7E A;  3UB8 A;  1DP9 A;  2VEA A;  2B02 A;  3MQO A;  4HY8 A;  1T1C A;  4I3A A;  2VV7 A;  5HD5 A;  3IS2 A;  1T19 A;  3NJA A;  3F1N A;  3H82 B;  4EET B;  3GEC A;  1Y28 A;  4L9E A;  4LRX C;  3UB7 A;  5IS1 A;  2A24 B;  2I9V A;  2QWS A;  1TS7 A;  2WKP A;  4B9O A;  5AVF A;  2H28 A;  3CLO A;  5TBM A;  3PHY A;  2KX6 A;  2CMN A;  4HNB A;  4BBT A;  2ZOH A; 
#chains in the Genus database with same CATH topology
 1TS8 A;  2GZA A;  4ESP A;  3A3F A;  1MY8 A;  3VE3 A;  1IKI A;  3EGX C;  2Y2Q A;  5FQM A;  1WYC A;  2J80 A;  4S2N C;  1BT5 A;  1G5U A;  2OWJ A;  4HH2 A;  4JF5 A;  1NWZ A;  4BWI A;  3DTE A;  5EVL A;  2Z2L B;  5HFO A;  4WMC D;  3GDI A;  4LCL A;  1PNE A;  3O87 A;  3ZG5 A;  3LR5 A;  5A91 A;  4LFU A;  4OPZ A;  4WEL A;  4B4X A;  1CI9 A;  1N9N A;  3ZYT A;  5CHU A;  4LLO B;  4PPR A;  5MC7 A;  1HZO A;  1F9I A;  3VSL A;  4OQ0 A;  4OLG A;  2XLN A;  2JHE A;  1Y54 A;  5F68 A;  2XFS A;  4U3T A;  4BJP A;  2WAD A;  1OTA A;  1I5Q A;  3JYI A;  5TGF A;  3U2A A;  3P7N A;  3PBN A;  4UA9 A;  2XA7 S;  3ZGA B;  2XEP A;  4EUZ A;  1MXO A;  3T4O A;  1U60 A;  2HDS A;  3BY8 A;  5F82 A;  1KGF A;  4AFI A;  4N9K A;  2M7U A;  1SCW A;  2O9B A;  1NZU A;  2QJ7 A;  4RA7 A;  1XJ6 A;  2EX9 A;  1TD5 A;  4EQ1 A;  2HGV A;  2J9P A;  3OCN A;  4MN5 A;  4R4S A;  4P6B A;  3O3V A;  4EEU A;  4EWF A;  4CLC B;  4ID4 A;  3R7W A;  3Q07 A;  4S2I A;  3S4X A;  4DF6 A;  4JF6 A;  2Y2K A;  2G2U A;  2W0N A;  4H6J B;  4NEE D;  3ULF A;  1IYQ A;  3D3O A;  1ERQ A;  1JNU A;  5J8X A;  5CED A;  5HL6 A;  5E2E A;  5E2G A;  1K54 A;  4DE0 A;  5A90 A;  4QB8 A;  1VM1 A;  5F69 A;  3M6H A;  1RCJ A;  1BUE A;  2GX5 A;  4HOI A;  5DKL A;  4EV4 A;  3LGO A;  5DFX A;  5L07 A;  5JYO A;  1XA7 A;  2HDU A;  4Y3I A;  1HTZ A;  2VGJ A;  4IUH A;  4OP8 A;  5HDD A;  2R78 A;  1FQG A;  3KSG A;  3GTC A;  4DE2 A;  1YMX A;  4F3L B;  3SH9 A;  4DDY A;  1EWZ A;  4YOF A;  3ZG0 A;  2HDR A;  3BYD A;  1XJ2 A;  4HBU A;  4GB7 A;  3N8R A;  1KGE A;  5TBM B;  3VOY A;  2P74 A;  1PRQ A;  1MPL A;  2BAS A;  3QNC A;  3IXB A;  5EVI C;  3LIB A;  4FH4 A;  1F98 A;  1L3L A;  1Y4O A;  3E98 A;  3LI8 A;  2QHK A;  4E3L A;  3T4S A;  3PBS A;  3W4P A;  4UA6 A;  2VJW A;  5CHJ A;  2AVX A;  4DKI A;  3V39 A;  2K7S A;  3W2Z A;  1PWG A;  4QJG A;  4DXB A;  3ZG7 B;  3HLG A;  5C5K A;  2G7U A;  3NI9 A;  4KZA A;  3OCL A;  1K4E A;  2ZBB A;  3P01 A;  2DCF A;  2P7J A;  1FCN A;  3MBZ A;  3MQQ A;  2IWD A;  4WYY A;  3JVU A;  3CG5 A;  1JWZ A;  2VV6 A;  3BFD A;  2XA7 M;  5FAQ A;  3EOI A;  1S4S A;  3HCY A;  4BBV A;  3LO7 A;  3OPR A;  5FQJ A;  4IED A;  1OPX A;  4ZAM A;  3T1R A;  1Q2P A;  4NKP A;  1ES5 A;  4H8R A;  4CPK A;  1H8Y A;  1Z6F A;  1K55 C;  3HLD A;  2MJ6 A;  5I5L A;  2J3T D;  1Q2Q A;  3A0V A;  4K91 A;  3HRE A;  1H0M A;  3SH8 A;  2OLU A;  4LEN A;  2A49 A;  4R6L A;  1BUL A;  2J7V A;  1D7E A;  4YIN A;  3MR0 A;  4DDS A;  4OH0 A;  1N9O A;  1F2K A;  5HWV A;  5I94 A;  2QZ6 A;  2ZOI A;  3TSG A;  2M7V A;  3FZC A;  2KOI A;  2XK1 A;  3ZCZ A;  5EVI A;  3S7P A;  1G6A A;  4QHC A;  3MS6 A;  4I5S A;  1W63 Q;  3UB5 P;  3E0Y A;  4O01 A;  4GS9 B;  3PYP A;  4WF0 A;  2P08 A;  3IXG A;  3EWK A;  3IF6 B;  2XDM A;  4S2L A;  3CIT A;  2BLS A;  1XA1 A;  3IX8 A;  5EE8 A;  1FR6 A;  2JN7 A;  3UPP A;  4X1L A;  3LYX A;  3BQ8 A;  5CER A;  3UE6 A;  1WYB A;  4KZ8 A;  4UEY A;  5EPH A;  3UNW A;  2Q9N A;  3CUE C;  1FIK A;  3F1O B;  2WGV A;  3ZNY A;  2L0W A;  3BLM A;  3H7W A;  1VEU B;  2WGI A;  4Y15 A;  3BFE A;  1YKD A;  4E3K A;  3A3E A;  4RX2 A;  1FR1 A;  5U47 A;  3VFF A;  1MWR A;  4P6Z S;  1MWU A;  4ZBE A;  1K55 A;  1CK3 A;  3LY3 A;  3D4F A;  4CJN A;  2QPN A;  3IX3 A;  2B02 A;  3LEZ A;  3MQO A;  4HY8 A;  3IBJ A;  1FIL A;  4KG5 A;  2ZL1 A;  4IUK A;  5A92 A;  1T19 A;  4BMW A;  4E3I A;  3F1N A;  1JTG A;  3LR0 A;  4EET B;  4R0Q A;  4L9E A;  3HUO A;  2G2W A;  3GRJ A;  2ZC5 B;  4LRX C;  1MKM A;  3UB7 A;  4Y17 A;  5E2F A;  2A24 B;  2WYX A;  4S2O A;  3IWQ A;  2HP6 A;  4KZ9 A;  2HPB A;  3Q82 A;  4EUV A;  4GJ4 A;  1W8Y A;  3C5A A;  4B9O A;  1TEM A;  2ZM2 A;  3G34 A;  3RJU A;  5AVF A;  4BD0 A;  4R4R A;  2CMN A;  4X1M A;  3ZNT A;  1BZA A;  3CMZ A;  1LL8 A;  3VP3 A;  3PBR A;  2EX8 A;  2CC1 A;  4EEP A;  3LR4 A;  3C4O A;  4ME4 A;  4B4Z A;  3ITA A;  2C6W B;  3MQ0 A;  5L10 A;  3EEA A;  1CEG A;  3IX4 A;  2BG1 A;  1ERM A;  3S22 A;  1VET A;  3CPT A;  3P09 A;  3C4P A;  4G3K A;  2JKR I;  4NXG A;  4MCW A;  4JGP A;  5DJT A;  1W63 M;  3IT9 A;  4GDN A;  1UWN X;  1X0O A;  1ODV A;  4ZRR A;  2PT7 A;  4MMN A;  4QD4 A;  4GKU A;  3LFV A;  4GOG A;  1LSW A;  4X69 A;  3R4K A;  2VX8 A;  5CTM A;  2Q0O A;  1L0E A;  2ACG A;  3MFD A;  2VV8 A;  3BY9 A;  3SOI A;  1PYY A;  2EX2 A;  1YAX A;  5CX7 A;  1JVJ A;  5KMW A;  2M1C A;  1D1J A;  5GLB A;  2V1A A;  4KG6 A;  3WS4 A;  3LR3 A;  3LIA A;  5A8B A;  2X01 A;  4G3W A;  5EOO A;  2WZZ A;  3SS4 A;  3FWL A;  2JCH A;  3IBR A;  3BFC A;  4GLQ A;  3QP4 A;  2V8C A;  2W3H A;  3G2Y A;  3UME A;  4WZ5 C;  4PM5 A;  2ZQ9 A;  1ZHH B;  4BL3 A;  2PHY A;  4MBK A;  3WS1 A;  1JWV A;  1WE4 A;  5EVI D;  3M6B A;  4OKP A;  1YMS A;  1HVB A;  4WN5 A;  3UB6 A;  5FDS A;  3KYZ A;  2PU2 A;  5F6A A;  4II7 A;  2EXB A;  2Q9M A;  5AQ7 A;  4YWZ A;  2ZC7 A;  1XXM A;  1GHP A;  2W27 A;  2ZMF A;  2FZ0 A;  2FFF B;  3CI6 A;  3LUQ A;  3PAG A;  1GA0 A;  4WL9 A;  3V5M A;  2V0U A;  3FYZ A;  3BEC A;  4UA7 A;  1DJC A;  4ZDX A;  4HJ3 A;  3SS5 A;  4ARZ A;  4QY6 A;  3B3X A;  4R1G A;  4RQ9 A;  4U0T A;  2FFY A;  3V3R A;  4R3A A;  4XT2 A;  1K6S A;  2VA0 A;  3IS2 B;  1ES2 A;  4LV2 A;  3Q81 A;  1TS6 A;  1C3B A;  2HV1 A;  4NG2 A;  3RH8 B;  4MNR A;  5FAT A;  4BD1 A;  1K54 C;  1XX2 A;  5FSR A;  1TVF A;  2GDN A;  4ZTK A;  1P9W A;  2OV5 A;  4OON A;  1IFQ A;  3QP5 A;  4F94 A;  2OSU A;  4LV3 A;  5AQB A;  2ZJ9 A;  3C2W A;  2Y2G A;  1IKG A;  2HDQ A;  2V1B A;  2PYP A;  3NIA A;  4WZ5 A;  3T4J A;  3WRZ A;  2WKH A;  4Y13 A;  1STZ A;  3H82 A;  3T4Q A;  3SS3 A;  4M4X A;  2IA2 A;  1SKF A;  3FG8 A;  1HLU P;  4WZ4 A;  1H8Z A;  2WK0 A;  2ZQD A;  4NXB A;  3UE3 A;  4WEJ A;  1K0K A;  4BEN A;  4OOM A;  5EOE A;  1G28 A;  1P97 A;  1ZG6 A;  2VGL M;  1BSG A;  5G4Y A;  2XD1 A;  4FUW A;  5CXW A;  4PM8 A;  4DMZ A;  5M1A A;  3DTK A;  3UDF A;  2D02 A;  4HEF A;  2GJ3 A;  2EWW A;  4E6W A;  1YLY A;  3SW1 A;  1ZKJ A;  3DW0 A;  2PD8 A;  1IYS A;  5GHZ A;  1L0G A;  3RXW A;  2WGW B;  1ZC2 A;  2OAP 1;  1YLJ A;  5HL1 A;  2H10 A;  2YKF A;  5DKK A;  1DRM A;  4FOF A;  2Y79 A;  5EUA A;  4I3J A;  1EW0 A;  3PBQ A;  2J3W A;  5CGW A;  3KO6 A;  1E4D A;  3HUN A;  3G31 A;  4N1X A;  4B88 A;  5FA7 A;  1ESU A;  3F1P A;  3BRM A;  3SH7 A;  5LBR A;  3BLS A;  5HSQ A;  1ZG4 A;  4NXF A;  5IU1 A;  1MZU A;  4OQH A;  2VZW A;  4PMA A;  3K2N A;  1AWI A;  5CGS A;  2WUQ A;  4P85 A;  2NUP C;  4Q0H A;  1YLT A;  1ES3 A;  1GCE A;  4EES A;  2Y91 A;  3FPW A;  2H5S A;  1XFN A;  3BWL A;  4E3M A;  5TJJ A;  3OC2 A;  4NXE A;  1G6O A;  5HD3 A;  4MDZ A;  2PU4 A;  3ISG A;  2PD7 A;  1OTD A;  1YLW A;  1M6K A;  2C5W B;  1WA9 A;  1GSX A;  2XH9 A;  1DJA A;  3HJI A;  3TOI A;  2JKG A;  3C38 A;  2V0W A;  3ZDJ A;  4HHD A;  3Q1F A;  1NYY A;  3UPN A;  5FAS A;  1VQQ A;  3D72 A;  2EFU A;  2K31 A;  3Q7V A;  2W1T B;  3G35 A;  4HIA A;  2R9W A;  3QP2 A;  3ZFZ A;  4CLC A;  4X55 A;  3BQA A;  2VGK A;  1NJ4 A;  2JKT M;  1EI5 A;  3T50 A;  1SKO A;  4JXW A;  2ZD8 A;  2VK3 A;  3NOP C;  3JVV A;  4H6J A;  2P9V A;  3LIF A;  3MFX A;  3MXS A;  4KZ5 A;  1CJF A;  3AGE A;  3S1Y A;  3N8S A;  2ZQC A;  5FEG A;  4N92 A;  3OPL A;  1OME A;  4E3N A;  5FEF A;  4ETX A;  4C3Q A;  5HD5 A;  3T1S A;  1IYO A;  1PW8 A;  1S0W A;  3NJA A;  4JLF A;  3HLE A;  3GEC A;  4Q0I A;  1Y28 A;  5KSH A;  3HBR A;  3JPU A;  1J3W A;  2ZQ8 A;  4LV0 A;  3NEC A;  2QWS A;  5CTN A;  3IWO A;  2XFT A;  1TS7 A;  5E43 A;  3O86 A;  5TBM A;  4E6X A;  2KX6 A;  4EBN A;  5DTK A;  1SDN A;  3KSH A;  4BBT A;  2Y8H A;  4DXC A;  1S6R A;  1MBL A;  2Y2L A;  2PBY A;  3C30 A;  5EM1 A;  2ZQ7 A;  1LSV A;  1XJ3 A;  4GDB A;  4PM6 A;  4FD8 A;  2PAV P;  1SDE A;  4GN2 A;  2NUT C;  3GR2 A;  3KSF A;  3A0S A;  1GHM A;  2L1M A;  1YT4 A;  3G6O A;  1TDL A;  2QJ5 A;  4JPM A;  1NZO A;  1G68 A;  1MC0 A;  2PR5 A;  2WKE A;  1TS0 A;  4XXR A;  1CF0 A;  1W5D A;  1P0Z A;  4Y0U A;  3ZHH A;  2JE5 A;  1RP5 A;  1D06 A;  3B42 A;  4OP5 A;  5HWW A;  1XGJ A;  4M3K A;  1S67 L;  2XRN A;  1NY0 A;  2YKH A;  2ZMV A;  4O7D A;  3EEH A;  4A5R A;  3P98 A;  3LCE A;  4HES A;  3NUL A;  4Y0T A;  2VKS A;  1XP4 A;  3MJQ A;  4R23 A;  1IEL A;  2XQZ A;  4KQD A;  4C6Y A;  5HW3 A;  2OOL A;  2X02 A;  3WS5 A;  5GLC A;  3ZVT A;  5FQQ A;  3HL9 A;  3PR6 A;  5L09 A;  4OPQ A;  1PI4 A;  3NC8 A;  3RXX A;  3A3D A;  3ZQ5 A;  1N9B A;  1QMF A;  5FI6 A;  2O99 A;  3HLW A;  3CPT B;  4C75 A;  4EBL A;  4QU3 A;  3D9Y A;  3CAX A;  1Z09 A;  4ZJ2 A;  2EA9 A;  1FCM A;  2OLV A;  3FKV A;  4E04 A;  4JGQ A;  3C8C A;  5CGX A;  5CEC A;  3FV7 A;  3BJN A;  5HAI A;  4RX3 A;  5AQ9 A;  3LEQ A;  3PAE A;  3MSH A;  2JKR M;  1PZP A;  2QYB A;  1FCO A;  2W3G A;  3E2K A;  4FSF A;  2L4R A;  3LIC A;  1H3Q A;  2VLG A;  3S7O A;  5HWT A;  1ONG A;  4B93 A;  4HH3 A;  3CHW P;  2FH5 A;  4K08 A;  3IQA A;  3PXP A;  5A93 A;  3IF6 A;  2ZLY A;  3QP6 A;  3BFF A;  1CEF A;  2JC7 A;  1QME A;  2O9C A;  1PI5 A;  1KGG A;  1ALQ A;  3IXH A;  3ZG9 B;  3AGD A;  2O9A A;  5EM0 A;  4HP4 A;  2W3E A;  1RGY A;  3UB9 A;  1NLZ A;  1H5X A;  1S4R A;  1L0F A;  4P0M A;  4E3O A;  2UV0 E;  3VSK A;  4Y2F A;  3PBT A;  4OPR A;  3F1O A;  2V9A A;  3VP2 A;  1I2S A;  2KLI A;  4KUK A;  1VEU A;  2HJ9 C;  4I3I A;  4I38 A;  2WAF A;  2WKI A;  1GSV A;  1J9M A;  1W7F A;  3E4O A;  2XF3 A;  1YM1 A;  5F83 A;  2VGL S;  5FI7 A;  3DWZ A;  3V3S A;  2WAE A;  3NOT C;  3OPH A;  4KEN B;  3E2L A;  1PWC A;  5JYP A;  3MKF A;  3VE4 A;  4EER A;  4BL2 A;  2DNS A;  5J4E A;  4JGR A;  1OTB A;  1GSW A;  4XT2 B;  1K57 A;  1SHV A;  3IHB A;  1K6R A;  3UE0 A;  3CZD A;  2ZMA A;  2A24 A;  1KDS A;  1KOU A;  2A2L A;  5FAP A;  2KDK A;  4PKY A;  3UPO A;  4DE3 A;  1IEM A;  2BTF P;  4DJ3 A;  1GA9 A;  2ZQA A;  2HP5 A;  5CRF A;  4JXV A;  4DN0 A;  4CQH A;  4R3J A;  4OOL A;  3WRT A;  2P04 A;  4HJ6 A;  4PM7 A;  4UHU A;  1OT6 A;  4O8G A;  2LB5 A;  4KQO A;  2PDR A;  4KZB A;  5DF8 A;  1FSY A;  5EEC A;  4RVA A;  5KSC A;  1W79 A;  4FCF A;  1BLC A;  5HAP A;  3A0R A;  3OOV A;  2DMW A;  3DWK A;  5DTS A;  3N4I A;  3VP1 A;  2WKR A;  1W8Q A;  4S2K A;  4QPR A;  1KVL A;  3OLO A;  4L9F A;  1BLH A;  4IVK A;  1VHM A;  3UO9 A;  3IHA A;  4R70 A;  5GLA A;  3C7V A;  2Z6D A;  4GHI A;  1UGU A;  4X53 A;  2IWB A;  4UAA A;  5GLD A;  4S2J A;  3VV4 A;  1NLY A;  2V20 A;  1GHI A;  2Y55 A;  3W8K A;  4X25 A;  5DF9 A;  5F5Y A;  1ES4 A;  4UQI M;  1BTL A;  4Q0J A;  3R7W B;  3G2Z A;  4XUX A;  4L9G A;  3QNB A;  3EQV A;  5GHX A;  3NDE A;  4NET A;  3VP4 A;  2B95 A;  2HP9 A;  1LL9 A;  2HF6 A;  3SZT A;  1PIO A;  3T4K A;  2PYR A;  1OJ5 A;  1PZO A;  4GD6 A;  3FPV A;  1ERO A;  4R38 A;  1E25 A;  3F1P B;  3WS2 A;  2ZM8 A;  3HUM A;  1IYP A;  1YLP A;  1TDG A;  3WWX A;  4PAU A;  4EU0 A;  4WLA A;  5FAO A;  4EXO A;  4IVI A;  3LID A;  2HJE A;  4I39 A;  1PWD A;  2Y2J A;  1PW1 A;  4KZ4 A;  3BM6 A;  5IHV A;  5BOH A;  1OT9 A;  3E4Q A;  3IWI A;  5GHY A;  3S7Q A;  4EQI A;  1YPR A;  4MN6 A;  3VOL A;  4CLC E;  3A3I A;  4OOY A;  1YSQ A;  3VFH A;  1ONH A;  5AVE A;  3T12 B;  3V50 A;  4GNU A;  5J7E A;  3UB8 A;  1DP9 A;  2Y4A A;  4Z9Q A;  4CLC C;  1RGZ A;  2UWX A;  4YNR A;  4Z1W A;  3PTE A;  1T1C A;  4OVD A;  3OPP A;  3IS2 A;  4U0X A;  1MKI A;  1E3U A;  2I72 A;  3HVF A;  2H0Y A;  3EQU A;  3AGF A;  1K56 A;  3Q7V B;  5FQI A;  5HPF A;  3MZD A;  2XR0 A;  3VP0 A;  5D3O A;  4S2N A;  2I9V A;  3N6I A;  3VOZ A;  1SKO B;  2WKP A;  3UE1 A;  4NK3 A;  2H28 A;  3CLO A;  1JTD A;  3ZVW A;  4OQI A;  2P9V B;  2ZOH A;  1M40 A;  1O07 A;  3G32 A;  1UWP X;  5EFW A;  2Y2H A;  3NHQ A;  1LHY A;  4QY5 A;  3MMH A;  4PKY G;  3OZH A;  3M2K A;  3LIE A;  4KZ6 A;  2IWC A;  2O0Y A;  3CWF A;  3V67 A;  3KX0 X;  3HJK A;  3W4Q A;  4HBT A;  4KG2 A;  5L8M A;  2EFX A;  4K0W A;  3NDG A;  3N8L A;  4N1H A;  5G18 A;  2QKP A;  4X68 A;  1ZTU A;  4BQM A;  1H8M A;  4MBF A;  5HAR A;  3RFB A;  3O5Y A;  2ZC4 B;  1FOF A;  3BEB A;  1O7E A;  4EW7 A;  1XJ4 A;  2WGW A;  4D2O A;  4R3B A;  4EBP A;  4KZ7 A;  5M18 A;  4BBU A;  3T1X A;  1NRF A;  3IH9 A;  4LRZ E;  5EVI B;  3QHY A;  2HZ5 A;  1LT0 A;  3HLB A;  4MN7 A;  4WM9 A;  3DTI A;  2Y2O A;  4JF4 A;  3M2J A;  4KQR A;  4LV1 A;  4X6T A;  1CQA A;  5HX9 A;  4JGO A;  4KQQ A;  1NYM A;  1L0D A;  5M19 A;  1OJG A;  1AXB A;  5G4Z A;  1I2W A;  5J3W A;  2XD5 A;  1KDW A;  4S2M A;  5CEB A;  4Y0O A;  3NBL A;  2EXA A;  3H9W A;  5E2H A;  5DJU A;  5L2F A;  4IBX A;  1PFL A;  4F3L A;  4IBR A;  4DE1 A;  1YQS A;  4MBH A;  3N7W A;  3C7U A;  5TR7 A;  1OTI A;  3DBA A;  3T4T A;  2V8F A;  1T1B A;  1HD8 A;  3MZE A;  1LLB A;  5DFY A;  3H7W B;  1BLP A;  4OQG A;  1YLZ A;  4X56 A;  3UDI A;  3FKW A;  3HLF A;  3KYE A;  3TG9 A;  3GV9 A;  5HDC A;  3LY4 A;  5GL9 A;  3W4O A;  2INW A;  2Y2N A;  3GQZ A;  3ITB A;  4RYE A;  2XRO A;  1P9R A;  3NOU C;  2JKT I;  2ZL1 B;  5FI2 A;  4DJ2 A;  2W1T A;  3MXQ A;  4JBF A;  2OWH A;  3F1N B;  4GZB A;  1KE0 A;  4MEZ A;  2DRW A;  3IF6 C;  5HDS A;  5FDH A;  1F5M A;  3A3J A;  1IOU A;  4LRY C;  3NCK A;  2Y2I A;  2ZC3 B;  1SZV A;  2JKF A;  2JBF A;  1T1A A;  2RCX A;  5EV0 A;  2D01 A;  1KE3 A;  4Q8I A;  1LI9 A;  4WUJ A;  3QP1 A;  4BLM A;  5HPI A;  4LCM A;  4LPZ A;  1E3U D;  2E8I A;  1MWT A;  1L2S A;  4S2P A;  4QWO A;  1LSX A;  5DVA A;  3OBF A;  3DTM A;  1K56 D;  5AQA A;  1KVM A;  2PRF A;  3TJZ C;  2V2F F;  2XSS A;  2Z2M B;  3NY4 A;  1XGI A;  4E3J A;  3B47 A;  3L9K A;  4LGW A;  1K25 A;  4HQA A;  4OPY A;  1V9Z A;  4WBG A;  1LL5 A;  1DP6 A;  1OTE A;  3FC7 A;  1VET B;  2R9X A;  2Z6C A;  1S66 L;  3ZG8 B;  4WMC A;  3VMA A;  3IXD A;  1K57 C;  3L7H A;  4HJ4 A;  2EX6 A;  3QP8 A;  3UN7 A;  5KIZ A;  3K3C A;  4KUO A;  4O0P A;  2J8Y A;  1S1Y A;  3KYQ A;  2WKQ A;  2B18 A;  3LI9 A;  4OLD A;  3TE8 A;  2ZM0 A;  3U4L P;  1N9L A;  2Y2P A;  2Y2M A;  3EGD C;  2B5R A;  4GS9 A;  1VB6 A;  1V9Y A;  1XFQ A;  1ACF A;  4JXG A;  4UQI S;  4JKT A;  2WZX A;  4WEK A;  5DTT A;  3UDX A;  4K0X A;  3UMD A;  3O88 A;  4CLC D;  1CI8 A;  2LB9 A;  2EWV A;  4YFM A;  4DRT A;  4GCZ A;  1NXY A;  1DJB A;  2A3U A;  1XPB A;  2W3D A;  3TW8 A;  3RTY A;  4XUZ A;  1A0K A;  3WS0 A;  3B33 A;  5F1F A;  3MZF A;  4D60 A;  5IT5 A;  2PR6 A;  4GD8 A;  5K5B A;  3G30 A;  4ZJ1 A;  3ICY A;  3DAV A;  3E4P A;  4HP9 A;  1S1Z A;  3T4L A;  3CUE A;  4IJG A;  4Y5F A;  4FH2 A;  4FTX A;  3IF5 A;  5TFQ A;  4ARZ B;  1LI0 A;  4GHI B;  2X71 A;  1XKZ A;  3KSI A;  2V1Z A;  3MXR A;  5HZH A;  4G3V A;  4HI4 A;  4PHT A;  1MWS A;  1BYW A;  2J9O A;  4IHQ A;  4ZJ3 A;  4Y7P A;  5CHM A;  3K3D A;  5FQK A;  1K38 A;  4P87 A;  1FSW A;  3PBO A;  1ESI A;  3CJM A;  3I7J A;  1DP8 A;  5KZH A;  3GVB A;  3BW6 A;  2RL3 A;  5F1G A;  5HAQ A;  2W3F A;  5AJG A;  2PBD P;  4GW9 A;  1NRJ A;  3IH8 A;  2QMI A;  2GNX A;  2ZC6 B;  3BFG A;  3T1Q B;  4L0L A;  3G4P A;  1T18 A;  2Y59 A;  5DF7 A;  5EVE A;  2J3T C;  2VEA A;  1YSP A;  3GSG A;  5FL3 A;  1KE4 A;  3UY6 A;  4I3A A;  1TF1 A;  2VV7 A;  4PM9 A;  1K4F A;  1N4O A;  1DY6 A;  3GMW A;  3H82 B;  4ETZ A;  2OAQ 1;  3MKE A;  1JWP A;  5IS1 A;  1BLS A;  2XGN A;  2E8J A;  4N9L A;  5FQ9 A;  3S7N A;  3Q7Z A;  4MLL A;  4P6Z M;  3MF0 A;  4KZ3 A;  3TRC A;  2H0T A;  2W1R A;  3PHY A;  2K2N A;  4HNB A;  4JXS A;  3HLC A; 
#chains in the Genus database with same CATH homology
 1TS8 A;  2GZA A;  1UWP X;  5EFW A;  3NHQ A;  3VE3 A;  1LL8 A;  3C30 A;  3MMH A;  3PBR A;  4EEP A;  3LR4 A;  1LSV A;  1XJ3 A;  3EGX C;  4ME4 A;  4PKY G;  2J80 A;  2NUT C;  3LIE A;  2OWJ A;  3KSF A;  4HH2 A;  3A0S A;  3MQ0 A;  2L1M A;  1NWZ A;  2O0Y A;  3EEA A;  3CWF A;  3V67 A;  3KX0 X;  3G6O A;  2QJ5 A;  4BWI A;  1MC0 A;  2PR5 A;  3HJK A;  1TS0 A;  1P0Z A;  3GDI A;  5L8M A;  4G3K A;  1D06 A;  3B42 A;  2JKR I;  4NXG A;  4MCW A;  4JGP A;  5DJT A;  1W63 M;  3LR5 A;  5HWW A;  2QKP A;  1ZTU A;  4WEL A;  1S67 L;  2XRN A;  1N9N A;  3ZYT A;  2YKH A;  1UWN X;  1H8M A;  1X0O A;  1ODV A;  4LLO B;  4ZRR A;  2ZMV A;  3RFB A;  5MC7 A;  3O5Y A;  1F9I A;  2PT7 A;  4MMN A;  3LFV A;  1LSW A;  3EEH A;  3R4K A;  2VX8 A;  2JHE A;  1XJ4 A;  5F68 A;  4EW7 A;  4BBU A;  4BJP A;  2VKS A;  2VV8 A;  3BY9 A;  3MJQ A;  1OTA A;  4LRZ E;  1YAX A;  4KQD A;  5CX7 A;  2M1C A;  3U2A A;  3P7N A;  2OOL A;  2V1A A;  3PBN A;  1LT0 A;  5A8B A;  3LR3 A;  2XA7 S;  3LIA A;  3PR6 A;  4G3W A;  4MN7 A;  3T4O A;  3BY8 A;  4AFI A;  3IBR A;  2M7U A;  3ZQ5 A;  4JGO A;  4GLQ A;  2O99 A;  2W3H A;  2O9B A;  1OJG A;  2QJ7 A;  3UME A;  1XJ6 A;  5G4Z A;  3CAX A;  1ZHH B;  2PHY A;  2EA9 A;  1TD5 A;  4E04 A;  4JGQ A;  4EQ1 A;  2HGV A;  3C8C A;  3OCN A;  5J3W A;  4MN5 A;  3BJN A;  4WN5 A;  3UB6 A;  2JKR M;  3H9W A;  5DJU A;  4EEU A;  3KYZ A;  5F6A A;  4II7 A;  4F3L A;  4YWZ A;  2QYB A;  4CLC B;  2W3G A;  3R7W A;  1OTI A;  3DBA A;  4FSF A;  2L4R A;  3LIC A;  2W27 A;  2ZMF A;  1H3Q A;  3T4T A;  2VLG A;  3S7O A;  5HWT A;  2FZ0 A;  3CI6 A;  1T1B A;  3LUQ A;  4B93 A;  4HH3 A;  2FH5 A;  3H7W B;  4K08 A;  5DFY A;  3PXP A;  4WL9 A;  2W0N A;  4H6J B;  4NEE D;  3ULF A;  2V0U A;  3D3O A;  1JNU A;  4HJ3 A;  4ARZ A;  2O9C A;  5HDC A;  5HL6 A;  2O9A A;  2INW A;  4RQ9 A;  4HP4 A;  5F69 A;  2XRO A;  1P9R A;  2W3E A;  3NOU C;  2JKT I;  4R3A A;  3UB9 A;  4XT2 A;  2GX5 A;  1NLZ A;  4HOI A;  5DKL A;  4DJ2 A;  5DFX A;  2W1T A;  4Y3I A;  2VA0 A;  3IS2 B;  3MXQ A;  1S4R A;  2OWH A;  4IUH A;  3F1N B;  1TS6 A;  5HDD A;  2HV1 A;  2R78 A;  5HDS A;  4Y2F A;  1F5M A;  3KSG A;  3PBT A;  3RH8 B;  3F1O A;  2V9A A;  1IOU A;  4LRY C;  2KLI A;  4F3L B;  4KUK A;  2HJ9 C;  4I3I A;  4YOF A;  4I38 A;  1GSV A;  1T1A A;  3E4O A;  2D01 A;  1XJ2 A;  4WUJ A;  1P9W A;  2VGL S;  1IFQ A;  5TBM B;  5HPI A;  4LPZ A;  3C2W A;  3NOT C;  1LSX A;  3OBF A;  2V1B A;  2PYP A;  3VE4 A;  4EER A;  2BAS A;  3TJZ C;  3T4J A;  1STZ A;  3LIB A;  3H82 A;  2XSS A;  1F98 A;  3T4Q A;  5J4E A;  4JGR A;  3LI8 A;  3E98 A;  2QHK A;  1OTB A;  4M4X A;  2IA2 A;  3T4S A;  1GSW A;  3FG8 A;  4XT2 B;  3PBS A;  4NXB A;  3B47 A;  2VJW A;  2A24 A;  3UE3 A;  4WEJ A;  1KOU A;  4HQA A;  2A2L A;  4OOM A;  2KDK A;  4PKY A;  1V9Z A;  1G28 A;  1DP6 A;  1P97 A;  2K7S A;  1OTE A;  2VGL M;  3FC7 A;  3W2Z A;  4DJ3 A;  5G4Y A;  2Z6C A;  4DMZ A;  1S66 L;  5C5K A;  2G7U A;  2D02 A;  4DN0 A;  4CQH A;  4OOL A;  3OCL A;  2GJ3 A;  2P04 A;  2EWW A;  4HJ6 A;  2ZBB A;  4HJ4 A;  3P01 A;  2P7J A;  1OT6 A;  3MQQ A;  4O8G A;  2LB5 A;  3SW1 A;  3JVU A;  4KQO A;  5KIZ A;  3K3C A;  2PDR A;  4KUO A;  4O0P A;  2VV6 A;  1S1Y A;  2PD8 A;  3KYQ A;  2XA7 M;  2WKQ A;  2B18 A;  2OAP 1;  3LI9 A;  3TE8 A;  3EOI A;  1S4S A;  2YKF A;  3HCY A;  5DKK A;  1N9L A;  4BBV A;  1DRM A;  3EGD C;  3A0R A;  4FOF A;  4GS9 A;  3OOV A;  1OPX A;  2Y79 A;  1VB6 A;  2DMW A;  1V9Y A;  4NKP A;  1XFQ A;  2WKR A;  4UQI S;  4I3J A;  4QPR A;  4WEK A;  1EW0 A;  3PBQ A;  3OLO A;  4L9F A;  2J3W A;  1VHM A;  3KO6 A;  4R70 A;  2Z6D A;  4GHI A;  3UMD A;  2MJ6 A;  3F1P A;  2J3T D;  5I5L A;  1UGU A;  4CLC D;  5LBR A;  5HSQ A;  4NXF A;  5IU1 A;  1MZU A;  2LB9 A;  2EWV A;  2VZW A;  3A0V A;  3K2N A;  4GCZ A;  3VV4 A;  1NLY A;  2NUP C;  4Q0H A;  2W3D A;  3TW8 A;  3RTY A;  4R6L A;  1D7E A;  3MR0 A;  5DF9 A;  5F5Y A;  3B33 A;  1N9O A;  4EES A;  5HWV A;  2ZOI A;  3FPW A;  2M7V A;  2KOI A;  1XFN A;  3BWL A;  5TJJ A;  5IT5 A;  4UQI M;  3S7P A;  4Q0J A;  3OC2 A;  2PR6 A;  4NXE A;  1G6O A;  3R7W B;  5HD3 A;  5K5B A;  4MDZ A;  4L9G A;  4I5S A;  1W63 Q;  3ICY A;  3E0Y A;  3E4P A;  4HP9 A;  2PD7 A;  1OTD A;  1S1Z A;  4O01 A;  4GS9 B;  3EQV A;  3PYP A;  3T4L A;  1WA9 A;  4WF0 A;  3CUE A;  1GSX A;  2P08 A;  4IJG A;  3EWK A;  2HF6 A;  3HJI A;  3CIT A;  3T4K A;  4Y5F A;  2PYR A;  1OJ5 A;  4ARZ B;  3FPV A;  3C38 A;  4GHI B;  2JN7 A;  2V0W A;  4R38 A;  3F1P B;  3LYX A;  4HHD A;  3BQ8 A;  3KSI A;  3UE6 A;  5HZH A;  3D72 A;  4G3V A;  4PAU A;  4HI4 A;  4PHT A;  4EU0 A;  4WLA A;  1BYW A;  4EXO A;  2K31 A;  3LID A;  4IHQ A;  2HJE A;  2W1T B;  4I39 A;  4HIA A;  3K3D A;  4CLC A;  4UEY A;  3CUE C;  3PBO A;  3BQA A;  2JKT M;  3T50 A;  3F1O B;  1OT9 A;  3E4Q A;  3S7Q A;  1DP8 A;  3BW6 A;  2L0W A;  3H7W A;  3NOP C;  4MN6 A;  3VOL A;  4CLC E;  3JVV A;  4H6J A;  1YSQ A;  3LIF A;  1YKD A;  2W3F A;  5AJG A;  3MFX A;  5AVE A;  4GW9 A;  1NRJ A;  2GNX A;  4L0L A;  1T18 A;  5J7E A;  3UB8 A;  4P6Z S;  1DP9 A;  2J3T C;  2VEA A;  4CLC C;  1YSP A;  2B02 A;  4YNR A;  4Z1W A;  5FL3 A;  3MQO A;  4HY8 A;  4ETX A;  3IBJ A;  1T1C A;  4I3A A;  1TF1 A;  2VV7 A;  5HD5 A;  4IUK A;  3IS2 A;  1T19 A;  3NJA A;  4BMW A;  3F1N A;  3H82 B;  4EET B;  3LR0 A;  3GEC A;  4ETZ A;  4Q0I A;  1Y28 A;  3EQU A;  4L9E A;  2OAQ 1;  5HPF A;  5KSH A;  4LRX C;  3UB7 A;  1MKM A;  5IS1 A;  2A24 B;  2I9V A;  2QWS A;  3S7N A;  4EUV A;  4GJ4 A;  1TS7 A;  4P6Z M;  3MF0 A;  2WKP A;  4B9O A;  3TRC A;  5AVF A;  2H28 A;  3CLO A;  2W1R A;  3PHY A;  2K2N A;  2KX6 A;  5TBM A;  2CMN A;  4HNB A;  3KSH A;  4BBT A;  2ZOH A;  2Y8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...