1OTAA

E46q mutant of photoactive yellow protein, p63 at 295k
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otaA00
1MZUA 4BBVA 2D01A 5TBMA 3NOPC 3G6OA 4GCZA 4HP4A 4M4XA 4JGOA 1OTEA 4HNBA 4DJ3A 2VV7A 4HI4A 3MFXA 2JHEA 4WUJA 2QJ5A 2ZOIA 1GSXA 2PYPA 3IS2A 5HWWA 3LIAA 4WLAA 3UB7A 5AVFA 3A0VA 2P7JA 3UMEA 3MJQA 3B33A 2WKPA 1TS8A 1ODVA 3NOUC 1KOUA 4GS9B 1P97A 3ULFA 5DJUA 2VV6A 2I9VA 3K3CA 5HZHA 5KIZA 4EW7A 2V1BA 1TS6A 3LYXA 3IBRA 3H82A 4NXEA 3MQQA 1S66L 3K3DA 3PYPA 3RTYA 1OTAA 4KQDA 3T50A 2PR5A 1BYWA 4EEUA 4WL9A 2GJ3A 3A0RA 3E4OA 3MXQA 4F3LA 2Z6CA 3VE3A 2M1CA 5IS1A 2K7SA 4L9FA 4NXGA 5HWVA 3E4QA 3F1PA 4NXBA 2BASA 1NWZA 3MQOA 5HSQA 1S4SA 3A0SA 3LIEA 3BY8A 3BY9A 2OWHA 3GECA 4HJ3A 1LT0A 3NHQA 1T19A 1S67L 4JGQA 5F69A 5HD3A 2L1MA 2QWSA 1OJGA 5TBMB 4GHIA 5AVEA 1S1ZA 2Z6DA 3NOTC 3ZQ5A 4B9OA 5I5LA 2YKFA 4LRXC 3D72A 3UB9A 1TS7A 1V9YA 3LUQA 2OOLA 4L9EA 1XFNA 5DKKA 4R38A 4MN6A 5IU1A 2J80A 4HJ4A 4HH2A 3IS2B 3E4PA 5G4YA 5HDSA 4JGRA 3LI8A 4PKYA 4HHDA 3UB8A 2HV1A 3MR0A 1UGUA 4KUKA 4EESA 4R6LA 2V0WA 2H28A 4EEPA 3CAXA 1DP9A 2KX6A 3H82B 1XJ2A 4R3AA 2PD8A 1T1BA 2L4RA 4I3JA 2EA9A 1D7EA 1OT6A 4I38A 1G28A 1N9NA 4HY8A 5F68A 4XT2B 3LICA 1LSVA 4XT2A 5G4ZA 4F3LB 1GSWA 2CMNA 3F1PB 1X0OA 3LIBA 1D06A 3EEHA 3C8CA 2PDRA 3F1NA 2V0UA 3F1NB 4E04A 5DKLA 4BBUA 1TS0A 3FG8A 4RQ9A 3EWKA 4PKYG 4L9GA 4HP9A 1LSXA 3HJIA 3FC7A 1VB6A 3C2WA 1V9ZA 1T18A 1N9LA 3P7NA 2A24A 5J3WA 1DP6A 3HJKA 5F6AA 5HDDA 4GHIB 5DJTA 3H7WA 1GSVA 2VLGA 3CWFA 4I3AA 2R78A 2INWA 4I39A 1OTDA 4I5SA 2PHYA 2ZOHA 3RH8B 4HIAA 3UE6A 3ICYA 4HJ6A 3UMDA 1UWNX 3UB6A 1XJ3A 2QHKA 4MN5A 1LL8A 2L0WA 1DRMA 5HWTA 4R70A 2VEAA 2D02A 4GW9A 3F1OB 3F1OA 4EERA 4HH3A 2V9AA 1JNUA 3SW1A 4LPZA 4DJ2A 4WF0A 2PD7A 1T1CA 4I3IA 1XFQA 1LSWA 1OT9A 2JN7A 3BWLA 1UWPX 4K08A 4LRYC 1XJ6A 1OJ5A 4KUOA 2QJ7A 3VE4A 2W0NA 5HDCA 2ZBBA 3H9WA 4GS9A 2PR6A 2WKQA 1XJ4A 3KX0X 4YWZA 4HQAA 2VV8A 3LIDA 3PHYA 4LRZE 5J4EA 2B02A 1T1AA 3VOLA 1WA9A 4H6JA 4H6JB 1S1YA 5HD5A 3LI9A 2QKPA 1P0ZA 4WN5A 4JGPA 1F9IA 1S4RA 5EFWA 5J7EA 3NJAA 1N9OA 4HOIA 5F5YA 1EW0A 2KDKA 4LLOB 2WKRA 3CLOA 1F98A 2V1AA 2W27A 1OTBA 1Y28A 5A8BA 2A24B 4NXFA 4EXOA 3LIFA 3H7WB 2YKHA 3GDIA 1DP8A 3OLOA 4EQ1A 2OWJA 4BBTA 2PYRA 1OTIA 4EETB
chains in the Genus database with same CATH superfamily
3C30A 4LV1A 2A49A 2O9BA 5EPHA 4BJPA 4NETA 2D01A 2KOIA 4U0XA 4WZ5A 4Y5FA 3NOPC 4GCZA 3LY4A 1MKMA 2JBFA 4QU3A 4O01A 5HW3A 4DJ3A 5MC7A 2VV7A 2BLSA 3VFFA 3MFXA 3PBOA 3NECA 4WUJA 2QJ5A 4ZRRA 4Z9QA 2W3HA 3BFCA 2PYPA 3IS2A 3HLBA 3LIAA 5HWWA 3AGFA 3A0VA 2Y2MA 1F5MA 2WKPA 2Y2LA 3HLEA 1ODVA 5CHJA 3NOUC 3HLFA 4IVKA 1GA0A 1KOUA 3IXBA 3KSIA 5EVID 4GS9B 2B95A 4R23A 1JVJA 4KZAA 4R0QA 5HZHA 5CTNA 4EW7A 3CPTB 2ZLYA 2EWWA 5F83A 4DMZA 4N1XA 3RXWA 3C38A 4GB7A 4GKUA 3MQQA 3PYPA 3N6IA 4OQGA 1L0EA 2CC1A 4DN0A 1MWTA 2WAEA 3ZVWA 3CUEA 2PR5A 4N9KA 1MWUA 5FEFA 3A0RA 5I94A 3MXQA 4F3LA 4NKPA 3G2YA 2ZM0A 2K7SA 3PBSA 2P9VB 4NXGA 5HWVA 3E4QA 3T1XA 3D3OA 1M40A 2BASA 2V1ZA 2HF6A 4OPYA 3TG9A 1S4SA 1W5DA 3GRJA 1FR6A 5HAQA 4GDNA 1WYCA 5FEGA 2OLVA 2ZC7A 1HTZA 2OWHA 4GD6A 2VZWA 1IELA 1MXOA 3BQAA 2RCXA 1DJAA 2ZC3B 2IA2A 3NHQA 5F69A 3FPWA 2DNSA 5JYPA 2UWXA 4KZ6A 4CPKA 5TBMB 4GHIA 4BL3A 3IX3A 4MEZA 2VX8A 5GHZA 4QJGA 1IYQA 2OOLA 5KMWA 3QP1A 4K0XA 1K57A 3M6HA 3N8RA 1JWPA 3P98A 2XH9A 5IU1A 4HH2A 3VSKA 3SOIA 1YLTA 4MMNA 3OCNA 3Q82A 3E4PA 2ZL1A 4QPRA 5HDSA 1YMXA 4UQIS 3BFGA 1XX2A 3I7JA 3TJZC 3MR0A 3A3EA 2W1TA 4S2NA 3VP2A 1HVBA 1CEGA 3SH8A 2V0WA 1JWZA 2WGVA 3QP5A 1ZHHB 4OVDA 3ZGAB 2XQZA 4ME4A 4EEPA 1YM1A 2I72A 3A3JA 2Y4AA 1XJ2A 2O9CA 2RL3A 3S7OA 4FUWA 5J8XA 5GLBA 3GTCA 4S2LA 3VV4A 3ZFZA 4LENA 4I3JA 5DTTA 4Q0IA 3R4KA 1E4DA 4HY8A 1XP4A 2WKIA 4WMCA 1LSVA 2EFXA 1DY6A 3MKEA 2WYXA 1HD8A 2CMNA 4FH2A 4D2OA 3HLCA 5G18A 4KG6A 4CLCB 2ZM2A 4PM8A 1TS0A 4G3KA 3PBNA 4IBXA 3EWKA 4JXGA 5E2EA 1F2KA 2XD5A 4UA6A 3BQ8A 4KZ3A 4FSFA 1IKIA 2XLNA 4XUXA 3PAEA 4X1LA 3FKWA 5DJTA 3UE0A 3O5YA 3OC2A 1VHMA 4GZBA 4O0PA 2INWA 4Y0UA 2PHYA 3MS6A 2VKSA 3FYZA 5AQ9A 4DE1A 4HIAA 4LCLA 2IWBA 2XROA 3QNBA 3UMDA 3Q7VA 3GR2A 1K55A 3IH8A 4MN5A 3MFDA 1PWDA 1DRMA 4X68A 4R70A 1SCWA 1L0FA 5FQMA 4GW9A 4R3JA 2OAP1 1JNUA 3SW1A 4DJ2A 5GLCA 4WYYA 2PBYA 1T1CA 4I3IA 1XFQA 4IVIA 5FL3A 5FQIA 3TRCA 4K08A 4JXWA 5DVAA 1KVMA 1CI8A 3ZG8B 3KYQA 4KUOA 2QPNA 2VGLM 5FSRA 2PR6A 2XA7S 1I2WA 3LR4A 4JF4A 1KGEA 4DXCA 2X02A 1XJ4A 2J7VA 2HP5A 4PHTA 2HDSA 1MY8A 2ZQAA 3IT9A 3QNCA 3LY3A 1TEMA 1SKOA 1SKOB 1WA9A 3P09A 4H6JA 4H6JB 2WGIA 3LI9A 1AWIA 4OONA 1K6RA 3QP2A 2QKPA 1XKZA 3M2KA 2PU2A 4JGPA 1F9IA 5J7EA 2OLUA 2WKRA 3LGOA 2C6WB 3HREA 2ZC6B 5AJGA 5FATA 3T4JA 3OZHA 5FQJA 1F98A 3BLSA 4R3BA 2W27A 5DF7A 1WE4A 5CGXA 1OTBA 5A8BA 3DTEA 1K54C 2A2LA 3T1RA 2WZXA 3IF6B 3FKVA 3EQUA 5KSHA 2FH5A 1GA9A 3H7WB 2XSSA 3GDIA 1DP8A 1W63Q 2XD1A 1IKGA 4MN7A 3V67A 4EWFA 1K4EA 3N8LA 1NZOA 2Y2PA 2R9XA 4MLLA 3HUOA 4OPZA 2HDUA 4X1MA 3C4PA 4LV2A 4N1HA 1PFLA 1H0MA 4Y7PA 4HP4A 3S7PA 4M4XA 4E3JA 1OTEA 4UA9A 1L2SA 5LBRA 3A3IA 3W8KA 4EV4A 3IWOA 4HI4A 5M1AA 2V8FA 3VP1A 2Y55A 4ZJ2A 4OLGA 4GN2A 2P74A 2J3WA 4OP5A 3BFEA 5M18A 4WLAA 2R9WA 3UB7A 1ESUA 4MCWA 4M3KA 2P7JA 5HPFA 5TFQA 2WKEA 3B33A 4CLCC 2O9AA 1XA1A 3NC8A 4IBRA 4QY6A 4R4RA 4ESPA 4PM5A 5M19A 1G6OA 1YPRA 2V20A 4NEED 4FH4A 4X69A 5DJUA 4B93A 2ZMAA 3CJMA 4KQRA 2W3DA 3MSHA 3NDEA 3MMHA 5FI6A 2V1BA 1GCEA 1W8QA 2PU4A 1ES2A 3H82A 3IBRA 4FD8A 4OQIA 4RX2A 3C5AA 3BLMA 5FI2A 4MBHA 4KQDA 1YQSA 4Z1WA 2GJ3A 5L09A 1WYBA 3S1YA 2DMWA 4S2OA 4QD4A 1PI5A 4LV0A 2Z6CA 1Z6FA 3NCKA 2M1CA 3PBTA 4UQIM 4L9FA 2FZ0A 2XDMA 2JKTI 1KE4A 3C7VA 3W4QA 2WAFA 2Z2LB 4NXBA 3MQOA 3HLWA 3A0SA 3EOIA 2XK1A 3BY8A 3G31A 1IEMA 3GECA 3E0YA 1LT0A 3NDGA 2VGLS 2Q0OA 4OP8A 1ES3A 3IHAA 5CHUA 2QWSA 3KYEA 5D3OA 5AVEA 1XGJA 2ZC5B 1K56A 1STZA 3NOTC 3ZQ5A 3K2NA 5I5LA 4ZDXA 4UEYA 3UB9A 4RA7A 1TS7A 1ERMA 2B5RA 3SS3A 3UPNA 1XA7A 1PWCA 4MN6A 5F1FA 4BL2A 3EGXC 3IS2B 4LGWA 2G2WA 4DXBA 4Y2FA 3GQZA 1JTDA 4RX3A 4PAUA 3LI8A 1IFQA 1P9WA 4HHDA 5CXWA 4CQHA 2Y2JA 5EM1A 2ZMVA 5FAPA 1Z09A 3BJNA 1UGUA 1VQQA 4PPRA 5FQ9A 1EROA 2PT7A 2H28A 3G4PA 1BT5A 5EUAA 1Y54A 3CAXA 3WS4A 1FILA 2Y91A 5FA7A 2XRNA 2H10A 5L8MA 1GHMA 4P85A 3OCLA 4R3AA 4RYEA 3ZNTA 3E2KA 3NBLA 5L07A 1T1BA 3BYDA 1CI9A 2L4RA 1ONGA 1PNEA 2Z2MB 4I38A 1G28A 3N8SA 5CECA 5F68A 3NIAA 1SDNA 4F3LB 2NUPC 2JKRI 1XXMA 3IXGA 1CK3A 2OV5A 4WBGA 3ZG9B 3IWIA 4LFUA 1D06A 4NG2A 3UNWA 3EGDC 2DCFA 4QY5A 1CJFA 2V0UA 3MBZA 2P08A 5DKLA 3FG8A 3IXHA 4CLCE 2EX9A 5E2HA 4BQMA 4PKYG 4L9GA 1ACFA 2XGNA 3O87A 3FC7A 4ZJ1A 2UV0E 4JF6A 4OPRA 1HZOA 1VB6A 3VOZA 3C2WA 1LL5A 4YNRA 3FZCA 4ZAMA 2XA7M 2A24A 3CITA 3SH7A 5J3WA 4KZ5A 4KQQA 4GHIB 5KSCA 4I3AA 4B4XA 4C3QA 1OTDA 4I5SA 2WGWA 1PZPA 3CMZA 4R1GA 2H0TA 4QB8A 4KZ9A 2H0YA 2ZQ9A 2Y2HA 3SZTA 4EBPA 4BMWA 1UWNX 1E3UA 1XJ3A 2QHKA 2L0WA 1YLZA 1YLJA 1BZAA 4MDZA 3DAVA 2D02A 2ZL1B 4DE0A 4DRTA 3ITAA 1HLUP 4UA7A 2HDRA 4LPZA 5CGWA 2PD7A 4RVAA 5IHVA 3WWXA 4KZ4A 1NYMA 3HBRA 3WS5A 5EE8A 1OT9A 3G30A 1ZG4A 2JN7A 5EOEA 4X55A 2W1TB 3W4PA 2EX6A 3IF5A 1SKFA 3ZG7B 1YSPA 2Y2QA 3G35A 3S7NA 3ZNYA 2ZBBA 3SS4A 3VFHA 5CEDA 3P01A 3EQVA 2QMIA 4G3WA 2VGKA 4YWZA 3UE1A 2VV8A 5HFOA 4OKPA 4HBTA 3MZEA 1VM1A 1TF1A 4XXRA 2M7VA 4WZ5C 2B02A 4IHQA 2ZQCA 4P6ZM 1G68A 4CJNA 1P0ZA 1I2SA 4E3IA 5E43A 1S4RA 5EFWA 3NJAA 4KQOA 1N9OA 2KDKA 4LLOB 3CLOA 4PMAA 5BOHA 2Y2NA 1IYSA 2V1AA 3DWKA 1VETA 1VETB 3HL9A 2JKGA 4UAAA 2YKHA 2Y2IA 4EQ1A 1NLZA 3DBAA 2W1RA 3UY6A 3IHBA 4S2JA 4HEFA 5F1GA 3IQAA 1MZUA 4EBLA 1TD5A 3Q7VB 5GLAA 3G6OA 3KSGA 5A92A 5A93A 1AXBA 2Y2GA 3G2ZA 4HNBA 3CUEC 3FWLA 1J3WA 3RFBA 1KDSA 1ERQA 5CRFA 4Y17A 2WKHA 1BLHA 2X01A 3HUMA 1KDWA 4BD1A 3UMEA 4PM7A 3MQ0A 3U2AA 3ZVTA 3IBJA 4ZTKA 2W3EA 3DTMA 4GD8A 4DDSA 1EWZA 4O8GA 1ZKJA 5DF9A 4Y0OA 4XUZA 2I9VA 4OOLA 1H5XA 4S2IA 4E6XA 3BW6A 4E3NA 4BENA 5EVIB 5EVIA 5KIZA 4E3OA 1TDGA 1FIKA 3UO9A 5AQAA 4Y0TA 1RCJA 1L3LA 3LYXA 3MXRA 1PI4A 3ZYTA 1M6KA 1RGYA 3UE3A 4BWIA 1S66L 3O86A 3WRZA 5FQQA 3RTYA 1OTAA 2J9PA 3UDIA 3V50A 1FCNA 1MKIA 2GNXA 1BYWA 4BLMA 4EEUA 4WL9A 5EOOA 2NUTC 1K57C 3NY4A 1LLBA 4R4SA 5CEBA 5CGSA 3F1PA 1SZVA 5GHXA 5F82A 2HPBA 4JPMA 3PTEA 1BSGA 2WK0A 3BY9A 1CQAA 2JKTM 3KSFA 1PZOA 1FCOA 1NLYA 5FDSA 5A90A 1T19A 2ZQ8A 5DTKA 4S2NC 3UB5P 2L1MA 3B47A 4GJ4A 3D9YA 5HAPA 1S1ZA 3PXPA 2Z6DA 4B9OA 2PRFA 4LRXC 3SH9A 2DRWA 4X56A 3M2JA 1S6RA 4P6ZS 1XFNA 4FOFA 3UDFA 3OBFA 4F94A 1BLCA 4R38A 4B4ZA 1FOFA 5TGFA 3WS1A 3O88A 4EQIA 1N9BA 3T4TA 2E8JA 4MNRA 1Q2QA 3E2LA 5G4YA 4JGRA 2FFYA 4PKYA 3UB8A 3T12B 3D4FA 1KE3A 5FDHA 3UN7A 1W63M 2HV1A 3PR6A 1A0KA 4JBFA 2EWVA 2K31A 4KUKA 5HPIA 3UDXA 1NXYA 3V3RA 3WS0A 2QYBA 3FPVA 2VK3A 4YOFA 1FSWA 1DP9A 2KX6A 3H82B 2Y79A 1G6AA 3KSHA 3LR5A 2EA9A 1D7EA 1OT6A 2LB5A 1N9NA 4Q0JA 4XT2B 3LICA 4XT2A 1H3QA 2X71A 5EVEA 5G4ZA 4UHUA 3NI9A 1GSWA 1W8YA 3U4LP 4CLCD 3B3XA 3LFVA 1K55C 1NRJA 3ZDJA 2HGVA 1YLWA 3A3DA 3LIBA 3C8CA 4MBFA 3QHYA 2PDRA 3F1NA 3F1NB 2HJ9C 5EECA 4ZJ3A 1SDEA 2JKRM 1W79A 1K6SA 2VGJA 4ZBEA 1KGGA 5FQKA 5GHYA 4HP9A 1LSXA 4E3KA 3HJIA 2ZJ9A 5DFYA 1V9ZA 2B18A 3ITBA 1N9LA 3P7NA 2MJ6A 3KYZA 1PW8A 5HDDA 2PAVP 4Y3IA 5EM0A 3V5MA 2VLGA 4QWOA 2R78A 1FR1A 3CZDA 4I39A 2XFSA 3GMWA 3UPOA 3MXSA 2ZOHA 1NZUA 3RH8B 1BUEA 4IJGA 3TW8A 1U60A 4HJ6A 4ETXA 5K5BA 1YKDA 3V39A 2KLIA 1LL8A 2K2NA 5DFXA 5HWTA 2FFFB 3F1OB 3F1OA 1LI0A 4EERA 1YAXA 2V9AA 2EX2A 3T1QB 5E2GA 2WADA 3M6BA 3BEBA 2ZQ7A 3OPRA 2VJWA 4K0WA 1LSWA 3IX8A 5DTSA 2WZZA 5CX7A 1UWPX 3NULA 4JLFA 1ESIA 5C5KA 4E6WA 1K25A 1XJ6A 2C5WB 1N4OA 3E98A 2QZ6A 2QJ7A 3VE4A 3IF6C 4DF6A 4P6BA 4WM9A 3DW0A 4GS9A 2JE5A 3HLGA 5L10A 3UPPA 3KX0X 3JVVA 1OPXA 3CPTA 1FCMA 3LIDA 3PHYA 4LRZE 2PBDP 3MF0A 1T1AA 3S4XA 2Q9MA 3A3FA 5HD5A 4C6YA 3IXDA 4WN5A 3ZG0A 2O99A 3BFFA 4L0LA 3V3SA 3VP0A 3QP8A 1IOUA 3VSLA 2P9VA 2J8YA 4KG5A 2EXBA 2IWDA 1Y28A 5U47A 2A24B 1MC0A 4D60A 1J9MA 4S2MA 4WZ4A 3LIFA 4KZ8A 1NYYA 2EXAA 3OLOA 2V2FF 3W2ZA 1QMFA 2OWJA 2WGWB 5CTMA 4BBTA 1ZTUA 2Q9NA 3ZG5A 4EU0A 3GVBA 4BBVA 2EFUA 4IUHA 5TBMA 3PAGA 1H8MA 1PRQA 5HAIA 3B42A 2GZAA 4JGOA 4OOYA 3TOIA 2IWCA 4DKIA 3TE8A 3T4KA 4S2PA 5IT5A 3LO7A 1DJCA 4YINA 5EVLA 1YLYA 2JHEA 3W4OA 4JKTA 2ZOIA 1RP5A 3C7UA 1GSXA 3HLDA 2XEPA 4LV3A 5AVFA 3MJQA 4EUZA 1K54A 3BFDA 1ZG6A 1PYYA 4DE2A 3MZDA 1TS8A 3G34A 1PIOA 3PBQA 1BULA 1P97A 2GX5A 2XF3A 3ULFA 4Y13A 2VV6A 3K3CA 3BM6A 3C4OA 4KENB 2ZC4B 1CEFA 4HESA 4ARZA 4ARZB 1NJ4A 1TS6A 2O0YA 3GSGA 1TVFA 4NXEA 4WEKA 3VOYA 3K3DA 3OPPA 1BLPA 4GOGA 1BLSA 4A5RA 5CHMA 1P9RA 3T50A 4PM9A 3OPLA 4Y15A 3E4OA 1TDLA 1KE0A 3T4OA 4X6TA 3OOVA 3VE3A 1SHVA 5IS1A 4G3VA 4IUKA 3KO6A 3L9KA 4OLDA 4CLCA 1NWZA 5GL9A 1I5QA 5HSQA 2BTFP 3LIEA 4II7A 1GHIA 1FSYA 4HJ3A 4MBKA 3FV7A 3HVFA 2Y59A 1S67L 4JXSA 5A91A 4JGQA 5HD3A 1JWVA 4C75A 4ID4A 4NK3A 3LR3A 2ZMFA 2Y8HA 1K56D 1Q2PA 1OJGA 3SS5A 4X53A 1S0WA 1KVLA 3T1SA 5GLDA 2YKFA 1O07A 1Y4OA 3D72A 5HL1A 1MWRA 4OOMA 1V9YA 3VP3A 2XR0A 3LUQA 1H8YA 1YSQA 4L9EA 5DKKA 3OPHA 2XFTA 2HP6A 2EX8A 2WUQA 1LI9A 4N9LA 1K0KA 2V8CA 3O3VA 2J80A 3Q7ZA 5FAOA 4HJ4A 2ZQDA 5L2FA 2J9OA 1RGZA 4Q8IA 1YMSA 3Q81A 5AQ7A 4PM6A 4IEDA 1ES4A 3VMAA 1KGFA 3S7QA 5FAQA 4LCMA 2HP9A 3S22A 1YLPA 3QP6A 3N4IA 4E3LA 5TJJA 4EESA 4R6LA 3TSGA 4K91A 1NRFA 2LB9A 4P87A 1NY0A 2M7UA 1ES5A 3CI6A 3WRTA 5CERA 5FASA 4N92A 1IYOA 4OQ0A 2PD8A 3ZCZA 1DJBA 2JCHA 5EV0A 4YFMA 3BECA 1BTLA 3EEAA 4KZ7A 5HL6A 2H5SA 4U3TA 4H8RA 5FI7A 3DWZA 3F1PB 4HBUA 3DTKA 2Y2OA 5HARA 1JTGA 1YT4A 1X0OA 2HDQA 3EEHA 3IX4A 5AQBA 1ONHA 3IH9A 3T4LA 4E04A 4GNUA 4BBUA 1MPLA 4EUVA 5TR7A 4RQ9A 2AVXA 1LHYA 1LL9A 1ZC2A 5E2FA 2J3TC 4E3MA 1H8ZA 1T18A 1QMEA 4O7DA 2Y2KA 2E8IA 3AGDA 1DP6A 3HJKA 3IF6A 5F6AA 3ISGA 1E25A 2JC7A 3H7WA 1GSVA 3CWFA 2HJEA 3LEZA 4AFIA 1E3UD 1MBLA 4OPQA 3UE6A 1MWSA 3ZHHA 3ICYA 4P0MA 4OQHA 3N7WA 3UB6A 1EI5A 4S2KA 4DDYA 1IYPA 3LEQA 1K38A 4ETZA 1CF0A 2VEAA 3Q1FA 4U0TA 4HH3A 2J3TD 2BG1A 3G32A 4JXVA 3RJUA 2OSUA 4WF0A 1XPBA 3CG5A 1L0DA 3LR0A 2G2UA 2GDNA 3BWLA 3LCEA 1O7EA 4KZBA 1FQGA 1K4FA 2G7UA 4X25A 3L7HA 4LRYC 5JYOA 4OH0A 5HX9A 2OAQ1 3T4SA 1OJ5A 2W0NA 5HDCA 4FTXA 3H9WA 2W3GA 3Q07A 3MKFA 3R7WB 3R7WA 4WMCD 2A3UA 1G5UA 2WKQA 2ZM8A 3HCYA 1ALQA 1L0GA 1VEUB 1VEUA 4HQAA 3AGEA 3T4QA 1GHPA 3JVUA 3IWQA 4Q0HA 3RXXA 4QHCA 5J4EA 3VOLA 2ACGA 4GDBA 1S1YA 4BD0A 4B88A 2W3FA 3HUNA 3CHWP 1PW1A 1OMEA 3JYIA 4HOIA 2VA0A 5F5YA 1EW0A 3VP4A 3BRMA 3WS2A 3JPUA 4KG2A 4DE3A 3PBRA 4GLQA 4FCFA 4JF5A 4EBNA 5DF8A 2P04A 3MZFA 2JKFA 4WEJA 4WELA 1D1JA 3GV9A 1XGIA 4NXFA 2HZ5A 4EXOA 3DTIA 5KZHA 1W7FA 3QP4A 2ZD8A 2PYRA 1C3BA 1OTIA 4EETB 1PWGA 5EVIC
chains in the Genus database with same CATH topology
3C30A 1MZUA 2O9BA 4BBVA 4IUHA 4BJPA 2D01A 2KOIA 4Y5FA 5TBMA 1TD5A 3NOPC 3G6OA 3KSGA 4GCZA 1H8MA 4HP4A 3S7PA 3B42A 4M4XA 2GZAA 4JGOA 1OTEA 1MKMA 4HNBA 3TE8A 3CUEC 4O01A 3T4KA 4DJ3A 5LBRA 5MC7A 5IT5A 2VV7A 3RFBA 4HI4A 3MFXA 2JHEA 3PBOA 4WUJA 4ZRRA 2QJ5A 2W3HA 2ZOIA 2J3WA 1GSXA 2PYPA 3IS2A 5HWWA 3LIAA 4WLAA 3UB7A 5AVFA 4MCWA 3A0VA 2P7JA 3UMEA 3MQ0A 3U2AA 3MJQA 5HPFA 3B33A 4CLCC 2O9AA 1F5MA 2WKPA 3IBJA 2W3EA 1TS8A 1ODVA 3NOUC 3PBQA 4O8GA 1KOUA 1G6OA 3KSIA 4NEED 5DF9A 4GS9B 1P97A 2GX5A 3ULFA 5DJUA 2VV6A 2I9VA 3K3CA 4OOLA 4B93A 3BW6A 5HZHA 5KIZA 4EW7A 2EWWA 2W3DA 4DMZA 4ARZA 4ARZB 3MMHA 2V1BA 1TS6A 2O0YA 3C38A 3LYXA 3IBRA 3H82A 4NXEA 4WEKA 3MQQA 3ZYTA 3UE3A 4BWIA 1S66L 3K3DA 3PYPA 3RTYA 1OTAA 4DN0A 4KQDA 1P9RA 3CUEA 3T50A 2PR5A 4Z1WA 2GNXA 1BYWA 4EEUA 4WL9A 2GJ3A 3A0RA 3E4OA 3MXQA 2NUTC 2DMWA 4F3LA 3T4OA 3OOVA 4NKPA 2Z6CA 3VE3A 2M1CA 5IS1A 2K7SA 3PBTA 3PBSA 4L9FA 4NXGA 2FZ0A 4UQIM 5HWVA 2JKTI 4G3VA 3E4QA 3F1PA 4IUKA 3D3OA 3KO6A 4NXBA 2BASA 4CLCA 1NWZA 3MQOA 5HSQA 2HF6A 1S4SA 3A0SA 3EOIA 3LIEA 4II7A 3BY8A 3BY9A 2OWHA 2VZWA 2JKTM 3GECA 3KSFA 4HJ3A 3BQAA 3E0YA 1LT0A 2IA2A 1NLYA 3NHQA 1T19A 2VGLS 1S67L 4JGQA 5F69A 5HD3A 2L1MA 3FPWA 3LR3A 2ZMFA 2Y8HA 3B47A 4GJ4A 2QWSA 1OJGA 5TBMB 4GHIA 5AVEA 1S1ZA 3PXPA 2Z6DA 1STZA 3NOTC 3ZQ5A 3K2NA 5I5LA 2VX8A 4B9OA 2YKFA 4LRXC 3D72A 4UEYA 3UB9A 4OOMA 1V9YA 1TS7A 3LUQA 2OOLA 1YSQA 4P6ZS 4L9EA 1XFNA 4FOFA 5DKKA 3OBFA 4R38A 4MN6A 5IU1A 2J80A 4HJ4A 3T4TA 4HH2A 3EGXC 3IS2B 4MMNA 4Y2FA 3OCNA 3E4PA 4QPRA 5G4YA 4PAUA 5HDSA 4JGRA 3LI8A 4PKYA 3S7QA 4UQIS 1IFQA 1P9WA 4HHDA 3UB8A 4CQHA 1W63M 2HV1A 2ZMVA 3TJZC 3MR0A 3PR6A 2EWVA 2K31A 3BJNA 1UGUA 2W1TA 4KUKA 5TJJA 4EESA 4R6LA 5HPIA 2V0WA 2LB9A 2PT7A 2QYBA 2H28A 3FPVA 1ZHHB 4YOFA 4ME4A 4EEPA 2M7UA 3CAXA 3CI6A 1DP9A 2KX6A 2XRNA 5L8MA 3H82B 1XJ2A 3OCLA 2O9CA 4R3AA 2PD8A 3S7OA 2Y79A 3KSHA 1T1BA 3VV4A 3LR5A 2L4RA 4I3JA 2EA9A 1D7EA 3EEAA 1OT6A 2LB5A 4I38A 1G28A 4Q0IA 3R4KA 1N9NA 4HY8A 5F68A 4Q0JA 4XT2B 3LICA 1LSVA 4XT2A 1H3QA 5HL6A 5G4ZA 4F3LB 1GSWA 2CMNA 2NUPC 2JKRI 4CLCD 3LFVA 1NRJA 2HGVA 3F1PB 1X0OA 3LIBA 1D06A 3EEHA 3C8CA 3EGDC 4CLCB 2PDRA 3F1NA 2V0UA 3F1NB 3T4LA 2HJ9C 2P08A 4E04A 5DKLA 4BBUA 1TS0A 4EUVA 3FG8A 4G3KA 3PBNA 4RQ9A 3EWKA 4CLCE 2JKRM 4PKYG 4L9GA 4HP9A 1LSXA 3HJIA 3BQ8A 3FC7A 2J3TC 5DFYA 1VB6A 3C2WA 1V9ZA 2B18A 1T18A 4FSFA 1N9LA 3P7NA 4YNRA 2XA7M 2A24A 3CITA 2MJ6A 3KYZA 5J3WA 1DP6A 3HJKA 5F6AA 5HDDA 4GHIB 5DJTA 4Y3IA 3H7WA 3O5YA 3OC2A 1GSVA 1VHMA 2VLGA 3CWFA 4I3AA 2HJEA 2R78A 4O0PA 2INWA 4I39A 1OTDA 4I5SA 4AFIA 2PHYA 2ZOHA 2VKSA 3RH8B 4HIAA 3UE6A 4IJGA 3TW8A 2XROA 3ICYA 4HJ6A 4ETXA 5K5BA 3UMDA 4BMWA 1UWNX 3UB6A 1YKDA 1XJ3A 2KLIA 2QHKA 4MN5A 1LL8A 2K2NA 2L0WA 5DFXA 1DRMA 5HWTA 4ETZA 4MDZA 4R70A 2VEAA 2D02A 4GW9A 3F1OB 3F1OA 2OAP1 4EERA 1YAXA 4HH3A 2V9AA 2J3TD 1JNUA 3SW1A 4LPZA 4DJ2A 4WF0A 2PD7A 2VJWA 1T1CA 4I3IA 1XFQA 5FL3A 1LSWA 1OT9A 3LR0A 2JN7A 3TRCA 3BWLA 2W1TB 5CX7A 1UWPX 4K08A 5C5KA 2G7UA 4LRYC 1XJ6A 1YSPA 2OAQ1 3KYQA 3T4SA 1OJ5A 4KUOA 3E98A 2QJ7A 3VE4A 3S7NA 2W0NA 5HDCA 2VGLM 2ZBBA 3H9WA 4GS9A 2W3GA 2PR6A 2XA7S 3P01A 3R7WB 3R7WA 2WKQA 3LR4A 3HCYA 3EQVA 1XJ4A 3KX0X 3JVVA 1OPXA 4G3WA 4PHTA 4YWZA 4HQAA 2VV8A 3T4QA 3JVUA 3LIDA 4Q0HA 3PHYA 1TF1A 4LRZE 2M7VA 5J4EA 2B02A 4IHQA 3MF0A 1T1AA 3VOLA 1WA9A 4H6JA 4H6JB 1S1YA 4P6ZM 5HD5A 3LI9A 2W3FA 2QKPA 1P0ZA 4WN5A 2O99A 4JGPA 1F9IA 4L0LA 1S4RA 5EFWA 5J7EA 3NJAA 4KQOA 1N9OA 4HOIA 2VA0A 5F5YA 1EW0A 2KDKA 4LLOB 2WKRA 3CLOA 5AJGA 1IOUA 3T4JA 3PBRA 4GLQA 1F98A 2P04A 2V1AA 4WEJA 2W27A 4WELA 1OTBA 1Y28A 5A8BA 2A24B 1MC0A 4NXFA 2A2LA 4EXOA 3EQUA 3LIFA 5KSHA 2FH5A 3H7WB 2YKHA 2XSSA 3GDIA 1DP8A 3OLOA 1W63Q 3W2ZA 4EQ1A 1NLZA 3DBAA 2W1RA 2OWJA 4MN7A 3V67A 4BBTA 2PYRA 1ZTUA 1OTIA 4EETB 4EU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZU A;  4BBV A;  2D01 A;  5TBM A;  3NOP C;  3G6O A;  4GCZ A;  4HP4 A;  4M4X A;  4JGO A;  1OTE A;  4HNB A;  4DJ3 A;  2VV7 A;  4HI4 A;  3MFX A;  2JHE A;  4WUJ A;  2QJ5 A;  2ZOI A;  1GSX A;  2PYP A;  3IS2 A;  5HWW A;  3LIA A;  4WLA A;  3UB7 A;  5AVF A;  3A0V A;  2P7J A;  3UME A;  3MJQ A;  3B33 A;  2WKP A;  1TS8 A;  1ODV A;  3NOU C;  1KOU A;  4GS9 B;  1P97 A;  3ULF A;  5DJU A;  2VV6 A;  2I9V A;  3K3C A;  5HZH A;  5KIZ A;  4EW7 A;  2V1B A;  1TS6 A;  3LYX A;  3IBR A;  3H82 A;  4NXE A;  3MQQ A;  1S66 L;  3K3D A;  3PYP A;  3RTY A;  1OTA A;  4KQD A;  3T50 A;  2PR5 A;  1BYW A;  4EEU A;  4WL9 A;  2GJ3 A;  3A0R A;  3E4O A;  3MXQ A;  4F3L A;  2Z6C A;  3VE3 A;  2M1C A;  5IS1 A;  2K7S A;  4L9F A;  4NXG A;  5HWV A;  3E4Q A;  3F1P A;  4NXB A;  2BAS A;  1NWZ A;  3MQO A;  5HSQ A;  1S4S A;  3A0S A;  3LIE A;  3BY8 A;  3BY9 A;  2OWH A;  3GEC A;  4HJ3 A;  1LT0 A;  3NHQ A;  1T19 A;  1S67 L;  4JGQ A;  5F69 A;  5HD3 A;  2L1M A;  2QWS A;  1OJG A;  5TBM B;  4GHI A;  5AVE A;  1S1Z A;  2Z6D A;  3NOT C;  3ZQ5 A;  4B9O A;  5I5L A;  2YKF A;  4LRX C;  3D72 A;  3UB9 A;  1TS7 A;  1V9Y A;  3LUQ A;  2OOL A;  4L9E A;  1XFN A;  5DKK A;  4R38 A;  4MN6 A;  5IU1 A;  2J80 A;  4HJ4 A;  4HH2 A;  3IS2 B;  3E4P A;  5G4Y A;  5HDS A;  4JGR A;  3LI8 A;  4PKY A;  4HHD A;  3UB8 A;  2HV1 A;  3MR0 A;  1UGU A;  4KUK A;  4EES A;  4R6L A;  2V0W A;  2H28 A;  4EEP A;  3CAX A;  1DP9 A;  2KX6 A;  3H82 B;  1XJ2 A;  4R3A A;  2PD8 A;  1T1B A;  2L4R A;  4I3J A;  2EA9 A;  1D7E A;  1OT6 A;  4I38 A;  1G28 A;  1N9N A;  4HY8 A;  5F68 A;  4XT2 B;  3LIC A;  1LSV A;  4XT2 A;  5G4Z A;  4F3L B;  1GSW A;  2CMN A;  3F1P B;  1X0O A;  3LIB A;  1D06 A;  3EEH A;  3C8C A;  2PDR A;  3F1N A;  2V0U A;  3F1N B;  4E04 A;  5DKL A;  4BBU A;  1TS0 A;  3FG8 A;  4RQ9 A;  3EWK A;  4PKY G;  4L9G A;  4HP9 A;  1LSX A;  3HJI A;  3FC7 A;  1VB6 A;  3C2W A;  1V9Z A;  1T18 A;  1N9L A;  3P7N A;  2A24 A;  5J3W A;  1DP6 A;  3HJK A;  5F6A A;  5HDD A;  4GHI B;  5DJT A;  3H7W A;  1GSV A;  2VLG A;  3CWF A;  4I3A A;  2R78 A;  2INW A;  4I39 A;  1OTD A;  4I5S A;  2PHY A;  2ZOH A;  3RH8 B;  4HIA A;  3UE6 A;  3ICY A;  4HJ6 A;  3UMD A;  1UWN X;  3UB6 A;  1XJ3 A;  2QHK A;  4MN5 A;  1LL8 A;  2L0W A;  1DRM A;  5HWT A;  4R70 A;  2VEA A;  2D02 A;  4GW9 A;  3F1O B;  3F1O A;  4EER A;  4HH3 A;  2V9A A;  1JNU A;  3SW1 A;  4LPZ A;  4DJ2 A;  4WF0 A;  2PD7 A;  1T1C A;  4I3I A;  1XFQ A;  1LSW A;  1OT9 A;  2JN7 A;  3BWL A;  1UWP X;  4K08 A;  4LRY C;  1XJ6 A;  1OJ5 A;  4KUO A;  2QJ7 A;  3VE4 A;  2W0N A;  5HDC A;  2ZBB A;  3H9W A;  4GS9 A;  2PR6 A;  2WKQ A;  1XJ4 A;  3KX0 X;  4YWZ A;  4HQA A;  2VV8 A;  3LID A;  3PHY A;  4LRZ E;  5J4E A;  2B02 A;  1T1A A;  3VOL A;  1WA9 A;  4H6J A;  4H6J B;  1S1Y A;  5HD5 A;  3LI9 A;  2QKP A;  1P0Z A;  4WN5 A;  4JGP A;  1F9I A;  1S4R A;  5EFW A;  5J7E A;  3NJA A;  1N9O A;  4HOI A;  5F5Y A;  1EW0 A;  2KDK A;  4LLO B;  2WKR A;  3CLO A;  1F98 A;  2V1A A;  2W27 A;  1OTB A;  1Y28 A;  5A8B A;  2A24 B;  4NXF A;  4EXO A;  3LIF A;  3H7W B;  2YKH A;  3GDI A;  1DP8 A;  3OLO A;  4EQ1 A;  2OWJ A;  4BBT A;  2PYR A;  1OTI A;  4EET B; 
#chains in the Genus database with same CATH topology
 3C30 A;  4LV1 A;  2A49 A;  2O9B A;  5EPH A;  4BJP A;  4NET A;  2D01 A;  2KOI A;  4U0X A;  4WZ5 A;  4Y5F A;  3NOP C;  4GCZ A;  3LY4 A;  1MKM A;  2JBF A;  4QU3 A;  4O01 A;  5HW3 A;  4DJ3 A;  5MC7 A;  2VV7 A;  2BLS A;  3VFF A;  3MFX A;  3PBO A;  3NEC A;  4WUJ A;  2QJ5 A;  4ZRR A;  4Z9Q A;  2W3H A;  3BFC A;  2PYP A;  3IS2 A;  3HLB A;  3LIA A;  5HWW A;  3AGF A;  3A0V A;  2Y2M A;  1F5M A;  2WKP A;  2Y2L A;  3HLE A;  1ODV A;  5CHJ A;  3NOU C;  3HLF A;  4IVK A;  1GA0 A;  1KOU A;  3IXB A;  3KSI A;  5EVI D;  4GS9 B;  2B95 A;  4R23 A;  1JVJ A;  4KZA A;  4R0Q A;  5HZH A;  5CTN A;  4EW7 A;  3CPT B;  2ZLY A;  2EWW A;  5F83 A;  4DMZ A;  4N1X A;  3RXW A;  3C38 A;  4GB7 A;  4GKU A;  3MQQ A;  3PYP A;  3N6I A;  4OQG A;  1L0E A;  2CC1 A;  4DN0 A;  1MWT A;  2WAE A;  3ZVW A;  3CUE A;  2PR5 A;  4N9K A;  1MWU A;  5FEF A;  3A0R A;  5I94 A;  3MXQ A;  4F3L A;  4NKP A;  3G2Y A;  2ZM0 A;  2K7S A;  3PBS A;  2P9V B;  4NXG A;  5HWV A;  3E4Q A;  3T1X A;  3D3O A;  1M40 A;  2BAS A;  2V1Z A;  2HF6 A;  4OPY A;  3TG9 A;  1S4S A;  1W5D A;  3GRJ A;  1FR6 A;  5HAQ A;  4GDN A;  1WYC A;  5FEG A;  2OLV A;  2ZC7 A;  1HTZ A;  2OWH A;  4GD6 A;  2VZW A;  1IEL A;  1MXO A;  3BQA A;  2RCX A;  1DJA A;  2ZC3 B;  2IA2 A;  3NHQ A;  5F69 A;  3FPW A;  2DNS A;  5JYP A;  2UWX A;  4KZ6 A;  4CPK A;  5TBM B;  4GHI A;  4BL3 A;  3IX3 A;  4MEZ A;  2VX8 A;  5GHZ A;  4QJG A;  1IYQ A;  2OOL A;  5KMW A;  3QP1 A;  4K0X A;  1K57 A;  3M6H A;  3N8R A;  1JWP A;  3P98 A;  2XH9 A;  5IU1 A;  4HH2 A;  3VSK A;  3SOI A;  1YLT A;  4MMN A;  3OCN A;  3Q82 A;  3E4P A;  2ZL1 A;  4QPR A;  5HDS A;  1YMX A;  4UQI S;  3BFG A;  1XX2 A;  3I7J A;  3TJZ C;  3MR0 A;  3A3E A;  2W1T A;  4S2N A;  3VP2 A;  1HVB A;  1CEG A;  3SH8 A;  2V0W A;  1JWZ A;  2WGV A;  3QP5 A;  1ZHH B;  4OVD A;  3ZGA B;  2XQZ A;  4ME4 A;  4EEP A;  1YM1 A;  2I72 A;  3A3J A;  2Y4A A;  1XJ2 A;  2O9C A;  2RL3 A;  3S7O A;  4FUW A;  5J8X A;  5GLB A;  3GTC A;  4S2L A;  3VV4 A;  3ZFZ A;  4LEN A;  4I3J A;  5DTT A;  4Q0I A;  3R4K A;  1E4D A;  4HY8 A;  1XP4 A;  2WKI A;  4WMC A;  1LSV A;  2EFX A;  1DY6 A;  3MKE A;  2WYX A;  1HD8 A;  2CMN A;  4FH2 A;  4D2O A;  3HLC A;  5G18 A;  4KG6 A;  4CLC B;  2ZM2 A;  4PM8 A;  1TS0 A;  4G3K A;  3PBN A;  4IBX A;  3EWK A;  4JXG A;  5E2E A;  1F2K A;  2XD5 A;  4UA6 A;  3BQ8 A;  4KZ3 A;  4FSF A;  1IKI A;  2XLN A;  4XUX A;  3PAE A;  4X1L A;  3FKW A;  5DJT A;  3UE0 A;  3O5Y A;  3OC2 A;  1VHM A;  4GZB A;  4O0P A;  2INW A;  4Y0U A;  2PHY A;  3MS6 A;  2VKS A;  3FYZ A;  5AQ9 A;  4DE1 A;  4HIA A;  4LCL A;  2IWB A;  2XRO A;  3QNB A;  3UMD A;  3Q7V A;  3GR2 A;  1K55 A;  3IH8 A;  4MN5 A;  3MFD A;  1PWD A;  1DRM A;  4X68 A;  4R70 A;  1SCW A;  1L0F A;  5FQM A;  4GW9 A;  4R3J A;  2OAP 1;  1JNU A;  3SW1 A;  4DJ2 A;  5GLC A;  4WYY A;  2PBY A;  1T1C A;  4I3I A;  1XFQ A;  4IVI A;  5FL3 A;  5FQI A;  3TRC A;  4K08 A;  4JXW A;  5DVA A;  1KVM A;  1CI8 A;  3ZG8 B;  3KYQ A;  4KUO A;  2QPN A;  2VGL M;  5FSR A;  2PR6 A;  2XA7 S;  1I2W A;  3LR4 A;  4JF4 A;  1KGE A;  4DXC A;  2X02 A;  1XJ4 A;  2J7V A;  2HP5 A;  4PHT A;  2HDS A;  1MY8 A;  2ZQA A;  3IT9 A;  3QNC A;  3LY3 A;  1TEM A;  1SKO A;  1SKO B;  1WA9 A;  3P09 A;  4H6J A;  4H6J B;  2WGI A;  3LI9 A;  1AWI A;  4OON A;  1K6R A;  3QP2 A;  2QKP A;  1XKZ A;  3M2K A;  2PU2 A;  4JGP A;  1F9I A;  5J7E A;  2OLU A;  2WKR A;  3LGO A;  2C6W B;  3HRE A;  2ZC6 B;  5AJG A;  5FAT A;  3T4J A;  3OZH A;  5FQJ A;  1F98 A;  3BLS A;  4R3B A;  2W27 A;  5DF7 A;  1WE4 A;  5CGX A;  1OTB A;  5A8B A;  3DTE A;  1K54 C;  2A2L A;  3T1R A;  2WZX A;  3IF6 B;  3FKV A;  3EQU A;  5KSH A;  2FH5 A;  1GA9 A;  3H7W B;  2XSS A;  3GDI A;  1DP8 A;  1W63 Q;  2XD1 A;  1IKG A;  4MN7 A;  3V67 A;  4EWF A;  1K4E A;  3N8L A;  1NZO A;  2Y2P A;  2R9X A;  4MLL A;  3HUO A;  4OPZ A;  2HDU A;  4X1M A;  3C4P A;  4LV2 A;  4N1H A;  1PFL A;  1H0M A;  4Y7P A;  4HP4 A;  3S7P A;  4M4X A;  4E3J A;  1OTE A;  4UA9 A;  1L2S A;  5LBR A;  3A3I A;  3W8K A;  4EV4 A;  3IWO A;  4HI4 A;  5M1A A;  2V8F A;  3VP1 A;  2Y55 A;  4ZJ2 A;  4OLG A;  4GN2 A;  2P74 A;  2J3W A;  4OP5 A;  3BFE A;  5M18 A;  4WLA A;  2R9W A;  3UB7 A;  1ESU A;  4MCW A;  4M3K A;  2P7J A;  5HPF A;  5TFQ A;  2WKE A;  3B33 A;  4CLC C;  2O9A A;  1XA1 A;  3NC8 A;  4IBR A;  4QY6 A;  4R4R A;  4ESP A;  4PM5 A;  5M19 A;  1G6O A;  1YPR A;  2V20 A;  4NEE D;  4FH4 A;  4X69 A;  5DJU A;  4B93 A;  2ZMA A;  3CJM A;  4KQR A;  2W3D A;  3MSH A;  3NDE A;  3MMH A;  5FI6 A;  2V1B A;  1GCE A;  1W8Q A;  2PU4 A;  1ES2 A;  3H82 A;  3IBR A;  4FD8 A;  4OQI A;  4RX2 A;  3C5A A;  3BLM A;  5FI2 A;  4MBH A;  4KQD A;  1YQS A;  4Z1W A;  2GJ3 A;  5L09 A;  1WYB A;  3S1Y A;  2DMW A;  4S2O A;  4QD4 A;  1PI5 A;  4LV0 A;  2Z6C A;  1Z6F A;  3NCK A;  2M1C A;  3PBT A;  4UQI M;  4L9F A;  2FZ0 A;  2XDM A;  2JKT I;  1KE4 A;  3C7V A;  3W4Q A;  2WAF A;  2Z2L B;  4NXB A;  3MQO A;  3HLW A;  3A0S A;  3EOI A;  2XK1 A;  3BY8 A;  3G31 A;  1IEM A;  3GEC A;  3E0Y A;  1LT0 A;  3NDG A;  2VGL S;  2Q0O A;  4OP8 A;  1ES3 A;  3IHA A;  5CHU A;  2QWS A;  3KYE A;  5D3O A;  5AVE A;  1XGJ A;  2ZC5 B;  1K56 A;  1STZ A;  3NOT C;  3ZQ5 A;  3K2N A;  5I5L A;  4ZDX A;  4UEY A;  3UB9 A;  4RA7 A;  1TS7 A;  1ERM A;  2B5R A;  3SS3 A;  3UPN A;  1XA7 A;  1PWC A;  4MN6 A;  5F1F A;  4BL2 A;  3EGX C;  3IS2 B;  4LGW A;  2G2W A;  4DXB A;  4Y2F A;  3GQZ A;  1JTD A;  4RX3 A;  4PAU A;  3LI8 A;  1IFQ A;  1P9W A;  4HHD A;  5CXW A;  4CQH A;  2Y2J A;  5EM1 A;  2ZMV A;  5FAP A;  1Z09 A;  3BJN A;  1UGU A;  1VQQ A;  4PPR A;  5FQ9 A;  1ERO A;  2PT7 A;  2H28 A;  3G4P A;  1BT5 A;  5EUA A;  1Y54 A;  3CAX A;  3WS4 A;  1FIL A;  2Y91 A;  5FA7 A;  2XRN A;  2H10 A;  5L8M A;  1GHM A;  4P85 A;  3OCL A;  4R3A A;  4RYE A;  3ZNT A;  3E2K A;  3NBL A;  5L07 A;  1T1B A;  3BYD A;  1CI9 A;  2L4R A;  1ONG A;  1PNE A;  2Z2M B;  4I38 A;  1G28 A;  3N8S A;  5CEC A;  5F68 A;  3NIA A;  1SDN A;  4F3L B;  2NUP C;  2JKR I;  1XXM A;  3IXG A;  1CK3 A;  2OV5 A;  4WBG A;  3ZG9 B;  3IWI A;  4LFU A;  1D06 A;  4NG2 A;  3UNW A;  3EGD C;  2DCF A;  4QY5 A;  1CJF A;  2V0U A;  3MBZ A;  2P08 A;  5DKL A;  3FG8 A;  3IXH A;  4CLC E;  2EX9 A;  5E2H A;  4BQM A;  4PKY G;  4L9G A;  1ACF A;  2XGN A;  3O87 A;  3FC7 A;  4ZJ1 A;  2UV0 E;  4JF6 A;  4OPR A;  1HZO A;  1VB6 A;  3VOZ A;  3C2W A;  1LL5 A;  4YNR A;  3FZC A;  4ZAM A;  2XA7 M;  2A24 A;  3CIT A;  3SH7 A;  5J3W A;  4KZ5 A;  4KQQ A;  4GHI B;  5KSC A;  4I3A A;  4B4X A;  4C3Q A;  1OTD A;  4I5S A;  2WGW A;  1PZP A;  3CMZ A;  4R1G A;  2H0T A;  4QB8 A;  4KZ9 A;  2H0Y A;  2ZQ9 A;  2Y2H A;  3SZT A;  4EBP A;  4BMW A;  1UWN X;  1E3U A;  1XJ3 A;  2QHK A;  2L0W A;  1YLZ A;  1YLJ A;  1BZA A;  4MDZ A;  3DAV A;  2D02 A;  2ZL1 B;  4DE0 A;  4DRT A;  3ITA A;  1HLU P;  4UA7 A;  2HDR A;  4LPZ A;  5CGW A;  2PD7 A;  4RVA A;  5IHV A;  3WWX A;  4KZ4 A;  1NYM A;  3HBR A;  3WS5 A;  5EE8 A;  1OT9 A;  3G30 A;  1ZG4 A;  2JN7 A;  5EOE A;  4X55 A;  2W1T B;  3W4P A;  2EX6 A;  3IF5 A;  1SKF A;  3ZG7 B;  1YSP A;  2Y2Q A;  3G35 A;  3S7N A;  3ZNY A;  2ZBB A;  3SS4 A;  3VFH A;  5CED A;  3P01 A;  3EQV A;  2QMI A;  4G3W A;  2VGK A;  4YWZ A;  3UE1 A;  2VV8 A;  5HFO A;  4OKP A;  4HBT A;  3MZE A;  1VM1 A;  1TF1 A;  4XXR A;  2M7V A;  4WZ5 C;  2B02 A;  4IHQ A;  2ZQC A;  4P6Z M;  1G68 A;  4CJN A;  1P0Z A;  1I2S A;  4E3I A;  5E43 A;  1S4R A;  5EFW A;  3NJA A;  4KQO A;  1N9O A;  2KDK A;  4LLO B;  3CLO A;  4PMA A;  5BOH A;  2Y2N A;  1IYS A;  2V1A A;  3DWK A;  1VET A;  1VET B;  3HL9 A;  2JKG A;  4UAA A;  2YKH A;  2Y2I A;  4EQ1 A;  1NLZ A;  3DBA A;  2W1R A;  3UY6 A;  3IHB A;  4S2J A;  4HEF A;  5F1G A;  3IQA A;  1MZU A;  4EBL A;  1TD5 A;  3Q7V B;  5GLA A;  3G6O A;  3KSG A;  5A92 A;  5A93 A;  1AXB A;  2Y2G A;  3G2Z A;  4HNB A;  3CUE C;  3FWL A;  1J3W A;  3RFB A;  1KDS A;  1ERQ A;  5CRF A;  4Y17 A;  2WKH A;  1BLH A;  2X01 A;  3HUM A;  1KDW A;  4BD1 A;  3UME A;  4PM7 A;  3MQ0 A;  3U2A A;  3ZVT A;  3IBJ A;  4ZTK A;  2W3E A;  3DTM A;  4GD8 A;  4DDS A;  1EWZ A;  4O8G A;  1ZKJ A;  5DF9 A;  4Y0O A;  4XUZ A;  2I9V A;  4OOL A;  1H5X A;  4S2I A;  4E6X A;  3BW6 A;  4E3N A;  4BEN A;  5EVI B;  5EVI A;  5KIZ A;  4E3O A;  1TDG A;  1FIK A;  3UO9 A;  5AQA A;  4Y0T A;  1RCJ A;  1L3L A;  3LYX A;  3MXR A;  1PI4 A;  3ZYT A;  1M6K A;  1RGY A;  3UE3 A;  4BWI A;  1S66 L;  3O86 A;  3WRZ A;  5FQQ A;  3RTY A;  1OTA A;  2J9P A;  3UDI A;  3V50 A;  1FCN A;  1MKI A;  2GNX A;  1BYW A;  4BLM A;  4EEU A;  4WL9 A;  5EOO A;  2NUT C;  1K57 C;  3NY4 A;  1LLB A;  4R4S A;  5CEB A;  5CGS A;  3F1P A;  1SZV A;  5GHX A;  5F82 A;  2HPB A;  4JPM A;  3PTE A;  1BSG A;  2WK0 A;  3BY9 A;  1CQA A;  2JKT M;  3KSF A;  1PZO A;  1FCO A;  1NLY A;  5FDS A;  5A90 A;  1T19 A;  2ZQ8 A;  5DTK A;  4S2N C;  3UB5 P;  2L1M A;  3B47 A;  4GJ4 A;  3D9Y A;  5HAP A;  1S1Z A;  3PXP A;  2Z6D A;  4B9O A;  2PRF A;  4LRX C;  3SH9 A;  2DRW A;  4X56 A;  3M2J A;  1S6R A;  4P6Z S;  1XFN A;  4FOF A;  3UDF A;  3OBF A;  4F94 A;  1BLC A;  4R38 A;  4B4Z A;  1FOF A;  5TGF A;  3WS1 A;  3O88 A;  4EQI A;  1N9B A;  3T4T A;  2E8J A;  4MNR A;  1Q2Q A;  3E2L A;  5G4Y A;  4JGR A;  2FFY A;  4PKY A;  3UB8 A;  3T12 B;  3D4F A;  1KE3 A;  5FDH A;  3UN7 A;  1W63 M;  2HV1 A;  3PR6 A;  1A0K A;  4JBF A;  2EWV A;  2K31 A;  4KUK A;  5HPI A;  3UDX A;  1NXY A;  3V3R A;  3WS0 A;  2QYB A;  3FPV A;  2VK3 A;  4YOF A;  1FSW A;  1DP9 A;  2KX6 A;  3H82 B;  2Y79 A;  1G6A A;  3KSH A;  3LR5 A;  2EA9 A;  1D7E A;  1OT6 A;  2LB5 A;  1N9N A;  4Q0J A;  4XT2 B;  3LIC A;  4XT2 A;  1H3Q A;  2X71 A;  5EVE A;  5G4Z A;  4UHU A;  3NI9 A;  1GSW A;  1W8Y A;  3U4L P;  4CLC D;  3B3X A;  3LFV A;  1K55 C;  1NRJ A;  3ZDJ A;  2HGV A;  1YLW A;  3A3D A;  3LIB A;  3C8C A;  4MBF A;  3QHY A;  2PDR A;  3F1N A;  3F1N B;  2HJ9 C;  5EEC A;  4ZJ3 A;  1SDE A;  2JKR M;  1W79 A;  1K6S A;  2VGJ A;  4ZBE A;  1KGG A;  5FQK A;  5GHY A;  4HP9 A;  1LSX A;  4E3K A;  3HJI A;  2ZJ9 A;  5DFY A;  1V9Z A;  2B18 A;  3ITB A;  1N9L A;  3P7N A;  2MJ6 A;  3KYZ A;  1PW8 A;  5HDD A;  2PAV P;  4Y3I A;  5EM0 A;  3V5M A;  2VLG A;  4QWO A;  2R78 A;  1FR1 A;  3CZD A;  4I39 A;  2XFS A;  3GMW A;  3UPO A;  3MXS A;  2ZOH A;  1NZU A;  3RH8 B;  1BUE A;  4IJG A;  3TW8 A;  1U60 A;  4HJ6 A;  4ETX A;  5K5B A;  1YKD A;  3V39 A;  2KLI A;  1LL8 A;  2K2N A;  5DFX A;  5HWT A;  2FFF B;  3F1O B;  3F1O A;  1LI0 A;  4EER A;  1YAX A;  2V9A A;  2EX2 A;  3T1Q B;  5E2G A;  2WAD A;  3M6B A;  3BEB A;  2ZQ7 A;  3OPR A;  2VJW A;  4K0W A;  1LSW A;  3IX8 A;  5DTS A;  2WZZ A;  5CX7 A;  1UWP X;  3NUL A;  4JLF A;  1ESI A;  5C5K A;  4E6W A;  1K25 A;  1XJ6 A;  2C5W B;  1N4O A;  3E98 A;  2QZ6 A;  2QJ7 A;  3VE4 A;  3IF6 C;  4DF6 A;  4P6B A;  4WM9 A;  3DW0 A;  4GS9 A;  2JE5 A;  3HLG A;  5L10 A;  3UPP A;  3KX0 X;  3JVV A;  1OPX A;  3CPT A;  1FCM A;  3LID A;  3PHY A;  4LRZ E;  2PBD P;  3MF0 A;  1T1A A;  3S4X A;  2Q9M A;  3A3F A;  5HD5 A;  4C6Y A;  3IXD A;  4WN5 A;  3ZG0 A;  2O99 A;  3BFF A;  4L0L A;  3V3S A;  3VP0 A;  3QP8 A;  1IOU A;  3VSL A;  2P9V A;  2J8Y A;  4KG5 A;  2EXB A;  2IWD A;  1Y28 A;  5U47 A;  2A24 B;  1MC0 A;  4D60 A;  1J9M A;  4S2M A;  4WZ4 A;  3LIF A;  4KZ8 A;  1NYY A;  2EXA A;  3OLO A;  2V2F F;  3W2Z A;  1QMF A;  2OWJ A;  2WGW B;  5CTM A;  4BBT A;  1ZTU A;  2Q9N A;  3ZG5 A;  4EU0 A;  3GVB A;  4BBV A;  2EFU A;  4IUH A;  5TBM A;  3PAG A;  1H8M A;  1PRQ A;  5HAI A;  3B42 A;  2GZA A;  4JGO A;  4OOY A;  3TOI A;  2IWC A;  4DKI A;  3TE8 A;  3T4K A;  4S2P A;  5IT5 A;  3LO7 A;  1DJC A;  4YIN A;  5EVL A;  1YLY A;  2JHE A;  3W4O A;  4JKT A;  2ZOI A;  1RP5 A;  3C7U A;  1GSX A;  3HLD A;  2XEP A;  4LV3 A;  5AVF A;  3MJQ A;  4EUZ A;  1K54 A;  3BFD A;  1ZG6 A;  1PYY A;  4DE2 A;  3MZD A;  1TS8 A;  3G34 A;  1PIO A;  3PBQ A;  1BUL A;  1P97 A;  2GX5 A;  2XF3 A;  3ULF A;  4Y13 A;  2VV6 A;  3K3C A;  3BM6 A;  3C4O A;  4KEN B;  2ZC4 B;  1CEF A;  4HES A;  4ARZ A;  4ARZ B;  1NJ4 A;  1TS6 A;  2O0Y A;  3GSG A;  1TVF A;  4NXE A;  4WEK A;  3VOY A;  3K3D A;  3OPP A;  1BLP A;  4GOG A;  1BLS A;  4A5R A;  5CHM A;  1P9R A;  3T50 A;  4PM9 A;  3OPL A;  4Y15 A;  3E4O A;  1TDL A;  1KE0 A;  3T4O A;  4X6T A;  3OOV A;  3VE3 A;  1SHV A;  5IS1 A;  4G3V A;  4IUK A;  3KO6 A;  3L9K A;  4OLD A;  4CLC A;  1NWZ A;  5GL9 A;  1I5Q A;  5HSQ A;  2BTF P;  3LIE A;  4II7 A;  1GHI A;  1FSY A;  4HJ3 A;  4MBK A;  3FV7 A;  3HVF A;  2Y59 A;  1S67 L;  4JXS A;  5A91 A;  4JGQ A;  5HD3 A;  1JWV A;  4C75 A;  4ID4 A;  4NK3 A;  3LR3 A;  2ZMF A;  2Y8H A;  1K56 D;  1Q2P A;  1OJG A;  3SS5 A;  4X53 A;  1S0W A;  1KVL A;  3T1S A;  5GLD A;  2YKF A;  1O07 A;  1Y4O A;  3D72 A;  5HL1 A;  1MWR A;  4OOM A;  1V9Y A;  3VP3 A;  2XR0 A;  3LUQ A;  1H8Y A;  1YSQ A;  4L9E A;  5DKK A;  3OPH A;  2XFT A;  2HP6 A;  2EX8 A;  2WUQ A;  1LI9 A;  4N9L A;  1K0K A;  2V8C A;  3O3V A;  2J80 A;  3Q7Z A;  5FAO A;  4HJ4 A;  2ZQD A;  5L2F A;  2J9O A;  1RGZ A;  4Q8I A;  1YMS A;  3Q81 A;  5AQ7 A;  4PM6 A;  4IED A;  1ES4 A;  3VMA A;  1KGF A;  3S7Q A;  5FAQ A;  4LCM A;  2HP9 A;  3S22 A;  1YLP A;  3QP6 A;  3N4I A;  4E3L A;  5TJJ A;  4EES A;  4R6L A;  3TSG A;  4K91 A;  1NRF A;  2LB9 A;  4P87 A;  1NY0 A;  2M7U A;  1ES5 A;  3CI6 A;  3WRT A;  5CER A;  5FAS A;  4N92 A;  1IYO A;  4OQ0 A;  2PD8 A;  3ZCZ A;  1DJB A;  2JCH A;  5EV0 A;  4YFM A;  3BEC A;  1BTL A;  3EEA A;  4KZ7 A;  5HL6 A;  2H5S A;  4U3T A;  4H8R A;  5FI7 A;  3DWZ A;  3F1P B;  4HBU A;  3DTK A;  2Y2O A;  5HAR A;  1JTG A;  1YT4 A;  1X0O A;  2HDQ A;  3EEH A;  3IX4 A;  5AQB A;  1ONH A;  3IH9 A;  3T4L A;  4E04 A;  4GNU A;  4BBU A;  1MPL A;  4EUV A;  5TR7 A;  4RQ9 A;  2AVX A;  1LHY A;  1LL9 A;  1ZC2 A;  5E2F A;  2J3T C;  4E3M A;  1H8Z A;  1T18 A;  1QME A;  4O7D A;  2Y2K A;  2E8I A;  3AGD A;  1DP6 A;  3HJK A;  3IF6 A;  5F6A A;  3ISG A;  1E25 A;  2JC7 A;  3H7W A;  1GSV A;  3CWF A;  2HJE A;  3LEZ A;  4AFI A;  1E3U D;  1MBL A;  4OPQ A;  3UE6 A;  1MWS A;  3ZHH A;  3ICY A;  4P0M A;  4OQH A;  3N7W A;  3UB6 A;  1EI5 A;  4S2K A;  4DDY A;  1IYP A;  3LEQ A;  1K38 A;  4ETZ A;  1CF0 A;  2VEA A;  3Q1F A;  4U0T A;  4HH3 A;  2J3T D;  2BG1 A;  3G32 A;  4JXV A;  3RJU A;  2OSU A;  4WF0 A;  1XPB A;  3CG5 A;  1L0D A;  3LR0 A;  2G2U A;  2GDN A;  3BWL A;  3LCE A;  1O7E A;  4KZB A;  1FQG A;  1K4F A;  2G7U A;  4X25 A;  3L7H A;  4LRY C;  5JYO A;  4OH0 A;  5HX9 A;  2OAQ 1;  3T4S A;  1OJ5 A;  2W0N A;  5HDC A;  4FTX A;  3H9W A;  2W3G A;  3Q07 A;  3MKF A;  3R7W B;  3R7W A;  4WMC D;  2A3U A;  1G5U A;  2WKQ A;  2ZM8 A;  3HCY A;  1ALQ A;  1L0G A;  1VEU B;  1VEU A;  4HQA A;  3AGE A;  3T4Q A;  1GHP A;  3JVU A;  3IWQ A;  4Q0H A;  3RXX A;  4QHC A;  5J4E A;  3VOL A;  2ACG A;  4GDB A;  1S1Y A;  4BD0 A;  4B88 A;  2W3F A;  3HUN A;  3CHW P;  1PW1 A;  1OME A;  3JYI A;  4HOI A;  2VA0 A;  5F5Y A;  1EW0 A;  3VP4 A;  3BRM A;  3WS2 A;  3JPU A;  4KG2 A;  4DE3 A;  3PBR A;  4GLQ A;  4FCF A;  4JF5 A;  4EBN A;  5DF8 A;  2P04 A;  3MZF A;  2JKF A;  4WEJ A;  4WEL A;  1D1J A;  3GV9 A;  1XGI A;  4NXF A;  2HZ5 A;  4EXO A;  3DTI A;  5KZH A;  1W7F A;  3QP4 A;  2ZD8 A;  2PYR A;  1C3B A;  1OTI A;  4EET B;  1PWG A;  5EVI C; 
#chains in the Genus database with same CATH homology
 3C30 A;  1MZU A;  2O9B A;  4BBV A;  4IUH A;  4BJP A;  2D01 A;  2KOI A;  4Y5F A;  5TBM A;  1TD5 A;  3NOP C;  3G6O A;  3KSG A;  4GCZ A;  1H8M A;  4HP4 A;  3S7P A;  3B42 A;  4M4X A;  2GZA A;  4JGO A;  1OTE A;  1MKM A;  4HNB A;  3TE8 A;  3CUE C;  4O01 A;  3T4K A;  4DJ3 A;  5LBR A;  5MC7 A;  5IT5 A;  2VV7 A;  3RFB A;  4HI4 A;  3MFX A;  2JHE A;  3PBO A;  4WUJ A;  4ZRR A;  2QJ5 A;  2W3H A;  2ZOI A;  2J3W A;  1GSX A;  2PYP A;  3IS2 A;  5HWW A;  3LIA A;  4WLA A;  3UB7 A;  5AVF A;  4MCW A;  3A0V A;  2P7J A;  3UME A;  3MQ0 A;  3U2A A;  3MJQ A;  5HPF A;  3B33 A;  4CLC C;  2O9A A;  1F5M A;  2WKP A;  3IBJ A;  2W3E A;  1TS8 A;  1ODV A;  3NOU C;  3PBQ A;  4O8G A;  1KOU A;  1G6O A;  3KSI A;  4NEE D;  5DF9 A;  4GS9 B;  1P97 A;  2GX5 A;  3ULF A;  5DJU A;  2VV6 A;  2I9V A;  3K3C A;  4OOL A;  4B93 A;  3BW6 A;  5HZH A;  5KIZ A;  4EW7 A;  2EWW A;  2W3D A;  4DMZ A;  4ARZ A;  4ARZ B;  3MMH A;  2V1B A;  1TS6 A;  2O0Y A;  3C38 A;  3LYX A;  3IBR A;  3H82 A;  4NXE A;  4WEK A;  3MQQ A;  3ZYT A;  3UE3 A;  4BWI A;  1S66 L;  3K3D A;  3PYP A;  3RTY A;  1OTA A;  4DN0 A;  4KQD A;  1P9R A;  3CUE A;  3T50 A;  2PR5 A;  4Z1W A;  2GNX A;  1BYW A;  4EEU A;  4WL9 A;  2GJ3 A;  3A0R A;  3E4O A;  3MXQ A;  2NUT C;  2DMW A;  4F3L A;  3T4O A;  3OOV A;  4NKP A;  2Z6C A;  3VE3 A;  2M1C A;  5IS1 A;  2K7S A;  3PBT A;  3PBS A;  4L9F A;  4NXG A;  2FZ0 A;  4UQI M;  5HWV A;  2JKT I;  4G3V A;  3E4Q A;  3F1P A;  4IUK A;  3D3O A;  3KO6 A;  4NXB A;  2BAS A;  4CLC A;  1NWZ A;  3MQO A;  5HSQ A;  2HF6 A;  1S4S A;  3A0S A;  3EOI A;  3LIE A;  4II7 A;  3BY8 A;  3BY9 A;  2OWH A;  2VZW A;  2JKT M;  3GEC A;  3KSF A;  4HJ3 A;  3BQA A;  3E0Y A;  1LT0 A;  2IA2 A;  1NLY A;  3NHQ A;  1T19 A;  2VGL S;  1S67 L;  4JGQ A;  5F69 A;  5HD3 A;  2L1M A;  3FPW A;  3LR3 A;  2ZMF A;  2Y8H A;  3B47 A;  4GJ4 A;  2QWS A;  1OJG A;  5TBM B;  4GHI A;  5AVE A;  1S1Z A;  3PXP A;  2Z6D A;  1STZ A;  3NOT C;  3ZQ5 A;  3K2N A;  5I5L A;  2VX8 A;  4B9O A;  2YKF A;  4LRX C;  3D72 A;  4UEY A;  3UB9 A;  4OOM A;  1V9Y A;  1TS7 A;  3LUQ A;  2OOL A;  1YSQ A;  4P6Z S;  4L9E A;  1XFN A;  4FOF A;  5DKK A;  3OBF A;  4R38 A;  4MN6 A;  5IU1 A;  2J80 A;  4HJ4 A;  3T4T A;  4HH2 A;  3EGX C;  3IS2 B;  4MMN A;  4Y2F A;  3OCN A;  3E4P A;  4QPR A;  5G4Y A;  4PAU A;  5HDS A;  4JGR A;  3LI8 A;  4PKY A;  3S7Q A;  4UQI S;  1IFQ A;  1P9W A;  4HHD A;  3UB8 A;  4CQH A;  1W63 M;  2HV1 A;  2ZMV A;  3TJZ C;  3MR0 A;  3PR6 A;  2EWV A;  2K31 A;  3BJN A;  1UGU A;  2W1T A;  4KUK A;  5TJJ A;  4EES A;  4R6L A;  5HPI A;  2V0W A;  2LB9 A;  2PT7 A;  2QYB A;  2H28 A;  3FPV A;  1ZHH B;  4YOF A;  4ME4 A;  4EEP A;  2M7U A;  3CAX A;  3CI6 A;  1DP9 A;  2KX6 A;  2XRN A;  5L8M A;  3H82 B;  1XJ2 A;  3OCL A;  2O9C A;  4R3A A;  2PD8 A;  3S7O A;  2Y79 A;  3KSH A;  1T1B A;  3VV4 A;  3LR5 A;  2L4R A;  4I3J A;  2EA9 A;  1D7E A;  3EEA A;  1OT6 A;  2LB5 A;  4I38 A;  1G28 A;  4Q0I A;  3R4K A;  1N9N A;  4HY8 A;  5F68 A;  4Q0J A;  4XT2 B;  3LIC A;  1LSV A;  4XT2 A;  1H3Q A;  5HL6 A;  5G4Z A;  4F3L B;  1GSW A;  2CMN A;  2NUP C;  2JKR I;  4CLC D;  3LFV A;  1NRJ A;  2HGV A;  3F1P B;  1X0O A;  3LIB A;  1D06 A;  3EEH A;  3C8C A;  3EGD C;  4CLC B;  2PDR A;  3F1N A;  2V0U A;  3F1N B;  3T4L A;  2HJ9 C;  2P08 A;  4E04 A;  5DKL A;  4BBU A;  1TS0 A;  4EUV A;  3FG8 A;  4G3K A;  3PBN A;  4RQ9 A;  3EWK A;  4CLC E;  2JKR M;  4PKY G;  4L9G A;  4HP9 A;  1LSX A;  3HJI A;  3BQ8 A;  3FC7 A;  2J3T C;  5DFY A;  1VB6 A;  3C2W A;  1V9Z A;  2B18 A;  1T18 A;  4FSF A;  1N9L A;  3P7N A;  4YNR A;  2XA7 M;  2A24 A;  3CIT A;  2MJ6 A;  3KYZ A;  5J3W A;  1DP6 A;  3HJK A;  5F6A A;  5HDD A;  4GHI B;  5DJT A;  4Y3I A;  3H7W A;  3O5Y A;  3OC2 A;  1GSV A;  1VHM A;  2VLG A;  3CWF A;  4I3A A;  2HJE A;  2R78 A;  4O0P A;  2INW A;  4I39 A;  1OTD A;  4I5S A;  4AFI A;  2PHY A;  2ZOH A;  2VKS A;  3RH8 B;  4HIA A;  3UE6 A;  4IJG A;  3TW8 A;  2XRO A;  3ICY A;  4HJ6 A;  4ETX A;  5K5B A;  3UMD A;  4BMW A;  1UWN X;  3UB6 A;  1YKD A;  1XJ3 A;  2KLI A;  2QHK A;  4MN5 A;  1LL8 A;  2K2N A;  2L0W A;  5DFX A;  1DRM A;  5HWT A;  4ETZ A;  4MDZ A;  4R70 A;  2VEA A;  2D02 A;  4GW9 A;  3F1O B;  3F1O A;  2OAP 1;  4EER A;  1YAX A;  4HH3 A;  2V9A A;  2J3T D;  1JNU A;  3SW1 A;  4LPZ A;  4DJ2 A;  4WF0 A;  2PD7 A;  2VJW A;  1T1C A;  4I3I A;  1XFQ A;  5FL3 A;  1LSW A;  1OT9 A;  3LR0 A;  2JN7 A;  3TRC A;  3BWL A;  2W1T B;  5CX7 A;  1UWP X;  4K08 A;  5C5K A;  2G7U A;  4LRY C;  1XJ6 A;  1YSP A;  2OAQ 1;  3KYQ A;  3T4S A;  1OJ5 A;  4KUO A;  3E98 A;  2QJ7 A;  3VE4 A;  3S7N A;  2W0N A;  5HDC A;  2VGL M;  2ZBB A;  3H9W A;  4GS9 A;  2W3G A;  2PR6 A;  2XA7 S;  3P01 A;  3R7W B;  3R7W A;  2WKQ A;  3LR4 A;  3HCY A;  3EQV A;  1XJ4 A;  3KX0 X;  3JVV A;  1OPX A;  4G3W A;  4PHT A;  4YWZ A;  4HQA A;  2VV8 A;  3T4Q A;  3JVU A;  3LID A;  4Q0H A;  3PHY A;  1TF1 A;  4LRZ E;  2M7V A;  5J4E A;  2B02 A;  4IHQ A;  3MF0 A;  1T1A A;  3VOL A;  1WA9 A;  4H6J A;  4H6J B;  1S1Y A;  4P6Z M;  5HD5 A;  3LI9 A;  2W3F A;  2QKP A;  1P0Z A;  4WN5 A;  2O99 A;  4JGP A;  1F9I A;  4L0L A;  1S4R A;  5EFW A;  5J7E A;  3NJA A;  4KQO A;  1N9O A;  4HOI A;  2VA0 A;  5F5Y A;  1EW0 A;  2KDK A;  4LLO B;  2WKR A;  3CLO A;  5AJG A;  1IOU A;  3T4J A;  3PBR A;  4GLQ A;  1F98 A;  2P04 A;  2V1A A;  4WEJ A;  2W27 A;  4WEL A;  1OTB A;  1Y28 A;  5A8B A;  2A24 B;  1MC0 A;  4NXF A;  2A2L A;  4EXO A;  3EQU A;  3LIF A;  5KSH A;  2FH5 A;  3H7W B;  2YKH A;  2XSS A;  3GDI A;  1DP8 A;  3OLO A;  1W63 Q;  3W2Z A;  4EQ1 A;  1NLZ A;  3DBA A;  2W1R A;  2OWJ A;  4MN7 A;  3V67 A;  4BBT A;  2PYR A;  1ZTU A;  1OTI A;  4EET B;  4EU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...