1OTAA

E46q mutant of photoactive yellow protein, p63 at 295k
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otaA00
5F5YA 3VE4A 2VV8A 4GCZA 3LI8A 3PYPA 5AVEA 4F3LB 1GSXA 1G28A 4XT2B 3F1OA 4JGRA 5DKKA 2PR5A 1TS6A 1TS0A 1V9YA 2YKHA 3LIDA 4L9FA 2VV6A 1XJ4A 3ICYA 4LRXC 1X0OA 2OOLA 5DKLA 4F3LA 3VOLA 2OWJA 1XFQA 1XJ3A 1T1AA 3F1PB 3MR0A 1LSWA 4BBTA 2PD8A 1DRMA 4GHIA 2GJ3A 4K08A 4MN6A 3C2WA 3IBRA 3A0VA 3IS2B 1DP9A 4I3JA 2VLGA 3LICA 4I3IA 5J3WA 4KUKA 3UMDA 5F6AA 2P7JA 2V0UA 2KX6A 2D02A 3ULFA 2JHEA 5HDDA 3F1OB 4GW9A 5IU1A 5HSQA 4YWZA 4HH3A 4R3AA 1KOUA 1S4SA 4DJ2A 5HDSA 4HNBA 3EWKA 3P7NA 3HJIA 2L4RA 2Z6DA 4KUOA 4EEPA 1DP6A 3F1NB 5EFWA 5HDCA 1LT0A 5DJUA 3UMEA 2D01A 3LYXA 3ZQ5A 3C8CA 4LRYC 1TS7A 5IS1A 1P97A 2A24B 2BASA 4HP4A 4HY8A 4GS9A 3SW1A 3HJKA 2PYRA 5TBMB 3FC7A 1OTAA 1S1ZA 2ZOHA 4BBVA 3KX0X 3LIFA 4L9EA 2QJ5A 3CAXA 5I5LA 4BBUA 2J80A 4HJ6A 4I5SA 1XJ2A 1F9IA 4EETB 3A0RA 4B9OA 3NHQA 4GS9B 2KDKA 4JGPA 3H82A 2V9AA 2EA9A 2PD7A 4I3AA 4R6LA 2HV1A 5G4YA 4NXEA 2PYPA 2QWSA 4I38A 4HIAA 2WKRA 3MQOA 5DJTA 2K7SA 1NWZA 2V1BA 3F1NA 3GDIA 4L9GA 4RQ9A 1T1CA 2W27A 3EEHA 3FG8A 2B02A 4HQAA 5F69A 3UE6A 1OTIA 3LIAA 3NOUC 1S66L 4EEUA 3MQQA 3BY9A 3F1PA 3NOPC 2L0WA 3D72A 1XJ6A 1T18A 4KQDA 4E04A 4DJ3A 3LUQA 4HI4A 2VEAA 2PDRA 4WF0A 1OJ5A 5HWWA 4XT2A 1WA9A 2ZOIA 3UB9A 5HD5A 1T19A 1MZUA 1VB6A 5J4EA 5G4ZA 1UGUA 2W0NA 4GHIB 4JGOA 2QJ7A 3B33A 3A0SA 3K3CA 4HHDA 1Y28A 4HJ3A 4LRZE 2PR6A 1GSWA 4M4XA 4NXFA 4EQ1A 1D7EA 4I39A 5HWVA 4LLOB 1P0ZA 1N9LA 1LSXA 1ODVA 1S1YA 2INWA 2VV7A 1XFNA 3LIBA 4H6JB 5HD3A 5A8BA 2H28A 5J7EA 1V9ZA 1N9OA 1OJGA 3CWFA 3PHYA 4JGQA 3T50A 3MFXA 3LI9A 3H9WA 4WLAA 4WUJA 3LIEA 3UB8A 2YKFA 5HZHA 4NXBA 1JNUA 3E4QA 2JN7A 4R38A 2QHKA 2WKQA 5AVFA 2PHYA 1GSVA 1OT9A 3H7WB 4EESA 3BY8A 3NOTC 1LL8A 3VE3A 1UWNX 3K3DA 3UB6A 1OT6A 4NXGA 1LSVA 2ZBBA 3H82B 2V1AA 4EXOA 3H7WA 3RH8B 1F98A 2I9VA 2OWHA 3UB7A 4MN5A 2V0WA 2M1CA 3E4OA 3GECA 3MXQA 4EW7A 5KIZA 3BWLA 2L1MA 5F68A 1S4RA 5HWTA 3RTYA 3NJAA 4WN5A 4R70A 2WKPA 1OTEA 5TBMA 1EW0A 1OTDA 2QKPA 2A24A 2R78A 3CLOA 3OLOA 4HJ4A 2Z6CA 1UWPX 4PKYG 1N9NA 1OTBA 1DP8A 1T1BA 4H6JA 4HH2A 1BYWA 4WL9A 2CMNA 1TS8A 4HOIA 4LPZA 3G6OA 4PKYA 1D06A 3MJQA 3IS2A 4EERA 1S67L 3E4PA 4HP9A
chains in the Genus database with same CATH superfamily
3R7WB 1IKIA 3PYPA 4BMWA 3HUNA 2JBFA 4MEZA 4EUZA 1ESIA 4KZBA 4DE0A 3IHBA 3IS2B 3UE0A 4GW9A 3N4IA 1K55A 1DY6A 5L2FA 3ITBA 1HTZA 3QP2A 4HP4A 2WAEA 1ES4A 2HJ9C 2ZC4B 4I5SA 4R6LA 3T1QB 1IYQA 1NWZA 1CEFA 1PI5A 3FKWA 4UQIS 5GHZA 3D72A 3V67A 4HI4A 2PDRA 4HESA 2PBYA 3C30A 1O07A 3A0SA 1Y28A 1KDWA 4GD8A 2WZZA 4X68A 1LL5A 3CI6A 4JGQA 4IUKA 3FZCA 3IXGA 1RGYA 5E2EA 1MKIA 2EX2A 2QZ6A 1OMEA 5FQQA 1SKFA 1JWVA 5GL9A 1EW0A 4UA6A 2A24A 4OOLA 4QY6A 3HLWA 4WL9A 1D06A 4Y15A 3NBLA 5CGWA 2VV8A 3LY3A 3O88A 1GSXA 4JGRA 5E2HA 1XJ3A 1YLYA 3MR0A 3FYZA 1BSGA 4Y0OA 1P9RA 2NUTC 3LICA 4GNUA 5CERA 2JHEA 3G34A 1ERMA 5HDSA 1XPBA 3EWKA 4KUOA 2FFYA 4EEPA 5M18A 3LR4A 1ZC2A 2BG1A 4UEYA 4LRYC 4Y3IA 5DTKA 4KZ9A 2WAFA 4LGWA 4B9OA 4O0PA 3N6IA 5HL1A 5KMWA 4I38A 2WKRA 5HARA 3GDIA 3C4OA 2A2LA 4EEUA 1ACFA 1XXMA 3NY4A 5CECA 3ZFZA 2EX6A 2EWVA 3TJZC 1UGUA 4PM5A 4ZRRA 2R9XA 3WRTA 4HJ3A 4WMCD 3UB5P 4MDZA 4S2MA 3PXPA 3EEAA 4PM9A 2HPBA 2W3GA 2PU2A 5KSCA 2HZ5A 5EOOA 4IHQA 5EVIC 1JTGA 1CI9A 4EESA 3VE3A 1LL8A 3IWOA 5FEGA 4JKTA 1FCOA 5CHJA 4OQ0A 3IQAA 3NJAA 3IH9A 4OPRA 4S2NC 4OVDA 2EFUA 1OTBA 3ZVTA 1SDEA 4GCZA 3I7JA 2Q9MA 4L9FA 4UQIM 1YLTA 1FOFA 1DRMA 4MN6A 1NYYA 3T4TA 4HBUA 5FQIA 3QP6A 2V0UA 1F2KA 2W3FA 4UA9A 3QNBA 2Q9NA 3IXDA 4ESPA 2ACGA 2HP5A 1H8ZA 4K0XA 1TS7A 3BFGA 3CITA 2J8YA 5DF8A 3MZDA 3PBSA 4E3JA 2KDKA 4OPYA 5DTTA 2PD7A 4R23A 3WS0A 4IVIA 4P87A 4X69A 1SCWA 2ZL1A 3Q07A 3WRZA 1P9WA 3TE8A 4GZBA 4RA7A 3JPUA 3UN7A 3BFDA 2WGVA 5I94A 3V3SA 4IEDA 3DTIA 1MWTA 4Q0HA 3NOTC 4JXGA 5AQ9A 4HBTA 3PTEA 4KQQA 4GJ4A 5GHYA 2OV5A 4HJ4A 1K57A 3MXRA 5HX9A 2IA2A 2J9OA 3MJQA 4Q8IA 3E4PA 5F69A 4HP9A 1ES3A 4CLCA 2Y2PA 4X55A 1O7EA 3M2KA 1K6SA 1CI8A 4R4SA 2B95A 2O9AA 4LRXC 3JVVA 1X0OA 4ARZB 1K4FA 2Y2JA 3A0VA 5G18A 2Z2MB 3DAVA 3HL9A 4X1MA 5GLCA 5HSQA 2V8CA 1ZG4A 3G31A 4R0QA 3BLSA 5MC7A 1IOUA 4CJNA 3N8LA 3ZGAB 4BLMA 1TEMA 1K55C 3DWKA 2Y8HA 4UA7A 1G6OA 2DCFA 1W5DA 4HJ6A 4EETB 3A0RA 4Z1WA 2PBDP 5E2GA 2EA9A 3S22A 2G7UA 4FTXA 3MQOA 3SZTA 4CQHA 3TOIA 1EI5A 1LHYA 1VM1A 3NOPC 3A3EA 5DF9A 1WYBA 4GLQA 5HD5A 5G4ZA 4JGOA 4Y17A 3WS1A 4NXFA 3N7WA 1AXBA 3B47A 1N9OA 3PHYA 2Y55A 1Z6FA 4KZ3A 2M7VA 2VKSA 4LV2A 4IVKA 5L10A 2WZXA 1OT9A 1UWNX 2AVXA 3GTCA 5FATA 1TDLA 4KZ6A 3ZDJA 4BJPA 4EUVA 3ZNYA 4DKIA 3ZYTA 2R78A 3IWQA 2K31A 1N9NA 3U4LP 2Y79A 5IT5A 3MFDA 2ZMAA 1F5MA 1K56A 4WM9A 5HAPA 1BLSA 4OPQA 2OLVA 3KYZA 4XT2B 5DKKA 1XGJA 3F1PB 3N8RA 2GJ3A 2HDSA 5CXWA 3UDXA 4MBFA 3F1OB 4ZTKA 2O9BA 5EUAA 2WKIA 1FR1A 3M6HA 4KG5A 4GOGA 3LIFA 1G6AA 3C38A 3MXSA 3QNCA 4BD0A 1Y4OA 2P9VA 2Q0OA 3LY4A 1LI0A 1GCEA 4EBLA 2QWSA 4JLFA 2V1BA 3HVFA 5KSHA 3A3DA 1BUEA 1A0KA 5FASA 1Z09A 2ZL1B 4RVAA 5AQAA 4B4ZA 2IWDA 1PIOA 1KVLA 4XT2A 3S4XA 1W63M 5J4EA 3B33A 5FA7A 1I2WA 4LRZE 5A93A 1L3LA 5HWVA 1LSXA 1ODVA 3QP8A 4R3JA 1ONHA 1TDGA 4DE3A 2QHKA 2XRNA 3VP3A 3O86A 2V20A 2EXAA 2ZBBA 3CPTA 3HLEA 5EVIA 2WYXA 4MN5A 3IF6C 5EVIB 2ZM8A 3PAEA 4OP5A 2ZD8A 5TR7A 4MN7A 4KZAA 4G3VA 4EBPA 3S7NA 3IS2A 2GNXA 2J9PA 5L8MA 3MZEA 4U3TA 3MZFA 1YMSA 1M40A 5F1FA 4DN0A 1PWCA 2ZQCA 3Q7ZA 4I3JA 1PW8A 3UE3A 1I5QA 4L0LA 3G30A 3HLBA 2MJ6A 3DBAA 3PBNA 3QP1A 4IBXA 3GQZA 4LCLA 4MNRA 1MC0A 3O87A 3HJKA 4ZAMA 2J80A 4B4XA 5L09A 4JGPA 3H82A 4RX3A 5L07A 2VZWA 1SDNA 3C4PA 4XUXA 1K4EA 3EEHA 3HLCA 4GKUA 2W1TB 3IXBA 1T18A 1PW1A 3B3XA 3G4PA 3RXWA 1K38A 3CJMA 3EQVA 4DXBA 3SOIA 5CTNA 1MKMA 3K3CA 1XGIA 5A8BA 4OOMA 2H28A 3BW6A 3UB8A 3LEZA 5AVFA 3H7WB 3G32A 3UB6A 2VK3A 3H7WA 1RGZA 5D3OA 1CF0A 3OZHA 4Y7PA 3E4OA 4Y2FA 4IBRA 4B88A 3FWLA 1J9MA 5AQBA 2BTFP 3DW0A 4DRTA 4LFUA 1K54A 3C5AA 1MWUA 5U47A 1YLZA 4Q0IA 4BL3A 4FH4A 1PWGA 3BFFA 3N8SA 1JVJA 1K57C 5EFWA 3T4QA 3FPVA 2VV6A 1XJ4A 3SS5A 3VOLA 5TFQA 4QU3A 3KSHA 5GLBA 2OLUA 4ZJ3A 2XDMA 3IF5A 4Y0UA 5AJGA 4E6XA 2XA7S 1W63Q 3UNWA 3ULFA 1ERQA 4N92A 4A5RA 1YLPA 1BTLA 1KOUA 2VGLS 4HNBA 1K6RA 3AGDA 3F1NB 4H8RA 4EU0A 1L2SA 1YMXA 3IT9A 5DFYA 1P97A 4WYYA 4L9EA 1U60A 4BBUA 3Q81A 3NDGA 5G4YA 3UE1A 4PHTA 4G3KA 1K0KA 2K7SA 4R1GA 2IWCA 3RJUA 2WK0A 1ZTUA 1GHMA 1MXOA 2VEAA 1MWSA 2Y2GA 4JF4A 1VB6A 5GLAA 1JWZA 2QJ7A 3ZG7B 4M4XA 1L0GA 1ES5A 2WUQA 2HDQA 5HD3A 1YLJA 3T50A 2ZC6B 1NLZA 4DE2A 5EOEA 5EV0A 4PMAA 1BZAA 2O99A 3FPWA 3VSKA 5F82A 2P04A 5FDHA 3K3DA 1PZOA 3T1XA 3ZNTA 4KZ4A 3TRCA 3MXQA 2L1MA 5CGSA 1S4RA 5TBMA 3ITAA 3NECA 2JKFA 4FCFA 3KSFA 1KVMA 3EGDC 3L7HA 3ZG0A 4C75A 5J8XA 4NG2A 2WGWA 5DKLA 4C3QA 1LSWA 3S7OA 3HBRA 5KIZA 2HF6A 2VLGA 4WMCA 5F6AA 3R4KA 1KGGA 2ZQAA 3SH7A 4YOFA 2Z2LB 1NZUA 3W2ZA 1FQGA 3C8CA 2C6WB 5TBMB 1YM1A 4S2IA 3D9YA 3BQAA 3E98A 5FDSA 5FQJA 5FQ9A 1YSPA 2B18A 4NXEA 1CJFA 4QB8A 4G3WA 1C3BA 2PRFA 4K0WA 4MBHA 1VQQA 3IX8A 1FSYA 5TGFA 4BQMA 3JVUA 3LUQA 1VHMA 2ZQDA 4YFMA 1PNEA 2ZOIA 4X25A 4OP8A 4JF5A 3ZVWA 4WEJA 2HGVA 1FIKA 1DJCA 3V50A 3LR0A 1FCMA 1IYPA 3GVBA 1PYYA 4CPKA 1OJGA 1VEUB 3MFXA 4S2LA 1BT5A 2LB9A 3ZG8B 1LSVA 2JKTM 3H82B 1HZOA 3T4LA 4OH0A 1CEGA 4N1XA 3HUOA 2XLNA 2XSSA 2PAVP 4PKYG 4HH2A 3IF6A 1BYWA 1IYOA 5BOHA 4PKYA 4KQRA 3GRJA 2WGWB 3O3VA 4ZJ2A 3A3IA 4I3IA 3EOIA 3KO6A 3VOZA 2WADA 2R9WA 2JKTI 3LGOA 3UPPA 4DJ2A 4WZ4A 2E8IA 1YPRA 2JCHA 1I2SA 1YKDA 4KQOA 4UAAA 1RCJA 3HLDA 3OPRA 3NDEA 5CEDA 1LI9A 3T4SA 2J7VA 3TG9A 2W3HA 4GS9B 4PM7A 5C5KA 1KDSA 5FI2A 1HD8A 1MBLA 1J3WA 5DFXA 3UE6A 1H0MA 4BD1A 3LR3A 4ARZA 4LCMA 5A90A 3BQ8A 3MKFA 3TW8A 1OJ5A 5HWWA 1T19A 4BENA 4QWOA 4M3KA 4HHDA 3Q82A 3MBZA 2PR6A 3HCYA 4I39A 3VP4A 2INWA 1XFNA 3LR5A 1YSQA 3D4FA 2XH9A 3PBQA 5FL3A 4OQIA 1IELA 5E43A 3UO9A 5CRFA 2XFSA 4E3IA 1FILA 3PR6A 3UB7A 5FAOA 2M1CA 1DJBA 2ZQ7A 3OLOA 3CLOA 1DP8A 4EQIA 2Z6DA 5IHVA 1K54C 1LL9A 4F3LB 1YAXA 3F1OA 4P6ZM 4ZBEA 3WS4A 1SZVA 2J3WA 2H0TA 5EECA 4F3LA 3VFHA 4AFIA 2JKRM 2V1ZA 3T1RA 2VA0A 5HDDA 4K91A 2ZQ8A 2OAQ1 3V5MA 1NY0A 1PRQA 4FUWA 4OQHA 5HL6A 3ZQ5A 1FR6A 4N9LA 3SH8A 2XD1A 3LCEA 1W79A 3SS4A 2VGLM 4S2KA 1S1ZA 1EROA 4BBVA 3W4PA 1KE0A 1XX2A 3G35A 2Y2HA 2UWXA 2W27A 3O5YA 2GDNA 3KSIA 1ALQA 2JE5A 3IH8A 3MQQA 2XR0A 3VFFA 3UB9A 2XK1A 4Q0JA 4WELA 1NYMA 1IFQA 3IF6B 1N9LA 2Y2MA 4H6JB 4OOYA 4LV1A 4D2OA 5GHXA 3LI9A 2YKFA 4NXBA 1JNUA 1KGFA 3E4QA 1GSVA 4UHUA 3CUEC 4KZ7A 1H5XA 2ZLYA 2V0WA 3GECA 4EWFA 4P6BA 3G2ZA 3OCLA 3GV9A 4DDSA 4H6JA 4DMZA 2EX8A 2J3TD 4PPRA 2QYBA 3LEQA 1PZPA 3NCKA 2HDUA 1WE4A 1S0WA 2OOLA 2DRWA 2WGIA 1HLUP 1T1AA 3R7WA 4BBTA 4GHIA 3AGFA 3BFCA 2Y2QA 1G5UA 4YINA 2X01A 3Q7VA 1KGEA 3T1SA 4JXSA 1S6RA 5LBRA 3UPNA 1ZKJA 3P7NA 3S7QA 3W8KA 1BULA 4U0XA 1BLCA 2Y2KA 5HDCA 4JF6A 1LT0A 1VETB 3LO7A 4QD4A 4Y13A 1OTAA 1F9IA 4WZ5C 5FEFA 2GZAA 5CHUA 1LLBA 1VETA 2Y2LA 1BLHA 2XGNA 3S1YA 3UY6A 2ZM2A 3FG8A 5FI7A 1S66L 3CMZA 2I72A 4KQDA 4CLCE 2PU4A 3OBFA 4EBNA 1N9BA 3PAGA 3UPOA 4EQ1A 4S2PA 5FAPA 2WKEA 5J7EA 2FH5A 1V9ZA 3CWFA 2W1TA 4NK3A 2Y2NA 4E3KA 3NI9A 3NC8A 1W8QA 4EXOA 1F98A 2M7UA 2I9VA 2G2UA 5HWTA 3RTYA 5CTMA 2QKPA 3DTEA 3IX4A 2ZQ9A 3GR2A 4OKPA 3QP4A 4X1LA 1E4DA 1TS8A 4LPZA 3Q7VB 3E2KA 3BM6A 3NULA 4X53A 5F5YA 1JWPA 3VE4A 3LI8A 3VP1A 1TS6A 3A3FA 3U2AA 3LIDA 3ICYA 4Y5FA 4FD8A 3UDFA 2HP9A 2ZC7A 3C2WA 5EVID 3G2YA 2OAP1 4O7DA 1ES2A 2H0YA 2Y2IA 3DWZA 2LB5A 5EVEA 5IU1A 1L0FA 1CQAA 5M19A 4DXCA 2PT7A 3PBTA 3HJIA 3IHAA 1IYSA 2WKHA 2ZC3B 4OLGA 5A91A 1SHVA 3KX0X 1Q2PA 3CG5A 3WWXA 3CAXA 4N9KA 3IWIA 4IUHA 2H5SA 4R70A 1W8YA 2HV1A 2XFTA 2DMWA 4DDYA 3IX3A 4HIAA 2VJWA 4HQAA 3RXXA 4HEFA 2BLSA 5HFOA 4OLDA 2V8FA 5KZHA 2KOIA 3VP0A 3NIAA 4X6TA 3T12B 4X56A 3HUMA 4KZ5A 2DNSA 1QMFA 2P9VB 3H9WA 4WLAA 1L0EA 3LIEA 5HZHA 3E0YA 1BLPA 5DF7A 4XUZA 5DVAA 3QHYA 4KENB 2W3EA 1OT6A 5CGXA 4QPRA 1NZOA 1FCNA 3B42A 4WN5A 3EGXC 1OTEA 4JBFA 3VOYA 2ZMVA 2FZ0A 1T1BA 1KE3A 4FSFA 2CMNA 4CLCD 1PI4A 3MS6A 1G68A 2JKRI 1TS0A 4ZJ1A 2X02A 1TD5A 4R4RA 3IBRA 3IXHA 3SS3A 2P7JA 3HLGA 2KX6A 3LFVA 1YLWA 2D02A 3OPLA 1DJAA 1DP6A 4ETXA 4U0TA 5DJUA 1NLYA 5IS1A 3SW1A 3OCNA 5CEBA 2QJ5A 4NETA 4GDNA 5HW3A 4WEKA 3NHQA 3BLMA 4I3AA 5DJTA 3P98A 5CHMA 5JYOA 4BWIA 1K56D 2B02A 2O9CA 4S2JA 3BY9A 2L0WA 1M6KA 4GN2A 2P08A 3HREA 1MWRA 1HVBA 2NUPC 2W0NA 3DTKA 4GHIB 2XA7M 4LLOB 1S1YA 4WUJA 3L9KA 3ZG5A 4P85A 4E3NA 4PM6A 4Z9QA 3V39A 3BY8A 3Q1FA 2XEPA 4QJGA 3W4QA 1JTDA 4MBKA 3C7VA 4GB7A 4FOFA 3BWLA 1IKGA 3CUEA 1OTDA 2EXBA 3C7UA 2Z6CA 1UWPX 4EV4A 3W4OA 3G6OA 3CZDA 4NEED 3HLFA 1V9YA 2VX8A 2YKHA 3DTMA 5E2FA 5K5BA 3OPPA 4OPZA 4LENA 3UMDA 4OONA 1KE4A 3OPHA 3QP5A 2X71A 3BRMA 4YWZA 1YQSA 1SKOB 4B93A 1MY8A 3T4JA 5F1GA 5EE8A 3UMEA 3LYXA 2BASA 3IBJA 1FSWA 2PYRA 5HPIA 2K2NA 4MLLA 5I5LA 4JXWA 1H8MA 2V9AA 4PM8A 3F1NA 1D1JA 3BJNA 1Y54A 4WZ5A 1OTIA 3LIAA 5HAQA 1XJ6A 2XF3A 4WF0A 1XA7A 3GSGA 2RL3A 1MZUA 5FI6A 5HPFA 3LIBA 3EQUA 4O01A 4PAUA 2Y2OA 5HAIA 5GLDA 5FQMA 1YT4A 3OOVA 1NRJA 2HJEA 5FQKA 2EWWA 2PHYA 3ZCZA 1XKZA 2XROA 3BECA 3KYEA 3PBOA 4NXGA 4E3LA 3RH8B 4GDBA 2OWHA 3VP2A 4BL2A 4EW7A 1ZHHB 5FAQA 2WKPA 4QHCA 2Y91A 3MF0A 1E3UD 4HOIA 3PBRA 1NXYA 1CK3A 2J3TC 1S67L 4OQGA 2RCXA 3AGEA 1G28A 1MPLA 1H3QA 3WS2A 2OWJA 1XFQA 3KYQA 4E3OA 4GD6A 4K08A 5J3WA 3ZHHA 1DP9A 1TVFA 3MMHA 5M1AA 4KG6A 3RFBA 2W1RA 3D3OA 4HH3A 1S4SA 3MQ0A 4QY5A 2JKGA 2KLIA 2HDRA 2B5RA 2QMIA 2Y4AA 3E2LA 2D01A 3M2JA 3FV7A 4HY8A 4GS9A 4ETZA 2ZOHA 2UV0E 1SKOA 1GHIA 3KSGA 4JXVA 1WYCA 5EM0A 4L9GA 2V2FF 2W3DA 1T1CA 3NOUC 5F83A 2XD5A 3P01A 1PWDA 3ZG9B 3FKVA 1GA9A 3JYIA 2FFFB 1GSWA 1D7EA 1E3UA 2VV7A 4XXRA 4FH2A 1GHPA 3S7PA 2O0YA 2XQZA 2JN7A 3BYDA 3P09A 4P0MA 4R38A 3VSLA 1W7FA 3CPTB 1STZA 4S2NA 3BEBA 1XP4A 3A3JA 4E3MA 2ZM0A 4KG2A 1L0DA 5F68A 1GA0A 2QPNA 4O8GA 4ZDXA 1TF1A 4MMNA 5EM1A 2H10A 5AQ7A 4EERA 3UDIA 1VEUA 5AVEA 1RP5A 5FSRA 2PR5A 3MKEA 2ZJ9A 2P74A 3MSHA 2PD8A 4CLCB 1EWZA 4KUKA 3SH9A 3ISGA 3VMAA 4N1HA 4R3AA 2Y59A 1ZG6A 2L4RA 2CC1A 4RYEA 3M6BA 5CX7A 3WS5A 5DTSA 4DF6A 4Y0TA 2VGKA 2A24B 2E8JA 3FC7A 2C5WB 4LV0A 1H8YA 2A49A 2OSUA 1XJ2A 3V3RA 4C6YA 3T4OA 4F94A 2PYPA 4MCWA 1AWIA 4RQ9A 1XA1A 1ESUA 3F1PA 1NJ4A 1NRFA 1PFLA 5EPHA 2A3UA 4E04A 4DJ3A 4DE1A 4KZ8A 1OPXA 1WA9A 4WBGA 5A92A 4ME4A 4ID4A 2VGJA 3GMWA 1E25A 1P0ZA 4RX2A 4P6ZS 4JPMA 1K25A 5JYPA 3BFEA 4IJGA 2IWBA 1IEMA 2G2WA 2EFXA 4E6WA 1Q2QA 2ZMFA 4II7A 2WKQA 2ZC5B 4YNRA 4NKPA 2V1AA 2HP6A 4LV3A 4D60A 3K2NA 3CHWP 5TJJA 4S2OA 3TSGA 2JC7A 5EVLA 4CLCC 3T4KA 1ONGA 1QMEA 2GX5A 3OC2A 4R3BA 2EX9A 3VV4A 1N4OA
chains in the Genus database with same CATH topology
3R7WB 3PYPA 3KYZA 4XT2B 4BMWA 5DKKA 1TS0A 3F1PB 1TD5A 2GJ3A 4I3IA 3IBRA 3IS2B 3EOIA 3KO6A 2P7JA 2KX6A 3LFVA 2D02A 3F1OB 4GW9A 2JKTI 4DJ2A 1YKDA 2O9BA 4KQOA 1DP6A 4ETXA 5DJUA 1NLYA 5IS1A 3SW1A 4HP4A 3OCNA 3LIFA 2HJ9C 2QJ5A 3C38A 3T4SA 4I5SA 4WEKA 2W3HA 3NHQA 4GS9B 4R6LA 4I3AA 5C5KA 2QWSA 5DJTA 1NWZA 2V1BA 4BWIA 4UQIS 5DFXA 5KSHA 3UE6A 2B02A 2O9CA 3BY9A 2L0WA 3D72A 3LR3A 4ARZA 3V67A 2P08A 4HI4A 3BQ8A 2PDRA 3TW8A 1OJ5A 5HWWA 4XT2A 1T19A 1F5MA 3C30A 1W63M 2NUPC 5J4EA 2W0NA 4GHIB 3B33A 3A0SA 4HHDA 1Y28A 4LRZE 2PR6A 2XA7M 3HCYA 4I39A 5HWVA 4LLOB 1LSXA 1ODVA 1S1YA 2INWA 1XFNA 3CI6A 3LR5A 4JGQA 4IUKA 1YSQA 4WUJA 3PBQA 5FL3A 2QHKA 2XRNA 3BY8A 2ZBBA 3PR6A 3UB7A 4MN5A 2M1CA 4FOFA 3BWLA 3CUEA 1EW0A 1OTDA 2A24A 3OLOA 3CLOA 4OOLA 2Z6CA 1UWPX 4MN7A 1DP8A 4G3VA 4WL9A 3S7NA 3G6OA 1D06A 3IS2A 2Z6DA 2GNXA 2VV8A 4NEED 5L8MA 4F3LB 1GSXA 1YAXA 3F1OA 4JGRA 4P6ZM 2J3WA 1V9YA 2VX8A 2YKHA 5K5BA 4F3LA 1XJ3A 4DN0A 3MR0A 4AFIA 4I3JA 1P9RA 2JKRM 2NUTC 3LICA 3UMDA 2VA0A 3UE3A 2JHEA 5HDDA 2OAQ1 4YWZA 5HDSA 4L0LA 3EWKA 4KUOA 4B93A 4EEPA 2MJ6A 3DBAA 3PBNA 3LR4A 3T4JA 4UEYA 5HL6A 3UMEA 3LYXA 3ZQ5A 4LRYC 1MC0A 2BASA 3IBJA 2VGLM 4Y3IA 3HJKA 2PYRA 5HPIA 1S1ZA 4BBVA 2K2NA 5I5LA 2J80A 4B9OA 4O0PA 4JGPA 1H8MA 3H82A 2V9AA 2VZWA 4I38A 2WKRA 3F1NA 3GDIA 3BJNA 2A2LA 2W27A 3EEHA 3O5YA 3KSIA 1OTIA 3LIAA 4EEUA 3MQQA 2W1TB 1XJ6A 1T18A 4WF0A 3UB9A 3EQVA 4Q0JA 1MZUA 2EWVA 3TJZC 1UGUA 1MKMA 4ZRRA 4WELA 3K3CA 4HJ3A 5HPFA 1IFQA 4MDZA 3PXPA 3EEAA 1N9LA 5A8BA 4H6JB 3LIBA 3EQUA 4OOMA 2H28A 4O01A 2W3GA 4PAUA 3BW6A 3LI9A 3UB8A 4IHQA 2YKFA 3OOVA 1JNUA 1NRJA 3E4QA 4NXBA 2HJEA 5AVFA 2EWWA 2PHYA 1GSVA 3H7WB 4EESA 2XROA 3VE3A 1LL8A 3CUEC 3UB6A 4NXGA 3PBOA 3H7WA 3RH8B 2OWHA 2V0WA 3E4OA 3GECA 4EW7A 4Y2FA 1ZHHB 3NJAA 2WKPA 3OCLA 3MF0A 4H6JA 1OTBA 4DMZA 4HOIA 3PBRA 4Q0IA 2J3TD 2J3TC 1S67L 2QYBA 4GCZA 1G28A 4L9FA 5EFWA 1H3QA 3FPVA 3T4QA 2VV6A 1XJ4A 4UQIM 2OOLA 3VOLA 2OWJA 1XFQA 1T1AA 3KSHA 3R7WA 3KYQA 4BBTA 1DRMA 4GHIA 4K08A 4MN6A 3T4TA 5J3WA 1DP9A 5AJGA 2XA7S 1W63Q 2V0UA 3MMHA 5LBRA 3ULFA 3RFBA 2W3FA 2W1RA 3D3OA 4HH3A 1KOUA 1S4SA 3MQ0A 2VGLS 4HNBA 3P7NA 3S7QA 2KLIA 3F1NB 5HDCA 4EU0A 1LT0A 2D01A 1TS7A 5DFYA 1P97A 4HY8A 3CITA 4GS9A 1OTAA 4ETZA 2ZOHA 4L9EA 4BBUA 1F9IA 3KSGA 3PBSA 2KDKA 2GZAA 5G4YA 2PD7A 4PHTA 4G3KA 2K7SA 4L9GA 2W3DA 1T1CA 3FG8A 1ZTUA 3NOUC 1S66L 4KQDA 3P01A 4CLCE 3OBFA 2VEAA 1VB6A 2QJ7A 1P9WA 4EQ1A 4M4XA 1GSWA 3TE8A 1D7EA 2VV7A 5HD3A 5J7EA 2FH5A 1V9ZA 3CWFA 2W1TA 3T50A 1NLZA 3S7PA 2O0YA 2O99A 2JN7A 3FPWA 4R38A 4Q0HA 3NOTC 2P04A 3K3DA 1STZA 4EXOA 1F98A 2M7UA 2I9VA 3TRCA 3MXQA 2L1MA 4GJ4A 1S4RA 5F68A 5HWTA 3RTYA 5TBMA 2QKPA 4HJ4A 3KSFA 4O8GA 3EGDC 1TS8A 1TF1A 2IA2A 4LPZA 4MMNA 3MJQA 4EERA 3E4PA 5F69A 4HP9A 5F5YA 4CLCA 3VE4A 3LI8A 5AVEA 2PR5A 1TS6A 3U2AA 2O9AA 3LIDA 4LRXC 5DKLA 3ICYA 3JVVA 4Y5FA 1X0OA 4ARZB 1LSWA 3S7OA 2PD8A 4CLCB 3C2WA 5KIZA 3A0VA 2HF6A 2VLGA 2OAP1 4KUKA 5F6AA 3R4KA 2LB5A 5IU1A 5HSQA 4R3AA 2PT7A 3PBTA 3HJIA 2L4RA 4YOFA 5MC7A 5CX7A 1IOUA 3W2ZA 3C8CA 2A24B 5TBMB 3FC7A 2Y8HA 3KX0X 1G6OA 3CAXA 4HJ6A 3BQAA 4IUHA 1XJ2A 4EETB 3A0RA 4Z1WA 3E98A 4R70A 3T4OA 2EA9A 1YSPA 2G7UA 2HV1A 2DMWA 2B18A 4NXEA 2PYPA 4MCWA 4HIAA 3MQOA 4RQ9A 4CQHA 2VJWA 4G3WA 4HQAA 3F1PA 3NOPC 4E04A 4DJ3A 3JVUA 3LUQA 1VHMA 5DF9A 1OPXA 1WA9A 2ZOIA 4GLQA 5HD5A 4WEJA 5G4ZA 2KOIA 4JGOA 2HGVA 4ME4A 3LR0A 4NXFA 3B47A 1P0ZA 4P6ZS 1N9OA 1OJGA 3PHYA 4IJGA 3MFXA 3H9WA 4WLAA 3LIEA 2M7VA 2VKSA 2ZMFA 5HZHA 4II7A 3E0YA 2WKQA 1OT9A 2LB9A 1UWNX 2W3EA 4YNRA 1OT6A 1LSVA 2JKTM 3H82B 2V1AA 4NKPA 3T4LA 3K2NA 4QPRA 5TJJA 4BJPA 3B42A 4WN5A 4EUVA 3EGXC 1OTEA 3ZYTA 2XSSA 2R78A 2ZMVA 4CLCC 3T4KA 2K31A 2FZ0A 4PKYG 1N9NA 1T1BA 2GX5A 2Y79A 3OC2A 4HH2A 5IT5A 1BYWA 4FSFA 2CMNA 4CLCD 4PKYA 3VV4A 2JKRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5Y A;  3VE4 A;  2VV8 A;  4GCZ A;  3LI8 A;  3PYP A;  5AVE A;  4F3L B;  1GSX A;  1G28 A;  4XT2 B;  3F1O A;  4JGR A;  5DKK A;  2PR5 A;  1TS6 A;  1TS0 A;  1V9Y A;  2YKH A;  3LID A;  4L9F A;  2VV6 A;  1XJ4 A;  3ICY A;  4LRX C;  1X0O A;  2OOL A;  5DKL A;  4F3L A;  3VOL A;  2OWJ A;  1XFQ A;  1XJ3 A;  1T1A A;  3F1P B;  3MR0 A;  1LSW A;  4BBT A;  2PD8 A;  1DRM A;  4GHI A;  2GJ3 A;  4K08 A;  4MN6 A;  3C2W A;  3IBR A;  3A0V A;  3IS2 B;  1DP9 A;  4I3J A;  2VLG A;  3LIC A;  4I3I A;  5J3W A;  4KUK A;  3UMD A;  5F6A A;  2P7J A;  2V0U A;  2KX6 A;  2D02 A;  3ULF A;  2JHE A;  5HDD A;  3F1O B;  4GW9 A;  5IU1 A;  5HSQ A;  4YWZ A;  4HH3 A;  4R3A A;  1KOU A;  1S4S A;  4DJ2 A;  5HDS A;  4HNB A;  3EWK A;  3P7N A;  3HJI A;  2L4R A;  2Z6D A;  4KUO A;  4EEP A;  1DP6 A;  3F1N B;  5EFW A;  5HDC A;  1LT0 A;  5DJU A;  3UME A;  2D01 A;  3LYX A;  3ZQ5 A;  3C8C A;  4LRY C;  1TS7 A;  5IS1 A;  1P97 A;  2A24 B;  2BAS A;  4HP4 A;  4HY8 A;  4GS9 A;  3SW1 A;  3HJK A;  2PYR A;  5TBM B;  3FC7 A;  1OTA A;  1S1Z A;  2ZOH A;  4BBV A;  3KX0 X;  3LIF A;  4L9E A;  2QJ5 A;  3CAX A;  5I5L A;  4BBU A;  2J80 A;  4HJ6 A;  4I5S A;  1XJ2 A;  1F9I A;  4EET B;  3A0R A;  4B9O A;  3NHQ A;  4GS9 B;  2KDK A;  4JGP A;  3H82 A;  2V9A A;  2EA9 A;  2PD7 A;  4I3A A;  4R6L A;  2HV1 A;  5G4Y A;  4NXE A;  2PYP A;  2QWS A;  4I38 A;  4HIA A;  2WKR A;  3MQO A;  5DJT A;  2K7S A;  1NWZ A;  2V1B A;  3F1N A;  3GDI A;  4L9G A;  4RQ9 A;  1T1C A;  2W27 A;  3EEH A;  3FG8 A;  2B02 A;  4HQA A;  5F69 A;  3UE6 A;  1OTI A;  3LIA A;  3NOU C;  1S66 L;  4EEU A;  3MQQ A;  3BY9 A;  3F1P A;  3NOP C;  2L0W A;  3D72 A;  1XJ6 A;  1T18 A;  4KQD A;  4E04 A;  4DJ3 A;  3LUQ A;  4HI4 A;  2VEA A;  2PDR A;  4WF0 A;  1OJ5 A;  5HWW A;  4XT2 A;  1WA9 A;  2ZOI A;  3UB9 A;  5HD5 A;  1T19 A;  1MZU A;  1VB6 A;  5J4E A;  5G4Z A;  1UGU A;  2W0N A;  4GHI B;  4JGO A;  2QJ7 A;  3B33 A;  3A0S A;  3K3C A;  4HHD A;  1Y28 A;  4HJ3 A;  4LRZ E;  2PR6 A;  1GSW A;  4M4X A;  4NXF A;  4EQ1 A;  1D7E A;  4I39 A;  5HWV A;  4LLO B;  1P0Z A;  1N9L A;  1LSX A;  1ODV A;  1S1Y A;  2INW A;  2VV7 A;  1XFN A;  3LIB A;  4H6J B;  5HD3 A;  5A8B A;  2H28 A;  5J7E A;  1V9Z A;  1N9O A;  1OJG A;  3CWF A;  3PHY A;  4JGQ A;  3T50 A;  3MFX A;  3LI9 A;  3H9W A;  4WLA A;  4WUJ A;  3LIE A;  3UB8 A;  2YKF A;  5HZH A;  4NXB A;  1JNU A;  3E4Q A;  2JN7 A;  4R38 A;  2QHK A;  2WKQ A;  5AVF A;  2PHY A;  1GSV A;  1OT9 A;  3H7W B;  4EES A;  3BY8 A;  3NOT C;  1LL8 A;  3VE3 A;  1UWN X;  3K3D A;  3UB6 A;  1OT6 A;  4NXG A;  1LSV A;  2ZBB A;  3H82 B;  2V1A A;  4EXO A;  3H7W A;  3RH8 B;  1F98 A;  2I9V A;  2OWH A;  3UB7 A;  4MN5 A;  2V0W A;  2M1C A;  3E4O A;  3GEC A;  3MXQ A;  4EW7 A;  5KIZ A;  3BWL A;  2L1M A;  5F68 A;  1S4R A;  5HWT A;  3RTY A;  3NJA A;  4WN5 A;  4R70 A;  2WKP A;  1OTE A;  5TBM A;  1EW0 A;  1OTD A;  2QKP A;  2A24 A;  2R78 A;  3CLO A;  3OLO A;  4HJ4 A;  2Z6C A;  1UWP X;  4PKY G;  1N9N A;  1OTB A;  1DP8 A;  1T1B A;  4H6J A;  4HH2 A;  1BYW A;  4WL9 A;  2CMN A;  1TS8 A;  4HOI A;  4LPZ A;  3G6O A;  4PKY A;  1D06 A;  3MJQ A;  3IS2 A;  4EER A;  1S67 L;  3E4P A;  4HP9 A; 
#chains in the Genus database with same CATH topology
 3R7W B;  1IKI A;  3PYP A;  4BMW A;  3HUN A;  2JBF A;  4MEZ A;  4EUZ A;  1ESI A;  4KZB A;  4DE0 A;  3IHB A;  3IS2 B;  3UE0 A;  4GW9 A;  3N4I A;  1K55 A;  1DY6 A;  5L2F A;  3ITB A;  1HTZ A;  3QP2 A;  4HP4 A;  2WAE A;  1ES4 A;  2HJ9 C;  2ZC4 B;  4I5S A;  4R6L A;  3T1Q B;  1IYQ A;  1NWZ A;  1CEF A;  1PI5 A;  3FKW A;  4UQI S;  5GHZ A;  3D72 A;  3V67 A;  4HI4 A;  2PDR A;  4HES A;  2PBY A;  3C30 A;  1O07 A;  3A0S A;  1Y28 A;  1KDW A;  4GD8 A;  2WZZ A;  4X68 A;  1LL5 A;  3CI6 A;  4JGQ A;  4IUK A;  3FZC A;  3IXG A;  1RGY A;  5E2E A;  1MKI A;  2EX2 A;  2QZ6 A;  1OME A;  5FQQ A;  1SKF A;  1JWV A;  5GL9 A;  1EW0 A;  4UA6 A;  2A24 A;  4OOL A;  4QY6 A;  3HLW A;  4WL9 A;  1D06 A;  4Y15 A;  3NBL A;  5CGW A;  2VV8 A;  3LY3 A;  3O88 A;  1GSX A;  4JGR A;  5E2H A;  1XJ3 A;  1YLY A;  3MR0 A;  3FYZ A;  1BSG A;  4Y0O A;  1P9R A;  2NUT C;  3LIC A;  4GNU A;  5CER A;  2JHE A;  3G34 A;  1ERM A;  5HDS A;  1XPB A;  3EWK A;  4KUO A;  2FFY A;  4EEP A;  5M18 A;  3LR4 A;  1ZC2 A;  2BG1 A;  4UEY A;  4LRY C;  4Y3I A;  5DTK A;  4KZ9 A;  2WAF A;  4LGW A;  4B9O A;  4O0P A;  3N6I A;  5HL1 A;  5KMW A;  4I38 A;  2WKR A;  5HAR A;  3GDI A;  3C4O A;  2A2L A;  4EEU A;  1ACF A;  1XXM A;  3NY4 A;  5CEC A;  3ZFZ A;  2EX6 A;  2EWV A;  3TJZ C;  1UGU A;  4PM5 A;  4ZRR A;  2R9X A;  3WRT A;  4HJ3 A;  4WMC D;  3UB5 P;  4MDZ A;  4S2M A;  3PXP A;  3EEA A;  4PM9 A;  2HPB A;  2W3G A;  2PU2 A;  5KSC A;  2HZ5 A;  5EOO A;  4IHQ A;  5EVI C;  1JTG A;  1CI9 A;  4EES A;  3VE3 A;  1LL8 A;  3IWO A;  5FEG A;  4JKT A;  1FCO A;  5CHJ A;  4OQ0 A;  3IQA A;  3NJA A;  3IH9 A;  4OPR A;  4S2N C;  4OVD A;  2EFU A;  1OTB A;  3ZVT A;  1SDE A;  4GCZ A;  3I7J A;  2Q9M A;  4L9F A;  4UQI M;  1YLT A;  1FOF A;  1DRM A;  4MN6 A;  1NYY A;  3T4T A;  4HBU A;  5FQI A;  3QP6 A;  2V0U A;  1F2K A;  2W3F A;  4UA9 A;  3QNB A;  2Q9N A;  3IXD A;  4ESP A;  2ACG A;  2HP5 A;  1H8Z A;  4K0X A;  1TS7 A;  3BFG A;  3CIT A;  2J8Y A;  5DF8 A;  3MZD A;  3PBS A;  4E3J A;  2KDK A;  4OPY A;  5DTT A;  2PD7 A;  4R23 A;  3WS0 A;  4IVI A;  4P87 A;  4X69 A;  1SCW A;  2ZL1 A;  3Q07 A;  3WRZ A;  1P9W A;  3TE8 A;  4GZB A;  4RA7 A;  3JPU A;  3UN7 A;  3BFD A;  2WGV A;  5I94 A;  3V3S A;  4IED A;  3DTI A;  1MWT A;  4Q0H A;  3NOT C;  4JXG A;  5AQ9 A;  4HBT A;  3PTE A;  4KQQ A;  4GJ4 A;  5GHY A;  2OV5 A;  4HJ4 A;  1K57 A;  3MXR A;  5HX9 A;  2IA2 A;  2J9O A;  3MJQ A;  4Q8I A;  3E4P A;  5F69 A;  4HP9 A;  1ES3 A;  4CLC A;  2Y2P A;  4X55 A;  1O7E A;  3M2K A;  1K6S A;  1CI8 A;  4R4S A;  2B95 A;  2O9A A;  4LRX C;  3JVV A;  1X0O A;  4ARZ B;  1K4F A;  2Y2J A;  3A0V A;  5G18 A;  2Z2M B;  3DAV A;  3HL9 A;  4X1M A;  5GLC A;  5HSQ A;  2V8C A;  1ZG4 A;  3G31 A;  4R0Q A;  3BLS A;  5MC7 A;  1IOU A;  4CJN A;  3N8L A;  3ZGA B;  4BLM A;  1TEM A;  1K55 C;  3DWK A;  2Y8H A;  4UA7 A;  1G6O A;  2DCF A;  1W5D A;  4HJ6 A;  4EET B;  3A0R A;  4Z1W A;  2PBD P;  5E2G A;  2EA9 A;  3S22 A;  2G7U A;  4FTX A;  3MQO A;  3SZT A;  4CQH A;  3TOI A;  1EI5 A;  1LHY A;  1VM1 A;  3NOP C;  3A3E A;  5DF9 A;  1WYB A;  4GLQ A;  5HD5 A;  5G4Z A;  4JGO A;  4Y17 A;  3WS1 A;  4NXF A;  3N7W A;  1AXB A;  3B47 A;  1N9O A;  3PHY A;  2Y55 A;  1Z6F A;  4KZ3 A;  2M7V A;  2VKS A;  4LV2 A;  4IVK A;  5L10 A;  2WZX A;  1OT9 A;  1UWN X;  2AVX A;  3GTC A;  5FAT A;  1TDL A;  4KZ6 A;  3ZDJ A;  4BJP A;  4EUV A;  3ZNY A;  4DKI A;  3ZYT A;  2R78 A;  3IWQ A;  2K31 A;  1N9N A;  3U4L P;  2Y79 A;  5IT5 A;  3MFD A;  2ZMA A;  1F5M A;  1K56 A;  4WM9 A;  5HAP A;  1BLS A;  4OPQ A;  2OLV A;  3KYZ A;  4XT2 B;  5DKK A;  1XGJ A;  3F1P B;  3N8R A;  2GJ3 A;  2HDS A;  5CXW A;  3UDX A;  4MBF A;  3F1O B;  4ZTK A;  2O9B A;  5EUA A;  2WKI A;  1FR1 A;  3M6H A;  4KG5 A;  4GOG A;  3LIF A;  1G6A A;  3C38 A;  3MXS A;  3QNC A;  4BD0 A;  1Y4O A;  2P9V A;  2Q0O A;  3LY4 A;  1LI0 A;  1GCE A;  4EBL A;  2QWS A;  4JLF A;  2V1B A;  3HVF A;  5KSH A;  3A3D A;  1BUE A;  1A0K A;  5FAS A;  1Z09 A;  2ZL1 B;  4RVA A;  5AQA A;  4B4Z A;  2IWD A;  1PIO A;  1KVL A;  4XT2 A;  3S4X A;  1W63 M;  5J4E A;  3B33 A;  5FA7 A;  1I2W A;  4LRZ E;  5A93 A;  1L3L A;  5HWV A;  1LSX A;  1ODV A;  3QP8 A;  4R3J A;  1ONH A;  1TDG A;  4DE3 A;  2QHK A;  2XRN A;  3VP3 A;  3O86 A;  2V20 A;  2EXA A;  2ZBB A;  3CPT A;  3HLE A;  5EVI A;  2WYX A;  4MN5 A;  3IF6 C;  5EVI B;  2ZM8 A;  3PAE A;  4OP5 A;  2ZD8 A;  5TR7 A;  4MN7 A;  4KZA A;  4G3V A;  4EBP A;  3S7N A;  3IS2 A;  2GNX A;  2J9P A;  5L8M A;  3MZE A;  4U3T A;  3MZF A;  1YMS A;  1M40 A;  5F1F A;  4DN0 A;  1PWC A;  2ZQC A;  3Q7Z A;  4I3J A;  1PW8 A;  3UE3 A;  1I5Q A;  4L0L A;  3G30 A;  3HLB A;  2MJ6 A;  3DBA A;  3PBN A;  3QP1 A;  4IBX A;  3GQZ A;  4LCL A;  4MNR A;  1MC0 A;  3O87 A;  3HJK A;  4ZAM A;  2J80 A;  4B4X A;  5L09 A;  4JGP A;  3H82 A;  4RX3 A;  5L07 A;  2VZW A;  1SDN A;  3C4P A;  4XUX A;  1K4E A;  3EEH A;  3HLC A;  4GKU A;  2W1T B;  3IXB A;  1T18 A;  1PW1 A;  3B3X A;  3G4P A;  3RXW A;  1K38 A;  3CJM A;  3EQV A;  4DXB A;  3SOI A;  5CTN A;  1MKM A;  3K3C A;  1XGI A;  5A8B A;  4OOM A;  2H28 A;  3BW6 A;  3UB8 A;  3LEZ A;  5AVF A;  3H7W B;  3G32 A;  3UB6 A;  2VK3 A;  3H7W A;  1RGZ A;  5D3O A;  1CF0 A;  3OZH A;  4Y7P A;  3E4O A;  4Y2F A;  4IBR A;  4B88 A;  3FWL A;  1J9M A;  5AQB A;  2BTF P;  3DW0 A;  4DRT A;  4LFU A;  1K54 A;  3C5A A;  1MWU A;  5U47 A;  1YLZ A;  4Q0I A;  4BL3 A;  4FH4 A;  1PWG A;  3BFF A;  3N8S A;  1JVJ A;  1K57 C;  5EFW A;  3T4Q A;  3FPV A;  2VV6 A;  1XJ4 A;  3SS5 A;  3VOL A;  5TFQ A;  4QU3 A;  3KSH A;  5GLB A;  2OLU A;  4ZJ3 A;  2XDM A;  3IF5 A;  4Y0U A;  5AJG A;  4E6X A;  2XA7 S;  1W63 Q;  3UNW A;  3ULF A;  1ERQ A;  4N92 A;  4A5R A;  1YLP A;  1BTL A;  1KOU A;  2VGL S;  4HNB A;  1K6R A;  3AGD A;  3F1N B;  4H8R A;  4EU0 A;  1L2S A;  1YMX A;  3IT9 A;  5DFY A;  1P97 A;  4WYY A;  4L9E A;  1U60 A;  4BBU A;  3Q81 A;  3NDG A;  5G4Y A;  3UE1 A;  4PHT A;  4G3K A;  1K0K A;  2K7S A;  4R1G A;  2IWC A;  3RJU A;  2WK0 A;  1ZTU A;  1GHM A;  1MXO A;  2VEA A;  1MWS A;  2Y2G A;  4JF4 A;  1VB6 A;  5GLA A;  1JWZ A;  2QJ7 A;  3ZG7 B;  4M4X A;  1L0G A;  1ES5 A;  2WUQ A;  2HDQ A;  5HD3 A;  1YLJ A;  3T50 A;  2ZC6 B;  1NLZ A;  4DE2 A;  5EOE A;  5EV0 A;  4PMA A;  1BZA A;  2O99 A;  3FPW A;  3VSK A;  5F82 A;  2P04 A;  5FDH A;  3K3D A;  1PZO A;  3T1X A;  3ZNT A;  4KZ4 A;  3TRC A;  3MXQ A;  2L1M A;  5CGS A;  1S4R A;  5TBM A;  3ITA A;  3NEC A;  2JKF A;  4FCF A;  3KSF A;  1KVM A;  3EGD C;  3L7H A;  3ZG0 A;  4C75 A;  5J8X A;  4NG2 A;  2WGW A;  5DKL A;  4C3Q A;  1LSW A;  3S7O A;  3HBR A;  5KIZ A;  2HF6 A;  2VLG A;  4WMC A;  5F6A A;  3R4K A;  1KGG A;  2ZQA A;  3SH7 A;  4YOF A;  2Z2L B;  1NZU A;  3W2Z A;  1FQG A;  3C8C A;  2C6W B;  5TBM B;  1YM1 A;  4S2I A;  3D9Y A;  3BQA A;  3E98 A;  5FDS A;  5FQJ A;  5FQ9 A;  1YSP A;  2B18 A;  4NXE A;  1CJF A;  4QB8 A;  4G3W A;  1C3B A;  2PRF A;  4K0W A;  4MBH A;  1VQQ A;  3IX8 A;  1FSY A;  5TGF A;  4BQM A;  3JVU A;  3LUQ A;  1VHM A;  2ZQD A;  4YFM A;  1PNE A;  2ZOI A;  4X25 A;  4OP8 A;  4JF5 A;  3ZVW A;  4WEJ A;  2HGV A;  1FIK A;  1DJC A;  3V50 A;  3LR0 A;  1FCM A;  1IYP A;  3GVB A;  1PYY A;  4CPK A;  1OJG A;  1VEU B;  3MFX A;  4S2L A;  1BT5 A;  2LB9 A;  3ZG8 B;  1LSV A;  2JKT M;  3H82 B;  1HZO A;  3T4L A;  4OH0 A;  1CEG A;  4N1X A;  3HUO A;  2XLN A;  2XSS A;  2PAV P;  4PKY G;  4HH2 A;  3IF6 A;  1BYW A;  1IYO A;  5BOH A;  4PKY A;  4KQR A;  3GRJ A;  2WGW B;  3O3V A;  4ZJ2 A;  3A3I A;  4I3I A;  3EOI A;  3KO6 A;  3VOZ A;  2WAD A;  2R9W A;  2JKT I;  3LGO A;  3UPP A;  4DJ2 A;  4WZ4 A;  2E8I A;  1YPR A;  2JCH A;  1I2S A;  1YKD A;  4KQO A;  4UAA A;  1RCJ A;  3HLD A;  3OPR A;  3NDE A;  5CED A;  1LI9 A;  3T4S A;  2J7V A;  3TG9 A;  2W3H A;  4GS9 B;  4PM7 A;  5C5K A;  1KDS A;  5FI2 A;  1HD8 A;  1MBL A;  1J3W A;  5DFX A;  3UE6 A;  1H0M A;  4BD1 A;  3LR3 A;  4ARZ A;  4LCM A;  5A90 A;  3BQ8 A;  3MKF A;  3TW8 A;  1OJ5 A;  5HWW A;  1T19 A;  4BEN A;  4QWO A;  4M3K A;  4HHD A;  3Q82 A;  3MBZ A;  2PR6 A;  3HCY A;  4I39 A;  3VP4 A;  2INW A;  1XFN A;  3LR5 A;  1YSQ A;  3D4F A;  2XH9 A;  3PBQ A;  5FL3 A;  4OQI A;  1IEL A;  5E43 A;  3UO9 A;  5CRF A;  2XFS A;  4E3I A;  1FIL A;  3PR6 A;  3UB7 A;  5FAO A;  2M1C A;  1DJB A;  2ZQ7 A;  3OLO A;  3CLO A;  1DP8 A;  4EQI A;  2Z6D A;  5IHV A;  1K54 C;  1LL9 A;  4F3L B;  1YAX A;  3F1O A;  4P6Z M;  4ZBE A;  3WS4 A;  1SZV A;  2J3W A;  2H0T A;  5EEC A;  4F3L A;  3VFH A;  4AFI A;  2JKR M;  2V1Z A;  3T1R A;  2VA0 A;  5HDD A;  4K91 A;  2ZQ8 A;  2OAQ 1;  3V5M A;  1NY0 A;  1PRQ A;  4FUW A;  4OQH A;  5HL6 A;  3ZQ5 A;  1FR6 A;  4N9L A;  3SH8 A;  2XD1 A;  3LCE A;  1W79 A;  3SS4 A;  2VGL M;  4S2K A;  1S1Z A;  1ERO A;  4BBV A;  3W4P A;  1KE0 A;  1XX2 A;  3G35 A;  2Y2H A;  2UWX A;  2W27 A;  3O5Y A;  2GDN A;  3KSI A;  1ALQ A;  2JE5 A;  3IH8 A;  3MQQ A;  2XR0 A;  3VFF A;  3UB9 A;  2XK1 A;  4Q0J A;  4WEL A;  1NYM A;  1IFQ A;  3IF6 B;  1N9L A;  2Y2M A;  4H6J B;  4OOY A;  4LV1 A;  4D2O A;  5GHX A;  3LI9 A;  2YKF A;  4NXB A;  1JNU A;  1KGF A;  3E4Q A;  1GSV A;  4UHU A;  3CUE C;  4KZ7 A;  1H5X A;  2ZLY A;  2V0W A;  3GEC A;  4EWF A;  4P6B A;  3G2Z A;  3OCL A;  3GV9 A;  4DDS A;  4H6J A;  4DMZ A;  2EX8 A;  2J3T D;  4PPR A;  2QYB A;  3LEQ A;  1PZP A;  3NCK A;  2HDU A;  1WE4 A;  1S0W A;  2OOL A;  2DRW A;  2WGI A;  1HLU P;  1T1A A;  3R7W A;  4BBT A;  4GHI A;  3AGF A;  3BFC A;  2Y2Q A;  1G5U A;  4YIN A;  2X01 A;  3Q7V A;  1KGE A;  3T1S A;  4JXS A;  1S6R A;  5LBR A;  3UPN A;  1ZKJ A;  3P7N A;  3S7Q A;  3W8K A;  1BUL A;  4U0X A;  1BLC A;  2Y2K A;  5HDC A;  4JF6 A;  1LT0 A;  1VET B;  3LO7 A;  4QD4 A;  4Y13 A;  1OTA A;  1F9I A;  4WZ5 C;  5FEF A;  2GZA A;  5CHU A;  1LLB A;  1VET A;  2Y2L A;  1BLH A;  2XGN A;  3S1Y A;  3UY6 A;  2ZM2 A;  3FG8 A;  5FI7 A;  1S66 L;  3CMZ A;  2I72 A;  4KQD A;  4CLC E;  2PU4 A;  3OBF A;  4EBN A;  1N9B A;  3PAG A;  3UPO A;  4EQ1 A;  4S2P A;  5FAP A;  2WKE A;  5J7E A;  2FH5 A;  1V9Z A;  3CWF A;  2W1T A;  4NK3 A;  2Y2N A;  4E3K A;  3NI9 A;  3NC8 A;  1W8Q A;  4EXO A;  1F98 A;  2M7U A;  2I9V A;  2G2U A;  5HWT A;  3RTY A;  5CTM A;  2QKP A;  3DTE A;  3IX4 A;  2ZQ9 A;  3GR2 A;  4OKP A;  3QP4 A;  4X1L A;  1E4D A;  1TS8 A;  4LPZ A;  3Q7V B;  3E2K A;  3BM6 A;  3NUL A;  4X53 A;  5F5Y A;  1JWP A;  3VE4 A;  3LI8 A;  3VP1 A;  1TS6 A;  3A3F A;  3U2A A;  3LID A;  3ICY A;  4Y5F A;  4FD8 A;  3UDF A;  2HP9 A;  2ZC7 A;  3C2W A;  5EVI D;  3G2Y A;  2OAP 1;  4O7D A;  1ES2 A;  2H0Y A;  2Y2I A;  3DWZ A;  2LB5 A;  5EVE A;  5IU1 A;  1L0F A;  1CQA A;  5M19 A;  4DXC A;  2PT7 A;  3PBT A;  3HJI A;  3IHA A;  1IYS A;  2WKH A;  2ZC3 B;  4OLG A;  5A91 A;  1SHV A;  3KX0 X;  1Q2P A;  3CG5 A;  3WWX A;  3CAX A;  4N9K A;  3IWI A;  4IUH A;  2H5S A;  4R70 A;  1W8Y A;  2HV1 A;  2XFT A;  2DMW A;  4DDY A;  3IX3 A;  4HIA A;  2VJW A;  4HQA A;  3RXX A;  4HEF A;  2BLS A;  5HFO A;  4OLD A;  2V8F A;  5KZH A;  2KOI A;  3VP0 A;  3NIA A;  4X6T A;  3T12 B;  4X56 A;  3HUM A;  4KZ5 A;  2DNS A;  1QMF A;  2P9V B;  3H9W A;  4WLA A;  1L0E A;  3LIE A;  5HZH A;  3E0Y A;  1BLP A;  5DF7 A;  4XUZ A;  5DVA A;  3QHY A;  4KEN B;  2W3E A;  1OT6 A;  5CGX A;  4QPR A;  1NZO A;  1FCN A;  3B42 A;  4WN5 A;  3EGX C;  1OTE A;  4JBF A;  3VOY A;  2ZMV A;  2FZ0 A;  1T1B A;  1KE3 A;  4FSF A;  2CMN A;  4CLC D;  1PI4 A;  3MS6 A;  1G68 A;  2JKR I;  1TS0 A;  4ZJ1 A;  2X02 A;  1TD5 A;  4R4R A;  3IBR A;  3IXH A;  3SS3 A;  2P7J A;  3HLG A;  2KX6 A;  3LFV A;  1YLW A;  2D02 A;  3OPL A;  1DJA A;  1DP6 A;  4ETX A;  4U0T A;  5DJU A;  1NLY A;  5IS1 A;  3SW1 A;  3OCN A;  5CEB A;  2QJ5 A;  4NET A;  4GDN A;  5HW3 A;  4WEK A;  3NHQ A;  3BLM A;  4I3A A;  5DJT A;  3P98 A;  5CHM A;  5JYO A;  4BWI A;  1K56 D;  2B02 A;  2O9C A;  4S2J A;  3BY9 A;  2L0W A;  1M6K A;  4GN2 A;  2P08 A;  3HRE A;  1MWR A;  1HVB A;  2NUP C;  2W0N A;  3DTK A;  4GHI B;  2XA7 M;  4LLO B;  1S1Y A;  4WUJ A;  3L9K A;  3ZG5 A;  4P85 A;  4E3N A;  4PM6 A;  4Z9Q A;  3V39 A;  3BY8 A;  3Q1F A;  2XEP A;  4QJG A;  3W4Q A;  1JTD A;  4MBK A;  3C7V A;  4GB7 A;  4FOF A;  3BWL A;  1IKG A;  3CUE A;  1OTD A;  2EXB A;  3C7U A;  2Z6C A;  1UWP X;  4EV4 A;  3W4O A;  3G6O A;  3CZD A;  4NEE D;  3HLF A;  1V9Y A;  2VX8 A;  2YKH A;  3DTM A;  5E2F A;  5K5B A;  3OPP A;  4OPZ A;  4LEN A;  3UMD A;  4OON A;  1KE4 A;  3OPH A;  3QP5 A;  2X71 A;  3BRM A;  4YWZ A;  1YQS A;  1SKO B;  4B93 A;  1MY8 A;  3T4J A;  5F1G A;  5EE8 A;  3UME A;  3LYX A;  2BAS A;  3IBJ A;  1FSW A;  2PYR A;  5HPI A;  2K2N A;  4MLL A;  5I5L A;  4JXW A;  1H8M A;  2V9A A;  4PM8 A;  3F1N A;  1D1J A;  3BJN A;  1Y54 A;  4WZ5 A;  1OTI A;  3LIA A;  5HAQ A;  1XJ6 A;  2XF3 A;  4WF0 A;  1XA7 A;  3GSG A;  2RL3 A;  1MZU A;  5FI6 A;  5HPF A;  3LIB A;  3EQU A;  4O01 A;  4PAU A;  2Y2O A;  5HAI A;  5GLD A;  5FQM A;  1YT4 A;  3OOV A;  1NRJ A;  2HJE A;  5FQK A;  2EWW A;  2PHY A;  3ZCZ A;  1XKZ A;  2XRO A;  3BEC A;  3KYE A;  3PBO A;  4NXG A;  4E3L A;  3RH8 B;  4GDB A;  2OWH A;  3VP2 A;  4BL2 A;  4EW7 A;  1ZHH B;  5FAQ A;  2WKP A;  4QHC A;  2Y91 A;  3MF0 A;  1E3U D;  4HOI A;  3PBR A;  1NXY A;  1CK3 A;  2J3T C;  1S67 L;  4OQG A;  2RCX A;  3AGE A;  1G28 A;  1MPL A;  1H3Q A;  3WS2 A;  2OWJ A;  1XFQ A;  3KYQ A;  4E3O A;  4GD6 A;  4K08 A;  5J3W A;  3ZHH A;  1DP9 A;  1TVF A;  3MMH A;  5M1A A;  4KG6 A;  3RFB A;  2W1R A;  3D3O A;  4HH3 A;  1S4S A;  3MQ0 A;  4QY5 A;  2JKG A;  2KLI A;  2HDR A;  2B5R A;  2QMI A;  2Y4A A;  3E2L A;  2D01 A;  3M2J A;  3FV7 A;  4HY8 A;  4GS9 A;  4ETZ A;  2ZOH A;  2UV0 E;  1SKO A;  1GHI A;  3KSG A;  4JXV A;  1WYC A;  5EM0 A;  4L9G A;  2V2F F;  2W3D A;  1T1C A;  3NOU C;  5F83 A;  2XD5 A;  3P01 A;  1PWD A;  3ZG9 B;  3FKV A;  1GA9 A;  3JYI A;  2FFF B;  1GSW A;  1D7E A;  1E3U A;  2VV7 A;  4XXR A;  4FH2 A;  1GHP A;  3S7P A;  2O0Y A;  2XQZ A;  2JN7 A;  3BYD A;  3P09 A;  4P0M A;  4R38 A;  3VSL A;  1W7F A;  3CPT B;  1STZ A;  4S2N A;  3BEB A;  1XP4 A;  3A3J A;  4E3M A;  2ZM0 A;  4KG2 A;  1L0D A;  5F68 A;  1GA0 A;  2QPN A;  4O8G A;  4ZDX A;  1TF1 A;  4MMN A;  5EM1 A;  2H10 A;  5AQ7 A;  4EER A;  3UDI A;  1VEU A;  5AVE A;  1RP5 A;  5FSR A;  2PR5 A;  3MKE A;  2ZJ9 A;  2P74 A;  3MSH A;  2PD8 A;  4CLC B;  1EWZ A;  4KUK A;  3SH9 A;  3ISG A;  3VMA A;  4N1H A;  4R3A A;  2Y59 A;  1ZG6 A;  2L4R A;  2CC1 A;  4RYE A;  3M6B A;  5CX7 A;  3WS5 A;  5DTS A;  4DF6 A;  4Y0T A;  2VGK A;  2A24 B;  2E8J A;  3FC7 A;  2C5W B;  4LV0 A;  1H8Y A;  2A49 A;  2OSU A;  1XJ2 A;  3V3R A;  4C6Y A;  3T4O A;  4F94 A;  2PYP A;  4MCW A;  1AWI A;  4RQ9 A;  1XA1 A;  1ESU A;  3F1P A;  1NJ4 A;  1NRF A;  1PFL A;  5EPH A;  2A3U A;  4E04 A;  4DJ3 A;  4DE1 A;  4KZ8 A;  1OPX A;  1WA9 A;  4WBG A;  5A92 A;  4ME4 A;  4ID4 A;  2VGJ A;  3GMW A;  1E25 A;  1P0Z A;  4RX2 A;  4P6Z S;  4JPM A;  1K25 A;  5JYP A;  3BFE A;  4IJG A;  2IWB A;  1IEM A;  2G2W A;  2EFX A;  4E6W A;  1Q2Q A;  2ZMF A;  4II7 A;  2WKQ A;  2ZC5 B;  4YNR A;  4NKP A;  2V1A A;  2HP6 A;  4LV3 A;  4D60 A;  3K2N A;  3CHW P;  5TJJ A;  4S2O A;  3TSG A;  2JC7 A;  5EVL A;  4CLC C;  3T4K A;  1ONG A;  1QME A;  2GX5 A;  3OC2 A;  4R3B A;  2EX9 A;  3VV4 A;  1N4O A; 
#chains in the Genus database with same CATH homology
 3R7W B;  3PYP A;  3KYZ A;  4XT2 B;  4BMW A;  5DKK A;  1TS0 A;  3F1P B;  1TD5 A;  2GJ3 A;  4I3I A;  3IBR A;  3IS2 B;  3EOI A;  3KO6 A;  2P7J A;  2KX6 A;  3LFV A;  2D02 A;  3F1O B;  4GW9 A;  2JKT I;  4DJ2 A;  1YKD A;  2O9B A;  4KQO A;  1DP6 A;  4ETX A;  5DJU A;  1NLY A;  5IS1 A;  3SW1 A;  4HP4 A;  3OCN A;  3LIF A;  2HJ9 C;  2QJ5 A;  3C38 A;  3T4S A;  4I5S A;  4WEK A;  2W3H A;  3NHQ A;  4GS9 B;  4R6L A;  4I3A A;  5C5K A;  2QWS A;  5DJT A;  1NWZ A;  2V1B A;  4BWI A;  4UQI S;  5DFX A;  5KSH A;  3UE6 A;  2B02 A;  2O9C A;  3BY9 A;  2L0W A;  3D72 A;  3LR3 A;  4ARZ A;  3V67 A;  2P08 A;  4HI4 A;  3BQ8 A;  2PDR A;  3TW8 A;  1OJ5 A;  5HWW A;  4XT2 A;  1T19 A;  1F5M A;  3C30 A;  1W63 M;  2NUP C;  5J4E A;  2W0N A;  4GHI B;  3B33 A;  3A0S A;  4HHD A;  1Y28 A;  4LRZ E;  2PR6 A;  2XA7 M;  3HCY A;  4I39 A;  5HWV A;  4LLO B;  1LSX A;  1ODV A;  1S1Y A;  2INW A;  1XFN A;  3CI6 A;  3LR5 A;  4JGQ A;  4IUK A;  1YSQ A;  4WUJ A;  3PBQ A;  5FL3 A;  2QHK A;  2XRN A;  3BY8 A;  2ZBB A;  3PR6 A;  3UB7 A;  4MN5 A;  2M1C A;  4FOF A;  3BWL A;  3CUE A;  1EW0 A;  1OTD A;  2A24 A;  3OLO A;  3CLO A;  4OOL A;  2Z6C A;  1UWP X;  4MN7 A;  1DP8 A;  4G3V A;  4WL9 A;  3S7N A;  3G6O A;  1D06 A;  3IS2 A;  2Z6D A;  2GNX A;  2VV8 A;  4NEE D;  5L8M A;  4F3L B;  1GSX A;  1YAX A;  3F1O A;  4JGR A;  4P6Z M;  2J3W A;  1V9Y A;  2VX8 A;  2YKH A;  5K5B A;  4F3L A;  1XJ3 A;  4DN0 A;  3MR0 A;  4AFI A;  4I3J A;  1P9R A;  2JKR M;  2NUT C;  3LIC A;  3UMD A;  2VA0 A;  3UE3 A;  2JHE A;  5HDD A;  2OAQ 1;  4YWZ A;  5HDS A;  4L0L A;  3EWK A;  4KUO A;  4B93 A;  4EEP A;  2MJ6 A;  3DBA A;  3PBN A;  3LR4 A;  3T4J A;  4UEY A;  5HL6 A;  3UME A;  3LYX A;  3ZQ5 A;  4LRY C;  1MC0 A;  2BAS A;  3IBJ A;  2VGL M;  4Y3I A;  3HJK A;  2PYR A;  5HPI A;  1S1Z A;  4BBV A;  2K2N A;  5I5L A;  2J80 A;  4B9O A;  4O0P A;  4JGP A;  1H8M A;  3H82 A;  2V9A A;  2VZW A;  4I38 A;  2WKR A;  3F1N A;  3GDI A;  3BJN A;  2A2L A;  2W27 A;  3EEH A;  3O5Y A;  3KSI A;  1OTI A;  3LIA A;  4EEU A;  3MQQ A;  2W1T B;  1XJ6 A;  1T18 A;  4WF0 A;  3UB9 A;  3EQV A;  4Q0J A;  1MZU A;  2EWV A;  3TJZ C;  1UGU A;  1MKM A;  4ZRR A;  4WEL A;  3K3C A;  4HJ3 A;  5HPF A;  1IFQ A;  4MDZ A;  3PXP A;  3EEA A;  1N9L A;  5A8B A;  4H6J B;  3LIB A;  3EQU A;  4OOM A;  2H28 A;  4O01 A;  2W3G A;  4PAU A;  3BW6 A;  3LI9 A;  3UB8 A;  4IHQ A;  2YKF A;  3OOV A;  1JNU A;  1NRJ A;  3E4Q A;  4NXB A;  2HJE A;  5AVF A;  2EWW A;  2PHY A;  1GSV A;  3H7W B;  4EES A;  2XRO A;  3VE3 A;  1LL8 A;  3CUE C;  3UB6 A;  4NXG A;  3PBO A;  3H7W A;  3RH8 B;  2OWH A;  2V0W A;  3E4O A;  3GEC A;  4EW7 A;  4Y2F A;  1ZHH B;  3NJA A;  2WKP A;  3OCL A;  3MF0 A;  4H6J A;  1OTB A;  4DMZ A;  4HOI A;  3PBR A;  4Q0I A;  2J3T D;  2J3T C;  1S67 L;  2QYB A;  4GCZ A;  1G28 A;  4L9F A;  5EFW A;  1H3Q A;  3FPV A;  3T4Q A;  2VV6 A;  1XJ4 A;  4UQI M;  2OOL A;  3VOL A;  2OWJ A;  1XFQ A;  1T1A A;  3KSH A;  3R7W A;  3KYQ A;  4BBT A;  1DRM A;  4GHI A;  4K08 A;  4MN6 A;  3T4T A;  5J3W A;  1DP9 A;  5AJG A;  2XA7 S;  1W63 Q;  2V0U A;  3MMH A;  5LBR A;  3ULF A;  3RFB A;  2W3F A;  2W1R A;  3D3O A;  4HH3 A;  1KOU A;  1S4S A;  3MQ0 A;  2VGL S;  4HNB A;  3P7N A;  3S7Q A;  2KLI A;  3F1N B;  5HDC A;  4EU0 A;  1LT0 A;  2D01 A;  1TS7 A;  5DFY A;  1P97 A;  4HY8 A;  3CIT A;  4GS9 A;  1OTA A;  4ETZ A;  2ZOH A;  4L9E A;  4BBU A;  1F9I A;  3KSG A;  3PBS A;  2KDK A;  2GZA A;  5G4Y A;  2PD7 A;  4PHT A;  4G3K A;  2K7S A;  4L9G A;  2W3D A;  1T1C A;  3FG8 A;  1ZTU A;  3NOU C;  1S66 L;  4KQD A;  3P01 A;  4CLC E;  3OBF A;  2VEA A;  1VB6 A;  2QJ7 A;  1P9W A;  4EQ1 A;  4M4X A;  1GSW A;  3TE8 A;  1D7E A;  2VV7 A;  5HD3 A;  5J7E A;  2FH5 A;  1V9Z A;  3CWF A;  2W1T A;  3T50 A;  1NLZ A;  3S7P A;  2O0Y A;  2O99 A;  2JN7 A;  3FPW A;  4R38 A;  4Q0H A;  3NOT C;  2P04 A;  3K3D A;  1STZ A;  4EXO A;  1F98 A;  2M7U A;  2I9V A;  3TRC A;  3MXQ A;  2L1M A;  4GJ4 A;  1S4R A;  5F68 A;  5HWT A;  3RTY A;  5TBM A;  2QKP A;  4HJ4 A;  3KSF A;  4O8G A;  3EGD C;  1TS8 A;  1TF1 A;  2IA2 A;  4LPZ A;  4MMN A;  3MJQ A;  4EER A;  3E4P A;  5F69 A;  4HP9 A;  5F5Y A;  4CLC A;  3VE4 A;  3LI8 A;  5AVE A;  2PR5 A;  1TS6 A;  3U2A A;  2O9A A;  3LID A;  4LRX C;  5DKL A;  3ICY A;  3JVV A;  4Y5F A;  1X0O A;  4ARZ B;  1LSW A;  3S7O A;  2PD8 A;  4CLC B;  3C2W A;  5KIZ A;  3A0V A;  2HF6 A;  2VLG A;  2OAP 1;  4KUK A;  5F6A A;  3R4K A;  2LB5 A;  5IU1 A;  5HSQ A;  4R3A A;  2PT7 A;  3PBT A;  3HJI A;  2L4R A;  4YOF A;  5MC7 A;  5CX7 A;  1IOU A;  3W2Z A;  3C8C A;  2A24 B;  5TBM B;  3FC7 A;  2Y8H A;  3KX0 X;  1G6O A;  3CAX A;  4HJ6 A;  3BQA A;  4IUH A;  1XJ2 A;  4EET B;  3A0R A;  4Z1W A;  3E98 A;  4R70 A;  3T4O A;  2EA9 A;  1YSP A;  2G7U A;  2HV1 A;  2DMW A;  2B18 A;  4NXE A;  2PYP A;  4MCW A;  4HIA A;  3MQO A;  4RQ9 A;  4CQH A;  2VJW A;  4G3W A;  4HQA A;  3F1P A;  3NOP C;  4E04 A;  4DJ3 A;  3JVU A;  3LUQ A;  1VHM A;  5DF9 A;  1OPX A;  1WA9 A;  2ZOI A;  4GLQ A;  5HD5 A;  4WEJ A;  5G4Z A;  2KOI A;  4JGO A;  2HGV A;  4ME4 A;  3LR0 A;  4NXF A;  3B47 A;  1P0Z A;  4P6Z S;  1N9O A;  1OJG A;  3PHY A;  4IJG A;  3MFX A;  3H9W A;  4WLA A;  3LIE A;  2M7V A;  2VKS A;  2ZMF A;  5HZH A;  4II7 A;  3E0Y A;  2WKQ A;  1OT9 A;  2LB9 A;  1UWN X;  2W3E A;  4YNR A;  1OT6 A;  1LSV A;  2JKT M;  3H82 B;  2V1A A;  4NKP A;  3T4L A;  3K2N A;  4QPR A;  5TJJ A;  4BJP A;  3B42 A;  4WN5 A;  4EUV A;  3EGX C;  1OTE A;  3ZYT A;  2XSS A;  2R78 A;  2ZMV A;  4CLC C;  3T4K A;  2K31 A;  2FZ0 A;  4PKY G;  1N9N A;  1T1B A;  2GX5 A;  2Y79 A;  3OC2 A;  4HH2 A;  5IT5 A;  1BYW A;  4FSF A;  2CMN A;  4CLC D;  4PKY A;  3VV4 A;  2JKR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...