1OTRA

Solution structure of a cue-ubiquitin complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
49
structure length
49
Chain Sequence
NDDHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKENDDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a CUE-Ubiquitin Complex Reveals a Conserved Mode of Ubiquitin Binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords protein Cue2
total genus 11
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2003-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1otrA00
2DI0A 2MROB 1G3IA 1WJ7A 2LVOC 3F92A 3FE3A 1Q02A 2KNAA 1HJPA 2ZTDA 1SG9A 2DZLA 1G41A 1UFZA 2JZ1A 3LCVB 1TTEA 2EJSA 1E94E 2JZ0A 1A5TA 1VDLA 1WIVA 2JNHA 2KNZA 3IECA 2BWBA 1VEGA 1G4AE 3T6PA 1C7YA 1JR3E 1WGNA 3B89A 4G3OA 3LCUA 1VQ1A 5DFLA 2DHYA 2JUJA 2OOBA 3GLIE 3K9PA 2DAEA 1HT2E 1EFUB 1WHCA 1OTRA 2JY8A 1T43A 1XB2B 1ZMVA 3GLGE 1R4GA 2EKFA 2MGWA 2OOAA 1PGYA 4F2LA 2QSFX 4HEOA 2QHOB 2ZTCA 2O25A 2MR9A 3GLFE 3IHPA 1P3QQ 2WZJA 2K0BX 1BVSA 1ZV1A 1NV8A 2LVAA 2R0IA 2EKKA 2LBCA 1OKSA 1NV9A 1Y8GA 2KHHA 3FRIA 1MN3A 3E46A 2JP7A 2DAGA 2BWEA 1VEJA 1DV0A 1QZEA 1IFYA 1TR8A 2L2DA 1V92A 5JI2E 2CP8A 2OO9A 2G3QA 2DKLA 1F4IA 2H5XA 2JY6B 1KYIA 2LVPC 2DAKA 2K9DA 1VG5A 4R71A 1VEKA 4F1IA 4DBGB 1DO2A 1CUKA 2MJ5B 2LVNC 3GLHE 2JY7A 4UN2B 1T6OA 3H4JA 1IXSA 3MMPA 1HQYE 1ZMUA 2HWJA 2RRUA 1AIPC 1HT1E 2LTUA 2DENA 1DO0A 2DAMA 2L4EA 4GEWA 1IM2A 3BBZA 3E21A 4WP2A 1XXHE 2B3TA 2DAIA 1WGLA 3K9OA 4Q7JA 1GO5A 1WR1B 2LVQD 1OQYA 1OAIA 1YLAA 2QNJA 2CWBA 2KNVA 1ZMWA 2HAKA 2DNAA 2L4FA 3FRHA 2JY5A
chains in the Genus database with same CATH superfamily
3DZDA 4JN6A 4DUZM 3GRRA 3FE3A 4P17A 1Q02A 4GIPA 2KEBA 2ZTDA 2I7NA 2JZ1A 3M7GA 1AUAA 2CUZA 2VQEM 4LF8M 4CIZA 3DFZA 1NVMA 2BWBA 2Y0TA 3J80S 3TWKA 5JI3E 4OX9M 1G4AE 3FUWA 1QYRA 3T38A 2V6ZM 4DR1M 4XGIA 2QBYA 4DUYM 1TH4A 3W0LB 1XMOM 3RGSA 3U61A 1GVNA 5IREB 4BB9A 4L78A 2QP9X 3RGPA 4HLQA 2JY8A 1WHCA 1OTRA 1XB2B 4XBOA 4MGKE 3NBXX 5EJCA 2OOAA 1PGYA 3HHWA 4QNRA 2FS1A 3U60A 2YQZA 4K0KM 3R9XB 4KHPM 5FTKA 5KPTA 3GQ4A 2ZTCA 1K82A 4LGYA 4Z6YA 5FLXS 4QOZC 5IZ7D 2K0BX 2Y0QA 3TE6A 1OJLA 3BXWA 4JI7M 2JWSA 2R0IA 1C1KA 5GKNA 4Z8XA 5FSWA 4S12A 4LF5M 2APLA 2R45A 3KP0E 1JR3D 3A45A 3HJSA 4IBEA 4L16A 1MN3A 5BPVA 3GLHA 1F4IA 4JI8M 4MB7A 2VF7A 1J09A 4GC9A 1GL6A 1SXJD 4JXJA 1QZEA 5E26A 1N78A 2J7OA 3VDPA 4A3VB 1IFYA 3HJ8A 3PVSA 4NSOB 4NXNM 4M9SA 3HHZA 3U5ZB 2FH0A 4IBFA 2R65A 2L2DA 1QAMA 5ITUA 3UGJA 2Z4RA 2G3QA 4RKUF 1Z5BA 3U6DA 2D7HA 2H5XA 2WSCF 1KYIA 3VDUA 3SMPA 2VQFM 2K9DA 2NQ8C 3L2AA 5EXXA 4NSRA 3ZQJA 3U6CA 2XEPA 1CUKA 3C3EA 2MJ5B 2CV0A 4L4UA 2EA0A 3KOYE 1T6OA 1YSYA 3QWLA 1GJSA 3FUTA 3KSJA 4QHSA 3SMSA 4IBJA 2WSEF 4AKGA 2YR0A 3UJNA 4R3DA 4L15A 5C1BA 4P16A 5ITTA 3GRYA 1OFIA 4LF7M 3EIEA 2E5LM 3GRUA 3KOXE 2C96A 4LJ5A 1PM5A 4DV7M 3SAWA 3I01M 1DGBA 4LJAA 4LZZA 2XLJA 5EP3A 3WHLA 1DO0A 3HHXA 1N34M 1MU5A 1EE8A 2L4EA 3QYBA 4GMQA 4AG5A 4ZPXA 2OQ4A 3SAVA 4DV4M 4WURA 3J2PB 1XWIA 3GPUA 3U6LA 1IBKM 4FCTA 2KW0A 1XXHE 2B3TA 2DAIA 4FVMA 4Q7JA 3GLGB 4LJ7A 1GO5A 3QYEA 4G4NA 1IN6A 1WR1B 1SXJB 5EQTA 1IN7A 1OAIA 2M60A 1YLAA 1L2BA 2FFJA 2KA6B 2R62A 3W0FA 1IXRC 3GLFB 4BBAA 4YHHM 1QUTA 1ZMWA 2HAKA 1IBLM 1D0LA 3B7NA 4I81A 2DVWB 3F92A 1G3IA 4OVZB 3EIHA 2CFOA 1D0MA 3K1JA 2KNAA 1SXJC 1FNNA 3L25A 1QUSA 1NY6A 2L7HA 4L6V6 1FJGM 2EJSA 1E94E 1JQJC 3I4VA 4QOSA 2JZ0A 4PT5A 1VDLA 3HKPA 2KNZA 2VDBB 1IY1A 4DV3M 1TDZA 2X8AA 3IECA 3MHVC 3HHYA 1GLNA 4BLCA 1K3WA 3AOGA 1IN5A 3T6PA 1UM8A 2XSZA 1JR3E 4FCVA 3AOEC 1JB0F 1XXHB 3LCUA 2J5YA 3J7BA 4LFCM 3KS4A 4JI3M 4AW4A 4JI4M 2DHYA 2JUJA 1IXSB 4B08A 5IT9S 2XH9A 4KO8A 2F5PA 1NSFA 3U6EA 3GLIE 1SXJE 4CHTB 3Q8GA 3HY5A 4MGIE 4M0WA 1TGUA 4LF4M 5KPRA 1XMQM 1Q3BA 3GLGE 2HCBA 1Z6TA 3AJIB 1Z59A 4JI0M 2EKFA 3U61B 2CE7A 4B3RM 4IJEA 4RF1A 2QSFX 2Z4SA 1XNQM 2QHOB 1D2NA 1OAOC 1PRBA 1ZAEA 3U6QA 3E4RA 1GABA 2L6OA 2XGNA 3QAUA 5LMNM 3U6SA 2DWNA 2WZJA 4LJ6A 3U60B 1ZV1A 2LVAA 2VF8A 3KSXA 3A98B 4HL4A 1Y8GA 1QDRA 1G8PA 4OW0A 3DOAA 2R46A 1V34A 3C3DA 3E46A 4MH0E 2O01F 1NHWC 2DAGA 1RU3A 3A42A 5FTNA 4L8RC 4QHTA 1DV0A 3KP1E 3R8FA 3JR4A 3ILKA 5EP1A 2WSFF 2KXEA 4RNAA 4LY6A 3ZH9B 4GITA 3T1YM 2K47A 3SASA 2XFTA 3CF6E 2DAKA 4MGZE 1GKIA 3THGA 2Z7JA 2R6FA 3B7QA 2XZFA 2UUAM 1N32M 3VK8A 3KOWE 4F1IA 1TF0B 3L26A 4DR5M 4RF0A 4AI6A 2LVNC 3SHGB 4LF6M 4IBIA 1R2ZA 2C9OA 1IXSA 5ITYA 3ZC7B 2JA2A 2R4EA 1HR0M 4MGHA 3LW5F 2G5GX 2CV2A 4AG6A 1QQWA 1AIPC 4LF9M 2LTUA 3SYKA 3L28A 3LQQA 3NWLA 4NXMM 5IWAM 4DR2M 3KDSE 4DR6M 2UXBM 1IQPA 4G4RA 3KFUG 3LMMA 5FTJA 4AKHA 4YY3M 3TPZA 4DR7M 5KQDA 4DR3M 3LVWA 3AKZA 3K9OA 4DV6M 2CV1A 3Q8XA 3L27A 4KLNA 4G4OA 2LVQD 3HU1A 4CISA 2ZAOA 3KW6A 1ZQ9A 3SFZA 3VLFB 1W5SA 5DNYA 3KS8A 1Q39A 2CRUA 2DWZB 2P5TA 1HQCA 2CWBA 3HJQA 1PJQA 2M5ZA 2Y21A 1MJGM 2L7IA 4I5SA 3H4MA 2V1CA 3FTCA 4I4LA 4JYAM 2DNAA 1TH2A 4LFAM 3SHFA 2F5OA 2F5SA 2JY5A 3M6AA 2DWMA 1IY0A 8CATA 2DI0A 1DGHA 1WJ7A 2JXNA 2LVOC 5ITXE 4IBCA 2OPFA 1QVRA 3PNVA 1ORYB 1S3SA 3FTDA 2V1UA 1HJPA 1G41A 1UFZA 1KSFX 3SAUA 3GLIA 3D8LA 4LGMA 3SC3A 2FE8A 1VEGA 1L2DA 2QPAA 1C7YA 4AZFA 3K2LA 4M9ZA 3B89A 4G3OA 3ZCBB 2CEAA 3TQSA 2Q2EB 1NO1A 2J7NA 3HU2A 1IBMM 4ITQA 3NBIA 4M0DA 2FNAA 2O5RA 2F5NA 1GL7A 4II7A 3B7ZA 3K9PA 1PJJA 3GPPA 1HT2E 1XC8A 3OTOM 4NOOB 2QENA 1T43A 3PFIA 3SARA 1R4GA 3GLGA 4FWGA 2MGWA 2YFQA 2UXCM 2R18A 4HEOA 2G8LA 3HGIA 5EP2A 3M0EA 2O25A 2X49A 4G6ZA 3JR5A 4LRTA 5KPZA 1QZMA 2C99A 3FUUA 3IG5A 2ZANA 3AFHA 1W5TA 2Z8YM 2EKKA 2LNHC 3WHKA 2FOIC 2LBCA 1NV9A 2D7GA 4ANRA 2Z3XA 1VDDA 1L8QA 3KXEC 1R6BX 3B74A 2CHQA 3GP1A 2XZUA 2BWEA 2XF3A 4IBKA 3FD9A 1TR8A 3AOEA 4MM3B 2QZ4A 3T1HM 2KRKA 4MGYE 2CP8A 1HNXM 4DV2M 3LVVA 2QQ8A 1D0KA 3I51A 1QANA 2DKLA 3MJ5A 2GNOA 5ITQA 2LVPC 4OU7A 5KQ8A 4GC5A 3GO8A 4G4QA 2QBYB 4JI1M 3B9PA 2ZBKB 1VG5A 2ZAMA 4R71A 3TWMA 4B3MM 1VEKA 2H1RA 4DBGB 1E9RA 1PJIA 1DO2A 4NL4H 4WW0A 2YNMD 4R7GA 3GLHE 1E9SA 2JY7A 3SBJA 2BJWA 4UN2B 4D82A 3PNYA 1G71A 1I94M 1R5LA 4FWHA 4JV5M 3D8BA 1R7RA 1J5EM 1E32A 5EP4A 1DGHB 2QCUA 2DWLA 1HQYE 1IY2A 2LXEA 1H6UA 5FTLA 2RGOA 3K8ZA 1IXZA 1HT1E 3C58A 2XSZD 4XK8F 1PJTA 4FWDA 3GPXA 1OIPA 4FW9A 4DR4M 1OIZA 2DAMA 3U6OA 2F4VM 3L29A 1IM2A 1OFHA 5A2QS 1IN8A 3BBZA 4DV0M 2X4AA 4LJ8A 3GRVA 4WP2A 1X37A 1Q3CA 3J27B 1SXJA 2EO2A 2Y20A 2KZUA 2LHGA 4FD2A 2UUBM 1I4WA 2ERCA 3RFWA 4JI6M 1JR3A 3AV0A 5H37D 4DV1M 2UUCM 2KNVA 3VFDA 4PDGA 1XHBA 1HNWM 4D81A 2LH0A 4LJ9A 4B3TM 1K3XA 2L4FA 4CJ6A 2KDLA 5F3WA 1TH3A 5DYGA 1XNRM 5ITRA 3FTEA 3K92A 2MROB 4GHLA 3SYLA 3GLIB 3TWLA 1N36M 2R4JA 3UMMA 2BJVA 4AKIA 1SG9A 2DZLA 4X64M 4B7GA 1TTEA 4PCZA 2RKOA 4X66M 1A5TA 1WIVA 2AHMA 2JNHA 2DZOB 2CHVA 3AL0C 1WGNA 2DZNB 4IBDA 2MH8A 4JI5M 2VIIA 4QNMA 1Z5AA 1VQ1A 5DFLA 4B7HA 4D80A 4GH9A 2LWXA 2LHCA 3PXGA 1T3TA 4NRVA 2OOBA 3U6PA 3VK7A 4Y28F 1KFVA 3GQ5A 2DAEA 3U6MA 4LCBA 1EFUB 3V76A 1ZMVA 2HHHM 3UK6A 3C9PA 3IG8A 4B7FA 3W68A 4F2LA 2ZM6M 2MR9A 3GLFE 3IHPA 2BNKA 1P3QQ 4IJFA 1NY5A 3HWSA 1BVSA 2GQFA 3A46A 2D7EA 4LG2A 3HZJA 1NV8A 3VKHA 1QAQA 3FUVA 4LFBM 1OKSA 1YUBA 1J7KA 5FTMA 4CGYB 1HNZM 1PJSA 2W82A 2KHHA 3FRIA 3FUXA 5E6JA 4AQYM 4TUWA 2CHGA 2UXDM 2XFSA 3GLFA 2JP7A 3SATA 1L1ZA 1NHGC 1VEJA 3GLHB 3MK6A 5EXPA 4NRWA 5EXTA 2K6BA 2DHRA 1YE9A 2HKJA 4JI2M 5LMUM 1GJTA 4W5WA 1N77A 1NJGA 1V92A 2KRUA 2OO9A 5JI2E 3J7AS 2I7PA 3CTWB 1QDTA 2JY6B 7CATA 4EIWA 3FTFA 2RGHA 2EUCA 3W67A 5EXSA 1Z5CA 3FKEA 4LZJA 2R44A 4X65M 3FYDA 4IBBA 3J81S 1DGFA 1L2CA 3JAMS 3VKGA 4GRIA 2KZSA 2DXIA 2N35A 3GPYA 5BR8M 3KOZE 3H4JA 4IBGA 1LTMA 5ITXA 1L1TA 4FCWA 2HL7A 3LQRA 3MMPA 2C98A 2L09A 3CF2A 4LRSA 4OVZA 2C9CA 4M9XA 1ZMUA 3FYCA 4LJ4A 2HWJA 4NC6A 2RRUA 5KO3A 2C5RA 3T15A 3UZUA 4GKJM 2DENA 4B3SM 4GKKM 4GHAA 4KODA 3TL4X 4KT0F 4GEWA 5DYIA 1N75A 1TDHA 1WXQA 1V33A 5L8RF 1XXHA 3E21A 3I4YA 3U5ZA 3HU3A 5C18A 4IIWA 3BOSA 1WGLA 3HX3A 3E9SA 2F5QA 4REZA 3DA1A 1G59A 1LV7A 1IN4A 1EIJA 3CF0A 3KVWA 1OQYA 1MX0A 4I8OA 2QNJA 4DV5M 1N33M 3GQ3A 4PD2A 4X62M 3I04M 2UU9M 1NNJA 2A5YB 1R2YA 3FRHA 4PDIA 1QAOA 1NNUC 3CGWA 3LCVB 1NJFA 3RE8A 1DGGA
chains in the Genus database with same CATH topology
2DI0A 2MROB 1G3IA 1WJ7A 2LVOC 3F92A 3FE3A 1Q02A 2KNAA 1HJPA 2ZTDA 1SG9A 2DZLA 1G41A 1UFZA 2JZ1A 3LCVB 1TTEA 2EJSA 1E94E 2JZ0A 1A5TA 1VDLA 1WIVA 2JNHA 2KNZA 3IECA 2BWBA 1VEGA 1G4AE 3T6PA 1C7YA 1JR3E 1WGNA 3B89A 4G3OA 3LCUA 1VQ1A 5DFLA 2DHYA 2JUJA 2OOBA 3GLIE 3K9PA 2DAEA 1HT2E 1EFUB 1WHCA 1OTRA 2JY8A 1T43A 1XB2B 1ZMVA 3GLGE 1R4GA 2EKFA 2MGWA 2OOAA 1PGYA 4F2LA 2QSFX 4HEOA 2QHOB 2ZTCA 2O25A 2MR9A 3GLFE 3IHPA 1P3QQ 2WZJA 2K0BX 1BVSA 1ZV1A 1NV8A 2LVAA 2R0IA 2EKKA 2LBCA 1OKSA 1NV9A 1Y8GA 2KHHA 3FRIA 1MN3A 3E46A 2JP7A 2DAGA 2BWEA 1VEJA 1DV0A 1QZEA 1IFYA 1TR8A 2L2DA 1V92A 5JI2E 2CP8A 2OO9A 2G3QA 2DKLA 1F4IA 2H5XA 2JY6B 1KYIA 2LVPC 2DAKA 2K9DA 1VG5A 4R71A 1VEKA 4F1IA 4DBGB 1DO2A 1CUKA 2MJ5B 2LVNC 3GLHE 2JY7A 4UN2B 1T6OA 3H4JA 1IXSA 3MMPA 1HQYE 1ZMUA 2HWJA 2RRUA 1AIPC 1HT1E 2LTUA 2DENA 1DO0A 2DAMA 2L4EA 4GEWA 1IM2A 3BBZA 3E21A 4WP2A 1XXHE 2B3TA 2DAIA 1WGLA 3K9OA 4Q7JA 1GO5A 1WR1B 2LVQD 1OQYA 1OAIA 1YLAA 2QNJA 2CWBA 2KNVA 1ZMWA 2HAKA 2DNAA 2L4FA 3FRHA 2JY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI0 A;  2MRO B;  1G3I A;  1WJ7 A;  2LVO C;  3F92 A;  3FE3 A;  1Q02 A;  2KNA A;  1HJP A;  2ZTD A;  1SG9 A;  2DZL A;  1G41 A;  1UFZ A;  2JZ1 A;  3LCV B;  1TTE A;  2EJS A;  1E94 E;  2JZ0 A;  1A5T A;  1VDL A;  1WIV A;  2JNH A;  2KNZ A;  3IEC A;  2BWB A;  1VEG A;  1G4A E;  3T6P A;  1C7Y A;  1JR3 E;  1WGN A;  3B89 A;  4G3O A;  3LCU A;  1VQ1 A;  5DFL A;  2DHY A;  2JUJ A;  2OOB A;  3GLI E;  3K9P A;  2DAE A;  1HT2 E;  1EFU B;  1WHC A;  1OTR A;  2JY8 A;  1T43 A;  1XB2 B;  1ZMV A;  3GLG E;  1R4G A;  2EKF A;  2MGW A;  2OOA A;  1PGY A;  4F2L A;  2QSF X;  4HEO A;  2QHO B;  2ZTC A;  2O25 A;  2MR9 A;  3GLF E;  3IHP A;  1P3Q Q;  2WZJ A;  2K0B X;  1BVS A;  1ZV1 A;  1NV8 A;  2LVA A;  2R0I A;  2EKK A;  2LBC A;  1OKS A;  1NV9 A;  1Y8G A;  2KHH A;  3FRI A;  1MN3 A;  3E46 A;  2JP7 A;  2DAG A;  2BWE A;  1VEJ A;  1DV0 A;  1QZE A;  1IFY A;  1TR8 A;  2L2D A;  1V92 A;  5JI2 E;  2CP8 A;  2OO9 A;  2G3Q A;  2DKL A;  1F4I A;  2H5X A;  2JY6 B;  1KYI A;  2LVP C;  2DAK A;  2K9D A;  1VG5 A;  4R71 A;  1VEK A;  4F1I A;  4DBG B;  1DO2 A;  1CUK A;  2MJ5 B;  2LVN C;  3GLH E;  2JY7 A;  4UN2 B;  1T6O A;  3H4J A;  1IXS A;  3MMP A;  1HQY E;  1ZMU A;  2HWJ A;  2RRU A;  1AIP C;  1HT1 E;  2LTU A;  2DEN A;  1DO0 A;  2DAM A;  2L4E A;  4GEW A;  1IM2 A;  3BBZ A;  3E21 A;  4WP2 A;  1XXH E;  2B3T A;  2DAI A;  1WGL A;  3K9O A;  4Q7J A;  1GO5 A;  1WR1 B;  2LVQ D;  1OQY A;  1OAI A;  1YLA A;  2QNJ A;  2CWB A;  2KNV A;  1ZMW A;  2HAK A;  2DNA A;  2L4F A;  3FRH A;  2JY5 A; 
#chains in the Genus database with same CATH topology
 3DZD A;  4JN6 A;  4DUZ M;  3GRR A;  3FE3 A;  4P17 A;  1Q02 A;  4GIP A;  2KEB A;  2ZTD A;  2I7N A;  2JZ1 A;  3M7G A;  1AUA A;  2CUZ A;  2VQE M;  4LF8 M;  4CIZ A;  3DFZ A;  1NVM A;  2BWB A;  2Y0T A;  3J80 S;  3TWK A;  5JI3 E;  4OX9 M;  1G4A E;  3FUW A;  1QYR A;  3T38 A;  2V6Z M;  4DR1 M;  4XGI A;  2QBY A;  4DUY M;  1TH4 A;  3W0L B;  1XMO M;  3RGS A;  3U61 A;  1GVN A;  5IRE B;  4BB9 A;  4L78 A;  2QP9 X;  3RGP A;  4HLQ A;  2JY8 A;  1WHC A;  1OTR A;  1XB2 B;  4XBO A;  4MGK E;  3NBX X;  5EJC A;  2OOA A;  1PGY A;  3HHW A;  4QNR A;  2FS1 A;  3U60 A;  2YQZ A;  4K0K M;  3R9X B;  4KHP M;  5FTK A;  5KPT A;  3GQ4 A;  2ZTC A;  1K82 A;  4LGY A;  4Z6Y A;  5FLX S;  4QOZ C;  5IZ7 D;  2K0B X;  2Y0Q A;  3TE6 A;  1OJL A;  3BXW A;  4JI7 M;  2JWS A;  2R0I A;  1C1K A;  5GKN A;  4Z8X A;  5FSW A;  4S12 A;  4LF5 M;  2APL A;  2R45 A;  3KP0 E;  1JR3 D;  3A45 A;  3HJS A;  4IBE A;  4L16 A;  1MN3 A;  5BPV A;  3GLH A;  1F4I A;  4JI8 M;  4MB7 A;  2VF7 A;  1J09 A;  4GC9 A;  1GL6 A;  1SXJ D;  4JXJ A;  1QZE A;  5E26 A;  1N78 A;  2J7O A;  3VDP A;  4A3V B;  1IFY A;  3HJ8 A;  3PVS A;  4NSO B;  4NXN M;  4M9S A;  3HHZ A;  3U5Z B;  2FH0 A;  4IBF A;  2R65 A;  2L2D A;  1QAM A;  5ITU A;  3UGJ A;  2Z4R A;  2G3Q A;  4RKU F;  1Z5B A;  3U6D A;  2D7H A;  2H5X A;  2WSC F;  1KYI A;  3VDU A;  3SMP A;  2VQF M;  2K9D A;  2NQ8 C;  3L2A A;  5EXX A;  4NSR A;  3ZQJ A;  3U6C A;  2XEP A;  1CUK A;  3C3E A;  2MJ5 B;  2CV0 A;  4L4U A;  2EA0 A;  3KOY E;  1T6O A;  1YSY A;  3QWL A;  1GJS A;  3FUT A;  3KSJ A;  4QHS A;  3SMS A;  4IBJ A;  2WSE F;  4AKG A;  2YR0 A;  3UJN A;  4R3D A;  4L15 A;  5C1B A;  4P16 A;  5ITT A;  3GRY A;  1OFI A;  4LF7 M;  3EIE A;  2E5L M;  3GRU A;  3KOX E;  2C96 A;  4LJ5 A;  1PM5 A;  4DV7 M;  3SAW A;  3I01 M;  1DGB A;  4LJA A;  4LZZ A;  2XLJ A;  5EP3 A;  3WHL A;  1DO0 A;  3HHX A;  1N34 M;  1MU5 A;  1EE8 A;  2L4E A;  3QYB A;  4GMQ A;  4AG5 A;  4ZPX A;  2OQ4 A;  3SAV A;  4DV4 M;  4WUR A;  3J2P B;  1XWI A;  3GPU A;  3U6L A;  1IBK M;  4FCT A;  2KW0 A;  1XXH E;  2B3T A;  2DAI A;  4FVM A;  4Q7J A;  3GLG B;  4LJ7 A;  1GO5 A;  3QYE A;  4G4N A;  1IN6 A;  1WR1 B;  1SXJ B;  5EQT A;  1IN7 A;  1OAI A;  2M60 A;  1YLA A;  1L2B A;  2FFJ A;  2KA6 B;  2R62 A;  3W0F A;  1IXR C;  3GLF B;  4BBA A;  4YHH M;  1QUT A;  1ZMW A;  2HAK A;  1IBL M;  1D0L A;  3B7N A;  4I81 A;  2DVW B;  3F92 A;  1G3I A;  4OVZ B;  3EIH A;  2CFO A;  1D0M A;  3K1J A;  2KNA A;  1SXJ C;  1FNN A;  3L25 A;  1QUS A;  1NY6 A;  2L7H A;  4L6V 6;  1FJG M;  2EJS A;  1E94 E;  1JQJ C;  3I4V A;  4QOS A;  2JZ0 A;  4PT5 A;  1VDL A;  3HKP A;  2KNZ A;  2VDB B;  1IY1 A;  4DV3 M;  1TDZ A;  2X8A A;  3IEC A;  3MHV C;  3HHY A;  1GLN A;  4BLC A;  1K3W A;  3AOG A;  1IN5 A;  3T6P A;  1UM8 A;  2XSZ A;  1JR3 E;  4FCV A;  3AOE C;  1JB0 F;  1XXH B;  3LCU A;  2J5Y A;  3J7B A;  4LFC M;  3KS4 A;  4JI3 M;  4AW4 A;  4JI4 M;  2DHY A;  2JUJ A;  1IXS B;  4B08 A;  5IT9 S;  2XH9 A;  4KO8 A;  2F5P A;  1NSF A;  3U6E A;  3GLI E;  1SXJ E;  4CHT B;  3Q8G A;  3HY5 A;  4MGI E;  4M0W A;  1TGU A;  4LF4 M;  5KPR A;  1XMQ M;  1Q3B A;  3GLG E;  2HCB A;  1Z6T A;  3AJI B;  1Z59 A;  4JI0 M;  2EKF A;  3U61 B;  2CE7 A;  4B3R M;  4IJE A;  4RF1 A;  2QSF X;  2Z4S A;  1XNQ M;  2QHO B;  1D2N A;  1OAO C;  1PRB A;  1ZAE A;  3U6Q A;  3E4R A;  1GAB A;  2L6O A;  2XGN A;  3QAU A;  5LMN M;  3U6S A;  2DWN A;  2WZJ A;  4LJ6 A;  3U60 B;  1ZV1 A;  2LVA A;  2VF8 A;  3KSX A;  3A98 B;  4HL4 A;  1Y8G A;  1QDR A;  1G8P A;  4OW0 A;  3DOA A;  2R46 A;  1V34 A;  3C3D A;  3E46 A;  4MH0 E;  2O01 F;  1NHW C;  2DAG A;  1RU3 A;  3A42 A;  5FTN A;  4L8R C;  4QHT A;  1DV0 A;  3KP1 E;  3R8F A;  3JR4 A;  3ILK A;  5EP1 A;  2WSF F;  2KXE A;  4RNA A;  4LY6 A;  3ZH9 B;  4GIT A;  3T1Y M;  2K47 A;  3SAS A;  2XFT A;  3CF6 E;  2DAK A;  4MGZ E;  1GKI A;  3THG A;  2Z7J A;  2R6F A;  3B7Q A;  2XZF A;  2UUA M;  1N32 M;  3VK8 A;  3KOW E;  4F1I A;  1TF0 B;  3L26 A;  4DR5 M;  4RF0 A;  4AI6 A;  2LVN C;  3SHG B;  4LF6 M;  4IBI A;  1R2Z A;  2C9O A;  1IXS A;  5ITY A;  3ZC7 B;  2JA2 A;  2R4E A;  1HR0 M;  4MGH A;  3LW5 F;  2G5G X;  2CV2 A;  4AG6 A;  1QQW A;  1AIP C;  4LF9 M;  2LTU A;  3SYK A;  3L28 A;  3LQQ A;  3NWL A;  4NXM M;  5IWA M;  4DR2 M;  3KDS E;  4DR6 M;  2UXB M;  1IQP A;  4G4R A;  3KFU G;  3LMM A;  5FTJ A;  4AKH A;  4YY3 M;  3TPZ A;  4DR7 M;  5KQD A;  4DR3 M;  3LVW A;  3AKZ A;  3K9O A;  4DV6 M;  2CV1 A;  3Q8X A;  3L27 A;  4KLN A;  4G4O A;  2LVQ D;  3HU1 A;  4CIS A;  2ZAO A;  3KW6 A;  1ZQ9 A;  3SFZ A;  3VLF B;  1W5S A;  5DNY A;  3KS8 A;  1Q39 A;  2CRU A;  2DWZ B;  2P5T A;  1HQC A;  2CWB A;  3HJQ A;  1PJQ A;  2M5Z A;  2Y21 A;  1MJG M;  2L7I A;  4I5S A;  3H4M A;  2V1C A;  3FTC A;  4I4L A;  4JYA M;  2DNA A;  1TH2 A;  4LFA M;  3SHF A;  2F5O A;  2F5S A;  2JY5 A;  3M6A A;  2DWM A;  1IY0 A;  8CAT A;  2DI0 A;  1DGH A;  1WJ7 A;  2JXN A;  2LVO C;  5ITX E;  4IBC A;  2OPF A;  1QVR A;  3PNV A;  1ORY B;  1S3S A;  3FTD A;  2V1U A;  1HJP A;  1G41 A;  1UFZ A;  1KSF X;  3SAU A;  3GLI A;  3D8L A;  4LGM A;  3SC3 A;  2FE8 A;  1VEG A;  1L2D A;  2QPA A;  1C7Y A;  4AZF A;  3K2L A;  4M9Z A;  3B89 A;  4G3O A;  3ZCB B;  2CEA A;  3TQS A;  2Q2E B;  1NO1 A;  2J7N A;  3HU2 A;  1IBM M;  4ITQ A;  3NBI A;  4M0D A;  2FNA A;  2O5R A;  2F5N A;  1GL7 A;  4II7 A;  3B7Z A;  3K9P A;  1PJJ A;  3GPP A;  1HT2 E;  1XC8 A;  3OTO M;  4NOO B;  2QEN A;  1T43 A;  3PFI A;  3SAR A;  1R4G A;  3GLG A;  4FWG A;  2MGW A;  2YFQ A;  2UXC M;  2R18 A;  4HEO A;  2G8L A;  3HGI A;  5EP2 A;  3M0E A;  2O25 A;  2X49 A;  4G6Z A;  3JR5 A;  4LRT A;  5KPZ A;  1QZM A;  2C99 A;  3FUU A;  3IG5 A;  2ZAN A;  3AFH A;  1W5T A;  2Z8Y M;  2EKK A;  2LNH C;  3WHK A;  2FOI C;  2LBC A;  1NV9 A;  2D7G A;  4ANR A;  2Z3X A;  1VDD A;  1L8Q A;  3KXE C;  1R6B X;  3B74 A;  2CHQ A;  3GP1 A;  2XZU A;  2BWE A;  2XF3 A;  4IBK A;  3FD9 A;  1TR8 A;  3AOE A;  4MM3 B;  2QZ4 A;  3T1H M;  2KRK A;  4MGY E;  2CP8 A;  1HNX M;  4DV2 M;  3LVV A;  2QQ8 A;  1D0K A;  3I51 A;  1QAN A;  2DKL A;  3MJ5 A;  2GNO A;  5ITQ A;  2LVP C;  4OU7 A;  5KQ8 A;  4GC5 A;  3GO8 A;  4G4Q A;  2QBY B;  4JI1 M;  3B9P A;  2ZBK B;  1VG5 A;  2ZAM A;  4R71 A;  3TWM A;  4B3M M;  1VEK A;  2H1R A;  4DBG B;  1E9R A;  1PJI A;  1DO2 A;  4NL4 H;  4WW0 A;  2YNM D;  4R7G A;  3GLH E;  1E9S A;  2JY7 A;  3SBJ A;  2BJW A;  4UN2 B;  4D82 A;  3PNY A;  1G71 A;  1I94 M;  1R5L A;  4FWH A;  4JV5 M;  3D8B A;  1R7R A;  1J5E M;  1E32 A;  5EP4 A;  1DGH B;  2QCU A;  2DWL A;  1HQY E;  1IY2 A;  2LXE A;  1H6U A;  5FTL A;  2RGO A;  3K8Z A;  1IXZ A;  1HT1 E;  3C58 A;  2XSZ D;  4XK8 F;  1PJT A;  4FWD A;  3GPX A;  1OIP A;  4FW9 A;  4DR4 M;  1OIZ A;  2DAM A;  3U6O A;  2F4V M;  3L29 A;  1IM2 A;  1OFH A;  5A2Q S;  1IN8 A;  3BBZ A;  4DV0 M;  2X4A A;  4LJ8 A;  3GRV A;  4WP2 A;  1X37 A;  1Q3C A;  3J27 B;  1SXJ A;  2EO2 A;  2Y20 A;  2KZU A;  2LHG A;  4FD2 A;  2UUB M;  1I4W A;  2ERC A;  3RFW A;  4JI6 M;  1JR3 A;  3AV0 A;  5H37 D;  4DV1 M;  2UUC M;  2KNV A;  3VFD A;  4PDG A;  1XHB A;  1HNW M;  4D81 A;  2LH0 A;  4LJ9 A;  4B3T M;  1K3X A;  2L4F A;  4CJ6 A;  2KDL A;  5F3W A;  1TH3 A;  5DYG A;  1XNR M;  5ITR A;  3FTE A;  3K92 A;  2MRO B;  4GHL A;  3SYL A;  3GLI B;  3TWL A;  1N36 M;  2R4J A;  3UMM A;  2BJV A;  4AKI A;  1SG9 A;  2DZL A;  4X64 M;  4B7G A;  1TTE A;  4PCZ A;  2RKO A;  4X66 M;  1A5T A;  1WIV A;  2AHM A;  2JNH A;  2DZO B;  2CHV A;  3AL0 C;  1WGN A;  2DZN B;  4IBD A;  2MH8 A;  4JI5 M;  2VII A;  4QNM A;  1Z5A A;  1VQ1 A;  5DFL A;  4B7H A;  4D80 A;  4GH9 A;  2LWX A;  2LHC A;  3PXG A;  1T3T A;  4NRV A;  2OOB A;  3U6P A;  3VK7 A;  4Y28 F;  1KFV A;  3GQ5 A;  2DAE A;  3U6M A;  4LCB A;  1EFU B;  3V76 A;  1ZMV A;  2HHH M;  3UK6 A;  3C9P A;  3IG8 A;  4B7F A;  3W68 A;  4F2L A;  2ZM6 M;  2MR9 A;  3GLF E;  3IHP A;  2BNK A;  1P3Q Q;  4IJF A;  1NY5 A;  3HWS A;  1BVS A;  2GQF A;  3A46 A;  2D7E A;  4LG2 A;  3HZJ A;  1NV8 A;  3VKH A;  1QAQ A;  3FUV A;  4LFB M;  1OKS A;  1YUB A;  1J7K A;  5FTM A;  4CGY B;  1HNZ M;  1PJS A;  2W82 A;  2KHH A;  3FRI A;  3FUX A;  5E6J A;  4AQY M;  4TUW A;  2CHG A;  2UXD M;  2XFS A;  3GLF A;  2JP7 A;  3SAT A;  1L1Z A;  1NHG C;  1VEJ A;  3GLH B;  3MK6 A;  5EXP A;  4NRW A;  5EXT A;  2K6B A;  2DHR A;  1YE9 A;  2HKJ A;  4JI2 M;  5LMU M;  1GJT A;  4W5W A;  1N77 A;  1NJG A;  1V92 A;  2KRU A;  2OO9 A;  5JI2 E;  3J7A S;  2I7P A;  3CTW B;  1QDT A;  2JY6 B;  7CAT A;  4EIW A;  3FTF A;  2RGH A;  2EUC A;  3W67 A;  5EXS A;  1Z5C A;  3FKE A;  4LZJ A;  2R44 A;  4X65 M;  3FYD A;  4IBB A;  3J81 S;  1DGF A;  1L2C A;  3JAM S;  3VKG A;  4GRI A;  2KZS A;  2DXI A;  2N35 A;  3GPY A;  5BR8 M;  3KOZ E;  3H4J A;  4IBG A;  1LTM A;  5ITX A;  1L1T A;  4FCW A;  2HL7 A;  3LQR A;  3MMP A;  2C98 A;  2L09 A;  3CF2 A;  4LRS A;  4OVZ A;  2C9C A;  4M9X A;  1ZMU A;  3FYC A;  4LJ4 A;  2HWJ A;  4NC6 A;  2RRU A;  5KO3 A;  2C5R A;  3T15 A;  3UZU A;  4GKJ M;  2DEN A;  4B3S M;  4GKK M;  4GHA A;  4KOD A;  3TL4 X;  4KT0 F;  4GEW A;  5DYI A;  1N75 A;  1TDH A;  1WXQ A;  1V33 A;  5L8R F;  1XXH A;  3E21 A;  3I4Y A;  3U5Z A;  3HU3 A;  5C18 A;  4IIW A;  3BOS A;  1WGL A;  3HX3 A;  3E9S A;  2F5Q A;  4REZ A;  3DA1 A;  1G59 A;  1LV7 A;  1IN4 A;  1EIJ A;  3CF0 A;  3KVW A;  1OQY A;  1MX0 A;  4I8O A;  2QNJ A;  4DV5 M;  1N33 M;  3GQ3 A;  4PD2 A;  4X62 M;  3I04 M;  2UU9 M;  1NNJ A;  2A5Y B;  1R2Y A;  3FRH A;  4PDI A;  1QAO A;  1NNU C;  3CGW A;  3LCV B;  1NJF A;  3RE8 A;  1DGG A; 
#chains in the Genus database with same CATH homology
 2DI0 A;  2MRO B;  1G3I A;  1WJ7 A;  2LVO C;  3F92 A;  3FE3 A;  1Q02 A;  2KNA A;  1HJP A;  2ZTD A;  1SG9 A;  2DZL A;  1G41 A;  1UFZ A;  2JZ1 A;  3LCV B;  1TTE A;  2EJS A;  1E94 E;  2JZ0 A;  1A5T A;  1VDL A;  1WIV A;  2JNH A;  2KNZ A;  3IEC A;  2BWB A;  1VEG A;  1G4A E;  3T6P A;  1C7Y A;  1JR3 E;  1WGN A;  3B89 A;  4G3O A;  3LCU A;  1VQ1 A;  5DFL A;  2DHY A;  2JUJ A;  2OOB A;  3GLI E;  3K9P A;  2DAE A;  1HT2 E;  1EFU B;  1WHC A;  1OTR A;  2JY8 A;  1T43 A;  1XB2 B;  1ZMV A;  3GLG E;  1R4G A;  2EKF A;  2MGW A;  2OOA A;  1PGY A;  4F2L A;  2QSF X;  4HEO A;  2QHO B;  2ZTC A;  2O25 A;  2MR9 A;  3GLF E;  3IHP A;  1P3Q Q;  2WZJ A;  2K0B X;  1BVS A;  1ZV1 A;  1NV8 A;  2LVA A;  2R0I A;  2EKK A;  2LBC A;  1OKS A;  1NV9 A;  1Y8G A;  2KHH A;  3FRI A;  1MN3 A;  3E46 A;  2JP7 A;  2DAG A;  2BWE A;  1VEJ A;  1DV0 A;  1QZE A;  1IFY A;  1TR8 A;  2L2D A;  1V92 A;  5JI2 E;  2CP8 A;  2OO9 A;  2G3Q A;  2DKL A;  1F4I A;  2H5X A;  2JY6 B;  1KYI A;  2LVP C;  2DAK A;  2K9D A;  1VG5 A;  4R71 A;  1VEK A;  4F1I A;  4DBG B;  1DO2 A;  1CUK A;  2MJ5 B;  2LVN C;  3GLH E;  2JY7 A;  4UN2 B;  1T6O A;  3H4J A;  1IXS A;  3MMP A;  1HQY E;  1ZMU A;  2HWJ A;  2RRU A;  1AIP C;  1HT1 E;  2LTU A;  2DEN A;  1DO0 A;  2DAM A;  2L4E A;  4GEW A;  1IM2 A;  3BBZ A;  3E21 A;  4WP2 A;  1XXH E;  2B3T A;  2DAI A;  1WGL A;  3K9O A;  4Q7J A;  1GO5 A;  1WR1 B;  2LVQ D;  1OQY A;  1OAI A;  1YLA A;  2QNJ A;  2CWB A;  2KNV A;  1ZMW A;  2HAK A;  2DNA A;  2L4F A;  3FRH A;  2JY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...