1OTRA

Solution structure of a cue-ubiquitin complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
49
structure length
49
Chain Sequence
NDDHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKENDDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Cue2
publication title Solution Structure of a CUE-Ubiquitin Complex Reveals a Conserved Mode of Ubiquitin Binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 11
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2003-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1otrA00
1UFZA 1P3QQ 1DO0A 1QZEA 2LBCA 4GEWA 1R4GA 1YLAA 2EKKA 3GLHE 3T6PA 2WZJA 3H4JA 1Q02A 1ZV1A 3MMPA 2H5XA 2OO9A 3B89A 2BWEA 1HT2E 2LVNC 1G41A 2KNZA 2QSFX 2RRUA 1XB2B 2OOAA 3K9OA 2JY8A 2L4EA 2DI0A 2LTUA 1C7YA 1F4IA 1CUKA 1BVSA 2JP7A 3LCVB 1OTRA 4F1IA 2LVQD 1ZMWA 2KNAA 3E21A 1GO5A 2B3TA 3FRHA 1A5TA 1WGLA 3F92A 3FRIA 2JZ1A 3IECA 2ZTDA 2KNVA 1WGNA 5JI2E 2DAGA 2JY6B 2QNJA 1Y8GA 1IXSA 1WR1B 1SG9A 2JY5A 2R0IA 3GLIE 1HJPA 2CWBA 3IHPA 2ZTCA 4HEOA 1OAIA 4UN2B 1ZMUA 1TR8A 1KYIA 2DAKA 5DFLA 1TTEA 1HQYE 3E46A 2G3QA 2DENA 1VEKA 2LVPC 1VDLA 4DBGB 1MN3A 2DAMA 2HAKA 1VEJA 2LVAA 1OQYA 3GLGE 1NV9A 2QHOB 2EKFA 2BWBA 1IM2A 2O25A 1DO2A 3BBZA 4G3OA 1VQ1A 4R71A 1G4AE 3FE3A 1PGYA 2MR9A 2OOBA 1T6OA 2LVOC 2JZ0A 2JNHA 4Q7JA 2DHYA 1WHCA 2DKLA 2K0BX 1NV8A 1G3IA 2JY7A 2L4FA 1E94E 1WIVA 4WP2A 2EJSA 2MROB 1T43A 2DAEA 1VEGA 1IFYA 1ZMVA 2JUJA 2KHHA 2L2DA 1DV0A 2CP8A 1VG5A 1WJ7A 2DAIA 1EFUB 1HT1E 2HWJA 2MJ5B 2DNAA 1JR3E 1V92A 2K9DA 2MGWA 1XXHE 3GLFE 2DZLA 3K9PA 4F2LA 3LCUA 1OKSA 1AIPC
chains in the Genus database with same CATH superfamily
4JI6M 1XC8A 1P3QQ 2F5PA 1DO0A 1E9RA 1QZEA 4GEWA 1R4GA 1NNJA 2ZAOA 4LJ8A 1ZQ9A 4LF9M 4MGYE 3T6PA 1L8QA 2BJWA 4G4OA 4LFCM 1Q3BA 5KO3A 1HNWM 3CTWB 1DGHA 1Q02A 3LMMA 4QNMA 1IXSB 4MB7A 4Z6YA 1ZV1A 1V34A 3Q8XA 2L7IA 3KOWE 4P16A 5ITXA 3UGJA 4CHTB 4ZPXA 2CEAA 5L8RF 2O01F 4ITQA 3B89A 4XGIA 1C1KA 3GPXA 5EQTA 1J09A 4TUWA 3CGWA 4P17A 1W5TA 4DR2M 2DVWB 3K9OA 4LZZA 2M60A 1N36M 1NNUC 2LTUA 1C7YA 1HR0M 4QOZC 3LCVB 2O5RA 3TL4X 2MH8A 4F1IA 2OPFA 2KZSA 1QYRA 3A98B 5EP2A 2LH0A 3FRHA 4NL4H 4AKGA 4MM3B 2XZFA 2FH0A 4B3MM 1IXZA 1XWIA 1R6BX 3B7ZA 3LQQA 4MGHA 4B7FA 2HL7A 4X65M 2DAGA 2JY6B 2C9OA 3CF0A 1SG9A 3I51A 5E6JA 4CJ6A 4AKIA 3I01M 2CWBA 2R62A 4JI4M 3IHPA 4AW4A 2R45A 3AOGA 4IBJA 3GQ3A 1OAIA 2YQZA 3AKZA 2UUBM 4UN2B 3TQSA 3TWMA 1R2ZA 4Z8XA 5EP3A 5KPTA 4KO8A 4M9SA 4IBFA 1VDDA 2Z8YM 1Z5AA 3U5ZA 2A5YB 3CF2A 5DFLA 3UZUA 4AG6A 4ANRA 4BB9A 3GPYA 2DENA 4FCVA 2LVPC 4LF6M 1H6UA 2UXCM 2CHGA 4DV4M 5A2QS 1MN3A 3BOSA 3PNVA 2HAKA 1JB0F 2LHGA 1GVNA 3PFIA 1VEJA 2RKOA 2LVAA 1UM8A 4OU7A 4DR6M 3HX3A 1KFVA 4I8OA 2DWMA 2KW0A 2QHOB 2EKFA 2R46A 3R8FA 3M7GA 1IM2A 3FE3A 4CGYB 1HQCA 3T1HM 2C5RA 2OOBA 4IBDA 2I7PA 4RF1A 5DYGA 3NBXX 3SHGB 2JNHA 3KSJA 1NVMA 2KXEA 4Q7JA 4D81A 2F5QA 3U60A 4I4LA 2DKLA 1JR3D 1G3IA 1DGBA 2Q2EB 3FUXA 1Z6TA 3GLHA 1WXQA 3D8LA 4MGZE 5EXTA 3L26A 5ITQA 2DAEA 2C96A 3HU3A 3HZJA 1K3XA 4G4QA 3FUWA 3VFDA 3OTOM 3FUUA 4R7GA 4LFAM 4PDIA 5BPVA 1TH4A 1VG5A 4BLCA 1G59A 1HT1E 4I81A 1N33M 2XFSA 3THGA 1QUTA 2DNAA 3UK6A 2K9DA 4IBIA 4FWDA 2L6OA 3RGPA 5FTLA 2V1UA 1OAOC 3GLFE 1LTMA 5FTKA 4IJFA 1N77A 2QBYA 4B3SM 1OKSA 1AIPC 4L78A 4AZFA 3U61A 3PNYA 2C99A 4S12A 3EIHA 4G6ZA 5EJCA 4AG5A 3FTDA 2EKKA 3HWSA 1OFIA 3AL0C 5EXPA 4NOOB 3AFHA 3FYDA 2ZBKB 4IBGA 5BR8M 4OW0A 4LGYA 4NXNM 3VK7A 5GKNA 3GLGA 1IBMM 1G71A 2W82A 1D0KA 3B74A 5FSWA 3M6AA 1SXJC 3KOYE 2LNHC 2OO9A 2UUAM 4AQYM 5ITRA 2QSFX 2KNZA 3BXWA 4K0KM 4JYAM 1IQPA 2APLA 1XB2B 4PD2A 3J27B 3U6LA 2EA0A 3V76A 2OOAA 4R3DA 2RGHA 3U6CA 2ERCA 1NY6A 1MU5A 2DI0A 4RF0A 1XMOM 1BVSA 5IT9S 4DR5M 4B7HA 4LJ5A 2CE7A 4FCWA 3HHXA 3HU1A 4LJAA 4B7GA 4KHPM 2YNMD 4IIWA 4GRIA 3JR4A 1RU3A 3F92A 1PRBA 2NQ8C 2Y0TA 3HJ8A 4CISA 2H1RA 4JI5M 5E26A 1ORYB 2KNVA 1J5EM 2EUCA 1IXRC 2OQ4A 3HHZA 2XSZA 1Y8GA 2R0IA 4M9ZA 3VDUA 3GLFB 3GLIE 2CV2A 1GABA 4DV1M 2WSEF 3U6QA 2UXDM 4I5SA 3MJ5A 3SAUA 2ZTCA 4FCTA 4HEOA 2XEPA 3C3DA 3E9SA 3TWLA 3A45A 3KS8A 1TR8A 5JI3E 1MX0A 3QWLA 2AHMA 3FUTA 2XLJA 4OVZB 3MHVC 4X66M 3AV0A 2DAKA 1PJSA 3R9XB 4LF7M 4X64M 4MGIE 3MK6A 1QDTA 2Z4RA 2DAMA 3FTCA 4EIWA 2R18A 3SASA 1Q3CA 5EP1A 4GC5A 3SMSA 1QVRA 2Y20A 1IY2A 4JI8M 1EE8A 3KOZE 4Y28F 4RKUF 2GQFA 2M5ZA 4LJ7A 3SMPA 3VLFB 3U6MA 1JR3A 3SYLA 3SHFA 3TWKA 3GQ5A 2K47A 1D0LA 2G8LA 1VQ1A 2V6ZM 1XXHA 2R65A 1I4WA 4DV5M 5ITUA 3J81S 3LVWA 3RFWA 3SARA 1LV7A 5H37D 3GQ4A 4CIZA 1JQJC 2CV0A 1ZAEA 2YFQA 4HLQA 1QUSA 3K1JA 3C58A 3KFUG 1EIJA 2VQFM 2K0BX 1NV8A 2XSZD 2ZANA 4GITA 3W68A 1E94E 1DGHB 3L28A 3IG8A 4KODA 4LF5M 1GKIA 4WP2A 2EJSA 2Z7JA 3QAUA 2R4JA 4DV3M 1IN4A 3HHWA 3TPZA 4LJ4A 4JV5M 1HNXM 2KHHA 3GLIB 5IREB 2CP8A 4LCBA 1WJ7A 2CV1A 1IN6A 1IBKM 2DAIA 2HWJA 2DXIA 4L6V6 2F5SA 4QOSA 1IN5A 1V92A 4KLNA 1GL7A 1YUBA 1NHWC 1QAQA 2DZLA 1Q39A 1TF0B 2FOIC 1T3TA 2L7HA 2KDLA 1SXJE 3LW5F 3LCUA 3LVVA 4IJEA 4NRVA 1QAOA 1G8PA 3A42A 3KP1E 4X62M 2JWSA 3C3EA 3T1YM 4IBKA 4JI7M 1PM5A 2LBCA 2QZ4A 2C98A 1QQWA 3KVWA 3AOEA 3GLHE 4W5WA 1D2NA 3H4JA 3J2PB 4FWHA 4M0WA 3ZH9B 2E5LM 3FKEA 1XHBA 4IBCA 2L09A 1PJQA 3D8BA 5EP4A 1K82A 5FTMA 1N34M 3GRVA 1Z59A 2H5XA 3C9PA 5KPRA 1HNZM 2BWEA 3QYEA 1G41A 4B3TM 1PJTA 2D7EA 2ZM6M 2RRUA 3HU2A 3K8ZA 1MJGM 3U6DA 3U5ZB 4NRWA 5KPZA 3ZCBB 2DZOB 5ITYA 4NXMM 3KSXA 3SAWA 3DZDA 3GP1A 4BBAA 4JI3M 3FD9A 3W0FA 4JI2M 2WSFF 3SAVA 4KT0F 1OTRA 3AJIB 1TDZA 5EXSA 1XMQM 1ZMWA 4DV0M 3E21A 3B7NA 3GRYA 2B3TA 1GO5A 4LFBM 4DR1M 1WGLA 2R6FA 2KA6B 3IECA 5FLXS 3K92A 3VK8A 1FNNA 2FNAA 1WGNA 1YSYA 4IBEA 3HGIA 4LJ9A 7CATA 3IG5A 1IXSA 2JY5A 4NC6A 2VIIA 5C18A 2FE8A 2UXBM 1SXJB 3ILKA 3FYCA 3J7AS 1PJJA 3UJNA 1YE9A 1OJLA 4QNRA 3B9PA 3U60B 1I94M 5ITTA 3AOEC 5LMUM 3GLHB 2DWLA 1KYIA 3B7QA 2R44A 2J7OA 3H4MA 3KP0E 4OX9M 3ZQJA 5IWAM 2ZAMA 3GO8A 3A46A 1VDLA 4DR3M 3NBIA 4A3VB 4LGMA 3DOAA 3HJQA 1L2CA 1QAMA 3CF6E 4PT5A 4DR4M 2UUCM 4NSOB 3VKGA 2BNKA 2WSCF 1NV9A 4IBBA 1FJGM 2HHHM 1QANA 1TH3A 1L1TA 5ITXE 2LXEA 3BBZA 1DO2A 1XNQM 3KW6A 4XK8F 2QBYB 2LWXA 1G4AE 1PGYA 3T15A 3U6SA 3U6PA 3U61B 1T6OA 5DNYA 2F5OA 2KRKA 2FFJA 3VKHA 3VDPA 1Z5CA 2DHYA 3J80S 2JY7A 3SC3A 1GL6A 1WIVA 2J5YA 3GPPA 2D7GA 3GLGB 2CUZA 4D82A 4G4NA 1VEGA 4L16A 1IFYA 3HHYA 3E4RA 5EXXA 8CATA 1ZMVA 2JUJA 3J7BA 2L2DA 1V33A 2Y21A 2FS1A 3GLIA 1GJTA 4LJ6A 4M9XA 4GKKM 1EFUB 1OIZA 5KQ8A 1KSFX 3SYKA 1JR3E 1R7RA 2MGWA 5FTNA 2UU9M 1XXHE 1N32M 3PXGA 2LHCA 2V1CA 5F3WA 3FTEA 2N35A 4AKHA 4LG2A 3NWLA 3DA1A 3L2AA 4F2LA 2DWZB 2XH9A 2LVNC 2BJVA 4G4RA 3I04M 1UFZA 4JN6A 1L1ZA 2QENA 3RGSA 4B08A 4LF8M 2R4EA 2QPAA 1E32A 1YLAA 2VF7A 1E9SA 3L27A 2JXNA 1TH2A 2CFOA 4WURA 3EIEA 2XF3A 4GH9A 2WZJA 3WHKA 4REZA 2EO2A 2C9CA 3HY5A 1IBLM 2I7NA 1W5SA 1TDHA 2QQ8A 1NJFA 2Y0QA 3MMPA 1DGGA 2VF8A 1NY5A 2KEBA 3UMMA 4DV2M 3U6OA 4DR7M 2F5NA 3HKPA 1GJSA 1HT2E 2CRUA 4L4UA 4QHTA 3DFZA 4RNAA 3GPUA 1PJIA 3Q8GA 3WHLA 5LMNM 1GLNA 4FWGA 4L8RC 2VQEM 2X4AA 3JR5A 2JA2A 2JY8A 2RGOA 3FTFA 2L4EA 5DYIA 3LQRA 4MGKE 1CUKA 2JP7A 1J7KA 4LY6A 4JI0M 1X37A 1L2DA 1F4IA 3K2LA 2LVQD 3FUVA 2KNAA 3I4YA 2J7NA 1A5TA 3FRIA 2JZ1A 1NHGC 3W0LB 3L29A 2ZTDA 4DV6M 3KS4A 2XGNA 5JI2E 1K3WA 2QNJA 1Z5BA 4L15A 1XXHB 1WR1B 4FVMA 3KOXE 2F4VM 1HJPA 1NJGA 1QDRA 1TGUA 3TE6A 4II7A 4YY3M 2XZUA 2CHVA 1SXJA 2X8AA 4MH0E 1ZMUA 1DGFA 3JAMS 3L25A 4YHHM 4QHSA 4DUYM 1N78A 3GRUA 1AUAA 1S3SA 1HQYE 1TTEA 3E46A 2G3QA 4JI1M 2YR0A 2K6BA 1VEKA 2P5TA 4GC9A 2GNOA 4DBGB 1IN8A 1QZMA 2DZNB 2KZUA 3KDSE 4JXJA 3SFZA 1NO1A 1IN7A 5C1BA 1IY0A 4PCZA 1XNRM 4GKJM 4AI6A 1OQYA 3GLGE 4WW0A 2D7HA 3KXEC 3GRRA 4GHAA 1OFHA 2KRUA 3SATA 2BWBA 2CHQA 2O25A 4LZJA 2DHRA 4G3OA 1OIPA 4GMQA 4XBOA 5IZ7D 4R71A 2MR9A 2HKJA 3GLFA 3SBJA 3W67A 2LVOC 3ZC7B 2G5GX 2JZ0A 4FD2A 2QCUA 4GHLA 2XFTA 2VDBB 3QYBA 4M0DA 3M0EA 1WHCA 2HCBA 2Z4SA 2L4FA 4DV7M 2DWNA 4OVZA 3U6EA 4B3RM 4LRSA 2MROB 1T43A 1N75A 2X49A 3PVSA 4HL4A 4PDGA 4DUZM 1SXJD 4GIPA 3T38A 3HJSA 5KQDA 1DV0A 1R2YA 4LF4M 1NSFA 1D0MA 4NSRA 4FW9A 2MJ5B 5FTJA 2Z3XA 4D80A 4LRTA 3I4VA 2QP9X 3K9PA 1R5LA 3RE8A 1L2BA 1IY1A
chains in the Genus database with same CATH topology
1UFZA 1P3QQ 1DO0A 1QZEA 2LBCA 4GEWA 1R4GA 1YLAA 2EKKA 3GLHE 3T6PA 2WZJA 3H4JA 1Q02A 1ZV1A 3MMPA 2H5XA 2OO9A 3B89A 2BWEA 1HT2E 2LVNC 1G41A 2KNZA 2QSFX 2RRUA 1XB2B 2OOAA 3K9OA 2JY8A 2L4EA 2DI0A 2LTUA 1C7YA 1F4IA 1CUKA 1BVSA 2JP7A 3LCVB 1OTRA 4F1IA 2LVQD 1ZMWA 2KNAA 3E21A 1GO5A 2B3TA 3FRHA 1A5TA 1WGLA 3F92A 3FRIA 2JZ1A 3IECA 2ZTDA 2KNVA 1WGNA 5JI2E 2DAGA 2JY6B 2QNJA 1Y8GA 1IXSA 1WR1B 1SG9A 2JY5A 2R0IA 3GLIE 1HJPA 2CWBA 3IHPA 2ZTCA 4HEOA 1OAIA 4UN2B 1ZMUA 1TR8A 1KYIA 2DAKA 5DFLA 1TTEA 1HQYE 3E46A 2G3QA 2DENA 1VEKA 2LVPC 1VDLA 4DBGB 1MN3A 2DAMA 2HAKA 1VEJA 2LVAA 1OQYA 3GLGE 1NV9A 2QHOB 2EKFA 2BWBA 1IM2A 2O25A 1DO2A 3BBZA 4G3OA 1VQ1A 4R71A 1G4AE 3FE3A 1PGYA 2MR9A 2OOBA 1T6OA 2LVOC 2JZ0A 2JNHA 4Q7JA 2DHYA 1WHCA 2DKLA 2K0BX 1NV8A 1G3IA 2JY7A 2L4FA 1E94E 1WIVA 4WP2A 2EJSA 2MROB 1T43A 2DAEA 1VEGA 1IFYA 1ZMVA 2JUJA 2KHHA 2L2DA 1DV0A 2CP8A 1VG5A 1WJ7A 2DAIA 1EFUB 1HT1E 2HWJA 2MJ5B 2DNAA 1JR3E 1V92A 2K9DA 2MGWA 1XXHE 3GLFE 2DZLA 3K9PA 4F2LA 3LCUA 1OKSA 1AIPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFZ A;  1P3Q Q;  1DO0 A;  1QZE A;  2LBC A;  4GEW A;  1R4G A;  1YLA A;  2EKK A;  3GLH E;  3T6P A;  2WZJ A;  3H4J A;  1Q02 A;  1ZV1 A;  3MMP A;  2H5X A;  2OO9 A;  3B89 A;  2BWE A;  1HT2 E;  2LVN C;  1G41 A;  2KNZ A;  2QSF X;  2RRU A;  1XB2 B;  2OOA A;  3K9O A;  2JY8 A;  2L4E A;  2DI0 A;  2LTU A;  1C7Y A;  1F4I A;  1CUK A;  1BVS A;  2JP7 A;  3LCV B;  1OTR A;  4F1I A;  2LVQ D;  1ZMW A;  2KNA A;  3E21 A;  1GO5 A;  2B3T A;  3FRH A;  1A5T A;  1WGL A;  3F92 A;  3FRI A;  2JZ1 A;  3IEC A;  2ZTD A;  2KNV A;  1WGN A;  5JI2 E;  2DAG A;  2JY6 B;  2QNJ A;  1Y8G A;  1IXS A;  1WR1 B;  1SG9 A;  2JY5 A;  2R0I A;  3GLI E;  1HJP A;  2CWB A;  3IHP A;  2ZTC A;  4HEO A;  1OAI A;  4UN2 B;  1ZMU A;  1TR8 A;  1KYI A;  2DAK A;  5DFL A;  1TTE A;  1HQY E;  3E46 A;  2G3Q A;  2DEN A;  1VEK A;  2LVP C;  1VDL A;  4DBG B;  1MN3 A;  2DAM A;  2HAK A;  1VEJ A;  2LVA A;  1OQY A;  3GLG E;  1NV9 A;  2QHO B;  2EKF A;  2BWB A;  1IM2 A;  2O25 A;  1DO2 A;  3BBZ A;  4G3O A;  1VQ1 A;  4R71 A;  1G4A E;  3FE3 A;  1PGY A;  2MR9 A;  2OOB A;  1T6O A;  2LVO C;  2JZ0 A;  2JNH A;  4Q7J A;  2DHY A;  1WHC A;  2DKL A;  2K0B X;  1NV8 A;  1G3I A;  2JY7 A;  2L4F A;  1E94 E;  1WIV A;  4WP2 A;  2EJS A;  2MRO B;  1T43 A;  2DAE A;  1VEG A;  1IFY A;  1ZMV A;  2JUJ A;  2KHH A;  2L2D A;  1DV0 A;  2CP8 A;  1VG5 A;  1WJ7 A;  2DAI A;  1EFU B;  1HT1 E;  2HWJ A;  2MJ5 B;  2DNA A;  1JR3 E;  1V92 A;  2K9D A;  2MGW A;  1XXH E;  3GLF E;  2DZL A;  3K9P A;  4F2L A;  3LCU A;  1OKS A;  1AIP C; 
#chains in the Genus database with same CATH topology
 4JI6 M;  1XC8 A;  1P3Q Q;  2F5P A;  1DO0 A;  1E9R A;  1QZE A;  4GEW A;  1R4G A;  1NNJ A;  2ZAO A;  4LJ8 A;  1ZQ9 A;  4LF9 M;  4MGY E;  3T6P A;  1L8Q A;  2BJW A;  4G4O A;  4LFC M;  1Q3B A;  5KO3 A;  1HNW M;  3CTW B;  1DGH A;  1Q02 A;  3LMM A;  4QNM A;  1IXS B;  4MB7 A;  4Z6Y A;  1ZV1 A;  1V34 A;  3Q8X A;  2L7I A;  3KOW E;  4P16 A;  5ITX A;  3UGJ A;  4CHT B;  4ZPX A;  2CEA A;  5L8R F;  2O01 F;  4ITQ A;  3B89 A;  4XGI A;  1C1K A;  3GPX A;  5EQT A;  1J09 A;  4TUW A;  3CGW A;  4P17 A;  1W5T A;  4DR2 M;  2DVW B;  3K9O A;  4LZZ A;  2M60 A;  1N36 M;  1NNU C;  2LTU A;  1C7Y A;  1HR0 M;  4QOZ C;  3LCV B;  2O5R A;  3TL4 X;  2MH8 A;  4F1I A;  2OPF A;  2KZS A;  1QYR A;  3A98 B;  5EP2 A;  2LH0 A;  3FRH A;  4NL4 H;  4AKG A;  4MM3 B;  2XZF A;  2FH0 A;  4B3M M;  1IXZ A;  1XWI A;  1R6B X;  3B7Z A;  3LQQ A;  4MGH A;  4B7F A;  2HL7 A;  4X65 M;  2DAG A;  2JY6 B;  2C9O A;  3CF0 A;  1SG9 A;  3I51 A;  5E6J A;  4CJ6 A;  4AKI A;  3I01 M;  2CWB A;  2R62 A;  4JI4 M;  3IHP A;  4AW4 A;  2R45 A;  3AOG A;  4IBJ A;  3GQ3 A;  1OAI A;  2YQZ A;  3AKZ A;  2UUB M;  4UN2 B;  3TQS A;  3TWM A;  1R2Z A;  4Z8X A;  5EP3 A;  5KPT A;  4KO8 A;  4M9S A;  4IBF A;  1VDD A;  2Z8Y M;  1Z5A A;  3U5Z A;  2A5Y B;  3CF2 A;  5DFL A;  3UZU A;  4AG6 A;  4ANR A;  4BB9 A;  3GPY A;  2DEN A;  4FCV A;  2LVP C;  4LF6 M;  1H6U A;  2UXC M;  2CHG A;  4DV4 M;  5A2Q S;  1MN3 A;  3BOS A;  3PNV A;  2HAK A;  1JB0 F;  2LHG A;  1GVN A;  3PFI A;  1VEJ A;  2RKO A;  2LVA A;  1UM8 A;  4OU7 A;  4DR6 M;  3HX3 A;  1KFV A;  4I8O A;  2DWM A;  2KW0 A;  2QHO B;  2EKF A;  2R46 A;  3R8F A;  3M7G A;  1IM2 A;  3FE3 A;  4CGY B;  1HQC A;  3T1H M;  2C5R A;  2OOB A;  4IBD A;  2I7P A;  4RF1 A;  5DYG A;  3NBX X;  3SHG B;  2JNH A;  3KSJ A;  1NVM A;  2KXE A;  4Q7J A;  4D81 A;  2F5Q A;  3U60 A;  4I4L A;  2DKL A;  1JR3 D;  1G3I A;  1DGB A;  2Q2E B;  3FUX A;  1Z6T A;  3GLH A;  1WXQ A;  3D8L A;  4MGZ E;  5EXT A;  3L26 A;  5ITQ A;  2DAE A;  2C96 A;  3HU3 A;  3HZJ A;  1K3X A;  4G4Q A;  3FUW A;  3VFD A;  3OTO M;  3FUU A;  4R7G A;  4LFA M;  4PDI A;  5BPV A;  1TH4 A;  1VG5 A;  4BLC A;  1G59 A;  1HT1 E;  4I81 A;  1N33 M;  2XFS A;  3THG A;  1QUT A;  2DNA A;  3UK6 A;  2K9D A;  4IBI A;  4FWD A;  2L6O A;  3RGP A;  5FTL A;  2V1U A;  1OAO C;  3GLF E;  1LTM A;  5FTK A;  4IJF A;  1N77 A;  2QBY A;  4B3S M;  1OKS A;  1AIP C;  4L78 A;  4AZF A;  3U61 A;  3PNY A;  2C99 A;  4S12 A;  3EIH A;  4G6Z A;  5EJC A;  4AG5 A;  3FTD A;  2EKK A;  3HWS A;  1OFI A;  3AL0 C;  5EXP A;  4NOO B;  3AFH A;  3FYD A;  2ZBK B;  4IBG A;  5BR8 M;  4OW0 A;  4LGY A;  4NXN M;  3VK7 A;  5GKN A;  3GLG A;  1IBM M;  1G71 A;  2W82 A;  1D0K A;  3B74 A;  5FSW A;  3M6A A;  1SXJ C;  3KOY E;  2LNH C;  2OO9 A;  2UUA M;  4AQY M;  5ITR A;  2QSF X;  2KNZ A;  3BXW A;  4K0K M;  4JYA M;  1IQP A;  2APL A;  1XB2 B;  4PD2 A;  3J27 B;  3U6L A;  2EA0 A;  3V76 A;  2OOA A;  4R3D A;  2RGH A;  3U6C A;  2ERC A;  1NY6 A;  1MU5 A;  2DI0 A;  4RF0 A;  1XMO M;  1BVS A;  5IT9 S;  4DR5 M;  4B7H A;  4LJ5 A;  2CE7 A;  4FCW A;  3HHX A;  3HU1 A;  4LJA A;  4B7G A;  4KHP M;  2YNM D;  4IIW A;  4GRI A;  3JR4 A;  1RU3 A;  3F92 A;  1PRB A;  2NQ8 C;  2Y0T A;  3HJ8 A;  4CIS A;  2H1R A;  4JI5 M;  5E26 A;  1ORY B;  2KNV A;  1J5E M;  2EUC A;  1IXR C;  2OQ4 A;  3HHZ A;  2XSZ A;  1Y8G A;  2R0I A;  4M9Z A;  3VDU A;  3GLF B;  3GLI E;  2CV2 A;  1GAB A;  4DV1 M;  2WSE F;  3U6Q A;  2UXD M;  4I5S A;  3MJ5 A;  3SAU A;  2ZTC A;  4FCT A;  4HEO A;  2XEP A;  3C3D A;  3E9S A;  3TWL A;  3A45 A;  3KS8 A;  1TR8 A;  5JI3 E;  1MX0 A;  3QWL A;  2AHM A;  3FUT A;  2XLJ A;  4OVZ B;  3MHV C;  4X66 M;  3AV0 A;  2DAK A;  1PJS A;  3R9X B;  4LF7 M;  4X64 M;  4MGI E;  3MK6 A;  1QDT A;  2Z4R A;  2DAM A;  3FTC A;  4EIW A;  2R18 A;  3SAS A;  1Q3C A;  5EP1 A;  4GC5 A;  3SMS A;  1QVR A;  2Y20 A;  1IY2 A;  4JI8 M;  1EE8 A;  3KOZ E;  4Y28 F;  4RKU F;  2GQF A;  2M5Z A;  4LJ7 A;  3SMP A;  3VLF B;  3U6M A;  1JR3 A;  3SYL A;  3SHF A;  3TWK A;  3GQ5 A;  2K47 A;  1D0L A;  2G8L A;  1VQ1 A;  2V6Z M;  1XXH A;  2R65 A;  1I4W A;  4DV5 M;  5ITU A;  3J81 S;  3LVW A;  3RFW A;  3SAR A;  1LV7 A;  5H37 D;  3GQ4 A;  4CIZ A;  1JQJ C;  2CV0 A;  1ZAE A;  2YFQ A;  4HLQ A;  1QUS A;  3K1J A;  3C58 A;  3KFU G;  1EIJ A;  2VQF M;  2K0B X;  1NV8 A;  2XSZ D;  2ZAN A;  4GIT A;  3W68 A;  1E94 E;  1DGH B;  3L28 A;  3IG8 A;  4KOD A;  4LF5 M;  1GKI A;  4WP2 A;  2EJS A;  2Z7J A;  3QAU A;  2R4J A;  4DV3 M;  1IN4 A;  3HHW A;  3TPZ A;  4LJ4 A;  4JV5 M;  1HNX M;  2KHH A;  3GLI B;  5IRE B;  2CP8 A;  4LCB A;  1WJ7 A;  2CV1 A;  1IN6 A;  1IBK M;  2DAI A;  2HWJ A;  2DXI A;  4L6V 6;  2F5S A;  4QOS A;  1IN5 A;  1V92 A;  4KLN A;  1GL7 A;  1YUB A;  1NHW C;  1QAQ A;  2DZL A;  1Q39 A;  1TF0 B;  2FOI C;  1T3T A;  2L7H A;  2KDL A;  1SXJ E;  3LW5 F;  3LCU A;  3LVV A;  4IJE A;  4NRV A;  1QAO A;  1G8P A;  3A42 A;  3KP1 E;  4X62 M;  2JWS A;  3C3E A;  3T1Y M;  4IBK A;  4JI7 M;  1PM5 A;  2LBC A;  2QZ4 A;  2C98 A;  1QQW A;  3KVW A;  3AOE A;  3GLH E;  4W5W A;  1D2N A;  3H4J A;  3J2P B;  4FWH A;  4M0W A;  3ZH9 B;  2E5L M;  3FKE A;  1XHB A;  4IBC A;  2L09 A;  1PJQ A;  3D8B A;  5EP4 A;  1K82 A;  5FTM A;  1N34 M;  3GRV A;  1Z59 A;  2H5X A;  3C9P A;  5KPR A;  1HNZ M;  2BWE A;  3QYE A;  1G41 A;  4B3T M;  1PJT A;  2D7E A;  2ZM6 M;  2RRU A;  3HU2 A;  3K8Z A;  1MJG M;  3U6D A;  3U5Z B;  4NRW A;  5KPZ A;  3ZCB B;  2DZO B;  5ITY A;  4NXM M;  3KSX A;  3SAW A;  3DZD A;  3GP1 A;  4BBA A;  4JI3 M;  3FD9 A;  3W0F A;  4JI2 M;  2WSF F;  3SAV A;  4KT0 F;  1OTR A;  3AJI B;  1TDZ A;  5EXS A;  1XMQ M;  1ZMW A;  4DV0 M;  3E21 A;  3B7N A;  3GRY A;  2B3T A;  1GO5 A;  4LFB M;  4DR1 M;  1WGL A;  2R6F A;  2KA6 B;  3IEC A;  5FLX S;  3K92 A;  3VK8 A;  1FNN A;  2FNA A;  1WGN A;  1YSY A;  4IBE A;  3HGI A;  4LJ9 A;  7CAT A;  3IG5 A;  1IXS A;  2JY5 A;  4NC6 A;  2VII A;  5C18 A;  2FE8 A;  2UXB M;  1SXJ B;  3ILK A;  3FYC A;  3J7A S;  1PJJ A;  3UJN A;  1YE9 A;  1OJL A;  4QNR A;  3B9P A;  3U60 B;  1I94 M;  5ITT A;  3AOE C;  5LMU M;  3GLH B;  2DWL A;  1KYI A;  3B7Q A;  2R44 A;  2J7O A;  3H4M A;  3KP0 E;  4OX9 M;  3ZQJ A;  5IWA M;  2ZAM A;  3GO8 A;  3A46 A;  1VDL A;  4DR3 M;  3NBI A;  4A3V B;  4LGM A;  3DOA A;  3HJQ A;  1L2C A;  1QAM A;  3CF6 E;  4PT5 A;  4DR4 M;  2UUC M;  4NSO B;  3VKG A;  2BNK A;  2WSC F;  1NV9 A;  4IBB A;  1FJG M;  2HHH M;  1QAN A;  1TH3 A;  1L1T A;  5ITX E;  2LXE A;  3BBZ A;  1DO2 A;  1XNQ M;  3KW6 A;  4XK8 F;  2QBY B;  2LWX A;  1G4A E;  1PGY A;  3T15 A;  3U6S A;  3U6P A;  3U61 B;  1T6O A;  5DNY A;  2F5O A;  2KRK A;  2FFJ A;  3VKH A;  3VDP A;  1Z5C A;  2DHY A;  3J80 S;  2JY7 A;  3SC3 A;  1GL6 A;  1WIV A;  2J5Y A;  3GPP A;  2D7G A;  3GLG B;  2CUZ A;  4D82 A;  4G4N A;  1VEG A;  4L16 A;  1IFY A;  3HHY A;  3E4R A;  5EXX A;  8CAT A;  1ZMV A;  2JUJ A;  3J7B A;  2L2D A;  1V33 A;  2Y21 A;  2FS1 A;  3GLI A;  1GJT A;  4LJ6 A;  4M9X A;  4GKK M;  1EFU B;  1OIZ A;  5KQ8 A;  1KSF X;  3SYK A;  1JR3 E;  1R7R A;  2MGW A;  5FTN A;  2UU9 M;  1XXH E;  1N32 M;  3PXG A;  2LHC A;  2V1C A;  5F3W A;  3FTE A;  2N35 A;  4AKH A;  4LG2 A;  3NWL A;  3DA1 A;  3L2A A;  4F2L A;  2DWZ B;  2XH9 A;  2LVN C;  2BJV A;  4G4R A;  3I04 M;  1UFZ A;  4JN6 A;  1L1Z A;  2QEN A;  3RGS A;  4B08 A;  4LF8 M;  2R4E A;  2QPA A;  1E32 A;  1YLA A;  2VF7 A;  1E9S A;  3L27 A;  2JXN A;  1TH2 A;  2CFO A;  4WUR A;  3EIE A;  2XF3 A;  4GH9 A;  2WZJ A;  3WHK A;  4REZ A;  2EO2 A;  2C9C A;  3HY5 A;  1IBL M;  2I7N A;  1W5S A;  1TDH A;  2QQ8 A;  1NJF A;  2Y0Q A;  3MMP A;  1DGG A;  2VF8 A;  1NY5 A;  2KEB A;  3UMM A;  4DV2 M;  3U6O A;  4DR7 M;  2F5N A;  3HKP A;  1GJS A;  1HT2 E;  2CRU A;  4L4U A;  4QHT A;  3DFZ A;  4RNA A;  3GPU A;  1PJI A;  3Q8G A;  3WHL A;  5LMN M;  1GLN A;  4FWG A;  4L8R C;  2VQE M;  2X4A A;  3JR5 A;  2JA2 A;  2JY8 A;  2RGO A;  3FTF A;  2L4E A;  5DYI A;  3LQR A;  4MGK E;  1CUK A;  2JP7 A;  1J7K A;  4LY6 A;  4JI0 M;  1X37 A;  1L2D A;  1F4I A;  3K2L A;  2LVQ D;  3FUV A;  2KNA A;  3I4Y A;  2J7N A;  1A5T A;  3FRI A;  2JZ1 A;  1NHG C;  3W0L B;  3L29 A;  2ZTD A;  4DV6 M;  3KS4 A;  2XGN A;  5JI2 E;  1K3W A;  2QNJ A;  1Z5B A;  4L15 A;  1XXH B;  1WR1 B;  4FVM A;  3KOX E;  2F4V M;  1HJP A;  1NJG A;  1QDR A;  1TGU A;  3TE6 A;  4II7 A;  4YY3 M;  2XZU A;  2CHV A;  1SXJ A;  2X8A A;  4MH0 E;  1ZMU A;  1DGF A;  3JAM S;  3L25 A;  4YHH M;  4QHS A;  4DUY M;  1N78 A;  3GRU A;  1AUA A;  1S3S A;  1HQY E;  1TTE A;  3E46 A;  2G3Q A;  4JI1 M;  2YR0 A;  2K6B A;  1VEK A;  2P5T A;  4GC9 A;  2GNO A;  4DBG B;  1IN8 A;  1QZM A;  2DZN B;  2KZU A;  3KDS E;  4JXJ A;  3SFZ A;  1NO1 A;  1IN7 A;  5C1B A;  1IY0 A;  4PCZ A;  1XNR M;  4GKJ M;  4AI6 A;  1OQY A;  3GLG E;  4WW0 A;  2D7H A;  3KXE C;  3GRR A;  4GHA A;  1OFH A;  2KRU A;  3SAT A;  2BWB A;  2CHQ A;  2O25 A;  4LZJ A;  2DHR A;  4G3O A;  1OIP A;  4GMQ A;  4XBO A;  5IZ7 D;  4R71 A;  2MR9 A;  2HKJ A;  3GLF A;  3SBJ A;  3W67 A;  2LVO C;  3ZC7 B;  2G5G X;  2JZ0 A;  4FD2 A;  2QCU A;  4GHL A;  2XFT A;  2VDB B;  3QYB A;  4M0D A;  3M0E A;  1WHC A;  2HCB A;  2Z4S A;  2L4F A;  4DV7 M;  2DWN A;  4OVZ A;  3U6E A;  4B3R M;  4LRS A;  2MRO B;  1T43 A;  1N75 A;  2X49 A;  3PVS A;  4HL4 A;  4PDG A;  4DUZ M;  1SXJ D;  4GIP A;  3T38 A;  3HJS A;  5KQD A;  1DV0 A;  1R2Y A;  4LF4 M;  1NSF A;  1D0M A;  4NSR A;  4FW9 A;  2MJ5 B;  5FTJ A;  2Z3X A;  4D80 A;  4LRT A;  3I4V A;  2QP9 X;  3K9P A;  1R5L A;  3RE8 A;  1L2B A;  1IY1 A; 
#chains in the Genus database with same CATH homology
 1UFZ A;  1P3Q Q;  1DO0 A;  1QZE A;  2LBC A;  4GEW A;  1R4G A;  1YLA A;  2EKK A;  3GLH E;  3T6P A;  2WZJ A;  3H4J A;  1Q02 A;  1ZV1 A;  3MMP A;  2H5X A;  2OO9 A;  3B89 A;  2BWE A;  1HT2 E;  2LVN C;  1G41 A;  2KNZ A;  2QSF X;  2RRU A;  1XB2 B;  2OOA A;  3K9O A;  2JY8 A;  2L4E A;  2DI0 A;  2LTU A;  1C7Y A;  1F4I A;  1CUK A;  1BVS A;  2JP7 A;  3LCV B;  1OTR A;  4F1I A;  2LVQ D;  1ZMW A;  2KNA A;  3E21 A;  1GO5 A;  2B3T A;  3FRH A;  1A5T A;  1WGL A;  3F92 A;  3FRI A;  2JZ1 A;  3IEC A;  2ZTD A;  2KNV A;  1WGN A;  5JI2 E;  2DAG A;  2JY6 B;  2QNJ A;  1Y8G A;  1IXS A;  1WR1 B;  1SG9 A;  2JY5 A;  2R0I A;  3GLI E;  1HJP A;  2CWB A;  3IHP A;  2ZTC A;  4HEO A;  1OAI A;  4UN2 B;  1ZMU A;  1TR8 A;  1KYI A;  2DAK A;  5DFL A;  1TTE A;  1HQY E;  3E46 A;  2G3Q A;  2DEN A;  1VEK A;  2LVP C;  1VDL A;  4DBG B;  1MN3 A;  2DAM A;  2HAK A;  1VEJ A;  2LVA A;  1OQY A;  3GLG E;  1NV9 A;  2QHO B;  2EKF A;  2BWB A;  1IM2 A;  2O25 A;  1DO2 A;  3BBZ A;  4G3O A;  1VQ1 A;  4R71 A;  1G4A E;  3FE3 A;  1PGY A;  2MR9 A;  2OOB A;  1T6O A;  2LVO C;  2JZ0 A;  2JNH A;  4Q7J A;  2DHY A;  1WHC A;  2DKL A;  2K0B X;  1NV8 A;  1G3I A;  2JY7 A;  2L4F A;  1E94 E;  1WIV A;  4WP2 A;  2EJS A;  2MRO B;  1T43 A;  2DAE A;  1VEG A;  1IFY A;  1ZMV A;  2JUJ A;  2KHH A;  2L2D A;  1DV0 A;  2CP8 A;  1VG5 A;  1WJ7 A;  2DAI A;  1EFU B;  1HT1 E;  2HWJ A;  2MJ5 B;  2DNA A;  1JR3 E;  1V92 A;  2K9D A;  2MGW A;  1XXH E;  3GLF E;  2DZL A;  3K9P A;  4F2L A;  3LCU A;  1OKS A;  1AIP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...