1OTRA

Solution structure of a cue-ubiquitin complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
49
structure length
49
Chain Sequence
NDDHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKENDDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Cue2
publication title Solution Structure of a CUE-Ubiquitin Complex Reveals a Conserved Mode of Ubiquitin Binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 11
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2003-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1otrA00
3GLGE 2LVAA 2QHOB 1DO2A 1V92A 2KNVA 1WR1B 2CWBA 2L4EA 3F92A 1OTRA 2JZ0A 3K9PA 2O25A 3H4JA 2WZJA 1DV0A 4HEOA 1MN3A 2EJSA 2L2DA 2K0BX 1ZMWA 2EKFA 2EKKA 3LCUA 4DBGB 4F2LA 2LVQD 2MROB 1TTEA 2JZ1A 1G3IA 3GLFE 1UFZA 1G4AE 2MGWA 2ZTDA 3FRIA 3K9OA 2DHYA 2LVNC 1CUKA 4GEWA 1BVSA 1TR8A 2DZLA 2JP7A 1VG5A 3FE3A 2BWBA 2QSFX 2MR9A 2ZTCA 1T43A 1NV9A 2DI0A 5DFLA 2KNZA 2DAKA 2HAKA 1XB2B 1OQYA 3BBZA 1G41A 2JY5A 3MMPA 1IM2A 1F4IA 3T6PA 4F1IA 2G3QA 2DENA 1IXSA 2QNJA 5JI2E 2H5XA 4UN2B 1C7YA 1GO5A 3IECA 4WP2A 1XXHE 1HJPA 1NV8A 2DAEA 2OO9A 1ZMUA 1QZEA 1T6OA 1WGNA 2JY8A 1PGYA 1VQ1A 2MJ5B 1WIVA 3GLHE 2R0IA 2HWJA 1DO0A 1WHCA 3B89A 2DAIA 2L4FA 2OOBA 3FRHA 1VEKA 3GLIE 1AIPC 1WGLA 2B3TA 2OOAA 4G3OA 2DKLA 2DAGA 3E46A 3IHPA 1KYIA 1VEJA 1Q02A 1SG9A 1HT2E 1E94E 2JY7A 1ZV1A 1ZMVA 2LVOC 2KHHA 2JY6B 2DNAA 2CP8A 4R71A 1HT1E 3E21A 3LCVB 2JNHA 1VDLA 1JR3E 4Q7JA 2DAMA 2JUJA 1EFUB 1P3QQ 1R4GA 2LTUA 1VEGA 1OKSA 2LVPC 1IFYA 1A5TA 2BWEA 1Y8GA 2LBCA 1OAIA 2K9DA 1HQYE 1WJ7A 2RRUA 1YLAA 2KNAA
chains in the Genus database with same CATH superfamily
3GLGE 4G4RA 2F4VM 3FTEA 2VDBB 2H1RA 2R65A 3OTOM 3T15A 4D81A 1R2YA 2QHOB 2CV0A 4KHPM 1NNUC 2L4EA 4B7GA 5ITRA 3GPYA 4G4OA 2JZ0A 3TWLA 3B9PA 3U6SA 2VF7A 3T1YM 2UU9M 4XGIA 3VKHA 2XSZA 3THGA 4LF5M 2VQFM 3ZH9B 2FNAA 3UGJA 2EKKA 2FH0A 4LZJA 3AJIB 4IBCA 1S3SA 2V6ZM 2X8AA 4DV1M 2DWNA 4MH0E 2LVQD 3J80S 4IBJA 5FSWA 3M6AA 1JB0F 4LCBA 2JZ1A 3J7BA 1G3IA 2G5GX 1G4AE 4PCZA 3W0FA 4NL4H 1OIPA 3FRIA 3K9OA 3SFZA 2EO2A 3HJSA 1N75A 2DHYA 3HJQA 1CUKA 5FLXS 4I5SA 4JXJA 4NRVA 4WW0A 3GLFB 3PVSA 1VG5A 2KEBA 2HKJA 2QSFX 2MR9A 4JI8M 2ZM6M 3FUWA 1IN4A 1XNQM 4D80A 3RE8A 3QWLA 4IJFA 3GQ3A 3M0EA 1HNZM 5DFLA 4LGMA 1L2DA 4P16A 3K92A 1XXHA 4OVZB 3BXWA 3LVWA 2JY5A 3R8FA 2AHMA 3RFWA 4TUWA 3K2LA 1Z5AA 1V33A 1IXSA 3IG8A 4QHTA 2QNJA 3KXEC 2DVWB 2F5SA 1XMOM 4IBIA 4AKIA 3U5ZB 3IECA 4DR4M 4WP2A 1IY0A 1XXHE 2R44A 4DV7M 2RGOA 8CATA 3B7QA 3FYDA 2OO9A 1ZMUA 3KOYE 1T6OA 3GRRA 4DR3M 4R7GA 3K1JA 3KOZE 5EP4A 1NJGA 4FCWA 3KW6A 3JR5A 4JV5M 1PJSA 1IY2A 3KSXA 2HWJA 1DO0A 1WHCA 3AL0C 3SATA 4QHSA 1VEKA 3LVVA 2NQ8C 4JI1M 4NRWA 1WGLA 2B3TA 2DWZB 3I01M 4S12A 1ZQ9A 1GABA 2DKLA 2DAGA 3E46A 2Z3XA 1G8PA 1KYIA 2YR0A 1L8QA 5IT9S 3FUUA 1SG9A 1HQCA 1SXJC 3EIHA 1E94E 4LJ7A 1IQPA 4LJ5A 2LXEA 2P5TA 3L29A 4MGYE 3SARA 2I7PA 2JY6B 2ZAOA 1WXQA 2DZOB 2QQ8A 2BJWA 2C98A 3CTWB 2DNAA 1NY6A 3C3DA 4X64M 2CP8A 1HNWM 4K0KM 3TQSA 2JWSA 3E21A 4FCTA 1OFIA 2JA2A 2QZ4A 2JNHA 2ZAMA 3CF2A 2I7NA 4CISA 1K3XA 1YSYA 2O5RA 3GRYA 2DXIA 2JUJA 1NNJA 1DGHA 2V1UA 1VEGA 2KRUA 4BLCA 3U6MA 3QYEA 4L15A 1R2ZA 1QANA 4JI3M 3GPUA 4DV6M 3FUXA 4B7HA 4DV5M 5E6JA 4IBBA 2R18A 3SAVA 2KZUA 3DOAA 2Y20A 4EIWA 5C18A 3SC3A 5DNYA 2RRUA 2KNAA 3HGIA 1NO1A 3U6QA 1SXJB 2LVAA 3KP0E 1GKIA 3VLFB 1DO2A 3HHWA 3GLFA 1V92A 4FWGA 3I4VA 3AOEA 4CGYB 3T38A 2C9CA 3U6EA 3HHXA 5ITYA 2WZJA 4HEOA 4QNMA 1YUBA 5FTMA 1XWIA 2M60A 1ZMWA 2WSEF 4DBGB 5ITTA 4OVZA 1W5SA 2CHGA 4F2LA 3U6CA 4FWHA 2MROB 4QOZC 4LG2A 1FNNA 4MGIE 2Z4RA 3GLFE 2CHQA 2QBYB 2K47A 4REZA 1IBKM 2ZTDA 1QAMA 2XFTA 4JN6A 1TH3A 2J7OA 1QQWA 1BVSA 3HHYA 2DZLA 2JP7A 5FTKA 4B3SM 3U5ZA 3J7AS 4L8RC 3FE3A 2RGHA 1IN6A 4L6V6 3U60B 2Y21A 1NHWC 1T43A 4QNRA 4ANRA 1J09A 2CFOA 2FE8A 2K6BA 2DAKA 2KNZA 2LHCA 4JI7M 5KQ8A 5DYIA 3RGSA 3J27B 3MMPA 4IJEA 1IM2A 1C1KA 5F3WA 3T6PA 2E5LM 1F4IA 3CF6E 4GMQA 5FTLA 3U61B 2G3QA 5GKNA 4BBAA 2R6FA 4LJAA 3HU3A 1D0LA 2KW0A 4AZFA 3KS8A 2G8LA 3ILKA 4GC9A 2HL7A 1J7KA 4L78A 4MM3B 2WSCF 2R45A 2OQ4A 4LJ8A 5LMUM 1XMQM 1IN5A 2UUBM 3J81S 3I4YA 4FW9A 2LNHC 4I4LA 1NV8A 1TDZA 2DAEA 1QZEA 1WGNA 1N32M 4IBDA 4II7A 1VQ1A 4AKHA 4X62M 4B08A 1FJGM 4B3TM 4FD2A 1JQJC 1GJTA 2N35A 3LMMA 1G59A 3KOXE 2D7EA 2CRUA 4B3RM 4IBFA 4AI6A 2X49A 1QDTA 1QAQA 4CHTB 3GP1A 1IXRC 1QDRA 2VF8A 3IHPA 3L28A 1VEJA 3LQQA 3GLIB 1HT2E 2XEPA 1VDDA 5H37D 4XK8F 2LVOC 1TDHA 2XZUA 1DGGA 3B7ZA 5IWAM 4DR6M 3VFDA 4R71A 1IBLM 3E4RA 1PJIA 2CV2A 2QPAA 4LFAM 1HR0M 3Q8GA 1PRBA 1VDLA 4GIPA 4GRIA 2L6OA 3T1HM 1NHGC 2DAMA 2F5NA 3I51A 3FTFA 2LTUA 2ZBKB 3H4MA 3SAUA 2C9OA 2XH9A 2LVPC 3GPXA 4DV3M 3BOSA 1SXJE 3UJNA 2FOIC 3W67A 5EXXA 3A45A 2D7GA 2UUCM 1OAIA 2QBYA 1TF0B 1XHBA 4PDGA 4DR7M 2YQZA 2Y0TA 1WJ7A 2BJVA 2HHHM 4W5WA 1OJLA 3IG5A 4JYAM 1I4WA 3GO8A 3I04M 4GITA 3U60A 4GKKM 4I81A 1OTRA 2QCUA 2V1CA 3FTCA 3GRVA 4CJ6A 2C96A 2XF3A 3K9PA 5L8RF 3C58A 4G4NA 1DV0A 4IBGA 5LMNM 3NBXX 2EJSA 5IZ7D 2L2DA 4L16A 2CV1A 2EKFA 4NOOB 1AUAA 3SYKA 2FFJA 3VK7A 1TTEA 3U6OA 1E9RA 1R6BX 1MU5A 4HL4A 3U61A 3HX3A 2DWLA 3KSJA 1EE8A 3ZCBB 4FWDA 3SHFA 2KZSA 3AV0A 3HJ8A 4P17A 1IXZA 1K82A 4GEWA 4LF7M 4GKJM 4KODA 2R4JA 2Y0QA 4RNAA 2CHVA 2L7HA 3WHLA 5ITQA 2BWBA 2VIIA 2LH0A 4OU7A 4X66M 1YE9A 4AW4A 1KFVA 1Z59A 3B74A 1NJFA 4KT0F 4DR5M 2FS1A 1N33M 1XB2B 3BBZA 3HU2A 4M9ZA 4F1IA 3L25A 1SXJD 3M7GA 1L2CA 2ZANA 4JI0M 2DENA 2LHGA 3HU1A 4M0DA 3SBJA 3L26A 4B3MM 2CE7A 2H5XA 5EQTA 1R5LA 2C5RA 2DWMA 4RF0A 1KSFX 2L7IA 1RU3A 4GHAA 1EIJA 2F5OA 3GQ5A 2F5QA 3L27A 4AG5A 2F5PA 3SHGB 1HJPA 1T3TA 5ITUA 1TH4A 2Z7JA 2DZNB 3A42A 3KDSE 5KPRA 3FD9A 1Q3BA 1IY1A 1W5TA 4G6ZA 2UXCM 2LWXA 1GJSA 5EP1A 4BB9A 2MJ5B 3VKGA 3PXGA 5KQDA 3B89A 3SYLA 2L4FA 2OOBA 4PD2A 1G71A 4NXMM 1X37A 3GLIE 2HCBA 1AIPC 1IN8A 4ZPXA 4DUYM 3GLHB 5KPTA 1MJGM 5E26A 2UXBM 1OAOC 4NC6A 2R4EA 2C99A 3PNYA 7CATA 1QUTA 5EP2A 4DV4M 3JAMS 1Q02A 3RGPA 1QAOA 2KRKA 4NSOB 2XZFA 1ZV1A 1ZMVA 2OPFA 2XFSA 1N36M 3AOEC 1D0MA 4OW0A 4RKUF 4R3DA 2KXEA 3L2AA 3KVWA 1IBMM 1L2BA 1PM5A 4NSRA 4A3VB 3LQRA 4KLNA 4PT5A 1Z6TA 1JR3E 1DGHB 3E9SA 3QYBA 5KO3A 1GL7A 1N77A 2UUAM 3W68A 1EFUB 2MH8A 1R4GA 3AOGA 4FVMA 5ITXA 3CGWA 2BNKA 4LGYA 3ZC7B 2Q2EB 1L1ZA 1GVNA 4ITQA 1E9SA 1Y8GA 2BWEA 2KDLA 2LBCA 1D2NA 3PFIA 1PJQA 5EXPA 1K3WA 1Z5CA 1G41A 4PDIA 1DGFA 2J5YA 3W0LB 4CIZA 1DGBA 4WURA 4IIWA 1SXJA 2KNVA 2GNOA 2UXDM 3VDPA 1WR1B 3GPPA 2CWBA 3U6DA 3F92A 4LZZA 3TPZA 5ITXE 4NXNM 1QZMA 4MGKE 3LW5F 3GLGB 1GLNA 2O25A 3H4JA 1GL6A 4D82A 5JI3E 1OFHA 1MN3A 3FTDA 2EA0A 4AQYM 2K0BX 3J2PB 3LCUA 4LFCM 2EUCA 1UM8A 2L09A 3GRUA 3C9PA 5FTJA 4YY3M 3U6LA 3HY5A 1E32A 1UFZA 5EJCA 3JR4A 2MGWA 4AKGA 4M9SA 5EXSA 5KPZA 3UZUA 2LVNC 1H6UA 1Q3CA 2XLJA 1TR8A 3SMSA 4JI6M 3AKZA 3NBIA 4DV2M 2ERCA 2O01F 4JI4M 1Q39A 4GH9A 2ZTCA 4IBEA 1V34A 2QP9X 4HLQA 4G4QA 1JR3D 1NV9A 2DI0A 3MK6A 2HAKA 4QOSA 3D8LA 2A5YB 3QAUA 1D0KA 1OQYA 4Z6YA 1PJJA 3R9XB 2J7NA 3CF0A 3EIEA 3PNVA 4M0WA 4DV0M 1XC8A 3VK8A 4LY6A 2R62A 3GLHA 1QYRA 4X65M 4LRSA 3TWMA 2QENA 5JI2E 3KFUG 2M5ZA 4I8OA 4MGHA 3TWKA 3UMMA 2YNMD 4DR2M 4UN2B 3FUVA 3U6PA 1J5EM 3D8BA 3HZJA 1C7YA 2XSZD 4GHLA 1GO5A 3UK6A 1R7RA 2DHRA 2CEAA 3HHZA 2R46A 2CUZA 4MB7A 4LF6M 2GQFA 1ORYB 1ZAEA 4FCVA 2WSFF 4OX9M 2JY8A 5DYGA 4LJ9A 1PGYA 3Q8XA 4DUZM 3NWLA 4XBOA 1NY5A 3K8ZA 4Y28F 3KOWE 3MHVC 1XXHB 4L4UA 1WIVA 1QVRA 3GLHE 1LTMA 2R0IA 4RF1A 3V76A 3HKPA 3SAWA 2DAIA 5C1BA 4LF9M 2APLA 1PJTA 4LF8M 3FRHA 5EP3A 4YHHM 4JI2M 2Z8YM 4G3OA 1IXSB 2OOAA 2RKOA 3TL4X 3AFHA 2W82A 4LF4M 1OIZA 4GC5A 5FTNA 1Z5BA 4IBKA 1XNRM 3DA1A 3WHKA 2JY7A 3DFZA 3GLIA 5A2QS 2KHHA 3TE6A 4LFBM 1QUSA 1MX0A 1I94M 2VQEM 3C3EA 3HWSA 5IREB 1NSFA 1HT1E 1NVMA 3MJ5A 3LCVB 3DZDA 3SMPA 4MGZE 4LRTA 3GLGA 1L1TA 5EXTA 4KO8A 3FYCA 3B7NA 4Q7JA 4B7FA 2KA6B 3SASA 3A98B 1N78A 1P3QQ 4DR1M 3KP1E 2JXNA 1OKSA 3ZQJA 2XGNA 4M9XA 3A46A 2D7HA 4JI5M 5BPVA 1TGUA 1N34M 1IFYA 4LJ6A 1IN7A 1A5TA 2X4AA 5BR8M 4AG6A 4LJ4A 1JR3A 2Z4SA 3GQ4A 1TH2A 2K9DA 1HQYE 3FUTA 3KS4A 4Z8XA 2YFQA 1LV7A 1YLAA 3FKEA 1HNXM 3VDUA
chains in the Genus database with same CATH topology
3GLGE 2LVAA 2QHOB 1DO2A 1V92A 2KNVA 1WR1B 2CWBA 2L4EA 3F92A 1OTRA 2JZ0A 3K9PA 2O25A 3H4JA 2WZJA 1DV0A 4HEOA 1MN3A 2EJSA 2L2DA 2K0BX 1ZMWA 2EKFA 2EKKA 3LCUA 4DBGB 4F2LA 2LVQD 2MROB 1TTEA 2JZ1A 1G3IA 3GLFE 1UFZA 1G4AE 2MGWA 2ZTDA 3FRIA 3K9OA 2DHYA 2LVNC 1CUKA 4GEWA 1BVSA 1TR8A 2DZLA 2JP7A 1VG5A 3FE3A 2BWBA 2QSFX 2MR9A 2ZTCA 1T43A 1NV9A 2DI0A 5DFLA 2KNZA 2DAKA 2HAKA 1XB2B 1OQYA 3BBZA 1G41A 2JY5A 3MMPA 1IM2A 1F4IA 3T6PA 4F1IA 2G3QA 2DENA 1IXSA 2QNJA 5JI2E 2H5XA 4UN2B 1C7YA 1GO5A 3IECA 4WP2A 1XXHE 1HJPA 1NV8A 2DAEA 2OO9A 1ZMUA 1QZEA 1T6OA 1WGNA 2JY8A 1PGYA 1VQ1A 2MJ5B 1WIVA 3GLHE 2R0IA 2HWJA 1DO0A 1WHCA 3B89A 2DAIA 2L4FA 2OOBA 3FRHA 1VEKA 3GLIE 1AIPC 1WGLA 2B3TA 2OOAA 4G3OA 2DKLA 2DAGA 3E46A 3IHPA 1KYIA 1VEJA 1Q02A 1SG9A 1HT2E 1E94E 2JY7A 1ZV1A 1ZMVA 2LVOC 2KHHA 2JY6B 2DNAA 2CP8A 4R71A 1HT1E 3E21A 3LCVB 2JNHA 1VDLA 1JR3E 4Q7JA 2DAMA 2JUJA 1EFUB 1P3QQ 1R4GA 2LTUA 1VEGA 1OKSA 2LVPC 1IFYA 1A5TA 2BWEA 1Y8GA 2LBCA 1OAIA 2K9DA 1HQYE 1WJ7A 2RRUA 1YLAA 2KNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLG E;  2LVA A;  2QHO B;  1DO2 A;  1V92 A;  2KNV A;  1WR1 B;  2CWB A;  2L4E A;  3F92 A;  1OTR A;  2JZ0 A;  3K9P A;  2O25 A;  3H4J A;  2WZJ A;  1DV0 A;  4HEO A;  1MN3 A;  2EJS A;  2L2D A;  2K0B X;  1ZMW A;  2EKF A;  2EKK A;  3LCU A;  4DBG B;  4F2L A;  2LVQ D;  2MRO B;  1TTE A;  2JZ1 A;  1G3I A;  3GLF E;  1UFZ A;  1G4A E;  2MGW A;  2ZTD A;  3FRI A;  3K9O A;  2DHY A;  2LVN C;  1CUK A;  4GEW A;  1BVS A;  1TR8 A;  2DZL A;  2JP7 A;  1VG5 A;  3FE3 A;  2BWB A;  2QSF X;  2MR9 A;  2ZTC A;  1T43 A;  1NV9 A;  2DI0 A;  5DFL A;  2KNZ A;  2DAK A;  2HAK A;  1XB2 B;  1OQY A;  3BBZ A;  1G41 A;  2JY5 A;  3MMP A;  1IM2 A;  1F4I A;  3T6P A;  4F1I A;  2G3Q A;  2DEN A;  1IXS A;  2QNJ A;  5JI2 E;  2H5X A;  4UN2 B;  1C7Y A;  1GO5 A;  3IEC A;  4WP2 A;  1XXH E;  1HJP A;  1NV8 A;  2DAE A;  2OO9 A;  1ZMU A;  1QZE A;  1T6O A;  1WGN A;  2JY8 A;  1PGY A;  1VQ1 A;  2MJ5 B;  1WIV A;  3GLH E;  2R0I A;  2HWJ A;  1DO0 A;  1WHC A;  3B89 A;  2DAI A;  2L4F A;  2OOB A;  3FRH A;  1VEK A;  3GLI E;  1AIP C;  1WGL A;  2B3T A;  2OOA A;  4G3O A;  2DKL A;  2DAG A;  3E46 A;  3IHP A;  1KYI A;  1VEJ A;  1Q02 A;  1SG9 A;  1HT2 E;  1E94 E;  2JY7 A;  1ZV1 A;  1ZMV A;  2LVO C;  2KHH A;  2JY6 B;  2DNA A;  2CP8 A;  4R71 A;  1HT1 E;  3E21 A;  3LCV B;  2JNH A;  1VDL A;  1JR3 E;  4Q7J A;  2DAM A;  2JUJ A;  1EFU B;  1P3Q Q;  1R4G A;  2LTU A;  1VEG A;  1OKS A;  2LVP C;  1IFY A;  1A5T A;  2BWE A;  1Y8G A;  2LBC A;  1OAI A;  2K9D A;  1HQY E;  1WJ7 A;  2RRU A;  1YLA A;  2KNA A; 
#chains in the Genus database with same CATH topology
 3GLG E;  4G4R A;  2F4V M;  3FTE A;  2VDB B;  2H1R A;  2R65 A;  3OTO M;  3T15 A;  4D81 A;  1R2Y A;  2QHO B;  2CV0 A;  4KHP M;  1NNU C;  2L4E A;  4B7G A;  5ITR A;  3GPY A;  4G4O A;  2JZ0 A;  3TWL A;  3B9P A;  3U6S A;  2VF7 A;  3T1Y M;  2UU9 M;  4XGI A;  3VKH A;  2XSZ A;  3THG A;  4LF5 M;  2VQF M;  3ZH9 B;  2FNA A;  3UGJ A;  2EKK A;  2FH0 A;  4LZJ A;  3AJI B;  4IBC A;  1S3S A;  2V6Z M;  2X8A A;  4DV1 M;  2DWN A;  4MH0 E;  2LVQ D;  3J80 S;  4IBJ A;  5FSW A;  3M6A A;  1JB0 F;  4LCB A;  2JZ1 A;  3J7B A;  1G3I A;  2G5G X;  1G4A E;  4PCZ A;  3W0F A;  4NL4 H;  1OIP A;  3FRI A;  3K9O A;  3SFZ A;  2EO2 A;  3HJS A;  1N75 A;  2DHY A;  3HJQ A;  1CUK A;  5FLX S;  4I5S A;  4JXJ A;  4NRV A;  4WW0 A;  3GLF B;  3PVS A;  1VG5 A;  2KEB A;  2HKJ A;  2QSF X;  2MR9 A;  4JI8 M;  2ZM6 M;  3FUW A;  1IN4 A;  1XNQ M;  4D80 A;  3RE8 A;  3QWL A;  4IJF A;  3GQ3 A;  3M0E A;  1HNZ M;  5DFL A;  4LGM A;  1L2D A;  4P16 A;  3K92 A;  1XXH A;  4OVZ B;  3BXW A;  3LVW A;  2JY5 A;  3R8F A;  2AHM A;  3RFW A;  4TUW A;  3K2L A;  1Z5A A;  1V33 A;  1IXS A;  3IG8 A;  4QHT A;  2QNJ A;  3KXE C;  2DVW B;  2F5S A;  1XMO M;  4IBI A;  4AKI A;  3U5Z B;  3IEC A;  4DR4 M;  4WP2 A;  1IY0 A;  1XXH E;  2R44 A;  4DV7 M;  2RGO A;  8CAT A;  3B7Q A;  3FYD A;  2OO9 A;  1ZMU A;  3KOY E;  1T6O A;  3GRR A;  4DR3 M;  4R7G A;  3K1J A;  3KOZ E;  5EP4 A;  1NJG A;  4FCW A;  3KW6 A;  3JR5 A;  4JV5 M;  1PJS A;  1IY2 A;  3KSX A;  2HWJ A;  1DO0 A;  1WHC A;  3AL0 C;  3SAT A;  4QHS A;  1VEK A;  3LVV A;  2NQ8 C;  4JI1 M;  4NRW A;  1WGL A;  2B3T A;  2DWZ B;  3I01 M;  4S12 A;  1ZQ9 A;  1GAB A;  2DKL A;  2DAG A;  3E46 A;  2Z3X A;  1G8P A;  1KYI A;  2YR0 A;  1L8Q A;  5IT9 S;  3FUU A;  1SG9 A;  1HQC A;  1SXJ C;  3EIH A;  1E94 E;  4LJ7 A;  1IQP A;  4LJ5 A;  2LXE A;  2P5T A;  3L29 A;  4MGY E;  3SAR A;  2I7P A;  2JY6 B;  2ZAO A;  1WXQ A;  2DZO B;  2QQ8 A;  2BJW A;  2C98 A;  3CTW B;  2DNA A;  1NY6 A;  3C3D A;  4X64 M;  2CP8 A;  1HNW M;  4K0K M;  3TQS A;  2JWS A;  3E21 A;  4FCT A;  1OFI A;  2JA2 A;  2QZ4 A;  2JNH A;  2ZAM A;  3CF2 A;  2I7N A;  4CIS A;  1K3X A;  1YSY A;  2O5R A;  3GRY A;  2DXI A;  2JUJ A;  1NNJ A;  1DGH A;  2V1U A;  1VEG A;  2KRU A;  4BLC A;  3U6M A;  3QYE A;  4L15 A;  1R2Z A;  1QAN A;  4JI3 M;  3GPU A;  4DV6 M;  3FUX A;  4B7H A;  4DV5 M;  5E6J A;  4IBB A;  2R18 A;  3SAV A;  2KZU A;  3DOA A;  2Y20 A;  4EIW A;  5C18 A;  3SC3 A;  5DNY A;  2RRU A;  2KNA A;  3HGI A;  1NO1 A;  3U6Q A;  1SXJ B;  2LVA A;  3KP0 E;  1GKI A;  3VLF B;  1DO2 A;  3HHW A;  3GLF A;  1V92 A;  4FWG A;  3I4V A;  3AOE A;  4CGY B;  3T38 A;  2C9C A;  3U6E A;  3HHX A;  5ITY A;  2WZJ A;  4HEO A;  4QNM A;  1YUB A;  5FTM A;  1XWI A;  2M60 A;  1ZMW A;  2WSE F;  4DBG B;  5ITT A;  4OVZ A;  1W5S A;  2CHG A;  4F2L A;  3U6C A;  4FWH A;  2MRO B;  4QOZ C;  4LG2 A;  1FNN A;  4MGI E;  2Z4R A;  3GLF E;  2CHQ A;  2QBY B;  2K47 A;  4REZ A;  1IBK M;  2ZTD A;  1QAM A;  2XFT A;  4JN6 A;  1TH3 A;  2J7O A;  1QQW A;  1BVS A;  3HHY A;  2DZL A;  2JP7 A;  5FTK A;  4B3S M;  3U5Z A;  3J7A S;  4L8R C;  3FE3 A;  2RGH A;  1IN6 A;  4L6V 6;  3U60 B;  2Y21 A;  1NHW C;  1T43 A;  4QNR A;  4ANR A;  1J09 A;  2CFO A;  2FE8 A;  2K6B A;  2DAK A;  2KNZ A;  2LHC A;  4JI7 M;  5KQ8 A;  5DYI A;  3RGS A;  3J27 B;  3MMP A;  4IJE A;  1IM2 A;  1C1K A;  5F3W A;  3T6P A;  2E5L M;  1F4I A;  3CF6 E;  4GMQ A;  5FTL A;  3U61 B;  2G3Q A;  5GKN A;  4BBA A;  2R6F A;  4LJA A;  3HU3 A;  1D0L A;  2KW0 A;  4AZF A;  3KS8 A;  2G8L A;  3ILK A;  4GC9 A;  2HL7 A;  1J7K A;  4L78 A;  4MM3 B;  2WSC F;  2R45 A;  2OQ4 A;  4LJ8 A;  5LMU M;  1XMQ M;  1IN5 A;  2UUB M;  3J81 S;  3I4Y A;  4FW9 A;  2LNH C;  4I4L A;  1NV8 A;  1TDZ A;  2DAE A;  1QZE A;  1WGN A;  1N32 M;  4IBD A;  4II7 A;  1VQ1 A;  4AKH A;  4X62 M;  4B08 A;  1FJG M;  4B3T M;  4FD2 A;  1JQJ C;  1GJT A;  2N35 A;  3LMM A;  1G59 A;  3KOX E;  2D7E A;  2CRU A;  4B3R M;  4IBF A;  4AI6 A;  2X49 A;  1QDT A;  1QAQ A;  4CHT B;  3GP1 A;  1IXR C;  1QDR A;  2VF8 A;  3IHP A;  3L28 A;  1VEJ A;  3LQQ A;  3GLI B;  1HT2 E;  2XEP A;  1VDD A;  5H37 D;  4XK8 F;  2LVO C;  1TDH A;  2XZU A;  1DGG A;  3B7Z A;  5IWA M;  4DR6 M;  3VFD A;  4R71 A;  1IBL M;  3E4R A;  1PJI A;  2CV2 A;  2QPA A;  4LFA M;  1HR0 M;  3Q8G A;  1PRB A;  1VDL A;  4GIP A;  4GRI A;  2L6O A;  3T1H M;  1NHG C;  2DAM A;  2F5N A;  3I51 A;  3FTF A;  2LTU A;  2ZBK B;  3H4M A;  3SAU A;  2C9O A;  2XH9 A;  2LVP C;  3GPX A;  4DV3 M;  3BOS A;  1SXJ E;  3UJN A;  2FOI C;  3W67 A;  5EXX A;  3A45 A;  2D7G A;  2UUC M;  1OAI A;  2QBY A;  1TF0 B;  1XHB A;  4PDG A;  4DR7 M;  2YQZ A;  2Y0T A;  1WJ7 A;  2BJV A;  2HHH M;  4W5W A;  1OJL A;  3IG5 A;  4JYA M;  1I4W A;  3GO8 A;  3I04 M;  4GIT A;  3U60 A;  4GKK M;  4I81 A;  1OTR A;  2QCU A;  2V1C A;  3FTC A;  3GRV A;  4CJ6 A;  2C96 A;  2XF3 A;  3K9P A;  5L8R F;  3C58 A;  4G4N A;  1DV0 A;  4IBG A;  5LMN M;  3NBX X;  2EJS A;  5IZ7 D;  2L2D A;  4L16 A;  2CV1 A;  2EKF A;  4NOO B;  1AUA A;  3SYK A;  2FFJ A;  3VK7 A;  1TTE A;  3U6O A;  1E9R A;  1R6B X;  1MU5 A;  4HL4 A;  3U61 A;  3HX3 A;  2DWL A;  3KSJ A;  1EE8 A;  3ZCB B;  4FWD A;  3SHF A;  2KZS A;  3AV0 A;  3HJ8 A;  4P17 A;  1IXZ A;  1K82 A;  4GEW A;  4LF7 M;  4GKJ M;  4KOD A;  2R4J A;  2Y0Q A;  4RNA A;  2CHV A;  2L7H A;  3WHL A;  5ITQ A;  2BWB A;  2VII A;  2LH0 A;  4OU7 A;  4X66 M;  1YE9 A;  4AW4 A;  1KFV A;  1Z59 A;  3B74 A;  1NJF A;  4KT0 F;  4DR5 M;  2FS1 A;  1N33 M;  1XB2 B;  3BBZ A;  3HU2 A;  4M9Z A;  4F1I A;  3L25 A;  1SXJ D;  3M7G A;  1L2C A;  2ZAN A;  4JI0 M;  2DEN A;  2LHG A;  3HU1 A;  4M0D A;  3SBJ A;  3L26 A;  4B3M M;  2CE7 A;  2H5X A;  5EQT A;  1R5L A;  2C5R A;  2DWM A;  4RF0 A;  1KSF X;  2L7I A;  1RU3 A;  4GHA A;  1EIJ A;  2F5O A;  3GQ5 A;  2F5Q A;  3L27 A;  4AG5 A;  2F5P A;  3SHG B;  1HJP A;  1T3T A;  5ITU A;  1TH4 A;  2Z7J A;  2DZN B;  3A42 A;  3KDS E;  5KPR A;  3FD9 A;  1Q3B A;  1IY1 A;  1W5T A;  4G6Z A;  2UXC M;  2LWX A;  1GJS A;  5EP1 A;  4BB9 A;  2MJ5 B;  3VKG A;  3PXG A;  5KQD A;  3B89 A;  3SYL A;  2L4F A;  2OOB A;  4PD2 A;  1G71 A;  4NXM M;  1X37 A;  3GLI E;  2HCB A;  1AIP C;  1IN8 A;  4ZPX A;  4DUY M;  3GLH B;  5KPT A;  1MJG M;  5E26 A;  2UXB M;  1OAO C;  4NC6 A;  2R4E A;  2C99 A;  3PNY A;  7CAT A;  1QUT A;  5EP2 A;  4DV4 M;  3JAM S;  1Q02 A;  3RGP A;  1QAO A;  2KRK A;  4NSO B;  2XZF A;  1ZV1 A;  1ZMV A;  2OPF A;  2XFS A;  1N36 M;  3AOE C;  1D0M A;  4OW0 A;  4RKU F;  4R3D A;  2KXE A;  3L2A A;  3KVW A;  1IBM M;  1L2B A;  1PM5 A;  4NSR A;  4A3V B;  3LQR A;  4KLN A;  4PT5 A;  1Z6T A;  1JR3 E;  1DGH B;  3E9S A;  3QYB A;  5KO3 A;  1GL7 A;  1N77 A;  2UUA M;  3W68 A;  1EFU B;  2MH8 A;  1R4G A;  3AOG A;  4FVM A;  5ITX A;  3CGW A;  2BNK A;  4LGY A;  3ZC7 B;  2Q2E B;  1L1Z A;  1GVN A;  4ITQ A;  1E9S A;  1Y8G A;  2BWE A;  2KDL A;  2LBC A;  1D2N A;  3PFI A;  1PJQ A;  5EXP A;  1K3W A;  1Z5C A;  1G41 A;  4PDI A;  1DGF A;  2J5Y A;  3W0L B;  4CIZ A;  1DGB A;  4WUR A;  4IIW A;  1SXJ A;  2KNV A;  2GNO A;  2UXD M;  3VDP A;  1WR1 B;  3GPP A;  2CWB A;  3U6D A;  3F92 A;  4LZZ A;  3TPZ A;  5ITX E;  4NXN M;  1QZM A;  4MGK E;  3LW5 F;  3GLG B;  1GLN A;  2O25 A;  3H4J A;  1GL6 A;  4D82 A;  5JI3 E;  1OFH A;  1MN3 A;  3FTD A;  2EA0 A;  4AQY M;  2K0B X;  3J2P B;  3LCU A;  4LFC M;  2EUC A;  1UM8 A;  2L09 A;  3GRU A;  3C9P A;  5FTJ A;  4YY3 M;  3U6L A;  3HY5 A;  1E32 A;  1UFZ A;  5EJC A;  3JR4 A;  2MGW A;  4AKG A;  4M9S A;  5EXS A;  5KPZ A;  3UZU A;  2LVN C;  1H6U A;  1Q3C A;  2XLJ A;  1TR8 A;  3SMS A;  4JI6 M;  3AKZ A;  3NBI A;  4DV2 M;  2ERC A;  2O01 F;  4JI4 M;  1Q39 A;  4GH9 A;  2ZTC A;  4IBE A;  1V34 A;  2QP9 X;  4HLQ A;  4G4Q A;  1JR3 D;  1NV9 A;  2DI0 A;  3MK6 A;  2HAK A;  4QOS A;  3D8L A;  2A5Y B;  3QAU A;  1D0K A;  1OQY A;  4Z6Y A;  1PJJ A;  3R9X B;  2J7N A;  3CF0 A;  3EIE A;  3PNV A;  4M0W A;  4DV0 M;  1XC8 A;  3VK8 A;  4LY6 A;  2R62 A;  3GLH A;  1QYR A;  4X65 M;  4LRS A;  3TWM A;  2QEN A;  5JI2 E;  3KFU G;  2M5Z A;  4I8O A;  4MGH A;  3TWK A;  3UMM A;  2YNM D;  4DR2 M;  4UN2 B;  3FUV A;  3U6P A;  1J5E M;  3D8B A;  3HZJ A;  1C7Y A;  2XSZ D;  4GHL A;  1GO5 A;  3UK6 A;  1R7R A;  2DHR A;  2CEA A;  3HHZ A;  2R46 A;  2CUZ A;  4MB7 A;  4LF6 M;  2GQF A;  1ORY B;  1ZAE A;  4FCV A;  2WSF F;  4OX9 M;  2JY8 A;  5DYG A;  4LJ9 A;  1PGY A;  3Q8X A;  4DUZ M;  3NWL A;  4XBO A;  1NY5 A;  3K8Z A;  4Y28 F;  3KOW E;  3MHV C;  1XXH B;  4L4U A;  1WIV A;  1QVR A;  3GLH E;  1LTM A;  2R0I A;  4RF1 A;  3V76 A;  3HKP A;  3SAW A;  2DAI A;  5C1B A;  4LF9 M;  2APL A;  1PJT A;  4LF8 M;  3FRH A;  5EP3 A;  4YHH M;  4JI2 M;  2Z8Y M;  4G3O A;  1IXS B;  2OOA A;  2RKO A;  3TL4 X;  3AFH A;  2W82 A;  4LF4 M;  1OIZ A;  4GC5 A;  5FTN A;  1Z5B A;  4IBK A;  1XNR M;  3DA1 A;  3WHK A;  2JY7 A;  3DFZ A;  3GLI A;  5A2Q S;  2KHH A;  3TE6 A;  4LFB M;  1QUS A;  1MX0 A;  1I94 M;  2VQE M;  3C3E A;  3HWS A;  5IRE B;  1NSF A;  1HT1 E;  1NVM A;  3MJ5 A;  3LCV B;  3DZD A;  3SMP A;  4MGZ E;  4LRT A;  3GLG A;  1L1T A;  5EXT A;  4KO8 A;  3FYC A;  3B7N A;  4Q7J A;  4B7F A;  2KA6 B;  3SAS A;  3A98 B;  1N78 A;  1P3Q Q;  4DR1 M;  3KP1 E;  2JXN A;  1OKS A;  3ZQJ A;  2XGN A;  4M9X A;  3A46 A;  2D7H A;  4JI5 M;  5BPV A;  1TGU A;  1N34 M;  1IFY A;  4LJ6 A;  1IN7 A;  1A5T A;  2X4A A;  5BR8 M;  4AG6 A;  4LJ4 A;  1JR3 A;  2Z4S A;  3GQ4 A;  1TH2 A;  2K9D A;  1HQY E;  3FUT A;  3KS4 A;  4Z8X A;  2YFQ A;  1LV7 A;  1YLA A;  3FKE A;  1HNX M;  3VDU A; 
#chains in the Genus database with same CATH homology
 3GLG E;  2LVA A;  2QHO B;  1DO2 A;  1V92 A;  2KNV A;  1WR1 B;  2CWB A;  2L4E A;  3F92 A;  1OTR A;  2JZ0 A;  3K9P A;  2O25 A;  3H4J A;  2WZJ A;  1DV0 A;  4HEO A;  1MN3 A;  2EJS A;  2L2D A;  2K0B X;  1ZMW A;  2EKF A;  2EKK A;  3LCU A;  4DBG B;  4F2L A;  2LVQ D;  2MRO B;  1TTE A;  2JZ1 A;  1G3I A;  3GLF E;  1UFZ A;  1G4A E;  2MGW A;  2ZTD A;  3FRI A;  3K9O A;  2DHY A;  2LVN C;  1CUK A;  4GEW A;  1BVS A;  1TR8 A;  2DZL A;  2JP7 A;  1VG5 A;  3FE3 A;  2BWB A;  2QSF X;  2MR9 A;  2ZTC A;  1T43 A;  1NV9 A;  2DI0 A;  5DFL A;  2KNZ A;  2DAK A;  2HAK A;  1XB2 B;  1OQY A;  3BBZ A;  1G41 A;  2JY5 A;  3MMP A;  1IM2 A;  1F4I A;  3T6P A;  4F1I A;  2G3Q A;  2DEN A;  1IXS A;  2QNJ A;  5JI2 E;  2H5X A;  4UN2 B;  1C7Y A;  1GO5 A;  3IEC A;  4WP2 A;  1XXH E;  1HJP A;  1NV8 A;  2DAE A;  2OO9 A;  1ZMU A;  1QZE A;  1T6O A;  1WGN A;  2JY8 A;  1PGY A;  1VQ1 A;  2MJ5 B;  1WIV A;  3GLH E;  2R0I A;  2HWJ A;  1DO0 A;  1WHC A;  3B89 A;  2DAI A;  2L4F A;  2OOB A;  3FRH A;  1VEK A;  3GLI E;  1AIP C;  1WGL A;  2B3T A;  2OOA A;  4G3O A;  2DKL A;  2DAG A;  3E46 A;  3IHP A;  1KYI A;  1VEJ A;  1Q02 A;  1SG9 A;  1HT2 E;  1E94 E;  2JY7 A;  1ZV1 A;  1ZMV A;  2LVO C;  2KHH A;  2JY6 B;  2DNA A;  2CP8 A;  4R71 A;  1HT1 E;  3E21 A;  3LCV B;  2JNH A;  1VDL A;  1JR3 E;  4Q7J A;  2DAM A;  2JUJ A;  1EFU B;  1P3Q Q;  1R4G A;  2LTU A;  1VEG A;  1OKS A;  2LVP C;  1IFY A;  1A5T A;  2BWE A;  1Y8G A;  2LBC A;  1OAI A;  2K9D A;  1HQY E;  1WJ7 A;  2RRU A;  1YLA A;  2KNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...