1OTRA

Solution structure of a cue-ubiquitin complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
49
structure length
49
Chain Sequence
NDDHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKENDDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a CUE-Ubiquitin Complex Reveals a Conserved Mode of Ubiquitin Binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords protein Cue2
total genus 11
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2003-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1otrA00
1NV8A 4DBGB 1MN3A 2LVNC 2LVAA 1HJPA 2L4EA 1IFYA 1TR8A 1VEGA 1E94E 4UN2B 1VQ1A 1ZV1A 1WGNA 5DFLA 1TTEA 2LTUA 1BVSA 1CUKA 3E21A 1VG5A 2WZJA 2DAKA 1WGLA 5JI2E 1Y8GA 3B89A 1WR1B 1JR3E 1OAIA 1T6OA 2L2DA 1ZMVA 2DKLA 3IECA 3FE3A 3E46A 2HAKA 2OOAA 3GLHE 2L4FA 1OKSA 2JZ1A 2MJ5B 1Q02A 1ZMUA 2JUJA 1C7YA 1WHCA 1AIPC 2CWBA 3K9PA 2HWJA 2EKFA 1DV0A 2JY5A 1HT1E 2DHYA 3GLIE 1ZMWA 2OO9A 2LBCA 3FRHA 2ZTCA 1VDLA 1WJ7A 3FRIA 1G4AE 3MMPA 4G3OA 1V92A 2DENA 2R0IA 1G41A 3LCVB 2KNVA 1HQYE 1EFUB 1PGYA 1XXHE 2G3QA 2DAMA 1WIVA 2K0BX 2H5XA 3GLFE 1F4IA 2B3TA 1G3IA 4F1IA 2CP8A 3K9OA 4Q7JA 1OQYA 2QNJA 2JP7A 2BWEA 1IM2A 2LVOC 2O25A 2ZTDA 1DO0A 2DZLA 3T6PA 1QZEA 1T43A 3BBZA 4R71A 2MR9A 4GEWA 2KNAA 2QSFX 2MROB 2JNHA 3IHPA 2DAGA 4F2LA 1GO5A 1OTRA 2EKKA 1VEJA 1R4GA 4HEOA 2JY8A 2RRUA 1UFZA 1IXSA 2MGWA 1NV9A 1A5TA 1P3QQ 4WP2A 2LVPC 1KYIA 2LVQD 2KNZA 1YLAA 2DI0A 1HT2E 1SG9A 2KHHA 2DAIA 1XB2B 2QHOB 2JY7A 2OOBA 2K9DA 2JZ0A 2DAEA 1VEKA 3F92A 2EJSA 1DO2A 2DNAA 3H4JA 3GLGE 2JY6B 3LCUA 2BWBA
chains in the Genus database with same CATH superfamily
1HQCA 1I94M 3HZJA 5KPTA 2R46A 1NVMA 1L2DA 2L4EA 1OIZA 3WHKA 4UN2B 4R7GA 1Z5BA 2WSEF 1WGNA 3MHVC 4I8OA 3KS4A 4DR4M 1IXZA 1WXQA 3HU2A 2F4VM 1SXJA 5ITYA 1PJIA 2WZJA 2UUCM 1WGLA 1PJSA 2Z3XA 4PDIA 1TH3A 2YNMD 1D0MA 5EXPA 3ZCBB 1WR1B 3KSJA 1PJJA 1JR3E 1Z59A 3L27A 3AL0C 2FH0A 3IECA 3FE3A 1XC8A 2EUCA 2HAKA 2OOAA 4GHAA 4GHLA 2JZ1A 4RF0A 4NRVA 2R62A 1Q02A 1X37A 5EJCA 3B9PA 2W82A 1C7YA 2CWBA 2FOIC 4B3MM 1YUBA 3GLHA 3K9PA 3GQ4A 3RE8A 2EKFA 3DZDA 4B7HA 3AJIB 2P5TA 3E9SA 4OVZA 5EXSA 1IY2A 5LMUM 5ITRA 4IBFA 3GLIE 1ZMWA 1ORYB 3HU1A 1XHBA 3FRHA 3U6LA 2DVWB 3GPUA 4JI1M 3HGIA 5FSWA 3U5ZB 1TDHA 3TQSA 3LCVB 2F5SA 4TUWA 3LVWA 1OAOC 1NNUC 3QYEA 2MH8A 1EFUB 1QYRA 5GKNA 4IBEA 4HLQA 2DZNB 1WIVA 2L7HA 4QHTA 3J81S 4JI7M 1F4IA 1QAMA 1Z5AA 2KA6B 4FCWA 3GLHB 4G4NA 4KHPM 4QHSA 4IBBA 3W0FA 1Z6TA 2CP8A 4KODA 3QAUA 1IXSB 2O01F 3U60B 4LRSA 4NC6A 3GQ5A 3GLGB 2XH9A 2O25A 2ZTDA 4ANRA 1YE9A 2OPFA 1QZEA 4M0DA 1T43A 4B7FA 4NXMM 1XNRM 3LQRA 2DHRA 3B7ZA 4FWHA 4CJ6A 4R71A 4DV7M 3D8BA 1IY0A 3IHPA 5KQ8A 3HJSA 3SYKA 4F2LA 2R4EA 3H4MA 2KEBA 2R45A 4JI3M 4QOZC 2YFQA 1GO5A 2A5YB 2EKKA 1FNNA 4HEOA 2CFOA 3LQQA 2QBYB 4MGIE 5DNYA 3D8LA 1N33M 4X65M 3A45A 2RRUA 3GPPA 3V76A 4DR7M 3DA1A 1R7RA 4L8RC 4HL4A 5E26A 4LFAM 1NNJA 2QP9X 4WP2A 2LVPC 2LVQD 4LY6A 3C58A 1NY6A 1QUTA 4G4OA 2DI0A 2FE8A 3FTCA 3HHYA 2FS1A 3T38A 2KZSA 4DV1M 1HT2E 1IN7A 4LRTA 1XB2B 2D7HA 1GL7A 4AQYM 2X8AA 4L6V6 3T1HM 1ZAEA 5FLXS 3NWLA 1D2NA 3F92A 3H4JA 4NXNM 3SBJA 3LCUA 4MH0E 3KOWE 3KXEC 3SFZA 3U6OA 3B74A 2Z4RA 4G4RA 3J7AS 3U6DA 4CGYB 2BJVA 2C9CA 5C1BA 2ZM6M 3TWMA 1MN3A 4DR6M 2ZBKB 3PNYA 2LVNC 2DWNA 2CV2A 3Q8GA 1HJPA 3SMPA 2YR0A 4KO8A 3VLFB 2KXEA 2K6BA 3DOAA 1VEGA 4LJ7A 3A46A 3NBXX 3TWLA 3AFHA 4B08A 1XMOM 2CHQA 4LJAA 2V1UA 3E21A 3GLIA 1Q3CA 1VG5A 4CISA 4PD2A 3CF6E 2R65A 4M0WA 3FUTA 5JI2E 3M0EA 2XEPA 4M9XA 4II7A 4NOOB 1Y8GA 5FTJA 1DGHA 1KFVA 4W5WA 3I4YA 2CV1A 1RU3A 3HHXA 1ZMVA 2DKLA 2LH0A 3HKPA 5FTKA 4LZZA 2VF7A 1NSFA 2L6OA 4IIWA 2L4FA 3SAVA 2MJ5B 1IN4A 3GRRA 2HHHM 5KO3A 8CATA 4B3SM 4IBCA 5JI3E 3K1JA 3JR5A 1JR3A 4FW9A 2CEAA 4MGKE 4OW0A 4MM3B 3L28A 4G6ZA 3GLFA 1IXRC 3KP0E 1YSYA 2G5GX 3AOEA 5EP2A 5ITXE 2XZUA 3K92A 4RKUF 3TWKA 1QDTA 5BPVA 2OO9A 3HU3A 2LBCA 5A2QS 3R8FA 1L2BA 1WJ7A 1G4AE 4YHHM 1IN8A 3MMPA 4M9ZA 4MGZE 4PCZA 2OQ4A 4DR3M 5IZ7D 4LFBM 1V34A 2DENA 2R0IA 1G41A 2XFSA 2DWMA 3PNVA 2X49A 3HX3A 1HQYE 1XXHE 3GP1A 2DAMA 1QQWA 2RGHA 2WSCF 2YQZA 2NQ8C 3I4VA 3J80S 4GC5A 4AZFA 4D82A 1QAQA 2EA0A 4IJFA 4DV5M 2Y0TA 2XZFA 4R3DA 3AOEC 3LMMA 1IN5A 4BBAA 2GQFA 2QNJA 4P17A 2BWEA 3FUWA 3I01M 4CHTB 3AKZA 1QZMA 1GJTA 2QCUA 2X4AA 2DWZB 1IN6A 1IBMM 1L2CA 4NRWA 4GRIA 1HNZM 1D0LA 4DV4M 3UK6A 3L25A 4DR2M 4YY3M 2QSFX 2JNHA 1C1KA 1QDRA 1N75A 7CATA 1K82A 1SXJC 3FUVA 3FYDA 3L29A 1VEJA 1JR3D 1R4GA 4IBJA 5EP1A 1OFIA 4OU7A 2JY8A 5IWAM 2CE7A 1GABA 3VKHA 1GL6A 2BJWA 2MGWA 4DR5M 1A5TA 4X66M 4IBGA 2CV0A 5FTNA 1KYIA 2KNZA 4IBKA 4X62M 1R6BX 2VIIA 2J5YA 4GITA 3VDPA 2KHHA 4LF9M 3VKGA 2QHOB 3U6QA 4FWDA 4S12A 2JY7A 5IREB 1HNWM 2CHGA 3U60A 1KSFX 1XXHB 3GLGA 4Y28F 1VEKA 1NHWC 2L7IA 2C9OA 2DNAA 2EJSA 3GLGE 2JA2A 2JY6B 4I81A 2ZAOA 1AUAA 1DGHB 2JWSA 4IBIA 4MB7A 4DR1M 3R9XB 4LGMA 1TH4A 3M7GA 1G71A 4GIPA 1Z5CA 5BR8M 1NV8A 4LG2A 2XGNA 3W67A 3IG8A 4OVZB 3TPZA 4BLCA 5KPZA 2LVAA 3VK8A 1IFYA 1TR8A 1N32M 5ITQA 4GKKM 1E94E 1VQ1A 3U5ZA 4Z8XA 3T15A 2LTUA 3VDUA 1BVSA 1CUKA 1DGGA 1T3TA 3SC3A 4DV6M 3JAMS 1MJGM 3PVSA 2DAKA 3HJ8A 4DUZM 1JB0F 1SXJD 3BOSA 1DGFA 1IY1A 3GRVA 3B89A 1GVNA 3MK6A 2Q2EB 1OAIA 4QNRA 5F3WA 3RFWA 2L2DA 2J7NA 1GKIA 2VF8A 5KPRA 2XSZA 4BB9A 1XNQM 4L78A 4DV3M 1NHGC 2LWXA 4LJ6A 4QOSA 2XLJA 1IQPA 3J27B 2EO2A 3AV0A 1ZMUA 3KVWA 4AKIA 2R4JA 3K8ZA 2CUZA 5H37D 1AIPC 1TDZA 1QAOA 4Z6YA 3KDSE 3U61B 2F5OA 3CGWA 4NSRA 3HHZA 2HWJA 3FTDA 4LJ9A 3JR4A 2XF3A 2UXCM 4B3TM 1MX0A 1Q39A 4LF7M 2JY5A 4LF6M 1DV0A 1HT1E 1R2YA 5E6JA 2UU9M 3KOYE 3B7NA 5EXXA 1J7KA 1OFHA 4GKJM 2D7GA 2ZTCA 3FRIA 1N78A 4JI2M 1V92A 3AOGA 4KLNA 3ZH9B 2KNVA 4FCTA 4JI6M 3FUUA 4JI5M 1PJQA 4LJ8A 3SHGB 2XFTA 4IBDA 2CRUA 4LCBA 3UZUA 3GRYA 2K0BX 4FCVA 3GPXA 1TGUA 3U6SA 5LMNM 1LV7A 1NJGA 4AI6A 4OX9M 2FNAA 2B3TA 3EIHA 1G3IA 2RKOA 2CHVA 1NY5A 3C9PA 4F1IA 1OIPA 3VFDA 4D81A 4Q7JA 1OQYA 4REZA 4DV0M 3RGPA 5DYGA 4JI8M 3KS8A 1IM2A 4LJ4A 2LXEA 4L4UA 3ZQJA 2L09A 2LVOC 3PXGA 2R6FA 1DO0A 4LZJA 1L8QA 1TF0B 1G59A 2Z7JA 3U6EA 2MR9A 4GEWA 1W5TA 2K47A 3U6MA 2C98A 1ZQ9A 3W68A 3T1YM 4AW4A 3J2PB 2DAGA 3KOZE 4JXJA 1EE8A 4LF5M 1NO1A 5FTMA 4DUYM 3UJNA 1N34M 2BNKA 3HHWA 1J09A 1HR0M 2F5NA 3SARA 4AG6A 3LW5F 1PJTA 4L15A 1K3WA 3FKEA 3FTEA 1UFZA 3GLIB 3SASA 3E4RA 1NV9A 1P3QQ 4B3RM 2Y0QA 3B7QA 3THGA 1UM8A 2KDLA 1W5SA 3U6CA 2HL7A 2LNHC 1YLAA 4B7GA 3WHLA 2UUBM 1QUSA 2I7PA 2I7NA 1SXJE 3FYCA 3HWSA 3PFIA 2DAIA 3SHFA 2VDBB 4LFCM 2QZ4A 3TL4X 2M5ZA 1GLNA 3GPYA 1R2ZA 5EP3A 3GO8A 4AKGA 2DAEA 4L16A 2F5QA 1DO2A 1VDDA 3C3EA 3I04M 4IJEA 5DYIA 2APLA 1I4WA 2UXDM 5IT9S 4FVMA 2FFJA 4XK8F 4DBGB 2KW0A 3QWLA 2DWLA 4MGHA 3SYLA 3UGJA 3GRUA 4NSOB 3A42A 3GLFB 3ILKA 2D7EA 2QPAA 1N77A 1XWIA 5ITTA 3HY5A 5DFLA 1ZV1A 3MJ5A 3L2AA 1TTEA 4DV2M 5KQDA 2G8LA 3OTOM 3U61A 5FTLA 3I51A 1EIJA 2UXBM 3FUXA 1OJLA 5ITUA 3GQ3A 3VK7A 4QNMA 1NJFA 1L1ZA 4KT0F 1T6OA 2RGOA 3LVVA 4X64M 2O5RA 2H1RA 1XMQM 4LJ5A 2KRUA 4CIZA 3E46A 2GNOA 3GLHE 1OKSA 1G8PA 4WW0A 4EIWA 2HKJA 3BXWA 2JUJA 1E32A 3CTWB 1WHCA 4ZPXA 3KSXA 2F5PA 4FWGA 2Y21A 4I4LA 3SATA 3K2LA 4XBOA 2ZANA 2HCBA 3CF0A 1V33A 3KP1E 2UUAM 2DHYA 2E5LM 3UMMA 2AHMA 1FJGM 4JV5M 1VDLA 2R44A 4M9SA 1QANA 4G3OA 2ZAMA 3RGSA 4ITQA 4JYAM 1LTMA 2Z4SA 4JN6A 3FD9A 2N35A 2LHGA 3TE6A 1HNXM 2Y20A 1PGYA 3KW6A 4GH9A 2V6ZM 2G3QA 1QVRA 2H5XA 2QQ8A 5L8RF 3GLFE 1J5EM 2R18A 3DFZA 3EIEA 1IBLM 4MGYE 5ITXA 4I5SA 3J7BA 4PDGA 3K9OA 2C96A 1E9RA 4JI0M 2JP7A 2V1CA 3U6PA 4RF1A 4AKHA 2QBYA 3FTFA 4WURA 1N36M 2XSZD 4K0KM 2KZUA 2WSFF 2QENA 2KRKA 2J7OA 2DZLA 3T6PA 1XXHA 3BBZA 5EP4A 2KNAA 5C18A 2MROB 4LF8M 5EQTA 1R5LA 1IBKM 4GC9A 4FD2A 3KFUG 1L1TA 4D80A 1OTRA 3SAUA 2JXNA 3IG5A 5EXTA 2C5RA 4G4QA 4LF4M 1IXSA 1PM5A 4RNAA 4XGIA 2VQFM 3CF2A 3L26A 2ERCA 2VQEM 4JI4M 2DXIA 2C99A 1K3XA 1DGBA 3A98B 3ZC7B 4LGYA 3NBIA 1E9SA 1SG9A 2Z8YM 3M6AA 3W0LB 4GMQA 4AG5A 1H6UA 1PRBA 3C3DA 4NL4H 2DZOB 4P16A 3HJQA 1D0KA 2M60A 2OOBA 3Q8XA 1GJSA 1SXJB 1MU5A 2K9DA 2JZ0A 4PT5A 3QYBA 1Q3BA 3SAWA 1S3SA 1TH2A 4A3VB 3KOXE 2LHCA 2BWBA 1JQJC 3SMSA
chains in the Genus database with same CATH topology
1NV8A 4DBGB 1MN3A 2LVNC 2LVAA 1HJPA 2L4EA 1IFYA 1TR8A 1VEGA 1E94E 4UN2B 1VQ1A 1ZV1A 1WGNA 5DFLA 1TTEA 2LTUA 1BVSA 1CUKA 3E21A 1VG5A 2WZJA 2DAKA 1WGLA 5JI2E 1Y8GA 3B89A 1WR1B 1JR3E 1OAIA 1T6OA 2L2DA 1ZMVA 2DKLA 3IECA 3FE3A 3E46A 2HAKA 2OOAA 3GLHE 2L4FA 1OKSA 2JZ1A 2MJ5B 1Q02A 1ZMUA 2JUJA 1C7YA 1WHCA 1AIPC 2CWBA 3K9PA 2HWJA 2EKFA 1DV0A 2JY5A 1HT1E 2DHYA 3GLIE 1ZMWA 2OO9A 2LBCA 3FRHA 2ZTCA 1VDLA 1WJ7A 3FRIA 1G4AE 3MMPA 4G3OA 1V92A 2DENA 2R0IA 1G41A 3LCVB 2KNVA 1HQYE 1EFUB 1PGYA 1XXHE 2G3QA 2DAMA 1WIVA 2K0BX 2H5XA 3GLFE 1F4IA 2B3TA 1G3IA 4F1IA 2CP8A 3K9OA 4Q7JA 1OQYA 2QNJA 2JP7A 2BWEA 1IM2A 2LVOC 2O25A 2ZTDA 1DO0A 2DZLA 3T6PA 1QZEA 1T43A 3BBZA 4R71A 2MR9A 4GEWA 2KNAA 2QSFX 2MROB 2JNHA 3IHPA 2DAGA 4F2LA 1GO5A 1OTRA 2EKKA 1VEJA 1R4GA 4HEOA 2JY8A 2RRUA 1UFZA 1IXSA 2MGWA 1NV9A 1A5TA 1P3QQ 4WP2A 2LVPC 1KYIA 2LVQD 2KNZA 1YLAA 2DI0A 1HT2E 1SG9A 2KHHA 2DAIA 1XB2B 2QHOB 2JY7A 2OOBA 2K9DA 2JZ0A 2DAEA 1VEKA 3F92A 2EJSA 1DO2A 2DNAA 3H4JA 3GLGE 2JY6B 3LCUA 2BWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV8 A;  4DBG B;  1MN3 A;  2LVN C;  2LVA A;  1HJP A;  2L4E A;  1IFY A;  1TR8 A;  1VEG A;  1E94 E;  4UN2 B;  1VQ1 A;  1ZV1 A;  1WGN A;  5DFL A;  1TTE A;  2LTU A;  1BVS A;  1CUK A;  3E21 A;  1VG5 A;  2WZJ A;  2DAK A;  1WGL A;  5JI2 E;  1Y8G A;  3B89 A;  1WR1 B;  1JR3 E;  1OAI A;  1T6O A;  2L2D A;  1ZMV A;  2DKL A;  3IEC A;  3FE3 A;  3E46 A;  2HAK A;  2OOA A;  3GLH E;  2L4F A;  1OKS A;  2JZ1 A;  2MJ5 B;  1Q02 A;  1ZMU A;  2JUJ A;  1C7Y A;  1WHC A;  1AIP C;  2CWB A;  3K9P A;  2HWJ A;  2EKF A;  1DV0 A;  2JY5 A;  1HT1 E;  2DHY A;  3GLI E;  1ZMW A;  2OO9 A;  2LBC A;  3FRH A;  2ZTC A;  1VDL A;  1WJ7 A;  3FRI A;  1G4A E;  3MMP A;  4G3O A;  1V92 A;  2DEN A;  2R0I A;  1G41 A;  3LCV B;  2KNV A;  1HQY E;  1EFU B;  1PGY A;  1XXH E;  2G3Q A;  2DAM A;  1WIV A;  2K0B X;  2H5X A;  3GLF E;  1F4I A;  2B3T A;  1G3I A;  4F1I A;  2CP8 A;  3K9O A;  4Q7J A;  1OQY A;  2QNJ A;  2JP7 A;  2BWE A;  1IM2 A;  2LVO C;  2O25 A;  2ZTD A;  1DO0 A;  2DZL A;  3T6P A;  1QZE A;  1T43 A;  3BBZ A;  4R71 A;  2MR9 A;  4GEW A;  2KNA A;  2QSF X;  2MRO B;  2JNH A;  3IHP A;  2DAG A;  4F2L A;  1GO5 A;  1OTR A;  2EKK A;  1VEJ A;  1R4G A;  4HEO A;  2JY8 A;  2RRU A;  1UFZ A;  1IXS A;  2MGW A;  1NV9 A;  1A5T A;  1P3Q Q;  4WP2 A;  2LVP C;  1KYI A;  2LVQ D;  2KNZ A;  1YLA A;  2DI0 A;  1HT2 E;  1SG9 A;  2KHH A;  2DAI A;  1XB2 B;  2QHO B;  2JY7 A;  2OOB A;  2K9D A;  2JZ0 A;  2DAE A;  1VEK A;  3F92 A;  2EJS A;  1DO2 A;  2DNA A;  3H4J A;  3GLG E;  2JY6 B;  3LCU A;  2BWB A; 
#chains in the Genus database with same CATH topology
 1HQC A;  1I94 M;  3HZJ A;  5KPT A;  2R46 A;  1NVM A;  1L2D A;  2L4E A;  1OIZ A;  3WHK A;  4UN2 B;  4R7G A;  1Z5B A;  2WSE F;  1WGN A;  3MHV C;  4I8O A;  3KS4 A;  4DR4 M;  1IXZ A;  1WXQ A;  3HU2 A;  2F4V M;  1SXJ A;  5ITY A;  1PJI A;  2WZJ A;  2UUC M;  1WGL A;  1PJS A;  2Z3X A;  4PDI A;  1TH3 A;  2YNM D;  1D0M A;  5EXP A;  3ZCB B;  1WR1 B;  3KSJ A;  1PJJ A;  1JR3 E;  1Z59 A;  3L27 A;  3AL0 C;  2FH0 A;  3IEC A;  3FE3 A;  1XC8 A;  2EUC A;  2HAK A;  2OOA A;  4GHA A;  4GHL A;  2JZ1 A;  4RF0 A;  4NRV A;  2R62 A;  1Q02 A;  1X37 A;  5EJC A;  3B9P A;  2W82 A;  1C7Y A;  2CWB A;  2FOI C;  4B3M M;  1YUB A;  3GLH A;  3K9P A;  3GQ4 A;  3RE8 A;  2EKF A;  3DZD A;  4B7H A;  3AJI B;  2P5T A;  3E9S A;  4OVZ A;  5EXS A;  1IY2 A;  5LMU M;  5ITR A;  4IBF A;  3GLI E;  1ZMW A;  1ORY B;  3HU1 A;  1XHB A;  3FRH A;  3U6L A;  2DVW B;  3GPU A;  4JI1 M;  3HGI A;  5FSW A;  3U5Z B;  1TDH A;  3TQS A;  3LCV B;  2F5S A;  4TUW A;  3LVW A;  1OAO C;  1NNU C;  3QYE A;  2MH8 A;  1EFU B;  1QYR A;  5GKN A;  4IBE A;  4HLQ A;  2DZN B;  1WIV A;  2L7H A;  4QHT A;  3J81 S;  4JI7 M;  1F4I A;  1QAM A;  1Z5A A;  2KA6 B;  4FCW A;  3GLH B;  4G4N A;  4KHP M;  4QHS A;  4IBB A;  3W0F A;  1Z6T A;  2CP8 A;  4KOD A;  3QAU A;  1IXS B;  2O01 F;  3U60 B;  4LRS A;  4NC6 A;  3GQ5 A;  3GLG B;  2XH9 A;  2O25 A;  2ZTD A;  4ANR A;  1YE9 A;  2OPF A;  1QZE A;  4M0D A;  1T43 A;  4B7F A;  4NXM M;  1XNR M;  3LQR A;  2DHR A;  3B7Z A;  4FWH A;  4CJ6 A;  4R71 A;  4DV7 M;  3D8B A;  1IY0 A;  3IHP A;  5KQ8 A;  3HJS A;  3SYK A;  4F2L A;  2R4E A;  3H4M A;  2KEB A;  2R45 A;  4JI3 M;  4QOZ C;  2YFQ A;  1GO5 A;  2A5Y B;  2EKK A;  1FNN A;  4HEO A;  2CFO A;  3LQQ A;  2QBY B;  4MGI E;  5DNY A;  3D8L A;  1N33 M;  4X65 M;  3A45 A;  2RRU A;  3GPP A;  3V76 A;  4DR7 M;  3DA1 A;  1R7R A;  4L8R C;  4HL4 A;  5E26 A;  4LFA M;  1NNJ A;  2QP9 X;  4WP2 A;  2LVP C;  2LVQ D;  4LY6 A;  3C58 A;  1NY6 A;  1QUT A;  4G4O A;  2DI0 A;  2FE8 A;  3FTC A;  3HHY A;  2FS1 A;  3T38 A;  2KZS A;  4DV1 M;  1HT2 E;  1IN7 A;  4LRT A;  1XB2 B;  2D7H A;  1GL7 A;  4AQY M;  2X8A A;  4L6V 6;  3T1H M;  1ZAE A;  5FLX S;  3NWL A;  1D2N A;  3F92 A;  3H4J A;  4NXN M;  3SBJ A;  3LCU A;  4MH0 E;  3KOW E;  3KXE C;  3SFZ A;  3U6O A;  3B74 A;  2Z4R A;  4G4R A;  3J7A S;  3U6D A;  4CGY B;  2BJV A;  2C9C A;  5C1B A;  2ZM6 M;  3TWM A;  1MN3 A;  4DR6 M;  2ZBK B;  3PNY A;  2LVN C;  2DWN A;  2CV2 A;  3Q8G A;  1HJP A;  3SMP A;  2YR0 A;  4KO8 A;  3VLF B;  2KXE A;  2K6B A;  3DOA A;  1VEG A;  4LJ7 A;  3A46 A;  3NBX X;  3TWL A;  3AFH A;  4B08 A;  1XMO M;  2CHQ A;  4LJA A;  2V1U A;  3E21 A;  3GLI A;  1Q3C A;  1VG5 A;  4CIS A;  4PD2 A;  3CF6 E;  2R65 A;  4M0W A;  3FUT A;  5JI2 E;  3M0E A;  2XEP A;  4M9X A;  4II7 A;  4NOO B;  1Y8G A;  5FTJ A;  1DGH A;  1KFV A;  4W5W A;  3I4Y A;  2CV1 A;  1RU3 A;  3HHX A;  1ZMV A;  2DKL A;  2LH0 A;  3HKP A;  5FTK A;  4LZZ A;  2VF7 A;  1NSF A;  2L6O A;  4IIW A;  2L4F A;  3SAV A;  2MJ5 B;  1IN4 A;  3GRR A;  2HHH M;  5KO3 A;  8CAT A;  4B3S M;  4IBC A;  5JI3 E;  3K1J A;  3JR5 A;  1JR3 A;  4FW9 A;  2CEA A;  4MGK E;  4OW0 A;  4MM3 B;  3L28 A;  4G6Z A;  3GLF A;  1IXR C;  3KP0 E;  1YSY A;  2G5G X;  3AOE A;  5EP2 A;  5ITX E;  2XZU A;  3K92 A;  4RKU F;  3TWK A;  1QDT A;  5BPV A;  2OO9 A;  3HU3 A;  2LBC A;  5A2Q S;  3R8F A;  1L2B A;  1WJ7 A;  1G4A E;  4YHH M;  1IN8 A;  3MMP A;  4M9Z A;  4MGZ E;  4PCZ A;  2OQ4 A;  4DR3 M;  5IZ7 D;  4LFB M;  1V34 A;  2DEN A;  2R0I A;  1G41 A;  2XFS A;  2DWM A;  3PNV A;  2X49 A;  3HX3 A;  1HQY E;  1XXH E;  3GP1 A;  2DAM A;  1QQW A;  2RGH A;  2WSC F;  2YQZ A;  2NQ8 C;  3I4V A;  3J80 S;  4GC5 A;  4AZF A;  4D82 A;  1QAQ A;  2EA0 A;  4IJF A;  4DV5 M;  2Y0T A;  2XZF A;  4R3D A;  3AOE C;  3LMM A;  1IN5 A;  4BBA A;  2GQF A;  2QNJ A;  4P17 A;  2BWE A;  3FUW A;  3I01 M;  4CHT B;  3AKZ A;  1QZM A;  1GJT A;  2QCU A;  2X4A A;  2DWZ B;  1IN6 A;  1IBM M;  1L2C A;  4NRW A;  4GRI A;  1HNZ M;  1D0L A;  4DV4 M;  3UK6 A;  3L25 A;  4DR2 M;  4YY3 M;  2QSF X;  2JNH A;  1C1K A;  1QDR A;  1N75 A;  7CAT A;  1K82 A;  1SXJ C;  3FUV A;  3FYD A;  3L29 A;  1VEJ A;  1JR3 D;  1R4G A;  4IBJ A;  5EP1 A;  1OFI A;  4OU7 A;  2JY8 A;  5IWA M;  2CE7 A;  1GAB A;  3VKH A;  1GL6 A;  2BJW A;  2MGW A;  4DR5 M;  1A5T A;  4X66 M;  4IBG A;  2CV0 A;  5FTN A;  1KYI A;  2KNZ A;  4IBK A;  4X62 M;  1R6B X;  2VII A;  2J5Y A;  4GIT A;  3VDP A;  2KHH A;  4LF9 M;  3VKG A;  2QHO B;  3U6Q A;  4FWD A;  4S12 A;  2JY7 A;  5IRE B;  1HNW M;  2CHG A;  3U60 A;  1KSF X;  1XXH B;  3GLG A;  4Y28 F;  1VEK A;  1NHW C;  2L7I A;  2C9O A;  2DNA A;  2EJS A;  3GLG E;  2JA2 A;  2JY6 B;  4I81 A;  2ZAO A;  1AUA A;  1DGH B;  2JWS A;  4IBI A;  4MB7 A;  4DR1 M;  3R9X B;  4LGM A;  1TH4 A;  3M7G A;  1G71 A;  4GIP A;  1Z5C A;  5BR8 M;  1NV8 A;  4LG2 A;  2XGN A;  3W67 A;  3IG8 A;  4OVZ B;  3TPZ A;  4BLC A;  5KPZ A;  2LVA A;  3VK8 A;  1IFY A;  1TR8 A;  1N32 M;  5ITQ A;  4GKK M;  1E94 E;  1VQ1 A;  3U5Z A;  4Z8X A;  3T15 A;  2LTU A;  3VDU A;  1BVS A;  1CUK A;  1DGG A;  1T3T A;  3SC3 A;  4DV6 M;  3JAM S;  1MJG M;  3PVS A;  2DAK A;  3HJ8 A;  4DUZ M;  1JB0 F;  1SXJ D;  3BOS A;  1DGF A;  1IY1 A;  3GRV A;  3B89 A;  1GVN A;  3MK6 A;  2Q2E B;  1OAI A;  4QNR A;  5F3W A;  3RFW A;  2L2D A;  2J7N A;  1GKI A;  2VF8 A;  5KPR A;  2XSZ A;  4BB9 A;  1XNQ M;  4L78 A;  4DV3 M;  1NHG C;  2LWX A;  4LJ6 A;  4QOS A;  2XLJ A;  1IQP A;  3J27 B;  2EO2 A;  3AV0 A;  1ZMU A;  3KVW A;  4AKI A;  2R4J A;  3K8Z A;  2CUZ A;  5H37 D;  1AIP C;  1TDZ A;  1QAO A;  4Z6Y A;  3KDS E;  3U61 B;  2F5O A;  3CGW A;  4NSR A;  3HHZ A;  2HWJ A;  3FTD A;  4LJ9 A;  3JR4 A;  2XF3 A;  2UXC M;  4B3T M;  1MX0 A;  1Q39 A;  4LF7 M;  2JY5 A;  4LF6 M;  1DV0 A;  1HT1 E;  1R2Y A;  5E6J A;  2UU9 M;  3KOY E;  3B7N A;  5EXX A;  1J7K A;  1OFH A;  4GKJ M;  2D7G A;  2ZTC A;  3FRI A;  1N78 A;  4JI2 M;  1V92 A;  3AOG A;  4KLN A;  3ZH9 B;  2KNV A;  4FCT A;  4JI6 M;  3FUU A;  4JI5 M;  1PJQ A;  4LJ8 A;  3SHG B;  2XFT A;  4IBD A;  2CRU A;  4LCB A;  3UZU A;  3GRY A;  2K0B X;  4FCV A;  3GPX A;  1TGU A;  3U6S A;  5LMN M;  1LV7 A;  1NJG A;  4AI6 A;  4OX9 M;  2FNA A;  2B3T A;  3EIH A;  1G3I A;  2RKO A;  2CHV A;  1NY5 A;  3C9P A;  4F1I A;  1OIP A;  3VFD A;  4D81 A;  4Q7J A;  1OQY A;  4REZ A;  4DV0 M;  3RGP A;  5DYG A;  4JI8 M;  3KS8 A;  1IM2 A;  4LJ4 A;  2LXE A;  4L4U A;  3ZQJ A;  2L09 A;  2LVO C;  3PXG A;  2R6F A;  1DO0 A;  4LZJ A;  1L8Q A;  1TF0 B;  1G59 A;  2Z7J A;  3U6E A;  2MR9 A;  4GEW A;  1W5T A;  2K47 A;  3U6M A;  2C98 A;  1ZQ9 A;  3W68 A;  3T1Y M;  4AW4 A;  3J2P B;  2DAG A;  3KOZ E;  4JXJ A;  1EE8 A;  4LF5 M;  1NO1 A;  5FTM A;  4DUY M;  3UJN A;  1N34 M;  2BNK A;  3HHW A;  1J09 A;  1HR0 M;  2F5N A;  3SAR A;  4AG6 A;  3LW5 F;  1PJT A;  4L15 A;  1K3W A;  3FKE A;  3FTE A;  1UFZ A;  3GLI B;  3SAS A;  3E4R A;  1NV9 A;  1P3Q Q;  4B3R M;  2Y0Q A;  3B7Q A;  3THG A;  1UM8 A;  2KDL A;  1W5S A;  3U6C A;  2HL7 A;  2LNH C;  1YLA A;  4B7G A;  3WHL A;  2UUB M;  1QUS A;  2I7P A;  2I7N A;  1SXJ E;  3FYC A;  3HWS A;  3PFI A;  2DAI A;  3SHF A;  2VDB B;  4LFC M;  2QZ4 A;  3TL4 X;  2M5Z A;  1GLN A;  3GPY A;  1R2Z A;  5EP3 A;  3GO8 A;  4AKG A;  2DAE A;  4L16 A;  2F5Q A;  1DO2 A;  1VDD A;  3C3E A;  3I04 M;  4IJE A;  5DYI A;  2APL A;  1I4W A;  2UXD M;  5IT9 S;  4FVM A;  2FFJ A;  4XK8 F;  4DBG B;  2KW0 A;  3QWL A;  2DWL A;  4MGH A;  3SYL A;  3UGJ A;  3GRU A;  4NSO B;  3A42 A;  3GLF B;  3ILK A;  2D7E A;  2QPA A;  1N77 A;  1XWI A;  5ITT A;  3HY5 A;  5DFL A;  1ZV1 A;  3MJ5 A;  3L2A A;  1TTE A;  4DV2 M;  5KQD A;  2G8L A;  3OTO M;  3U61 A;  5FTL A;  3I51 A;  1EIJ A;  2UXB M;  3FUX A;  1OJL A;  5ITU A;  3GQ3 A;  3VK7 A;  4QNM A;  1NJF A;  1L1Z A;  4KT0 F;  1T6O A;  2RGO A;  3LVV A;  4X64 M;  2O5R A;  2H1R A;  1XMQ M;  4LJ5 A;  2KRU A;  4CIZ A;  3E46 A;  2GNO A;  3GLH E;  1OKS A;  1G8P A;  4WW0 A;  4EIW A;  2HKJ A;  3BXW A;  2JUJ A;  1E32 A;  3CTW B;  1WHC A;  4ZPX A;  3KSX A;  2F5P A;  4FWG A;  2Y21 A;  4I4L A;  3SAT A;  3K2L A;  4XBO A;  2ZAN A;  2HCB A;  3CF0 A;  1V33 A;  3KP1 E;  2UUA M;  2DHY A;  2E5L M;  3UMM A;  2AHM A;  1FJG M;  4JV5 M;  1VDL A;  2R44 A;  4M9S A;  1QAN A;  4G3O A;  2ZAM A;  3RGS A;  4ITQ A;  4JYA M;  1LTM A;  2Z4S A;  4JN6 A;  3FD9 A;  2N35 A;  2LHG A;  3TE6 A;  1HNX M;  2Y20 A;  1PGY A;  3KW6 A;  4GH9 A;  2V6Z M;  2G3Q A;  1QVR A;  2H5X A;  2QQ8 A;  5L8R F;  3GLF E;  1J5E M;  2R18 A;  3DFZ A;  3EIE A;  1IBL M;  4MGY E;  5ITX A;  4I5S A;  3J7B A;  4PDG A;  3K9O A;  2C96 A;  1E9R A;  4JI0 M;  2JP7 A;  2V1C A;  3U6P A;  4RF1 A;  4AKH A;  2QBY A;  3FTF A;  4WUR A;  1N36 M;  2XSZ D;  4K0K M;  2KZU A;  2WSF F;  2QEN A;  2KRK A;  2J7O A;  2DZL A;  3T6P A;  1XXH A;  3BBZ A;  5EP4 A;  2KNA A;  5C18 A;  2MRO B;  4LF8 M;  5EQT A;  1R5L A;  1IBK M;  4GC9 A;  4FD2 A;  3KFU G;  1L1T A;  4D80 A;  1OTR A;  3SAU A;  2JXN A;  3IG5 A;  5EXT A;  2C5R A;  4G4Q A;  4LF4 M;  1IXS A;  1PM5 A;  4RNA A;  4XGI A;  2VQF M;  3CF2 A;  3L26 A;  2ERC A;  2VQE M;  4JI4 M;  2DXI A;  2C99 A;  1K3X A;  1DGB A;  3A98 B;  3ZC7 B;  4LGY A;  3NBI A;  1E9S A;  1SG9 A;  2Z8Y M;  3M6A A;  3W0L B;  4GMQ A;  4AG5 A;  1H6U A;  1PRB A;  3C3D A;  4NL4 H;  2DZO B;  4P16 A;  3HJQ A;  1D0K A;  2M60 A;  2OOB A;  3Q8X A;  1GJS A;  1SXJ B;  1MU5 A;  2K9D A;  2JZ0 A;  4PT5 A;  3QYB A;  1Q3B A;  3SAW A;  1S3S A;  1TH2 A;  4A3V B;  3KOX E;  2LHC A;  2BWB A;  1JQJ C;  3SMS A; 
#chains in the Genus database with same CATH homology
 1NV8 A;  4DBG B;  1MN3 A;  2LVN C;  2LVA A;  1HJP A;  2L4E A;  1IFY A;  1TR8 A;  1VEG A;  1E94 E;  4UN2 B;  1VQ1 A;  1ZV1 A;  1WGN A;  5DFL A;  1TTE A;  2LTU A;  1BVS A;  1CUK A;  3E21 A;  1VG5 A;  2WZJ A;  2DAK A;  1WGL A;  5JI2 E;  1Y8G A;  3B89 A;  1WR1 B;  1JR3 E;  1OAI A;  1T6O A;  2L2D A;  1ZMV A;  2DKL A;  3IEC A;  3FE3 A;  3E46 A;  2HAK A;  2OOA A;  3GLH E;  2L4F A;  1OKS A;  2JZ1 A;  2MJ5 B;  1Q02 A;  1ZMU A;  2JUJ A;  1C7Y A;  1WHC A;  1AIP C;  2CWB A;  3K9P A;  2HWJ A;  2EKF A;  1DV0 A;  2JY5 A;  1HT1 E;  2DHY A;  3GLI E;  1ZMW A;  2OO9 A;  2LBC A;  3FRH A;  2ZTC A;  1VDL A;  1WJ7 A;  3FRI A;  1G4A E;  3MMP A;  4G3O A;  1V92 A;  2DEN A;  2R0I A;  1G41 A;  3LCV B;  2KNV A;  1HQY E;  1EFU B;  1PGY A;  1XXH E;  2G3Q A;  2DAM A;  1WIV A;  2K0B X;  2H5X A;  3GLF E;  1F4I A;  2B3T A;  1G3I A;  4F1I A;  2CP8 A;  3K9O A;  4Q7J A;  1OQY A;  2QNJ A;  2JP7 A;  2BWE A;  1IM2 A;  2LVO C;  2O25 A;  2ZTD A;  1DO0 A;  2DZL A;  3T6P A;  1QZE A;  1T43 A;  3BBZ A;  4R71 A;  2MR9 A;  4GEW A;  2KNA A;  2QSF X;  2MRO B;  2JNH A;  3IHP A;  2DAG A;  4F2L A;  1GO5 A;  1OTR A;  2EKK A;  1VEJ A;  1R4G A;  4HEO A;  2JY8 A;  2RRU A;  1UFZ A;  1IXS A;  2MGW A;  1NV9 A;  1A5T A;  1P3Q Q;  4WP2 A;  2LVP C;  1KYI A;  2LVQ D;  2KNZ A;  1YLA A;  2DI0 A;  1HT2 E;  1SG9 A;  2KHH A;  2DAI A;  1XB2 B;  2QHO B;  2JY7 A;  2OOB A;  2K9D A;  2JZ0 A;  2DAE A;  1VEK A;  3F92 A;  2EJS A;  1DO2 A;  2DNA A;  3H4J A;  3GLG E;  2JY6 B;  3LCU A;  2BWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...