1OTUC

Structure of the escherichia coli clc chloride channel e148q mutant and fab complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
b'VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated ClC-type chloride channel eriC
publication title Gating the Selectivity Filter in ClC Chloride Channels
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 37
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuC01
5BS0E 1QSFD 2HT3D 4GXUN 1CE1H 1FGNL 1PEWA 1RZJH 2YEZB 5DJAA 5MEPB 1S9VB 4A6YB 3TNMA 3FCTB 4LVEA 2AXGA 3PWJA 1I1FB 4GAGL 5A43C 2CDGA 3WKML 3QIUC 3ARSA 1BD2B 2VZ3A 4P57B 4OLYL 3JTTA 3CFCL 5I17B 1A3LL 2QTEA 4WUUA 2OS7A 3IDYB 1ZV5A 1OD7A 1ZSDA 1IARB 1CLOH 1QPPA 5EO1A 3MXWH 3B5GA 2QSCL 3HTLX 5L8JB 1UWXK 1FSKB 3FO0L 2LU4A 4OGYL 4G6AC 4U4BA 4OIBA 1OAUH 5FO7B 4IOSD 1A1NB 4GBXD 1Y6MR 1JTTA 3AM8C 4S2SB 1OP3H 3T0WA 5TH2B 2CLRA 5DEFA 3ZKNC 4Z7WE 3UZVB 3GSWA 3SJVB 1N7MH 3RWCB 1HXYA 2ZG1A 3D2UB 1X7QA 5CGMA 2AGJH 5HHOE 3S35H 3BDXA 5C70A 5D7LB 1OAYL 5B8CA 1TJHH 4M4PA 4CN6A 4ZMAT 4JPKL 4ZUSA 4LHQB 3KXFE 4S1DC 2GITA 2R2HB 3U36A 3BH8A 3UTOA 3SN6N 4Z7VB 4OZIB 1MOEA 2X4UB 2NY4B 2Y1VA 4R4NC 5IUSA 1A6AB 3D39D 4MAYC 1OTUC 1YPZF 2WBJD 1QSFB 4IIQC 4UTBH 2H1PH 4Y5YB 4W6YB 1NPUA 1G9MH 1MIEH 1PQZB 3LKRB 4NKIL 5F71A 5CEYB 3VD7A 3O41B 1FG9C 2BRQA 2R0WH 5IQ7L 4P5TD 5IOPB 1Y6KR 2RFXB 3JV5A 4PJGF 2NY0C 4X98A 5DVKA 3HC4L 3MRFA 4RIRA 1B4RA 4XP4L 1IGJB 4HHAB 4GRMA 1RZGA 5E2TL 4KJYA 4H26A 1NCBL 2CH8A 4R90H 4L8BB 3VFMB 4JRXD 5A3ID 2JELL 1YMMA 5GS0L 4W4OC 1KIRB 2WK2A 3V0VA 3MRPB 1SEBA 4EN3D 4LRIA 5DJ0B 3MJ8B 3JVGA 1W0YT 1ZA6B 1S7TB 5CZVL 3LPFA 3L3JB 1KIQA 5HI3D 3MUGB 5L7XH 3T0DA 4KKLC 3O45B 3L3DB 3DBXB 3ZHLA 3U9PH 5CD3A 3QCTH 4HS6A 4Q2ZB 2AI0H 3QUMB 1C16A 4FQJH 1MFEL 4MJID 5GS0C 3O8XB 2J88L 2ZSWB 1GHFH 4ZUWA 1TTUA 4HLZH 2VIRA 4KVCH 1EX0A 3MCKB 5ECJE 4LSQH 5F44A 4WFFE 1T1WA 1S9XB 4F58L 4X6FB 1JV5B 3OAYH 4HUWB 3NCCB 1WISA 2YRPA 5ID1A 3WD5L 2NY5L 3QA3B 3G5ZB 2HTLC 5K93A 4JPWH 2BNRE 4O2CA 4Y7MA 3HZVA 1N0XH 3ZKQD 5C6TH 5JW5B 5D1QD 3PQYD 3MOAL 5C07A 1XF3B 2WBJB 3RIAF 2GSGA 2P8PB 4C4KT 4ZUTB 5JW4R 4WCYL 3UDWC 5JDJA 4NT6B 2R2EB 3RWIA 1RK1A 4RZCA 4P5TB 1OARH 3WE6B 2NZ9D 4DN3L 2DQFA 3HHRB 4Y5XC 5FK9A 5C9KA 2NY5C 4MD4A 3JWNC 5MHSD 2OP4H 1YYLL 1MWAL 1JZ6A 1FV1B 1P7QD 1YMHA 1X9QA 3WFEH 4ZNEE 5HDQL 2H2SC 4QOKA 3SGEI 3RJDA 1EUTA 3Q1SL 4GAYB 4R2GC 3IDGB 4YNYA 3GIZH 3GB7B 1EEYB 4XRCA 5HVWA 4V2CB 2KDGA 5J12C 5KSUA 4X5XB 2P45B 4EN3B 4X7TA 3RX5A 5D1ZB 4NKMB 4GAJH 4M6NL 2R9HD 3TIEB 1RSFA 5CJOL 5C2BH 3ZKMD 2VABA 1ND0B 3B6SA 4P4KD 5E5MB 5GGUA 3FB5B 2C26A 1T0PB 1WWCA 2EE3A 1N8ZA 2FX7L 4OCSH 2VXTL 1LEIB 1K2DB 5E08L 1H3PL 3GUTB 2C4FU 4R3SB 5IESL 3IJSB 2Y7QA 2WIMA 5I30L 3ARVA 4LSSL 2EE2A 3G5YB 2PUQT 4JM2A 2F58L 4JVUA 4MJ4A 4HWBH 2ED8A 2EE6A 1MLCB 2D0HA 3KYNA 4BKLB 3G04A 5J4MA 1U8IA 2AJVH 1CFTA 5TE7L 4YDKH 4ETYA 3GMMA 4JY5H 2N1KA 5D1QB 2X4PA 3W2DL 1DEDA 3PP4L 1EFQA 4X7FC 4JO3L 1XGPB 2F54E 3PGCA 4PJIE 5DFWH 4R2GB 3P73B 3L3KB 3SDDA 3N0PB 4NHCL 4XPFH 1HNFA 1T6VN 1NGQH 4F9LA 3C8KA 3KDMB 3TBWA 4HCRL 1ETZA 3AREA 1NGYA 1GGCH 1EMTH 3BP6A 1KEGH 2ZUTA 4XT1C 1R3LB 1R5IB 1P7QB 5GGVL 3QDME 4F15C 1GOHA 2RIKA 1MAKA 4YXKH 2HAZA 5AG8A 5CEXB 1ADQA 1S78D 2APTA 2X4RB 5EUOF 4FXKB 1HHHB 5C86A 1F6AA 4NN6B 1JJUA 4LCUB 4KROD 4NDMB 4HQQH 1FFRA 1FYHB 4JCLA 2BVEA 5GSRB 4HWZB 2N4IA 5HJ3B 1B0GA 3GDBA 4ODSL 4WNQA 5SWSD 2DDQH 5D7SL 5L6YH 1ZE3C 4P4KB 5D2NE 1INQB 5JQ6H 4GRLB 4M4RA 2HRPH 5DEGA 5L2KA 3F8UB 2YUWA 3E6HB 3GSRB 4YLQT 2WWKT 3QDJE 1GRWA 4X6DE 4KVNH 4QXGL 3ARRA 5DVLA 2H2PC 5KSAA 5LWYL 4PRNA 4RISL 2GCYA 4RWYH 3UO1H 3SDYH 4HV8B 4PJAA 3ULUE 2DTML 4KTDL 1INEL 4BFGA 4KJQC 4WO4D 4WGVB 5I8CA 1M6OB 5DK2A 3O4OB 1YEDB 5JPMA 3QCUH 4QRPE 1NCUA 3OHXA 4L8SA 3RPIA 4PYGA 3LPWA 4APQD 1EPFA 1FVCB 3DMMC 3RVWD 12E8L 3VXUA 5HGBA 4BH7A 4YXHH 4ZTOL 2E8YA 2MSPA 3NFNB 3UJIH 4F80A 2WUBL 5E6IA 3CFDB 2C1OA 4YPGB 5DD3H 3ZO0A 1MF2H 2GTZB 2WZPD 1FNHA 4GQ9L 1KT2A 1ZVYA 1TZHB 3X17A 5B3JF 2NY1B 2ITDA 1RUPH 3O6FD 1O0VA 3UBXG 3GRWL 2DQDH 5D9SB 4L4JA 4XPAL 4F2MB 1QTYT 2DLFH 3HMXL 3G5VB 1SM3H 4L4TA 3S9DB 1NMAL 4HDIB 3SPVB 5H35A 4FQPA 4KROB 2EIDA 1H3XA 1LK3H 4KI5E 2HWZL 2Z92B 3P11H 3WNMA 1DN0A 1D5IL 1J1OH 4NQSA 5SWSB 1BQLH 3WFHA 4LVHB 4I18B 5LG1A 4NC0B 3HE7D 1T1XB 4AENA 4OJFL 1F2QA 3TJHD 4NQXB 1G6RB 1BVKA 3D39A 4O02L 1IQDB 5K9OA 1BPVA 2Z8VC 4JJ5A 5CLWA 3NCYP 3WXVL 1MCJA 4PRHD 4IDJL 1PEZA 3DXAD 2BVTA 4MX7B 3P0VL 2G5BB 4M61A 3MYJA 3TYGH 3VFRA 1OSPL 2XRAH 1P4BH 3PG2A 1UB6A 1S3KL 4FQ1H 3DIFB 5F97E 3HCVA 1NCAH 1RUKL 4OCRH 3OAUH 3ARBC 4KK5D 2VWEE 1QRNA 6FABL 3LDBC 1MJ7H 4APQB 4MNQB 2BSTA 3F12A 2XFXB 2IWGA 3P9LA 2RR3A 2CMRL 4K9EH 3FQXB 1SYSB 1IAMA 3CUPA 3VXMA 1LNUA 4OM0H 5TGBA 5HXMA 1BQUA 3DJ9A 2CIIB 1NFDB 3MRJA 5FHAH 3D0LB 3CPLA 3GBNH 1EA9C 2VH5H 2EYSB 3O6FB 2XXCB 3LEYL 4M9OA 2DQCH 1IEAB 1IEBB 3AY4A 4MB3A 4LLVB 3IU4L 3RWDA 5GPRA 1NBVL 3AS2A 5B22A 4WUKH 1F5WA 4MJIA 3ES6A 4P46C 1T5WA 4C83A 2O93L 1EJ6A 4POZC 1MQKL 1AQDB 4XC1L 4YFDB 3SDXA 3OKOA 5CSGA 5H2BB 2OTUB 3SHSA 1TZGL 2EKSB 1E0OB 4JFOB 1P7HL 1QBLH 3EDFA 3ZDYF 3IXAB 3N1GC 3T65A 4LCWE 5DD0H 2VSCA 2NY6C 3FB7A 3HE7B 4NRZB 3TO4C 3PQYA 3BRFA 4C56B 3O3EA 3K80A 1F4HA 1W8OA 2P44B 3VWKD 5ESAA 5EZOL 2FEEI 1KENL 1KLGB 3D1MC 1VPOH 3CXDH 5BVJB 2V2WB 4I77H 3IAQA 4JHWH 3TV3H 1NMCB 4X6CB 5TDNB 5EIVA 1VSCA 2ZKHL 1B90A 3MRNA 1JNNL 4LP4A 1UWGL 1G1CA 1AIFA 4XP9H 5E56A 1FFOB 2ICES 1D5MB 2GJZB 4C57C 1W0VB 5FM4A 4N68A 3MQIA 5HYQA 5M94B 1KCVH 1I7RB 2WQ8A 5JXAL 3SE9L 5E99H 3L6FB 2SEBA 2YHGA 2V5TA 3DARA 4LF3B 4HEME 1IFHL 1YEGL 3IDJA 3LEXB 43CAB 1A14L 1C8PA 3DHJA 2XKNA 1AGEA 5TDPB 4ZUVB 5CWSB 4H88L 5DD5H 3U30C 2F53E 1MCEA 5LGHL 3RDTA 1OB1B 2YOCA 3MJ9A 2Z9TA 4QKXB 3MGAA 2AJYL 2DQTH 1NMBH 3ZKXC 2ZNWA 1DBKH 3N85H 4P2RD 5I19H 3RIFK 1PKOA 3D18A 3RZWA 1NC2B 3QDAA 4MA1B 5FB8B 4Z7WF 4Q9QH 5F7EH 5HHME 3U48A 5J13B 3ZYJA 1JHKH 1I8KA 4BSWB 3FB6A 4YX2H 2ZUVA 2I5YL 3VWKB 5AAWA 1IQWH 1DBJL 4P2OD 5IHLB 3EO9H 4U1JA 2Z4QB 3GSNL 1KC5L 1FVDA 1DEEB 2DL9A 5GISL 5T3XE 2V7HA 4XXCA 2FLRT 2FGWL 3EO1A 1B3JA 3T0ED 1K6QL 1WBXA 2P24A 3LN4B 4YWGL 3ILPA 3BO8B 4UT9H 3MLXH 4P4RB 4LMQI 2GK0B 1N0LA 3HS0B 1J05B 4HIHB 1T22A 2VITA 3K2UL 1ONQA 1VFAB 2XKUA 1S9YA 4FOMA 4PRDB 5A2KH 1W72H 4QGYA 5BXFB 5J3HC 4G43A 1A47A 1NL0H 1U3HD 5EOTB 3ELAT 5FYLL 15C8H 5CJQH 2GFBB 1SJEB 3UPCA 1I7TB 1A4KB 3VMNA 1A9BB 1RUQL 4G6KH 4R7DB 3PABA 3PV6A 4XBGB 1ZTXH 3U7AA 4OZHB 1WEJL 5DMJB 3ZDXE 2DL2A 2JJVA 4KC3B 1CLZL 2NTSP 3T1WA 3P77B 2WLZA 5DS8A 5JHDE 1RZ7L 3OKEB 4QTIL 1CU4H 2X9XA 3HC0A 4TNVK 2HVJA 4WO4A 5C0AE 4XVSH 5HD8D 3O4LB 2R4RL 1FH5H 1F13A 3IU3A 3MV7A 2VDRH 4OBRA 4P2RB 3P40A 2KQNA 4UAOB 5EFIA 5IVZA 1TVBB 4YHML 1QFWI 4S1RH 1U8QB 2AJSL 4MD0B 3QI9A 2QLVB 3GSXA 3BGFC 4NKQB 4PGBB 2DJUA 3FO1B 3BP4B 1TTGA 1WT5C 2AJUL 3JV4A 3RTQB 3F7YB 4N0UB 1ZGLM 1ZXQA 4ODHL 4X9BA 4Y2DC 3AC0A 3VGAC 3WV0A 4L4VE 5H94B 1BF2A 3KNBA 1W8NA 3QXAB 5C0BA 3BKYL 4L5FL 3U9UB 5ACLA 3HZMA 4OZFA 2BFVH 2YD4A 1QQDA 2VRAA 1UXWA 4RAUB 5DSCB 3VFVB 1BIIB 1NLBL 3QULA 3HA0A 2C3HA 2UUDK 2X1QA 1U3HB 2D9CA 1NDMA 4YFLF 5D2LB 1Q72L 3QWOA 4KAQL 1CDJA 3QUZB 3B5TA 3QO0A 3WIHA 1HHJA 3OGOE 2NY2C 4YK4B 1MCBA 2CPCA 2W65A 1M4KA 1GZPA 5E4EC 4DVBB 2YD9A 1UCBL 1KN2L 1F90L 5IMMA 3E8UL 1XCTA 4BM7A 1DE4A 4Y4HA 1L7TL 4PY7A 4OKVA 5CJ8A 5GJSH 4GKZB 1N59B 3OKLB 5IGXH 3HPLB 5ESVA 4PRHA 5I74B 3BX7C 3DXAA 3HPJA 2G9HA 3O2VL 5ID0A 1TPXC 4O5LL 1AD0B 4ZUUB 1MFBH 3VW3L 1HYSC 2JB6B 3M1BA 1JWUA 5DWUL 2MTPA 3O3AB 3H9YA 3MV8B 4P9MH 2BVYA 2NW3A 3NCBB 4ESKA 1FFNB 3HI5L 1G84A 2HLFC 2VE6A 4GW4B 5D93B 4UDTA 2E6QA 5FCUL 1I9IH 5EU6E 3O0RL 4U0RB 1OP5H 4AT6A 4JKLA 1ZLWK 5D2NC 3L95B 4CDHA 4JREC 5IMOA 1HI6A 5FUOL 1D5XB 1FYTA 2IH1A 4M3JA 1XH3B 4LNRA 3WIHH 2PR4L 5AD0A 1KJMA 4I2XA 4BQBA 1NAML 3N9GL 5I1HL 5I1CL 3WS3B 2ZOKA 4WI6A 5HGGS 4TVPH 1KBGL 3D87B 5F9OH 3JV6A 1N64H 5JLZB 3RP1A 4LIQE 1R24A 1QSED 1JGLH 3S34H 5T5NG 3QJHA 2YXMA 3QFDA 3FOMB 3DOSA 5KANG 4PJIF 1BVLA 3S96A 3NFSL 5BW7A 2AW2A 3MRGA 1OW0C 4I0PC 2W0FA 3H42H 1U8LA 2BVPA 5J57B 4P23A 2DQIL 3VFSB 2JCCE 1GIGH 3BXNB 4DZ8B 3LS4L 1RZIA 3SGDH 1U95B 4G9FA 2Z91A 2R56H 4XAWH 3IJHA 3V4UH 2YPLD 3TBVB 3K1DA 5HY9B 3DTXB 4PB0L 2D9QB 2OL3H 5D6CB 4TQEL 3GK8H 3G6DL 4JG0L 4M8QB 1UM6L 4WW2F 2YUZA 3EFDL 1LO3L 4R96B 3MRDA 5DR5H 3THMH 1NKOA 1MSPA 3BKCL 4JDTH 2V17L 5JNYA 3MLSH 2VDMH 2X44D 3IJYB 4YHLH 4Y19D 4AH2B 4OB5L 1D5BB 5DD6B 4Z0BH 2AAVA 4U6HB 1CXKA 1KCSH 1QACA 1UQSB 4LAQL 3T09A 5SX5H 4X6DF 2FJFA 3L5XH 4FXGA 3FQTA 4NQEE 4OCYL 3HNTL 3DO3A 1HDMB 3RGVC 1QLFB 3R1GH 1DUYA 5C0DB 3MLPA 2FZ3A 2GAZA 5IT2H 4N0CC 1S9KC 4X4ZA 4J23A 3ULUF 4CAGA 4NN7B 5C2UB 3Q5OA 4FFWC 4JFQA 2J6EA 3BDYL 3FQNB 1T3FA 4OLXH 5FIEA 4J4PD 5K9JH 5IIEA 2F5BL 2NXYC 1QSEB 3WFCL 4U1SB 4BSVB 3CU7A 1DQMH 3CMOL 1NCCH 1EJOL 2DAVA 1C5BH 3VFWB 3RAJL 5CP3A 1MVFA 1SY6L 4V2BA 4XBPA 1FLRH 2CKBH 5JMOC 2VLRE 1R3KA 3M07A 3RUGE 4BFEA 3K8MA 5FGBA 2CO6B 4HG4K 3P0YH 5EU7E 3SDAD 1IGFH 5F7DA 1CLYH 4UNUA 5DTFB 2YPLB 2K1MA 3LCYA 4F3FA 5JQHC 5F1NB 4R9HA 5EC1A 4GMSL 4Z6AT 3I6KB 2EC8A 1HILB 5C9JA 5DMIL 5TF1L 4PGJA 1CTNA 4CN1A 1K8IA 3SDCA 2CD0A 1ZK9A 1D6EB 1UENA 4KI5F 1A7QL 3IRPX 4XNZB 3V4PL 5I18H 2PKDA 3VXOA 3CCHB 2A83B 3RHWK 1KNOB 3BPLC 3DYMA 2X42A 3OR7B 4PP1D 1M05B 2J6EH 5F89B 4BK5A 5ANME 4Y19B 2P1YA 4OIAA 1XZ0A 3U82B 1I1RA 3GNMH 4LEXH 3WJJC 4GSDH 1G9NH 2JIXD 3T2OA 5EBLA 2D03L 4YHIB 5I1DA 2VC2H 1BBDL 1XGRA 2NXYB 4K94H 5IR1B 5GSVB 2FIKB 4XP1H 3BIBX 5BJTB 5DQ9A 3ULVD 3R8QA 2JKXA 4LQFL 2H3NB 4ZD3L 1TCRA 4ALAH 3B83A 5BZDB 4W68A 4FXLA 4UIMB 5GJTL 4N9OB 4TULL 3BP7B 4NKOA 5BZWB 2GI7A 1T2JA 4PRIA 2R0KL 4LSRH 2FJHA 5J9PB 3RNQA 4XC3H 3BZEB 5DJ6A 1M7DA 5IB5B 1KACB 1U36A 2WUCH 4HUXB 5DVNA 5EU3A 1VFBB 1CFNB 4K7FA 3BIKB 3UAJC 4K8RD 4WHYG 3X12B 5ICYB 1AXTH 1U8NB 1HSBA 2NX5B 3Q3GA 4WDIA 2VLME 3IFLL 4XAKE 3VDAA 4LHUB 4HPYH 2AEIT 3KPMA 1HOCB 3CH8A 1YEHL 4ETQB 3UCRA 1QO3B 3W11C 4I8DA 3LIZL 2DD8H 4G9DA 4OLUL 5EBWA 2P5ED 1U8HA 2VO5A 2PF6A 4S1SH 4L8DB 3INUL 5B39B 4D9RD 3T8XA 4JRYA 3P0GB 3B9DA 1UH2A 4NYLA 3GJEB 1M71A 1J9CT 4JDVA 1UVQA 4YHOL 5FA3A 3LQAH 2A73A 35C8H 1JK8A 1D9KA 5I73B 1FL3B 2VXUL 1FIGH 5T3XL 2D7PA 1KFAL 5JMRA 5C3TA 5CMAB 4IOIB 4KGJA 4JFPA 1IKFH 1KTRL 5T3ZL 1NEZB 4NQVB 4I3SL 4U6TA 5KJRH 1ERNA 3BQUD 2IH3B 1NFKA 4QRSB 3ZTJG 3PDDA 1AGCB 3QUKA 4PJEE 4JPIB 2HFTA 5L9DH 1RQ5A 2EXYD 3FRUB 3C09C 4FG6D 5AZ2L 1JRHH 4RFOH 1Q8MA 1JPFA 4PJFE 1OWRM 2VSDA 3F58L 4MNGA 3DVNA 3E3QE 3TF7C 5C71A 1BQHA 4LKCA 3UX9B 5HHQB 3CFEB 1VFUA 1LEKA 3BAEL 4HS8H 2OR9H 3QXDA 1WC7B 5B21A 3ARDD 2ZZUT 1YEJL 4OD3L 1NGWA 2XACC 2UZXB 5DHVH 1FNFA 4TSAH 3VU2A 4JFYA 2HLAB 5C07E 2EDEA 4KQ3L 1A6TB 4DOHB 1ZOXA 2VTFA 5DK0B 3FOLA 1KCLA 4B7IA 1HQ4B 4G6AD 4MJ2A 3FN3A 3RA7H 1QRKA 5CLTA 1AD9B 3CX5K 4JAMA 5FV2A 3RNKB 1UWXH 4UV7L 1UWEH 2MMXA 1JVKA 1FPTH 2BC4A 3TVMD 4HWNA 3QCVL 1A6VH 1AR1D 1CFBA 2P5EB 2VISB 4JKPL 1LO0L 4EUPB 3F6LA 5CILL 3ZKND 3DURA 1TQBC 2HH0L 4NZTH 2E7MA 4NJAL 1ZLSL 5LXGL 2C7UB 1QG3A 2A0LC 2ZUWA 3OSKA 3BHBA 4JM4H 4ZPTB 3D85B 5FYKD 1QFUH 1ZHKB 4HGWB 2DQJH 3MNVB 2IPUK 4CVWA 1NDGA 1VDGA 5ISZA 3H3PL 2AP2A 4IRJC 2AK4B 4OLVH 1FNGB 4S1DD 3AB0C 5ERWB 5F96L 4R4ND 3LPGA 3WLWC 4MAYD 5JHLL 3HUJE 1F4XL 3KYKH 1YDPA 1A7OH 3UPRB 4GUPB 1YPZB 4LHJB 4FNLL 2V5YA 3ARDB 3QIWA 1CBVH 2CRZA 4FS0A 4QHMA 1FLTX 1MHEA 2Z31C 4HUMB 5IWLC 3KLDA 4UBDD 5DJ8B 1QEWA 3OKKB 2RQ8A 2GJ6B 3TBYB 1IM9B 1IT9H 2ICCA 3H3KA 3HI1B 4WU5A 1E6JH 4JFFD 4M6ML 1TQBB 1HXMA 1HHKA 3I9GH 1BM3L 1E4KA 5CSZB 1G7QA 5KN5A 1BMGA 2ADFH 4M5ZH 1V3MA 1QYGL 4N90E 2I9TA 2YPKA 1CT8A 5E8DH 1PKQE 3QEHB 5EO0B 3TVMB 4KZDH 1I7ZA 1TZIA 5CEZL 1GXEA 3EGSB 4KH2A 4YHKL 5F7HA 5I0DA 3MROA 4M5YH 2YSSA 3TYFB 3V79C 4ZOCA 5I8OH 1YC8A 1L0XA 3B5HA 4J4PA 3BPNC 1PG7W 5C08B 2MOVA 4U1KA 2BOCA 2VDLL 2NCMA 2E7HA 5DUBB 4LQ1A 1K5NB 2OQJB 4Z7UA 4G3YL 3QDGA 1Z2KA 2E5EA 5KOVC 3UMTA 3H9SD 4DKEL 1NJ9A 4XNQB 1LO4L 4JZJA 5E95B 5C0IB 5DVOA 1KJ2B 4IOFC 5IP4A 4UILL 3D25B 4NQDD 2AV1A 2VLKD 4ZDHB 5HBBA 5DT1L 3SDAA 3VFTB 4DFHA 1S5IH 4BQ8A 2H32A 2GSIB 2ICEB 4LGSB 2V5SA 4YGVB 4FQCH 4OFKA 2VUOA 3MRKB 4S0SD 4KMTH 3T4YA 2H9GB 4Q6YA 5GRVL 3WNLA 1Q0XH 1ZVSA 4N1EA 1FFQA 1OL0A 1Z5LB 3QO1B 1AGDA 3CFBA 5FHBH 2BNUB 3VXUE 2PW2B 3I2CH 5DEZA 1CL7H 3ARGC 4KRPC 4WFHE 5ACZB 1FG2A 4E5XA 5IB1A 4EDWH 2ORBH 3B8SA 5JW4N 2X89A 5IFHL 1EGJH 1S7RA 2A74A 2VQ1A 5EG6C 1PG7H 4LSVH 4L9LC 5GS3A 2JIXA 4AL8H 1RZJL 5FO8A 4BZ2L 4AEEA 1FFPB 1HIMH 2OSLB 3BEWB 3LHPL 3IYLW 43C9A 3RZCD 2FYYB 1A6PA 2JJTA 2Z8SA 3KWWB 1A6UH 2VXQH 5CIPA 2R23B 3IVKB 4I3GA 1UXSB 3O2WH 2VDQH 2A1WH 4YIQA 5LBSL 1T6WA 4LP5A 1FRGL 2VDNH 4L4TE 2FLBT 1OGAD 2D3VA 2WIIA 1RZJC 1X5XA 1MCPL 4K2UH 2NTFA 5HDBE 2J5LC 3J7HA 1OAUL 3CLEH 3VGEA 1RURL 3FQWA 1CZ8H 4RX4A 3OKMA 3GSUA 5C0EA 5KSBE 3H9SB 1S7VA 1CGTA 4H8WH 1HNGA 3P9WB 4JQIL 2YEZA 3KPOB 4UINL 1WCQA 3FCTA 3ESVF 4MXWH 1OGTB 5GXBB 2OYPA 3FT4B 3O2DH 4DN4H 5IM7A 2XXMB 4M8VA 4CMHB 1NCDL 3MFGB 1TJHL 1PAMA 3TCLB 3HZYB 4WEMB 5ADOH 5JOFA 4NWTL 1QRNE 2VR4A 4U1IB 4MJ6B 1ZLUH 4IS6A 3BKJL 3A6OA 2AJZA 3PWLB 5E8NA 4F7PA 5D7KE 1U8MB 1JPGA 4EOWH 5GGRY 2EC9T 5CIPH 3VXME 4Y2OA 2JCCF 1UG9A 1RHFA 2VKWA 3BH9B 2YD1A 1T66C 3MV9B 4LLUA 4K07A 4KKCD 2OTWA 1YC7A 3TBTA 3OB0K 2DRUA 3BWAA 1G7LB 2H1PL 1RZ8A 1MJUH 3SKOA 5DJ2B 1MIEL 4QXUH 1MLBB 3DSNA 3S36L 2ZPKH 3RZCB 3BQUA 3CH1B 4IDLA 1KLUB 5E2UH 3HRZB 4V1DD 5F6IC 3SJVA 4CJ1A 3VFNA 1XR9B 3MUHL 3NCJH 1D6VH 3U4EB 1A7RH 4K3EL 3MLYH 2J12B 4FMFA 4Z78B 4HAGA 4P0DA 3KPNA 5EB9A 1DDHB 3SDXE 4A6YH 4HUVB 4QYOB 1G9MC 2QADC 3SCMC 1KB9K 4KJQD 3QIUA 3WYRA 3CMGA 2XNAB 1Q9KB 4FZ8L 4OZIA 2PW1B 5IW6B 1RIVL 3X3GH 4EXKA 5HI4D 3EJYD 4NQCB 3U9PL 1XGUB 3V4VH 3U1SH 4K3DL 5DJDB 4U6XA 4P9HL 1QR1B 4WI2A 4DCQA 3LN5A 2EXWC 5EA0H 5I8KH 4MQ7B 3QRGH 5EDXA 4HULB 2FD6H 1DUZB 1YNTA 4OCXL 3CDGB 4EI5D 3EHBC 2W91A 1T83C 2MKLC 1CYGA 4LSQL 3AM8A 1U58B 1DP0A 1DJSA 2QR0B 2R1YB 5I6XC 5JO5B 4LARH 4PIRF 3MGTB 4PG9B 1NC4B 3JWOH 1N5AA 4YHPA 1HH6B 3U4BH 4L8BA 4BH8B 2IADA 2YN5A 4JPWL 1A7PH 5HYSB 3RUGF 3CAFA 3REWB 4XZUB 4MVBC 4W6WB 1CVSC 3FO2B 3H9HB 2ZUQC 3MUY1 3U0TB 3W0WA 1EBAA 5JTWA 5ETUA 1JPST 3TT3H 3SQOH 2BJMH 3VWJC 1A6WL 1ES0B 3MRRA 1EAJA 4UUJA 2BNQD 3EDJA 1NCWH 3WSQL 4ZO8A 4LCIH 1X5JA 3WFEL 4RQQB 2BY1A 4ZPVB 4MAYA 4IIQA 3BZ4A 3VXQA 4YHZH 3P4MB 4JFDD 1FGNH 3SGKC 2EIBA 1J86A 3ZL4L 4U6YB 1O5DT 2DYPA 1B2WL 1HHGB 4GAGH 3D69B 4X5LA 5K9QG 2FJGA 4H0HB 5JW5A 4OLYH 2NZIA 3CFCH 3ARBD 4Q97A 5C2BL 1A3LH 3QNXB 3UTZB 3SKUD 3BEVA 4FQHA 1OF2A 5A2LH 1XF3A 3FONB 3OXSB 1JF1B 4MQXD 1QBML 3ORJA 3TA3C 3M17A 2IAND 3RBGA 4JFFA 4W4OA 4YBHA 5IB2A 1B0RA 3PIQA 3FO0H 4OCSL 2Y23A 1RY7B 5C8JB 4EI5B 5I16A 2M8XA 3S3PA 4OGYH 4ODBD 4QXTB 2UWEE 1FV1A 3E3QC 5BS0D 2XKSA 5I1KH 5CP7A 3OQ3B 5TJWK 1XIWC 4HWBL 4NN5C 1OSZA 1C5CH 3UJTL 4HGKC 3QUMH 4W81A 2ZUUA 2AJVL 4YDKL 3VI4E 1UJTA 4JY5L 2DQUL 4HZLB 4ZYKA 3U0PA 3RWGB 1A1MA 4AM0A 5DJXA 4NKMA 2ZOLB 3TIEA 3L3IB 3PL6C 4NOBA 4QWWD 1OAYH 4I48A 2Q3AA 2BMKB 5A1AA 3PUCA 4XPFL 1NGQL 2HT2C 4HPOL 5LAXA 4XCYA 3UTQA 1OD9A 3MFFB 2BNQB 1EMTL 3RVTC 4PV8A 4OF8A 3L3GA 4NCC2 4PJ9C 4JN2B 4XCEA 1DANT 4HKXB 4NQDA 3TO4D 5EU5B 4ZQKA 5I71B 1UM5L 5IB4B 4QRQB 4POUB 4PREB 1BEYL 3UDWA 4HW6A 2D4DA 3QEUA 1NFIA 2GK2A 1FCGA 5D72L 5CBEB 3MV7E 4PB9L 1CE6B 1F02I 1KB5L 5HHOD 4HQQL 1ZWIA 1WTGT 4Y5XA 3DX9A 1VGKB 4FQIL 4PJEF 4XHJC 2DDQL 2XT1B 1GZQB 1V3KA 3SGEH 5JQ6L 2NR6D 1OLZA 3AROA 4PJFF 2P49B 3TJEH 2IAMD 2UYLA 1DLHA 1G1YA 3NN8B 1IGYB 1NCBH 5HYFA 1JYXA 1GGIH 2YRLA 3KPRE 5GS0H 3JBG7 3MBEC 5A2FA 1QA9B 4RWYL 3UO1L 1AKJB 1TQCB 4Z7OE 2ZJSL 1LO5A 5C0BE 1R5IA 5CZVH 5EUOA 4K7PX 1QSZA 1MWAA 2Y9RT 2A9ML 3KPLB 3VJ6A 1WBYA 4G8GD 4JN1L 5GRXG 1SJVA 4UQ2A 3QCUL 4JHZA 1NBYA 4FQXD 5C0FA 1A6ZA 4RBPK 1HHHA 3CSPA 1OGAA 2F9BT 1MFEH 5IB3A 4YXHL 3N50A 2P8MB 2ERJB 3UJIL 1F3JA 1EFXA 2VZUA 3QXUA 2JJWA 3PWPB 3QG6A 5DI8A 4TVPE 3F65A 1MF2L 3HRPA 4Y5VC 4F58H 3VFGH 2XPGA 1TNMA 3JWDL 3O11B 5SV3A 3WD5H 5JXED 1U6AL 2AKRA 4QHLA 1B9ZA 1B0WA 1MH5B 2DQDL 3G5XB 4JHBA 3QUXC 1K85A 4M1CD 2DWDB 3HE6D 5I1EL 3MOAH 1CDUA 1SM3L 1YEDA 4WCYH 1OQOA 5EOCJ 3ZYIA 3TPUB 1MRFL 2APBA 1LK3L 5HHOB 4MXQC 4Y16C 1P2CB 3F7VB 3EYSL 3P11L 4F7TB 1KB5B 3DVIA 3LB6D 4RGNE 2H26B 1N5YL 4MDIB 4JFHE 5C7XL 4L1HA 1KTDA 4WFFD 1Z3GL 4JY4A 4WEUD 1F4YH 5HDQH 2CLVB 4NKDB 2IAMB 3Q1SH 3CFDA 1UJ3B 4FFZH 5DRXB 2VYRE 4YPGA 1OTSD 2BNRD 1FYTE 4AEIL 5INDB 3HUJF 4KK6C 4U1MA 4N9GB 5E8OA 4KK8D 4MB4A 3ZE1E 4HCRA 3QHTC 4O51B 3D0VA 3GMLB 2Q87A 1W0WB 2BY3A 1F4AA 3Q48A 4M6NH 4V1DA 1P4BL 4RAVA 4OUUB 4FQ1L 4G8GB 1NCAL 4HFWA 1EAPB 3MRBA 2ZUYA 3H0TA 2PYEA 1A4JB 1FNEA 3HNVH 1RJLB 3E2HC 5KSVA 2ARJB 1BX2B 2VXTH 4IJ3C 1CDHA 4OM0L 5F1IB 1AHWC 1TDQA 1H3PH 1TITA 5E08H 3GMQA 4RFNC 4NSKA 5I30H 5CD5D 2PTTA 4ZS6D 1U8JB 3SY0B 3BVNA 2UY7A 4G9FE 2EYTA 3OJDB 2R2CA 2F58H 2BSRB 3CSGA 5FHAL 3GBNL 1RMFL 3CDYA 4PJCB 4YHYB 2ILLA 1GC1L 2Z93A 2ZP0T 3WIFB 1P5VA 5DMGC 2DQCL 2Z8WC 3QUYC 4XH2A 3DMMA 5D1XC 3S8WA 2Y5TB 4I4WB 5EC2B 1R0AL 4Q9RL 4LASL 4WUKL 3PP4H 3UTTA 3HE6B 4JO3H 1DSFH 3VFOA 3IDIA 4Y2DD 3B8YA 3WIIH 4OT1H 3W9DB 3VMPA 1GGTA 1FO0B 2J7LA 4KDWA 5DFVD 4MSWA 3V8OA 3LV3B 1OP9A 3U46B 4OM1L 4PRBA 3G9AB 1AQKL 2CIIA 4LAJH 1U8OB 2BNRB 4PJ5A 5C0RL 1OVZA 2EIZB 1FJ1B 1CFQA 2IQAB 4CNIB 3RWFB 2EE9A 4YFLI 3QB7C 4O58L 1JZ4A 4I77L 4OZGB 2F54D 1YN7B 4JHWL 3U79A 3EDEA 4LLVA 1BFOB 2K7QA 2Q8BH 4MQSB 2ATPA 1QNZL 4ZSOA 3GRWA 1KEML 3L5WB 4UOW1 4WV1C 5D7SH 4ODXA 4DUWA 1C7TA 1A8JH 1IL1B 1G6RH 5INCA 3HMXA 5LWYH 3QDMD 3N1MC 3ULSB 4JFDA 5CJ5A 5E99L 5HHPB 4U6VL 5ICZB 3IXAA 1LMKA 1BECA 1INEH 3MA7B 4MCZA 4Y4KC 1T5XB 1ZANH 5GGRB 4QHNA 2P5WB 3ARBA 1I85C 4C56A 2HLFD 5DD5L 2CKNA 3IKCB 5JZ7D 1LE9A 2IANA 3IF1A 5IJKC 4ZTOH 5HDLA 1NBZB 1SBSH 3VH8A 2WUBH 1TETH 3QDJD 1P5UA 1QFWM 3I50H 4XNMA 2VAAB 5HDBF 2YD5A 1ZLWH 3UTSE 5BS0A 4XMPH 2DQTL 4AIZB 2E9JA 3F62A 5I19L 5KSBF 2A9NL 4PGDB 4LBEA 4ODUB 1PY9A 3ULUD 1D5MA 3DPBA 2A6IB 4OQ1A 3HG1D 3GRWH 4IBLT 1G7HB 1S7XA 4Z7NE 5F7EL 3DRQA 4P46A 4QRPD 1OAKL 1H3UA 3LEXA 1IQWL 3QT2A 3DVGB 8FABA 4NCDA 3EO9L 1NMAH 2APWA 3FQUB 3MGOB 3C5SA 2HWZH 1CG9A 2F54B 1T1YA 2FATL 1WV7T 2R1WA 3IFNL 4UT9L 4Y4KB 3OX8A 3RX8A 2OCFD 5J6GB 4OJFH 3KJ4C 4G7VL 5FAAA 5D70H 5HGAB 1W72L 3GKZA 3QDMB 4X99A 4Z7WA 1NL0L 3ARWA 3B9KC 15C8L 3GBMH 5CJQL 3DGGA 3SKMB 1CF8L 1XAUA 5D96B 1Q9LB 3P0VH 1MCWM 1K4DB 4U7MA 3VFUB 1OSPH 4WW2B 3IETA 4Y4FD 2NLJA 1BJMA 3RI5F 3WHXB 1RUKH 4QEGA 4OV6F 3QH3B 2P8LA 4KI5D 1JGEA 4XGZB 6FABH 1ZTXL 3PWVB 4G6FB 4ZO7A 1EXUA 3KXFA 2CMRH 4ZXBC 3SDXF 3NPSC 4JRYE 4YAQB 1CU4L 4NO2A 4X6DB 2BVQA 5C92A 3FO9A 1XF5A 4MD5A 4MA3B 5IBUB 3S5LA 1V7MH 4XVSL 2VNCA 3HS0A 1IGTA 2VDRL 3DSFH 1RU9H 1FZKA 5DJYB 1QD0A 1ORSA 5FYJE 4CVXA 4S1RL 3S88H 3HG1B 3IU4H 4HK0B 2OJEB 5AYQA 5E1AB 1NBVH 3NCFB 4QRPB 1RUAH 3BPOB 4J3OC 4PJDB 3KS0J 1MQKH 4XC1H 5IF0A 1WWAX 1IGML 5FGCE 5F1SA 4Z5RB 1JNHB 1TZGH 5I66A 3MRMA 2QKIA 4NO3B 4M43L 2HJFA 1TVHB 2Y07H 2JLLA 4EVNA 3QZWB 2D0GA 1MCDA 2NXZC 4TTDC 4N0RA 4ERSH 1WFNA 4K3GA 3WBDA 3C8DA 1KENH 1R5WA 2Q7YA 3G6JF 1ZLVH 1BZQK 1T2XA 4MD0A 4YO0B 1JHTA 1D5ZA 1H9VA 3EO0A 2NY3C 2XTJC 4OGAD 4Y4FB 3JV0A 2OK0L 2R0ZH 3B2VH 1JNLL 2ZKHH 4D0BA 4KJWC 1CGSL 1MREH 1JNNH 3QAZB 4DTGL 1UWGH 5LGJA 4LCWD 3GSNA 3QNZB 1AGBB 3SE9H 1F8TH 4PR5A 3QXAA 2IPKA 1OT2A 2O5ZL 4PPTA 2PCPA 1IFHH 3GSQA 1MFBL 1YEGH 1YEKL 4HKJB 2RBLA 5T5FH 1A14H 3MNWB 2FH8A 4P9ML 3DX8B 4OQTH 3V5DB 5HVFB 3RL1A 1U93B 5LGHH 1I9IL 5FOJA 5E9DE 2PO6C 4PTUA 1CD1B 1AE6H 4FQQB 3PNWA 4XVUD 3TIDB 1UZ8A 4ZAKC 5FA4B 1A3QA 3UAJD 5I2IA 1FAIL 3G6AB 3QPXH 3QIBC 1N6QL 4MHHI 1II4E 2UWEF 3QISA 4PRPA 2AJYH 2A6DA 5SWQA 5D5MB 4Z76B 1AR2A 4WTZG 1IAOB 4GKZA 4MB5A 2OJZH 4RFEB 1N59A 2XTJB 4U1HA 2IPUG 4TVPL 3W11D 4Z95H 3VI4F 3R06B 5F9OL 1N64L 1JTPA 1S5HB 2EDJA 1HSAA 1JGLL 3MRIA 3S34L 3GGWB 2F53D 2I5YH 1WT5A 4ZUUA 1TIUA 2Z0BA 5C1MB 1DBJH 3O3AA 3U6RA 2XN9E 3KPSD 1T80A 1KC5H 3MV8A 4Y2DA 3VXRB 3VXNA 1N2RA 4B7LA 4DGVH 2OXGA 3H42L 1K6QH 3CFKB 4YBLB 1GIGL 4PV9B 4YWGH 3T77B 1LD9B 2DQHH 3AS1A 4HS3A 4NJ9L 3RRQA 3BGMA 1YNLH 1A21A 4FTVE 3O6LL 3K2UH 4H20L 3RVVC 4Y4HC 1Q9WB 4GKOA 4KPHH 4XMKL 3L7FB 4F7MA 5JDSA 2ZUSA 2E7BA 1JF6A 4EDXA 1JHLL 5FYLH 2QSTA 3X11B 3UZEA 1WVZA 2EZ0D 5EWIH 3ROLB 3WS3A 4CVZA 3L3HA 1E4WH 5DR5L 4ZFOL 2H41A 3WNKA 2HFEB 4DZBB 5I1LB 4GG6F 4XPGH 1E27A 2VDML 4PS4L 5T3XD 2C3GA 3V6ZA 4Z7UE 1WEJH 5GIRB 3QDGE 4RGNC 2B7DT 4Y88A 3L5XL 1RJYA 3C60D 5A40E 3DV6A 3CXHJ 1KLFA 1J87A 3R1GL 1ACYH 5CBAB 2Y6SC 4QTIH 4JKMA 3BXNA 4DZ8A 4QXWA 3MLRH 4RGMB 4Z7OF 3WNNA 1CDBA 4R4BB 5BRZE 5E00B 2R4RH 3VMOA 4UNVA 3OR6A 3TBVA 2IBBA 4GRWB 4YHMH 1KG0A 4HMDA 2Q6WA 1XGYL 2AJSH 2H8PA 3GI8L 5C0CE 3EYOB 5IK3B 3RY6C 4R96A 4H5SA 1GCFA 5D2NA 1DQML 4GLRH 2CDEA 2AJUH 3QPQC 1C5BL 3E1F1 3QDJA 2OZ4L 3KPSB 5ICXA 1VKXB 2QQNL 4ODHH 4OGXH 4YHNA 2P43B 1WCBA 3L1OL 4K3JH 5JHDD 1MI5B 2AV7B 3GFUA 1FLRL 5C6PB 1YUHB 2QQKL 5J6HB 2A0LD 4R7NA 2O5XL 4L5FH 3VD5A 3HB3C 1E4XI 3WN5B 1MFDL 3NTCH 4D94A 3V7AG 3H6JA 2Q76B 3WEXB 1FZMA 1VENA 2YC1B 4XNUH 1NLBH 1UM4H 4WTXA 2K3TA 4U1LA 4IRJD 5MEOB 1E6OL 1OW0A 4I0PA 1Z9SA 4KTYA 3ECBA 5EZIH 4HJGA 1NAMA 4U3HA 3OV6A 4F7EA 5I18L 1XEDA 4CW1A 1H0DB 1UCBH 3EJZD 4AK1A 1MVUA 3PDOB 3GMRA 1JPTL 1F90H 4DKDC 1ZHBA 2WWMC 1WIPA 5EPMA 2JF1A 1NGZB 2BOBA 4L4VD 2R39A 3LEVH 3C9NB 4LEXL 3HC3L 5DRWA 5DJZA 4FZEH 4N0YH 1X4XA 3C60B 3JTSA 4S0TD 4HEPG 2AXFB 3QEQE 4K94L 3ZE1F 1I3RA 2LAGB 2Z31D 3O2VH 1G7JB 4JDZA 4XP1L 3FT2A 4E41B 4ONHB 4A2MA 5LGKA 4HX1B 3VW3H 3O3DA 5DVMA 3LD8B 4NHUA 4MWFB 5DWUH 4X4MA 3ARXA 3EYUL 4HKBB 1BD2E 4YDVB 5BOPA 4U05A 1FL5B 2YXFA 1JN6B 5FCUH 5FXCH 1PSKL 1K4CB 3WUWB 5DJCB 4QRUA 2D31A 1Y18B 5KW9L 4LSUH 3QYCA 3RGVA 3ALXA 2R29L 1DQQB 4LOUD 5SX4H 4UIKL 3CCHA 3O6KH 4K94C 3TO2A 1YN6A 1KGCE 5D8JL 1HQRA 2EEDA 4G42B 1MCNA 3FT3B 1NAMH 4HPYL 3N9GH 3GJFA 1DVFD 2C1PB 4HIJB 3IGAB 5B39G 3MA9H 1E28A 1ZGLB 1KBGH 3NACH 5HI5C 1ZHNB 4O2FA 3MV01 3GMPA 2GEEA 3SJVE 5GRJL 5BJTA 1J0ZA 3A67H 2B8OT 2X4QA 2H3NA 3SGJC 4POYA 1XF4B 1UYWH 3NFSH 3P30H 3HZKB 3HLAA 3VG0L 5D7LE 1PW3A 1NEZG 4UIMA 3O6ML 4JR9H 4R0LC 4NO0B 5EBMB 1FDLH 4IOFD 4M7JL 4WWKB 4MJ5B 3KPQB 3LS4H 2X4OB 3Q6FB 3X3FL 1PD6A 3AU1A 1ZA3A 3FHAA 4L4VB 3CVHA 3N06B 4Z7VE 1ZT7A 4OZIE 3P9MA 5T1DL 4TQEH 1MJJB 3HKFA 5KJRL 4PLKD 2J4WL 3KYOB 3EFDH 2PYFA 1SY6A 1LO3H 5L9DL 4BQ9A 2GTWA 4TRPL 5TQ0L 2CDFA 1JRHL 4ETQA 2V17H 1SYVA 3PDGA 2ZCHH 1U9KA 2XWJB 4KFZC 4X4YA 2EDTA 3LRSA 2PXYB 2KKQA 1T4KB 4OB5H 3WJJA 3GJFH 1A7BA 4M7LT 1U8PA 3WL9B 1XR8B 4HS8L 5D7JD 1IC5H 2K9UA 3MR9B 5EZJA 1KYOJ 3S4SA 1WBZA 3BUYB 5HYEA 1VESA 3NA9L 4TSAL 5FECA 4EKXA 1TTFA 3DUUA 1ED3B 2VZ1A 1F6LL 1I8IB 3W0WE 2R1XB 3IB4A 3BDYH 1FVEA 1AI1H 1CICB 3CZJA 4IOIA 5D7IA 2FR4A 4UT6H 2BP3A 3GMOB 2AXJA 2E7CA 3EIFA 2VZOA 2F5BH 1QLEH 3KLAB 3LKSB 4DEPB 3RKDC 2WP3O 3NFPB 1EJOH 1FL6A 4KK9C 2R8SH 3LKQB 5D71H 4NQED 1A02N 3RAJH 1Q94A 4YC2B 1SY6H 2HMIC 4NBXB 1QLRA 1P4LB 1NANI 5JPNB 4NZTL 5HHQA 1S9WA 2C3VB 5ALCL 2NPLX 4LKXB 4C55A 4JM4L 1T1ZB 4Z7NF 1J1XH 2QEJA 5EU4B 2DQJL 5LQBH 5I8EA 1YECL 3B4NA 2F5AL 2F53A 4F37F 4OD1L 3O9WC 4AY0A 1U92B 1IAKA 4YEEA 3NOIA 5HYJB 1QVOA 2UZIH 4OLVL 3UXFA 4D8PB 5DK0A 3V4PH 1I1AB 4P2QD 5FF6A 4OFVA 4ZFFA 2W60A 1T66D 4OGZA 3GEWB 4IRSC 2ED9A 4M93B 1SVZA 3WNPA 2VLRD 1CFSB 4OLEA 4PJ8D 2JCCB 3KYKL 2F19H 3F5WA 3MRHA 1INDH 4PLJD 1A7OL 3ARFC 4YEFA 3SO3B 2D03H 3OB0H 5D7JB 4TUJB 2A6KB 1BBDH 5MERB 3U4AA 2WMPA 2DICA 3DI2B 1CXLA 1HEZB 4KRNA 1QP1A 1EERB 1LP9B 1N4XL 4PJXB 5CHNA 3PWNA 4LQFH 4ZD3H 5B4MC 5I1IH 4OZ4B 4F7CA 1MHCA 1E6JL 1ORQB 5GJTH 1MRDH 3DRTB 1H5BC 2QADD 2R0KH 3EYFA 4PBXA 5DQJA 4L3EA 1SJXA 2ADFL 5BMFH 4AZ8A 1IC7H 4ZO9A 5E8DL 5K59E 4OF3A 3OXRA 4OF0A 3VRIA 4N8VA 5ITBL 5K33A 3LKPA 5C0GA 1BZ7A 4NQEB 3C5JA 3TN0C 3X14B 1UZ6E 4L1DA 1VACA 2WBWB 1H15B 1MFNA 2V6HA 2GW5A 6CGTA 2EXWD 4JY6A 2DLHA 1YEHH 1MCLA 3HR6A 5I8OL 3OKDB 4Z18A 1C7SA 3I02A 4JO2H 5I1JH 4JRWA 4GUPA 5IVXB 3MREA 4IRSB 2LV4A 1D3CA 1F11B 4KU1A 4QGTA 3WHE0 1IM3A 5DA0B 2V7NA 3TBYA 4EUPH 5GZND 2DI8A 4H1LA 4OD2A 3INUH 2BVUA 3MRCB 5JHDA 4P2QB 2VLLB 3NZHL 1RUMH 2FSEA 5C0AA 3LQZB 1KIPB 3OJ2C 2VLMD 2VLRB 2DLEA 1I75A 2VXUH 4QY8A 4G8IA 4XAKD 3C5ZC 1KFAH 4MS8D 1F4WL 5T3ZH 1G0YR 5DJAB 4OKDA 3TNMB 2X70A 3T0VA 4KMTL 2AXGB 4X4XA 4IRJA 1BFSA 3PWJB 3TYFA 4BZ1H 2CDGB 5EOQL 4GMTL 3L5JA 1T04A 1FZOB 3JTTB 3MJ7B 5FHBL 4DQOH 4J3SA 3I2CL 3VE0B 4WUUB 2ATKA 3WNOA 3W39A 2J8OA 1ZSDB 5C09A 3F58H 4E0RA 2ADIA 1EGJL 3MO1A 5IMKA 2LU3A 5MI0C 4UT7L 3BAEH 3K8KA 4HIIA 5F70A 2DMCA 4OD3H 1V3JA 1EZVY 4UNTA 3FAWA 3P4NA 5IWLA 1A6UL 1VERA 2VXQL 3VGBA 5FO9B 2CLRB 4HIEA 3O2WL 5EBGA 5DEFB 5AUMA 3TA3D 1MFAH 2A1WL 3GSWB 4YGVA 1HXYB 4NZUH 1MUJB 1X7QB 2H9GA 4U1GC 2H45A 4J12A 5B8CB 4L29A 4UV7H 4R6UA 2W59A 1YEIL 2X1PA 2WBKA 3QCVH 2YPVH 4DUXA 1IAIL 2E6JA 3QHFL 2VL5A 3NZ8A 5CILH 4ZUSB 4NRXA 2BXYA 3C6LB 4H8WL 2GITB 3U36B 3BH8B 1ZLSH 4NJAH 1FFPA 5FYKH 5IKCB 3BEWA 4MXWL 5C07D 3D3VA 3CZFA 3B2UC 3O2DL 2YD3A 1SMOA 5KVFH 2YMXH 1UXSA 4Z77A 3SKNA 2VL4A 5EU6A 3ET9F 2GUOA 1N26A 2PYEE 1DZBA 3RVTD 4X98B 1KJ2H 3ZKSD 3OF6A 3IDMA 4H8WC 2CIKA 4RIRB 4X7DC 4XPTH 4EOWL 4GRMB 1C5DA 5F96H 4ONFL 5KS9A 1RZGB 4XTRD 1RULL 4H26B 4KJYB 2XYCA 4WHTA 1F4XH 1YMMB 1VGEH 3CD4A 3EDDA 3V0VB 4QXUL 1SEBB 3K2MC 2D7TL 4FNLH 2IBZY 4MAUH 5E2UL 3V6BR 1FN4A 3EYQC 1YY8A 1J0HA 2FH6A 3ARGA 3UTTE 4XP6H 5CD3B 5M7QA 3NCJL 1BWMA 2B1HL 4G8EA 4LCYB 1X4ZA 4HS6B 3IDNA 1C16B 4M6MH 4Z7UF 5TDOA 4JJHA 4L9LA 1BOGA 4ZUWB 3BJLA 3DV4B 3D9AL 4MNQE 1L0QA 1QYGH 2VIRB 1HINH 3FTGA 4M1DL 5HGHA 4LEOA 1T1WB 2OM5A 5A2JH 5IW1A 4XWOD 5CEZH 4JM2D 3DUSA 4ODTH 3X3GL 2DIJA 3V0AC 5ID1B 3IKKA 2LTQB 1KTKE 3V6FA 1CXFA 4O2CB 3U1SL 3HZVB 2XY2A 1S7UA 4HXBL 5EA0L 4JB9L 5I8KL 3ARYA 3VXTA 3QRGL 2FD6L 2IALA 1KLUA 4RBPH 4LPTA 4XX1G 5HYSG 2IPTH 4LLMA 2ARWA 2GSGB 1DTUA 2R69L 3SDDD 1KYOK 4G3YH 3RWIB 1RK1B 3U4EA 3BP5A 4RZCB 2LU7A 2YD7A 3QXWA 4K7PY 3IDYC 3BW9A 5FK9B 4MD4B 5T1LA 3MYZA 2BK8A 1JZ8A 5ACMA 1YMHB 3BGAA 4UILH 4QOKB 3QUXD 1FSKC 2PTVA 5KTEL 5DT1H 2HYMA 1BLNA 5I9QB 5DD1L 5HPMA 5FCSH 4XRCB 4TVSa 5E24E 1MNUL 1WITA 4FP8H 1BJ1H 4MXQD 4XXDA 4HFUH 5KSUB 4X7TB 3SQOL 4C56E 3TZVB 5KAQF 2ITCA 1I3UA 2VR9A 4CN4A 1NCWL 2VOTA 4NBZB 3MTRA 3WMSA 2VABB 4LCIL 1N6UA 3B6SB 3BPCA 1REIA 1I3VA 5L2KD 2VDPH 5GGUB 4XP5H 4UQ3A 4KJPC 3DO7A 1NGXA 3RUGA 4YHZL 1A9EB 1L9NA 1N8ZB 5KSAD 4Q7DA 1P7KA 4BZ2H 1HH6A 3GIVA 2YRZA 4ZFGH 3LHPH 2Y7QB 4UDUA 1X6NA 1JZ5A 3FHQA 4WJ5A 2Q7NA 4JM2B 4DW2H 4P5KA 3ZDZE 3N1PC 1IILE 2NY4C 5CZXC 3G04B 1U8IB 1CFTB 3GMMB 5LBSH 1FRGH 1MHPL 2HT3C 4Y5YC 2X4PB 3VXUD 5DMKA 1WZKA 4Y8DC 1ES0A 3PGCB 3SCMA 4GJTB 1MCPH 5E6ID 3SDDB 1RURH 5ANMA 3SKJL 1IE5A 1ODAA 3C8KB 1U0QA 3TBWB 4RQQA 3SE4C 5I1KL 1G7IA 3AREB 1NGYB 3MLWH 2V5RA 3BP6B 4JO1L 1C5CL 5DMGD 3L9RA 5L0QB 3QUYD 3QUML 4JQIH 4UINH 1OP3K 4FABL 5IV2A 3VGDA 3NCMA 3UEZA 2MKWA 1T83A 2VZVA 4L4TD 3D48R 1F6AB 1NCDH 4B50A 3UTZA 1JL8A 1KPVA 4NWTH 3BKJH 3MBXL 3VCLA 3W9EB 4W6XB 4LPUA 1B0GB 1T0MB 4ZOBA 4WNQB 1WFTA 1TMCB 3IT8D 3O8XC 5DEGB 5L2KB 5H8DA 4GS7B 2X10A 3EBAA 2B1AH 4JEGB 1JWMA 3FMGH 5KSAB 4PRNB 1LO2L 2GCYB 3H7BA 5I1AA 2X4NA 4Z7VF 3VWJA 2F74A 2EYRA 2R15A 3EYVA 4OZIF 4PJAB 5EIQA 3SQBA 3S36H 4RWHA 5I8CB 3CIQA 5DK2B 3VH8G 5T33L 3IDXH 5JOPE 5JPMB 3V95A 3OHXB 1QRND 4L8SB 2ZOLA 1DQJA 4K3EH 3RPIB 3MSPA 5I15L 3TJEL 1ZHLB 2WBJC 1WUNT 4FN0A 4G8FA 5D7KD 5HGBB 4BH7B 1WZ1H 1BHGA 1GGIL 3VXMD 1V3LA 3SGKA 3MFFA 1QHOA 4K71B 4OZHE 2PETA 4P5TC 4OF7A 5E6IB 4I5BA 2C1OB 3U0WL 4GBXB 2AQ2A 5HHNA 4JN2A 3NGBB 2D7QA 4HGMA 4JQVC 2EDOA 4FZ8H 5ESQA 1KT2B 3RWEA 1RIVH 2ITDB 4NUJA 4PJEA 3TA3A 3O4LE 4K3DH 4P9HH 5CJBA 2EKJA 1MCKA 3NVQA 1OWWA 1U8KA 4QTHB 1BGXH 1X5YA 4JKWA 4EN3C 1JGDB 5E94A 4OCXH 4PJFA 2YBRA 4OSUH 1J1PH 3QFJA 4LLWA 4N0FB 4URTB 4L4TB 5D1ZC 5DYOA 5H35B 3C6SA 4AG4H 1BBJA 4P3WA 1XIWA 3CSYA 3VFGL 1DN0B 1KN4H 2Z35A 5MEQA 3DX6A 4NQSB 1RVFL 3WFHB 4ODWA 5HHVL 3VXSA 4CGTA 5L8KB 4AENB 3PXHA 1XGQA 1SQ2N 1MEXH 1BVKB 3D39B 1DL7H 3PL6A 1YEEH 5K9OB 3RY4A 2X41A 4JJ5B 3CX2A 3MZGB 32C2A 3ZE2E 1YQ2A 2QHRL 4M61B 4HWBA 1A6WH 4ZG1A 3MYJB 5JORA 4NZRL 3VFRB 2AERT 5J0BA 1UEYA 4JZNA 5D2LE 1UKTA 3WSQH 3ZZ1A 5H37G 1UB6B 3HCVB 2QHLA 2FCBA 4PJ9A 3UC0H 5D1QC 4JLRA 5FYLE 1QRNB 1F4YL 3S5LG 5GZOD 5DLML 3UBXI 4FFZL 3BKML 4PD4J 3F12B 3P9LB 1LK2A 4UB0L 4M62H 4JRXB 1J7VR 3CFIC 3CUPB 5IEHA 3VXMB 4PRPE 1X5KA 1LNUB 1U3YA 3V5HA 2WV3A 2NZ9C 3ZL4H 1B2WH 1QFPA 1JZ2A 3MRJB 4ZODA 4OCMC 1UEMA 2M1KA 3BZFA 1G9EA 3I85A 4ELMA 4HAFA 1QBMH 3RWDB 4C58B 3HNVL 5F3BA 3RDTD 4NN6C 3MV8E 2D7OA 3MBEA 5DHXB 4MJIB 2X9WA 3MJ9L 4C83B 4Z9KB 2FO4A 2R9HC 4X8JA 1TNNA 3SDXB 3ZSSA 4UOW0 3HUJA 3OKOB 3ABZA 5K59F 1BJ8A 2CLVA 4P4KC 1QPXA 4GRLC 5JIPA 4M00A 3UJTH 4NM4L 1YNKL 1C08A 1GVIA 4YE4H 3T65B 1UZ6F 5BQ7B 8CGTA 4G6JH 4XNXL 2DQUH 5EUKA 3CJJA 3PQYB 4R97B 3GMLA 3O3EB 2ZCKL 3K3QA 1DSFL 4XCNA 3CC5A 3O4OC 1EAPA 1A3RH 3BE1H 3WIIL 4Y5VA 3RIFF 4HPOH 4OT1L 3BRDA 3AMLA 1GOFA 2RGSA 2XWTA 1PKQA 1ZT1A 1BX2A 1I4FA 2NXZD 3QUXA 3OKNA 1UM5H 3MNZA 1AIFB 3FB8A 1U8JA 1BEYH 1ZKAA 5HYQB 1HN1A 2BSRA 3HMWL 5D72H 4JO4H 4PB9H 1KB5H 4Y16A 2SEBB 4WEBH 2NY1C 5FKPB 2NY3D 1JBJA 2Y5TA 3IDJB 4FQIH 2Q8BL 2E9IA 4QLRA 4J3XA 2XKNB 4LLYA 1AGEB 4Q58C 1IBGH 3RBSA 2AEPL 1G6RL 3RDTB 2VZSA 1QBAA 1LVEA 1JP5A 4KROC 4P59H 4YBQD 5DGQA 4WFEE 3FQRA 1TJGH 4M6OH 2ZJSH 3AAZA 3S3JA 4LVHC 1ZANL 2A9MH 4I18C 3MV7D 4JN1H 1EIBA 3SBWC 2R4SL 5E70A 3D18B 3QI9D 5DO2D 1M7IA 2PO6D 4U1NA 4GG8A 4M48L 1I8KB 2QQLL 3FB6B 4OFDA 3WCYA 1XF1A 2ZSVA 4DGYL 4OZGA 4NFCA 1AHWA 2E3VA 5DDHA 1F3DH 1SBSL 2D2OA 2V9TA 4TNVF 3REVA 1AP2A 1TETL 25C8H 3B3IA 4ZFZA 4U1JB 4GH7B 3I50L 3EDKA 3B9EA 4CRPA 2V7HB 4XB8A 3KPRD 4HJ0D 3EO1B 4XMPL 1WBXB 4HBCH 2P24B 3JWDH 3IAGC 3OJVC 4APQC 5C0BD 1U6AH 3ILPB 4JZOA 4J7RA 3N1FC 3QUYA 5D1XA 3RVWC 5ABDE 4FHBD 1PX3A 4P3DB 1KJVB 3BN9D 5MENA 4NRYA 1T22B 1F6FB 2VITB 3NAAL 5KVEH 1ONQB 4D0CA 1S9YB 2GIYA 5I1EH 4TSBH 3MA7A 4G43B 2CR6A 1CGXA 1EHLL 2WLYA 4X4ME 1MRFH 3MLTA 1FO0H 3EYSH 3O6FC 4KDTC 2J2ZA 2FL5A 1N5YH 1ITBB 5CFHA 3PJSA 3U7WH 4X6EA 3VFPA 4FFVC 5C7XH 3PABB 3PV6B 4HWUA 1Z3GH 3RVVD 3FFDA 5KSBA 4M7KL 4Y4HD 3I6GB 4RNRA 4RRPG 5D70L 2QL1A 3K1KC 5GGSB 5DS8B 4AEIH 5F1OB 3K4DA 2F8OA 3GBML 2XQBH 5DFTA 3GSVA 4ZTPH 3HC0B 2EDYA 2HVJB 3HR5A 4WO4B 3ME0A 1ITCA 1CGVA 3IU3B 3MV7B 4WV1A 5EFIB 3HE7C 4ELKA 1GGBH 4QRTA 5IVZB 2CJUH 5IBUG 4M9PA 3QI9B 4RGND 4O4YH 3GSXB 3NH7L 4JFHD 3FQUA 3UBXA 2O26U 1JWSA 5K9KA 3MLUH 2X5PA 1P84J 1HZHL 3JV4B 5GS2H 3QP3A 1NMCC 4AEHH 4Y4KA 1FYTD 1V7ML 2FGZA 3LH2L 2XG4A 4KK5C 4AJ0A 1I85A 1ROWA 3MC0A 3DSFL 1RU9L 1RMFH 3KNBB 5HGAA 1GC1H 5C0BB 2KZWA 5CSBA 1RZKH 1PYWA 3S88L 4RGOL 1D7FA 2NX5E 3OGCB 3S37L 5KZCD 5IJKA 2IFGA 3HZMB 1R0AH 5HVGB 4OZFB 3V9FA 4Q9RH 1Q9LA 1QQDB 4LASH 1RV6X 1UXWB 2HTKC 1RUAL 3QULB 1IMHC 1CFVH 1NDMB 3QZWG 3QWOB 1DQLL 3QH3A 3QO0B 1UGNA 2W65B 4P23D 1GZPB 4W4NA 5A16A 5IMMB 1XCTB 4KUCF 4G9FD 2Y07L 1S7QB 1DE4B 4PY7B 5KVDH 5L8LB 4PRAA 4ERSL 2NY7L 4OKVB 4OM1H 1AQKH 4G80A 3LKOA 5IQ9A 1KCUL 1MIML 5C0RH 2AJ3A 5CCKL 4NO5A 3GKWH 2BDNL 4PRHB 3OZ9L 3DXAB 4CU8A 3HPJB 2G9HB 4O58H 5D7IE 5ID0B 1RJZA 3SGDI 2XQYK 3M1BB 1JWUB 4MA1C 1QNZH 2R0ZL 3B2VL 1KEMH 4JVPA 2WWMD 5J13C 3MCLL 3QNYA 2NW3B 2HVKA 2VE6B 1F42A 4EI6A 1MREL 4X9GA 3UYPA 3VWKC 4MNHA 3ESUF 4Q9BA 2HN7A 4AT6B 5E8EA 3B9KA 9CGTA 4W70A 3QWRA 4XPHL 5E7FA 4QO1A 4HUUA 4U3CA 2JK5A 1F8TL 4U6VH 5IMOB 2ADJA 1HI6B 3KR3L 2YWZA 2XTLA 2IH1B 4HIXH 4Q6IB 4QF1A 3RI5K 4LNRB 1JUFA 4NP4H 4Z0XB 3G6JA 5AD0B 4I2XB 5T5FL 5CGYD 3ZDZF 4Z8FL 1V7NH 5I1GH 4LVNC 3G08B 4PD4K 2ZOKB 3G9VA 4OQTL 1IC1A 3ARZA 1W72A 4DUVA 3JV6B 4D0DA 2NQCA 2OI9B 1R24B 4DOHE 3T08A 4ZXBA 1AE6L 3QJHB 2AXHA 3QFDB 1BVLB 3S96B 5IHZA 4PJBA 3MRGB 3QPXL 3HAEG 2W0FB 2HFFA 5DRNA 1I9RH 3ULUH 1U8LB 2BVPB 4OCLC 4P23B 1S8DB 2A9NH 1RZIB 2OJZL 4XMLH 2VXVL 2X1OA 4NNPL 5HI5D 4G9FB 2Z91B 4H25A 2ADGA 3IJHB 4Z95L 4CUCA 2GQHA 3DETC 3QJFA 3KJ6H 2DKSA 2XIDA 3CDCA 1OAKH 5TPWH 4MA8L 1BFTA 2I9LA 1OAQL 3SDCD 3ALWA 4DGVL 4L3CA 3ZT5A 3MRDB 4UAOC 4F9PC 2FATH 1A1OA 1LDPL 5T3ZE 5JNYB 2FRGP 4NWUL 3S4SG 2AK4E 2UWEA 3IFNH 2DQHL 4Y0GA 3BFOA 4L3EE 1UT9A 3ARQA 4U49A 4BFBD 1YNLL 1Z0NA 4G7VH 4LVNB 4KPHL 3RTQC 2EICA 2FJFB 4FXGB 1OCWH 1X5ZA 1J18A 1DUYB 5D5MA 4J1UA 5EN2A 1IAOA 1CF8H 2GAZB 1G7PA 3LKNB 5EWIL 3WFDH 4HH8A 5KANI 1BFVL 1E4WL 4XVJH 3KPTA 4U33A 5BV7B 2YS4A 4JFQB 4QRRA 4HC1H 4XPGL 2J3SA 1T3FB 4F8TA 3MLVH 3UYRH 1EDQA 2VDOL 3IXTA 4GKNA 5IIEB 1U3HC 2GJ6E 4PRID 3TC9A 2HJLA 2JE8A 5EIIA 3FFCA 3QUZC 4YXLL 2EH8L 2BCKA 1CQYA 3FL7A 2XA3A 4YK4C 2VERN 4OZHF 1ACYL 1U91A 4PUBH 3K0WA 2YD6A 3T1FA 4ONGH 3MLRL 1RHHA 5JW3H 1WWBX 4CJ0A 1R3KB 2EDHA 2RCSL 4X9FA 4GG6A 5F7DB 4XBEL 4WW1A 2PO6A 4YUEH 3V6OE 1LE5B 3RKDD 4ZAKA 4F3FB 5I74C 5D6DC 5EC1B 4KK9D 5C9JB 4P2OB 3QIBA 5FYKE 5C08E 4JFEA 1IGMH 5E8PA 1K8IB 3SDCB 4OGXL 4JFZL 5C09E 3KPRA 4K3JL 3T0EB 4JRYD 3VXOB 5FGRA 5D93C 4M43H 3FRPG 5EZLA 4U0RC 1Q0YL 1D9KD 3PP3K 2EDXA 1XZ0B 3NTCL 4PBWD 1X5IA 5FYJD 1XCQA 4XNUL 1FZJA 1UM4L 5EBLB 5GHWH 5E00A 5IFJA 5I1DB 1J88A 1JF5A 1XGRB 4MDJA 4LDEB 5EZIL 5DQ9B 4M03A 3ZE2F 5CKGA 3WDJA 3V0WH 5B38G 2HJKA 5IK3A 5D2LF 2OK0H 3RVXD 1TCRB 1JNLH 4N8VG 1DLFH 2N56A 1S7WA 1CD9B 4R4FH 5F88A 1CGSH 5J8OA 5LJYH 4NKOB 4DTGH 3OTTA 4PRIB 2P47B 3LEVL 2FJHB 2GKIA 3RNQB 4E42A 4FZEL 4N0YL 4KKAC 5DJ6B 1M7DB 2MPAH 5EU3B 1JRHI 3WUWG 2W92A 3JXAA 4K7FB 5F3HB 2K7PA 1AGFA 1DBAL 1OQXA 2O5ZH 1HSBB 5TE6L 3Q3GB 5B4MD 4WDIB 1YEKH 4OLZL 3D3VE 1CIDA 3KPMB 1X44A 1WSST 2NYYD 5CEZE 4NGHH 2OL3A 3V2AR 3TNNA 5FEBA 4LSUL 3FKUS 3X13A 5SWZA 2VQTA 2X9YA 3O6KL 4U7SA 2CGRL 5EBWB 1H0DA 2Y72A 4ZFOA 2QSVA 1P69B 1FAIH 2YK1H 5KS9E 1N6QH 1ZT4A 1EEZA 1DQDL 1WTLA 4PGCA 2X7LA 4GRWH 4ZS7L 4JRYB 3PHOA 3RL2A 2VLJA 1KPRA 3DYOA 4X0KA 3EOAA 4JDVB 1UVQB 3H9SE 5FA3B 2A73B 2UZYB 1JK8B 1D9KB 3MA9L 3ROOA 3RY6A 5HGDA 3NACL 5CINH 4TUKH 2W07A 4JFPB 5GRWA 1P84K 4ONHA 3A67L 4NN7C 4XI5C 3CVIL 3RWHA 5ISZD 3TH3T 3EFFA 5E9DD 3QUKB 1N3NA 1UYWL 3P30L 2IFFL 4G7YH 3VG9B 4JR9L 5DXWA 1T20A 1FDLL 4F33B 4MA7L 5FKAA 1JPFB 2WM0A 2WP3T 5L2JB 1HKFA 4MNGB 3DVNB 4NJ9H 4RMWA 5DURD 3O6LH 1BQHB 1RFDH 4H20H 1S7SA 4XMKH 2NW2A 3V5KA 3MV9E 1LEKB 1T0NB 2ESVA 4JG1L 1JHLH 3QIWD 1NGWB 2CKBA 3BMWA 1LEGA 2OMNA 4GXUM 2HT4C 4DAGL 5IEKA 4JFYB 2OMBA 1CGYA 2ZCHL 1A5FL 4KKBD 2AJXH 4PS4H 1OPGH 3DX7A 1JYVA 3FOLB 3M8OL 3KLHD 4WU7B 1GH7A 2YD8A 4JAMB 3T4AA 2J8UB 2EECA 5DUPL 1IC5L 5T1KD 4IMLA 2BC4B 4FTVD 4XNZC 4UV4L 1UB5B 3DROA 2ED7A 2DLTA 3DURB 1IJ9A 1ZVHA 5JA9A 1AI1L 4UT6L 1XGYH 1I8MB 3GI8H 3BHBB 4GOSA 4NQCE 1IGCL 2P7TA 1QLEL 4UU9A 4UMGA 1NDGB 4QHUA 1NEUA 3QDGD 2DLIA 5ISZB 2R8SL 1EEUA 2OZ4H 5D71L 2QQNH 4PP2A 2YKLL 3L1OH 3FAXA 2QQKH 2O5XH 3WL9A 5BRZD 3B2UD 2HG5A 5C0ND 5DURB 1MFDH 1YDPB 1J1XL 3BUYA 5FYKU 1RK0A 5LQBL 3QHZH 3HNSL 2ZNXA 3SGJA 4B41A 5C0CD 3I6LD 1E6OH 5I76B 3QIWB 5KG9A 1CICA 1VADA 2VDKH 1I7UA 2UZIL 4QHMB 1JGVL 4R0LA 5F9WB 3NIFE 1V5JA 5F7FA 5IJVA 1QEWB 2ICWJ 1MHHA 5FOBA 2F8VA 1JPTH 4M7LH 3UTSA 4D3CH 4U0QB 4WU5B 4GW5A 2X89D 3S35X 4JANA 1HXMB 1Z0MA 1HHKB 5DC4B 4KKNA 2F19L 3A6BH 1G7QB 1X3DA 3HC3H 1INDL 5KN5B 2I9TB 5E5RB 2YPKB 1CT8B 2APFA 1A0QH 4P5MA 1RI8A 3ULVL 3TESA 1CL7I 1I7ZB 4CU7A 1J0YA 3MROB 1NAKL 3O3BA 4HF5H 4BK4A 3MRQA 1T1ZA 2YSSB 5I73C 3EYUH 2RB8A 1W2KT 1WK0A 1YY9D 2ICWI 5I1IL 4B53A 2G75A 4MZ3A 2UV3A 2CRIA 3CFJA 1MRDL 1PSKH 4LLDA 2P4AB 2PTUA 5KW9H 2BOCB 4NUGH 3UYOD 2R29H 5BMFL 1IC7L 4MXVE 4UIKH 4K8RL 4RX4D 4J8RA 3BT2H 1AXSB 1ZAGA 5D8JH 1NJ9B 3GSOA 3I3DA 4JZJB 2AK1L 4ZNCD 1FCCA 3CLFL 5JW4Q 2FX9H 3QEQD 7CGTA 5GGVY 2AV1B 5F9JA 3SDAB 1PY4A 2CLZB 2EEAA 3ZYOA 4JO2L 2XWBA 5I1JL 5I0ZA 5T1MA 4O2EA 1P6AB 2H32B 1BD2D 2KZ1B 4MLSA 3MCG1 5GRJH 3GMNA 4KZEH 4K8RC 5DHVA 3T4YB 1FBIL 1ZVSB 4PJHA 4ENED 1A22B 3IS0X 3VG0H 1ORQA 1AGDB 2EC9U 3CFBB 3O6MH 5JR1L 2XZQH 4M7JH 4QT5A 2HP4A 2B20A 1K8DB 1LQSR 1RUML 2DIAA 1FG2B 4E5XB 5IB1B 3X3FH 4JFXA 2HKFH 1S7RB 2A74B 2VQ1B 4LU5H 3ZYZA 4F37K 1UC6A 2JIXB 3O9WA 5FO8B 3IFPA 2BSSB 5T1DH 2FWOA 5MP6H 43C9B 4OIIL 2J4WH 4BZ1L 2DM3A 5IHUH 1YYML 3SJVD 1FNAA 1I9EA 4TRPH 4F57H 5D7IF 5TQ0H 2FEDD 3GI9L 2I60L 2EDQA 4DQOL 4IRSA 1Y0LA 2UY6A 3MODH 1J11A 4YIQB 3QFJE 3NA4A 2EDFA 5D7LD 2WIIB 3KVQA 3WO4B 3ARFA 1R5VA 4ISVA 4LLAA 3IAPA 2NTFB 3FQWB 4FG6C 3QIUD 3OKMB 3GSUB 3MRLA 3NA9H 4Y1AA 3VXSE 3PGDA 1S7VB 2NY4D 2H6PA 2O61A 5DUMH 2OLDA 5C3LD 1MFAL 3TBSA 1GL4B 2X05A 4HXAL 4NZUL 4N8CL 5GGTH 1Q9OA 1H5BA 5FDYA 2V2XA 5IM7B 3ARDC 4TSCL 1FZOA 4P3CL 2EH7L 1NUFA 3MJ7A 3NMEA 3AXLA 5JOFB 1I1YA 4HLZG 3VE0A 1RIHL 2YPVL 4IS6B 5HHXL 4X6BA 3TN0A 3WFBL 3EOBA 2IGFH 4HWEH 3PWPE 2AJZB 1T89C 5E8NB 4F7PB 1JPGB 4YDLB 4K23H 1XMWA 3WLBA 5ALCH 5FYKL 4LLUB 4M7ZB 2OTWB 4WHYH 3TBTB 2Y06H 3W82A 3ZHKA 3IFOA 3W0WD 1KTLA 3BWAB 4YDJB 4NPYA 1YECH 3TVMC 1RZ8B 5KVFL 2F5AH 1CLCA 1AR1C 5FO9A 2DF3A 3SKOB 2YMXL 3VDCA 4OD1H 3BQUB 4ELME 5E9DA 5F9DC 3SOBL 3V6OC 3VA6A 2L4OA 1QHPA 3VFNB 1KJ2L 2VR5A 4RDQF 1MUJA 4XPTL 4GAFB 4FRWA 2BXZA 3O8XD 4HKZA 1XGTA 1CGWA 4YR6A 1NBQA 2XG5A 4JGUA 1OTUD 3KPNB 3C5ZA 4JGJA 3S98A 4D9QE 1VGEL 4X80H 1MQ8A 3MMEA 5J1AA 1CDYA 2DYPD 3C6LA 3QIUB 2NY0D 4MAUL 1XFPA 2LVEA 1T21A 3STZA 2MHAB 1AO7A 5F1KC 2XZCL 5IKCA 1N4XH 3STLB 4XP6L 3QQ4A 4PJGB 2XN9A 4NFBA 4U6XB 4WI7A 3ZTJH 4G8GE 4DCQB 3LN5B 3CSBA 4KI1A 4KY1L 4LPCA 1YNTB 3E0GA 2A6JA 4HMCA 3E6FA 5GGQL 1PGRB 5F7UA 4R26L 2ZWLT 1HINL 5T1KA 4FTVA 4UBDC 5ITBH 4KKLD 3RU8H 1H8SA 2BVOA 1N5AB 4YHPB 4ODTL 2Q20A 1F3RB 4HK3N 2IADB 3LSOA 1EGJA 3LVEA 2E6PA 5GS0D 5ITFA 2ICWA 4PJCE 2AEWA 4PLNC 3QQ3A 1SJHA 3W0WB 5D1ZD 2IPTL 5ETUB 4OV5A 4CADA 1BZ9A 3QXVA 2DJSA 3MRRB 4CMMA 3VI3E 4KTEL 4LCYA 4UUJB 4IRZL 1P9MC 3PF2A 2B0SL 2HTLD 1NSNL 2DWEA 5AWNH 4RA0C 1B4JH 1DANU 3NZHH 4WHDA 3DV4A 5DF0A 2ZG3A 5BRZA 1ZS8A 4MAYB 1PZ5A 1MRCL 4Z7QE 4IIQB 3BZ4B 4TUOA 3VXQB 2GT9A 1R3HA 1F4WH 2Y36H 2X4SA 4NNXA 4FP8L 2Z8RA 1SBBA 2D0FA 4HFUL 3WXWL 2DYPB 5C0CA 1DBML 4OTXH 2EO9A 2NY0B 2APXA 4KXZH 2X4TA 5EOQH 1KCRL 2FJGB 4GMTH 4X5WA 4HH9A 4EIZC 2H2SD 3BEVB 3V8CA 4FQHB 1C12A 1OF2B 4OZGE 3P2TA 1FORH 2G2RA 2VDPL 4R2GD 4XP5L 1I3GH 3M17B 3O2DA 4JFFB 4PJ7A 4CMHC 5IB2B 1B0RB 3PIQB 5F7WC 2VXSH 4ACPA 4L8CA 5I16B 3P4OA 2W0PA 4UT7H 4MZ2A 4ZFGL 3U7YL 5FM5O 4XWGL 3I75A 3RWJA 3KYMA 5CP7B 2PN5A 1AJ7L 4DW2L 5MENE 3LZFH 1OSZB 4P49A 4GW1A 3KPPA 4I9WE 2EDDA 4EIGB 1X4YA 2NNAA 2BX5A 4E9LA 2P5WE 1K3ZA 3BJ91 4ZYKB 3U0PB 3TZVA 1A1MB 3V52L 4AM0B 5DJXB 3RZCC 3UJJL 1EFXD 5F7KC 3F6IA 4I48B 1J8HA 4WY7L 5HSFA 1YEIH 5LAXB 4GRLD 4XCYB 2O5YH 1IAIH 3HI6H 3QHFH 3MLWL 3UTQB 4YZFE 5KS9F 4JPVL 5DMYA 4PV8B 5K9QI 4EZMA 3L3GB 1A9EA 3LAFA 1MFCH 3QEQA 4XCEB 4NQDB 3UTPE 5MEPA 4ZQKB 2VLKB 1S9VA 4A6YA 1JPSL 1I1FA 4LFHD 3QEUB 1BD2A 5ILTH 1NFIB 4P57A 5F6HJ 5I17A 3NCEB 5KVGH 4X7SH 1ZWIB 4Y5XB 4EEEA 3DX9B 2EDRA 1FC1A 2DM2A 5KBNC 3GO1L 1YQVL 3BDBA 4ONFH 1ZLUK 2UYLB 3BYTA 1DLHB 2B1AL 5FO7A 2FBOJ 1A1NA 1FNSH 1RULH 3AUVA 1PJ9A 3FMGL 3GHEH 3L7EB 5E6YA 4S2SA 5J12B 2NY1D 1VB9A 5TH2A 1LO5B 4X9IA 5F6HI 2D7TH 1HE7A 5EUOB 1MWAB 3C08L 3RWCA 3VJ6B 1WBYB 3D2UA 4ODVL 1UA6L 3IDXL 4UQ2B 4KKCC 1NBYB 2B1HH 2PYED 5C0FB 1A6ZB 5D7LA 5E4IA 1OGAB 2H2PD 3WKNA 5IB3B 5IFAH 1WZ1L 4WI9A 1F3JB 3W9EA 3D9AH 3K7UA 1EFXB 3MUZ1 4KHTL 2JTDA 3S7GA 3QG6B 1T0MA 5DI8B 4LSTH 4M1DH 2E27H 2IF7A 2R2HA 4M1GL 2CO7B 2XPGB 4Z7VA 3RFZC 2X4UA 1UACL 1A6AA 3B9AA 4Q9CA 2AKRB 1GAFL 1QSFA 4QHLB 5LVEA 3DMMD 4Y5YA 4HXBH 1Y6NR 1PQZA 3LKRA 1J0IA 3QEGL 4JB9H 5CEYA 3O41A 1BGXL 3UTTD 5FDWB 5AZEH 4EQ3A 3T2NH 3HG1E 5IOPA 1X5AA 2RFXA 4OSUL 4UZGA 1A7NL 1J1PL 2R69H 3SE4A 1TLKA 1IGJA 3GHBL 4AG4L 4HHAA 4DWHA 5HI4C 3EJYC 4PJDE 2R0LH 4NZJA 1ZHLA 4MNQD 2AABH 1KN4L 2QQQA 5CJXC 2EDWA 1T2QH 3VFMA 1KTDB 4F15B 4P9HC 4TN9A 4JY4B 1KIRA 4WVRA 1RIUL 3MRPA 1ADQH 4KRMB 5KTEH 1B6UA 4EI5C 3NCYS 4KMQA 5DJ0A 3MJ8A 4MCYB 4GBXA 1ZA6A 1MEXL 1S7TA 4IMKC 5DD1H 1DL7L 2JB5H 3L3JA 1YEEL 4PJ5D 4WRLA 1LDSA 3MUGA 4U1MB 3G6JE 5E8OB 3O45A 2XQYG 3L3DA 1MNUH 3DBXA 1LHZA 1EZVX 2AQ3A 3D0VB 3K74B 1BREA 1IZKA 5JUEH 1J0KA 1EV2E 4FFVD 4V1DB 4Q2ZA 4RAVB 3QUMA 4QTHA 2W9EL 5BO1H 4HFWB 3NIFF 3UC0L 3MRBB 3O8XA 1JGDA 2ZSWA 3W81A 1R3IL 3H0TB 1AY1H 2PYEB 4N0FA 4PG2C 1FNEB 4J3UA 3MCKA 2XZAH 1LGVA 4PJBE 4KUCD 5KSVB 4M62L 1S9XA 4X6FA 1CVRA 1JV5A 4HUWA 4WIQA 3AGVA 3GMQB 3QA3A 4NSKB 3G5ZA 1XT5A 2PTTB 3BVNB 4UTAL 4IEFB 3BMVA 4NC1C 2EYTB 3LRGA 5I71C 4C56D 2Z93B 2IQ9L 1GOGA 2WBJA 2P8PA 3DMMB 4XH2B 4ZUTA 1MHPH 2BY0A 3QDHA 4NT6A 1JMXA 4D9LH 2R2EA 1GPOL 1Z9MA 3UTTB 1KPUB 4P5TA 3WE6A 1SVCP 3VFOB 4XVTL 1EK3A 1CS6A 3IDIB 3VD3A 3SKJH 2EO1A 1OTTC 4JQVA 4MXVF 4CL7A 1CN4A 2IG2L 3W5NA 4GAYA 4JO1H 4MQXC 4AEFA 3IDGA 4JRXA 4YE4L 1BAFH 4MSWB 3GB7A 1EEYA 5IHBA 2OX5A 4G6JL 4M6AA 5IBTL 5D5ME 4FABH 4X5XA 4EN3A 2HTKD 4P46D 1MAMH 3SE3C 3NIGE 4PRBB 1TQCC 4POZD 2XTJE 4PJ5B 5D1ZA 2HFGH 3L3OB 1CFQB 4QRRE 2IBZX 1A3RL 3BE1L 4S10A 1ND0A 1WLHA 2W9LA 5E5MA 3K81A 3FB5A 3MBXH 3TPKA 2ATPB 4ZSOB 1CXHA 3VXRE 4FMKA 4YQXL 3FFCE 4ODXB 2NY6D 4EJ1C 1LEIA 1K2DA 3FZUC 2ERJC 3GUTA 2I07B 4R3SA 4QWWC 3IJSA 5INCB 3RIAK 4GT7A 1UH4A 3G5YA 1LO2H 4JFDB 4JO4L 1KSRA 4IHOB 1MLCA 4WEBL 4BKLA 5BQ7A 4MCZB 4GG6E 1NC2D 2XA8H 4WFGE 5T33H 4QHNB 5D1QA 3ARBB 2Q86B 2KUTA 4D2NA 1IBGL 1XGPA 3LDBB 4LL9A 2HRLA 3TH4T 5I15H 3P73A 3L3KA 1LE9B 2IANB 3IF1B 4JFEE 2W9DL 2VMFA 3KXFD 5IBLC 3KDMA 1CXIA 1N6VA 4P59L 3ZSTA 4ZO6A 3RX7A 3VH8B 2G60L