1OTUC

Structure of the escherichia coli clc chloride channel e148q mutant and fab complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated ClC-type chloride channel eriC
publication title Gating the Selectivity Filter in ClC Chloride Channels
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 37
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuC01
5CJ8A 1MFCH 1S7RB 3BPLB 3KPLB 3VXTA 3NGBB 1GC1C 3OKKA 4J23A 2F5AH 4I5BB 3TN0C 1J1PL 2NY0C 4JQVA 1DTUA 4ODHL 3ECBB 4HPYL 1MHEB 5F7NC 4M02A 1UXWB 1BM3H 1H3PH 4EUPG 2XQYK 2AK1L 1J05A 2AI0L 5HHQB 1L7IL 5MP6L 1T1WB 4IIQA 1M05B 4LARL 5ISZB 1TXKA 5I1LA 1G7JA 5EFIB 3DX9B 3IFPA 4ONHA 1YN7B 2F53B 1PZ5A 2P5WB 1D9KB 5I8KL 3EIFA 3GBLA 1M1SA 4ZOCA 2EE9A 1S9VA 4JFOA 4XGZA 2HLAA 5D2LB 4P3WA 3G6AB 5DDHB 4R0LA 1E27A 3UJTH 3DROB 1E6OL 4KRPB 2VDMH 4S1SH 1G7LA 2DKSA 4ZSOA 5I73C 2X42A 3QEHA 2IAMA 4P23D 3DYMA 4AENB 3PQYD 3MLTA 1MCCA 5FECA 1T1XB 5DJDA 3ARZA 3EDDA 4JLRB 5CJQL 1YEIL 4Q9QH 1MHHB 3N1GC 3SKJH 3RZCB 3C5ZD 2FATH 4O2CB 5T3ZH 3W11D 3WNLA 3E3QC 2DQFB 3QI9B 4PB9H 3PV7A 2E8ZA 4LCCB 2IBZY 3LEVL 1BECA 2DAVA 5L7XL 3OKMB 3WN5A 4GRLC 4UU9A 3FTGB 1YEJL 3JWDH 1JCKA 1S9WA 1YEKH 2Q76B 5EU6D 4BSVA 1FFPB 1MVUB 5JOFB 5F7KC 5D7IB 1OM3L 4XAWH 4XP6L 5IQ7H 2Q7NA 3QUMB 3HTLX 5FUCE 3WHXB 5BXFA 2BOCA 1BWWA 1FGVL 2X1WL 2IPKA 4Z6AT 3RWDB 4GW1B 4HS8L 1DN0A 1OAKH 1WFUA 4XP9H 2H26A 5DJCB 5D7JA 3G6JF 4XMLH 2JJSA 3KJ6L 1X5ZA 3AM8A 3KWWB 2D4FA 4JFXA 1JZ2A 3VWKC 1NCAL 2R0WH 4F15B 3JTSB 3JWOH 4ZUTA 3FO2A 2VR5A 1OAUH 2H2PD 1IEBA 5CILH 4HJJH 2KDGA 3A6OA 2GSGB 4C83A 3VXUD 4FP8H 3TIEA 1MFDL 1LK3H 4G8FB 4U1HA 2YC1A 4HC1H 4PP2A 1OQXA 3QRFM 4G3YH 2QKIA 4P4KD 4HFWA 1GRWA 4OZIE 2R1WA 4LCUA 3OZ9H 2IALB 2DM2A 1L6ZA 3L3KA 3P9MB 4QOKD 3TT1L 4MD5B 2Q87A 5JDSA 3HKFA 5C08D 1NQBA 5FYKE 3HR5B 4GLRH 2GEEA 1UZ8A 1Y6MR 4K8RL 4W4OC 4PRIE 3DGGA 2YS4A 1SJHA 4K9EL 1KYOJ 5KVFL 5DEGB 4TSCL 4KVCH 5TH2B 4M6AA 3BKCH 1A6UH 4MX7B 1L0QA 4RDQG 5C6TH 2OSLA 2VZTA 1D6EB 4P9MH 4Y5XB 4EI5B 4HMEA 2A9ML 5E6ZA 3TGXA 1CICB 2DIJA 4JDTH 2CH8A 5DJYA 4PJ7F 2GHWB 4MYWB 2VLJE 5ITBH 4ELKB 5ICXA 4PUBH 1HXMA 1Q9OB 1Q0XL 4BKLB 4DOHE 5IW6A 5DZNA 3REVB 5ANME 1KELL 4UDUA 3F5WA 3SJVB 3KYKL 4YNYB 1ES0A 3OWEA 3KPQA 2MSPA 2NR6D 4S11A 2B0SL 4MA7H 1KLUA 3VH8A 4KVNL 4JY6B 2B4CH 1N59B 3NCJH 1HCVA 3GJFH 3ZKQD 4HH9B 1U92B 2Z31B 3EKCA 5E8OA 2C1PA 1X7QA 3D3VA 3O8XA 3IFOB 4XXDB 5CCKL 2NXZB 2X1OA 5DMIL 4Z76B 1NAML 2IAMD 4HKZB 4X8JA 1V3JA 4PRPA 3HI5L 2C4FT 4GG8B 1WISA 4PS4H 1DQML 3EYSH 2IMNA 2B1HL 3LPGA 3RWFA 2DOCA 3MRRB 2WQ8A 3SKMB 1PG7X 1KENH 1ADQH 4TYUA 1FH5H 3CX2A 1RULH 2XI9A 2FECL 5CZXC 5I8EA 2EDTA 3FN3A 1R3JA 1RPQA 1MRFH 5I6XC 1F2QA 2NTSP 3C09B 4O4YL 1R0AL 1RZ8B 4LSTL 3VGEA 1YMMA 3DVFA 4MDIB 4Y16A 4DZ8B 4PJGF 5C0BE 43C9A 4M62H 1OSPL 1PBYA 2XQBL 4UV4L 3INUL 2JELH 3EYVA 1KCUL 1F00I 4NM8L 5IBLD 3IXTA 4IOFC 3QCUL 2XN9E 1XZ0A 4OD2B 1XH3B 3ARBB 1VA9A 4M9PA 5L88H 1UJ3A 4ERSH 5TE4H 2IF7A 5D7JD 5BVPL 1PY4A 3QUML 3RX5A 4PJEF 5IESL 3SHSA 3BRDA 1YPZA 3ESUF 2WUCL 2JB6B 4UDTB 1U8QA 4OCSL 2DMCA 4YHNA 5KVGH 4YXHL 1WICA 5F9JB 4OTXL 3HAEG 15C8H 2IQAA 2VAJA 4TQEL 3MRGB 3MRFB 5E9DB 2V2TB 3V7MA 4PJ5B 4ZFFA 5IMMB 4ZPTB 1MCLA 1GZQB 1KEGH 4TVSa 1KULA 2J8UF 2UZXB 1TJGH 1BVLA 5F1IA 2DQDH 3DJ9A 1GJIA 2P4AB 4NPYB 3SKOB 3EYFA 2VLRA 4PJ9C 1E4XL 1W0VB 1WZKA 3SGEI 4ZPVA 5ADOL 2R2HB 3GMNB 1P4IH 3IJYA 3KPRA 4XHJD 3KPPB 2KQNA 1FYTE 5KZCD 3BW9A 4YDJA 3MJ9L 1BVZA 1TCMA 4BH8A 5K9OA 3NIGF 4NO2A 5H37G 1EHLL 4HUXA 5I66A 2IG2L 4XPTH 1LGVA 4L8SB 3S9DB 2LV4A 2X5PA 3KPLA 4UT7H 5I76B 3P73B 1J0ZA 1TQCB 3EHBC 4P2QB 3ZDYE 4I5BA 2ZJSL 2BHZA 4JVPA 3ULUC 1TZHB 3FQNA 3TPUB 3UCRA 3O4LE 1MHEA 1UXWA 1BAFH 4ODVL 3OR6A 4OB5L 1M05A 5TQ2H 1DQQB 1G9NL 3ARGB 1OGTA 2FRGP 5EFIA 4PG9B 1L0XA 1YN7A 3SBWC 1FQ9C 3U9PH 5KJRL 2QQKH 3MRIB 1D9KA 1JGEB 3NPSC 1LD9B 4Y88A 1K9TA 1UWEL 5F1NA 1DVFB 3BISA 3BQUB 1S5IH 5D2LA 3TT3L 3WFDL 2OLDA 3G6AA 4IDJH 5DDHA 3X13B 3NIFE 1L4IA 1Z2KA 2AK4A 4NKMB 4OFPA 3D6GA 5IW1B 1V7NH 1OB1B 3KLHD 4LVNB 4HGKC 4YAQB 4H20L 3O8XD 3QH3B 4M7KL 2MWCA 1A9EB 3H42H 1YNTB 3MV9A 3Q6FB 3R1GH 4WUUB 1Q0XH 3PWVB 1XMWA 2ITDB 1PKQE 2DQGH 4LPCA 4PRPD 5DLMH 3S3SA 5C3LD 1T1XA 1KF9B 4JLRA 3P4NB 2YK1L 1KELH 1MHHA 2F74B 3RZCA 4U3CA 3CVIH 1RV6X 4M3JA 2DQFA 2VH5H 2EIBA 1KC5L 1A7OL 4XNZC 3TESA 4KVNH 4LEXH 4XXCC 1YMHB 1A6ZB 3OKMA 3QZWA 1Z6JT 4M7LH 1A47A 3FTGA 1PX4A 2X4RB 4N5UA 2NMSA 4GSDL 3BAEH 4F33B 2Q76A 4WWKC 1FFPA 2ZSWA 2X70B 3Q5YA 4PJIF 3VRLF 1MVUA 4E41A 4OD3H 1CDJA 3HMWL 2Y25A 3VXME 4LSVL 4FQCL 4KZDH 3N0PB 1EEYB 2QSCH 5CBAB 1MRCL 3WHXA 4GAGH 3FFCB 2Z92B 2P8PB 3NAAL 4NQVA 1I75A 1XIWC 1N64H 4NWUL 4UIKH 1WUNT 3HMXH 5DJCA 1D3CA 4JQXC 3PWLB 4LIQH 1MFNA 1EV2E 5KVEL 5FM8A 5EBWA 1XF2B 1N2RB 5FUCC 1CZ8L 1RZ7H 4HK3N 3ILQC 4EZMA 4KHXH 4EXKA 1BHGA 4CN6A 4XPFL 2YD6A 5D8JH 2AEWA 4CU6A 2CPCA 3MGAA 4OCXL 6FABH 2GSGA 5DWUL 3P3YA 1AR1D 5E2VH 4FQHB 4QRRE 4G8FA 4I0PC 2YA1A 5IBTH 3UBXB 1CGSL 3BIBX 1UYWL 1I9EA 1P2CB 4K8RD 4TULH 4UBDD 1Z9OA 2IALA 1T03H 3S97C 5CFHA 3P9MA 3NFNB 2VO5A 4MD5A 1ZT1B 5JMOC 5DJAA 1RIVH 1YNKH 2VLRD 1FHGA 3NZHH 4HJ0D 5IESH 3HR5A 3P4MB 2DQJH 3BH9A 3KPRD 2AV7B 4I77H 4X99A 3PXJA 4OLUL 4OTXH 1BPVA 1N0XH 4U1MA 5DEGA 3SO3B 3ZDZE 4P46D 2DQHL 4Q58C 1Q0YH 4M43H 4XNUH 1CQYA 4TSAL 1D6EA 1U0QA 1FZJA 5DJ0B 3QQ3A 3V5KB 1UQSB 2O5XL 4XNQA 2QADB 1JGUL 3G5YB 5B3JE 5EO9B 2IBBA 1X5FA 1HK6A 3MLVH 4OGZA 4WW2B 1J5OH 1Q9OA 5ETUB 1RFDH 3DRTB 4MXVF 5C0CB 3MRHB 2Y6SC 4YNYA 2F53D 3QHZH 4NHUA 2PYFB 2BNQB 5I17B 2P5WD 1D9KD 4HWZB 1WLHA 2HT2D 1IGFL 4M7JL 1AGFA 4JY6A 4XP1H 3T1WA 1UADC 1BBJB 1RZIB 4HH9A 3RWJA 2Z31A 4YPGB 3L5JA 5F6HJ 3LN5A 3W2DH 1T1ZA 3BMVA 4KQ4H 4MSWB 3NCYP 3P0YH 4NM4L 4PJHB 2N56A 4Z76A 4GG6B 1MJUH 4LPWA 4IS6B 3TJEH 4OFIA 2OTUB 4S1QL 4GG8A 3BD3A 4TUJB 4KY1H 1F4YL 1MH5B 1OW0A 1VDGA 3QXVA 4HFUL 3RZCD 1U3JA 1GSMA 3MACL 2F9BT 2ZUWA 3SKMA 1Q9KB 4XP4L 2HN7A 5DQ9B 2X9WA 3DX6B 1AY1L 3CDCA 2R2CA 1ZEAH 5TE6L 5CEYA 1ZHLB 3S88L 4RFOL 3W39A 3NCFB 2MPAH 3V7AE 5MI0B 4CVZB 4CJ1A 3V9FA 1BBDH 3CH8A 2EZ0D 4MDIA 2NZ9C 2WINB 4B7LA 5EU4B 1KIQB 2EXYD 3D39A 3QCVH 4XRCA 3U48A 4E41D 3EOTH 3MCKA 4MXWL 4M7KH 5T3ZE 4WJ5B 2AEIT 3HG1E 2CLVB 2YOCA 5EZOL 1CGVA 3RGHA 5IVXB 2HKHL 3TBSB 1CLOL 2CSPA 1YECL 5DRWA 5L2KB 1HHGB 2C1OB 4OD2A 3JBG7 3L6FA 1XH3A 1AQDA 1PLGL 4DN3H 2XTJB 3K1KC 5E5MA 3RDTB 5F1KC 3ARBA 1GVIA 1I9RH 3FB5A 5IJVB 2P24B 3EO9H 4LHUA 1HN1A 1KTDB 3GZKA 5EA0H 4GRMB 3C5JB 3CZJA 4LU5H 4ODWB 3JXAA 1J87A 2ZNXA 1TTUA 2JB6A 1FG9C 2VXVH 3DBXB 1JPSL 4YFDB 5F9JA 1ZMYA 4PJDB 3SDYH 4PRBB 1NBVH 5JOPD 1FNHA 1I1AB 2FX9L 4M1GH 1U8IA 2NW3B 3MRFA 3MRGA 2H2SD 2VDPL 3NIDF 5KG9A 2V2TA 2VLJA 4PJ5A 4ZFOB 5E56A 1VADB 1T04B 1PYWA 4ZPTA 4JPVL 2DD8L 3SDCC 5I1HL 4YFEA 1A14L 4K7PY 4WFHD 4HWBA 4WFFD 4BQ8A 2EEBA 3BEVB 2IH1B 5INDA 3QCTL 2JCCB 5GXBB 3QRGH 4NPYA 4WI2A 5CGYC 3SKOA 3O0RH 3THML 1W0VA 2WAHA 1S9YB 5DT1H 3V0AC 3T09A 2R2HA 5GJSH 4XBGA 2ZWLT 4OCRL 4BSJA 1RSFA 5IVOA 4XPFH 2V5MA 1DEEA 2FNBA 4FQQB 1CFSA 3HNVL 1K3IA 5GZNC 1DUYA 1VHPA 4Z0XA 4U6XB 4L8SA 4ZD3L 4LAQL 4EUPH 1E28B 1EZVY 2IBZX 1N8ZB 4F2MA 3RPKA 4NZRL 4P2QA 1RMFL 1B4RA 4X6BA 4Y1AE 3MCLH 4EI5D 5DJ6A 5BJTB 1R3KA 1YEGH 3I6LE 1TZHA 3TPUA 1CICD 1NGYA 2VZOA 4ZTPH 1BLNA 3DETC 4RGMC 5LAXB 5IEKB 4S2SB 3SKUD 3BEWB 4P9HL 3CMOL 2EKSB 3KYMA 1DQQA 4F7MA 3HS0A 2X2YA 4OIAA 4PG9A 1AFVH 1I7TB 4E0RB 3C6LC 3SJVD 4XPBL 5DSCB 3Q5OA 1JGEA 1PDKA 4K71C 1LD9A 3TLRA 4P48A 1DVFA 4MJIB 4YXLL 2DQHH 1KN4H 1KTLB 3X13A 3B83A 1A4KA 4PV9B 3ZT6A 4NKMA 2MTPA 2Z31D 1KJVB 4WFGE 4CL7A 5GSRA 3V4UH 1U8JB 2W59A 5GIRB 3QH3A 2NXZD 3LV3A 1YNTA 3Q6FA 3SKNA 3PWVA 3LAFA 1T7XA 1JGDB 4NO5A 4U6VL 4F3FB 4JPWH 2F74A 4S10A 2H8PB 4NZTL 4O02L 1Y6KR 3LS5L 4KRNA 1CD9B 1FNFA 4Q9BA 3PDOB 3SN6N 1OTUD 3IDGB 3GSNH 1A4JB 4YWGL 5IMOB 1AQKH 1A6ZA 1AR2A 1EXUA 5GHWL 1V7MH 2BNUB 2CIKA 1VCAA 1J8HE 5DJ2B 3IRPX 2CDFB 2A6JB 4HGWA 3O6LH 4Y4KC 4BK4A 3BSZH 1REIA 3QAZB 2X70A 3DURB 1JWSB 1WIPA 3NPZB 3D39D 2RFXB 4TNWF 4W6YB 2H41A 1NMCB 1D5MA 5K9KB 4OV5A 4KJPD 5CBAA 1KJMB 3LKPA 4L9DA 1XGUB 3FFCA 4GRWF 2Z92A 4W6XB 1UACL 2WP3O 3BKJH 4PGDB 1VFOA 1FYTA 4C56B 3ARBD 4AT6A 3Q1SH 4TOYH 3RJQB 3C60B 5FK9B 3PWLA 5I1JH 2ENSA 4AQOA 1IEAB 4O5LL 5HDLA 2LFGA 4Z7VE 2WV3A 1XF2A 4OIBA 2AV1B 5C8JA 1B6UA 1EAJA 4RFNC 1I8KA 4UOW1 2X1XR 1T2QL 2QQQA 2NNAB 3GK8H 5CP7B 1TNNA 5TFSH 4WV1B 4NN7B 1JBJA 3QIWB 1I4FB 4IHOB 2JE8A 5GGQH 1MREH 5CIPH 2L4OA 3QWOB 2X7LB 2E27L 4N8CH 5E9DD 4FQHA 4PG2C 4EI6A 4GXVL 4PJ5D 3UBXA 4KJWD 5C0AE 2GT9B 3WIFB 4M8VA 2HJKB 4X4MA 2XIDA 4L4VE 2DN7A 4WO4C 5I1CL 4E5XB 3VXRE 2FZ3A 2CKNA 5FYKU 3BKMH 5EH1A 3MRDA 4JAMB 1DCLA 3ROOB 1G6RH 1HDMA 3CJJA 3NFNA 1ZT1A 2LE9A 1EJOH 3TIDA 4ZFOL 1YQVL 3GRWH 3DVGB 5EPMB 3P4MA 5IB4B 3QPXH 5CD3B 3CU1A 1S8DB 4DVRL 1TJIH 4XTRD 1TDQA 2AV7A 1R24B 3KJ4C 3P11H 3TEUA 2MFNA 4P5KA 1SY6H 1I3RA 5KW9H 4G8GB 3PHOB 5HSFA 3NMEA 3DUHA 1XF5B 2B2XL 2JB5L 2HG5B 5HYSG 4U1NA 3DRQA 3QG6A 1KN2L 3UC0L 1G7PB 4UT6L 2IPTL 4P2QD 4NO3B 5I1HH 4W68A 2E9JA 3V5KA 1H3UA 2WBKA 1OF2A 4W70A 5JLZB 3GJFK 4Z0BH 2PO6A 4X4ZA 1CDIA 5EO9A 2YPLB 1NUFA 2VR4A 3MXVL 2F8XC 4Y7MA 5GSVA 3DXAB 4OZHE 2PCPB 4N1HB 4XMPL 5ETUA 4M6MH 5C09B 3SDXF 5C0CA 3ARGD 1EIBA 3TZVB 3EYQC 3TNNB 3PABB 1ZANH 4JB9H 2LVCA 2PYFA 1VGEL 2BNQA 4X8XA 1D5ZA 5HVWA 5I17A 5EOTB 5I71B 4HK0B 4ZS7L 5J11B 1RK1B 1DVFD 1KV3A 2PF6A 3AGVA 3BQUD 1BBJA 1WT5C 3MV8B 1RZIA 4LPVA 3IDMA 2ZCLL 5FF6B 2F58H 5LCVL 5FDYA 1TQBC 5GS3A 1W8NA 4MSWA 4PJHA 1XCQB 4EOWH 4XWGL 2EC9U 4HIHB 1QP1A 4PG2A 3CLEH 4WUUD 2D0GA 2OTUA 4G43A 2ADFL 5FKAB 3TBVB 4HD9A 1LMKA 4WO4A 4M7ZB 4Q74A 5D93C 1FO0A 5DQ9A 4C59B 5CMAA 4WCYH 3DX6A 1NFKA 1MPAL 4FMKA 5HVGB 1CE1L 4NDMB 1W72B 1T0NB 2EEDA 1ZHLA 1AGEB 3CVHH 4KAQL 2ED9A 1RIHL 1UEMA 3WLWD 2J4WL 3H3PL 4JRXE 5KN5B 4QRRA 1WITA 3QIUC 3DVIA 2UVFA 1KOAA 2FECI 4PRNB 1JYWA 4MAYC 1KIQA 4NP4L 3BZEA 3BP7B 3QR2A 1UFUA 2IPUG 1FSKC 3P0GB 2CLVA 4FFZH 3F12B 4K07A 5IVXA 1R5WB 2DDQL 1SEQH 1KPRA 4XCEB 5D1ZB 3SDAC 3W9EB 5FFLA 1HHGA 2C1OA 5IVZB 1HEZB 2D7QA 3FFCD 3QIBB 5E8DH 5ISZE 5DVMA 1ZTXH 3HAEH 3U7YL 1IM9A 2JJTA 5IJVA 1NL0H 2P24A 4HHAB 1SYVB 2C3VB 1GL4B 1KTDA 4OI9A 5CHNA 2P5WE 2APTA 1MCIA 3SQBA 3NBNA 4ODWA 1MEXH 1OP9A 2VQ1B 1U8PB 3T0AA 1SVCP 4ACPA 2UZYB 4RISL 4PJBB 1CL7L 1IARB 5DMGD 3ARTA 4HULB 1N6QL 1QQDA 1TTFA 4PJDA 3TJHC 4PRBA 5GRVK 4PJCB 4YO0B 4WI9A 4NJ9H 1EPFA 5FHBH 1IL1B 2HVKB 1H8NA 5E6IC 1JNNL 1IGTB 4P5TB 3IETB 1FP5A 4N0CC 1VADA 4QXGH 1T04A 3J8F7 2IEPA 4OCYL 2M26A 5ADPL 4ZAKB 4LIQE 1MFAL 4NT6B 3RIAK 5AWNL 3GBNL 3BEVA 5H37H 2NXYB 3H9SB 4P99A 3N1PC 3CFDA 4OLZH 5LXGL 2RAMA 1F11B 1F3JB 1FFNB 1S9YA 5JW5A 1DSFL 1LO2L 2JKXA 2UWEA 2Q8AL 4ZTOH 2DQCH 3VXPB 2IFFH 3C8HA 5FM5M 2XACC 1JZ8A 4FQQA 3W0WE 3WLBA 1E4XI 3CPLB 1JNLL 5CS7A 2R4SH 4LLUB 1N8ZA 1EMTH 1CF8L 3JWOC 4GXVH 4Y19B 5D7IE 3LZFH 1OAYH 2EC9T 5FYLH 1X5KA 1I9JL 4FFWD 4OLWH 4KTYA 3BWUC 3LQMA 3CDYA 2PO6D 2QADD 1YY9C 4PD4K 5LAXA 5ID1B 5IEKA 1MSPA 4NBXB 4QHLB 1HHJB 3FO1B 2YR3A 2ZUVA 3G6DL 3STZA 4OM1H 5DEFB 2QJDA 2HKFH 5C0CD 5T33H 1I7TA 4IRZH 4KK9C 5MERB 4JRYB 4OZFH 5KSUA 4G9FB 2BNQD 3QG7H 1D5IL 4K55A 2V2WB 5FYJL 1MJ8L 1CIUA 1K4CB 5JQ6L 3CFBA 3KR3L 2JJUA 5K33A 2CGRL 43CAB 2V5TA 3MRBA 1L7TL 1KJVA 1HI6B 4Z8FH 4MQSB 4LASL 4WFFE 2BFVH 3WNNA 4NUGL 3RBSA 5GIRA 1FLRL 3MLUL 3UP1A 1MWAB 2QL1A 5TGBB 3NIFF 2LU7A 4TUKL 4D3CL 1FPTH 1QFUL 1NGXB 1JGDA 4G7VL 5IFAL 4F3FA 5DFTA 2WM0A 5H2BB 5HGHA 2H8PA 3MBXL 3TVMC 3F7PC 2NY3B 1VGEH 5C7XH 2J88L 3IDGA 5GS1C 2X40A 4RX4D 1A4JA 5I1IH 1CFNA 4LDLB 4ZS7H 3HI6H 3FHAA 2OI9C 4I4WA 4NWTL 5ESAA 4Y4FB 2BNUA 4G5ZH 3RU8L 3FB8B 5IIEB 5J06A 4X6FB 1IKNC 3R0MA 2C3WA 5DJ2A 3FN0L 3ARDB 3IT8D 3WJJC 4U4BA 2CDFA 2A6JA 4QHNB 3MLPA 2OK0H 1A1NB 1R5VB 1JWSA 5DI8B 5AZEL 4JFDE 3IDYC 5B8CB 1W72L 2DB8A 2IFGA 5K9KA 1C5BL 5A2KH 3BPNC 4RGNE 5LVEA 3RVXD 1KJMA 2DQUL 5F72S 3P4OB 1XGUA 1CK0L 1UM4L 4M4PA 1ORQB 4FQ2L 2PNDA 4NQSB 2XTJD 3RDTD 1NBYA 4C56A 2VUYA 3NTCL 1IM9D 2E9WA 3C60A 5F9AC 5FK9A 4OZGE 3WDHA 4D0BB 5CKAA 4X9IA 5CINH 4CNIA 1WWAX 2FJGB 4Z7UB 2KPNA 4MA8L 2BY0A 5F8QC 4NN6B 4GQPH 1RJZA 2AV1A 5AYQA 1JTPA 4NGHH 4YR6A 3I85A 1ND0B 3KXFE 1FC1A 4PLKD 5JW4R 1QSZA 2WWMC 4WV1A 3QIWA 3QHFH 5KSAC 3MNWA 4MA1C 1I1AD 3QWOA 1TVBB 3IF1B 3QHTC 2R0KL 4U1IB 4YHKL 5J6HB 1IFHH 4X6DE 2GT9A 3WIFA 3C5SA 4ODSH 4KH2A 4P3DB 1QRNE 5FHAH 1IM3B 3HZKB 3ES6B 3B2VL 4KROC 1Q72L 1TZIB 4JAMA 5DRZA 4FQJL 4FTVB 2CMRH 3DVGA 3QDMB 3B5TA 1RZKH 5IB4A 5CD3A 1S8DA 5GRJL 2ZOKB 4CMHB 4N68A 1FVDA 2XKNB 1E4WH 1M7DB 3D87B 4N1CA 1U6AL 3PHOA 3GKZA 1XF5A 1AC6A 1X5GA 4XVSL 1WEJL 1HSAB 1KCVH 2CUHA 2VXTH 4G8IB 5T1LA 1ITBB 3QULA 5CWSB 4OCYH 4D9QD 4XBEL 3NA4A 4LKXB 5EU3B 1KB5H 2IANB 3DSFH 4JGJA 3ZDZF 5JLZA 5ALCL 3MFGB 3GJFA 5E8NA 3RWCA 4JFEB 2YPLA 2ZUTA 3SCMB 4HPOL 3DXAA 3H9HA 3X14B 2PCPA 4RA0C 2PYEA 1CTOA 4XVUD 1SMOA 1LO3L 2A6IB 3CXDL 1DBBH 4M1CD 3MLXH 1OTTD 3PABA 3WCYA 3OG4B 3WFEL 4C57C 4G6AC 1T7VA 4X4XB 4U05A 5EOTA 4Y2OA 4UQ3B 3SGJA 1NGPL 3H7LA 2UUDH 3IRZA 4MJID 4HIXL 1NMAL 4M6NL 4MJ4A 4ELMB 1T4KB 3BN9D 1F8TL 2OBGA 3NFPB 2XZZA 4WNQB 5FAAA 5DK0A 3CLFH 1A7BA 5FA3B 5FF6A 5HD8C 5FGBA 5DURB 3VFNA 4E42B 5EWIL 3ZKMC 1XCQA 1FL3B 3ELAT 4NKOA 1HIMH 4HIHA 5D7LB 4AL8H 2Z8SA 4TVPH 5FKAA 3TBVA 2ATPA 4AEEA 5GGUB 3OJDB 3EJYD 1K5NA 5HY9B 4MNQE 12E8L 4K7PX 3ZE1E 5HDOA 5SX5H 1MWAL 1ACYL 4H1LG 4NDMA 4UBDC 4A6YH 2MCG1 2EO1A 2HT3D 4K23L 4K9EC 3PHQB 4U2YA 4EBQL 4L3AA 1ZXQA 3RNKA 5JORB 1UCBH 2YUWA 1NCCL 4PRNA 3FQXA 5HHNA 1FGNL 4MA3B 2VDOL 3BP7A 1BJ8A 4CU7A 1T83A 5EORL 3VFRA 3LKSB 4XCEA 5D1ZA 5F7EL 1EZVX 3E6HA 2OJZH 3W9EA 5IVZA 1HEZA 1URLA 3T2NL 3QIBA 4H25A 4IRSB 4NKQB 3O6FB 2H9GB 3VXSB 3TYFB 1KBGH 1PEWA 3T0EA 4C56D 4KHTL 2F15A 3TYGL 3C60D 5JHDB 1F90H 1EHXA 1YEFL 2XNAB 2BX5A 4H26B 3UZEA 2VQ1A 1U8PA 1AXSB 3FN0H 5C07E 3GMQA 4YEFA 3FT2B 4HXAH 3V6OA 5J0BA 2VC2H 5J8OA 1PFCA 3V5DB 3RZWA 3BRFA 3QIWD 4QXUH 3MLWH 2APBA 4PTUA 4PJCA 4YO0A 2YD2A 4ONFH 5DFWH 3TNMA 1IL1A 2HVKA 3WUZA 4P5TA 2KUTA 1IGCH 4RWYH 3IETA 4WUUE 3SE4C 4OZHA 3U46A 3GKWH 1MI5B 1TZGL 1A6AB 1I8MA 4ZAKA 4X5XB 4NT6A 1DANU 2ZCHL 4R96B 3NA9L 4YDKL 2WBJC 1OY3B 4G9DA 3S34L 1FAIH 4JG0H 3DWTA 4KXZH 4XMKH 3H9SA 1MF2L 1MCNA 4KRPC 3OAYH 4U1LB 2ICWA 1IAKB 3VCLA 1F3JA 1IGMH 3ALPA 1WWWX 1FFOA 1NSNH 1R3LB 5E08L 3PHSA 2VMFA 1X6LA 3DECA 4BQBA 3S4SG 1NKRA 1CWVA 2AJXH 3HI1B 3UBXI 3CPLA 5D7KD 3GSQB 4LLUA 1AI1H 3ZDXF 4DGIH 3QI9C 2I5YL 2BSTB 2APFA 5T1LD 4LCCC 1AXTH 3FB6B 3KPMB 4M6OL 3TO4C 4QRUB 2CLRA 2YPLD 3QEQE 4L29B 4AEHH 4FQJH 2EXYC 5FYJD 4BA8A 3DXAD 3VXNB 4FXKB 1OVZA 3WL9A 4JRWA 4JRXA 5DEFA 3UTSE 1T2JA 1AJ7L 3VD4A 4U1JA 3WFHB 3TZVD 4PY8J 2R29L 4G8EA 1CXFA 4JRYA 4U7SA 5MERA 1UENA 2VQUA 4YHML 2NLJB 1NMBL 2EDYA 1KCSL 4NKDA 5GJTH 1K4CA 3MFFB 3U6RB 4KK6C 4DAGH 3CX5J 4WI4A 3CFEA 5IBUB 3QPQD 2RB8A 3QUYB 2P1YA 1SJXA 2H3NB 1RUQL 3DV4B 4X98B 1HHKA 4YHZL 3LN4B 3F7QA 2FHFA 4RQQB 1G1CA 1XR8B 3UX9B 4F15C 2DTMH 5KSVB 1NGXA 1YY8B 5H2BA 2MCPL 3ARXA 3WKML 4HG4K 3WNMA 5T5FH 2A77H 1RZGB 5HI3C 3RVVD 1GYAA 4PIRF 4LLMA 2E5EA 2YZ8A 4L4TA 5IV2A 1QSVA 3CXHJ 1GGTA 5T5NF 4LBEA 1J86A 5EZJA 3ZKND 4PB0H 5IIEA 3T08A 3HMXA 1AE6L 4HBCL 3ARDA 3DMMB 4JJ5B 4QHNA 1GIGH 2GITA 3IFLL 4HCRH 4XCFH 4CU8A 3O3AA 2NY7L 3M17B 1R5VA 1M71A 5DI8A 1OAZL 4ODUB 2P5EE 2CRYA 2N7BA 1XEDA 1LO4H 1IAIL 4LP4A 1YJDL 2JLLA 4DTGL 4BQ6A 5D1ZD 1EFXA 3PNWA 4PGCB 4DEPB 4F37K 2UY6A 1AO7B 3QIBD 2HTKD 5D1QC 3V4PH 5IG7B 5AD0A 1F42A 4GAJH 5D70H 3T0ED 1F4XL 4Y5XC 4D0BA 4JKPL 5FM4A 1QLFB 1CICC 2WIIB 3VGHA 4RGNC 3UJJL 3WXWH 2MNUA 4JY5L 2Y7QB 1ND0A 1ZA6A 2J6EH 3AAZA 3I6KB 5EORH 4X6CB 1TVBA 4Z7VF 2R0LL 4YGVB 1WWCA 3IF1A 4GG6E 3SE9H 4RMQA 4P5TD 5J6HA 3N06B 3WXVL 3ZYIA 2AJUH 5KAQF 3VXQB 1M7XA 2D3VA 1LHZA 3ULSB 4ZAKD 4P3DA 3HC3L 5IFHH 3K46A 4OI8A 3ES6A 2R9HC 5A1AA 2DRUA 3IXAB 2Y4SA 2RR3A 5JUEH 5BS0B 3TYGH 3H9SD 5TDNA 4G6MH 5I75B 3O11B 2NXZC 4XC1L 4FZ8H 4GS7B 3D0LB 1RZJL 1NKOA 2XKNA 3HC0A 2IH3B 1M7DA 2C7UA 2RCSL 4OQTH 5FGCB 1AIFB 5FGRA 3S36L 1DBMH 1OTUC 2I9LA 2E9BA 5CWSA 1G1YA 3DARA 3HE6C 4LKXA 2IANA 5EU3A 4XZUB 1C16B 2ZCHH 4WVRA 1YEEH 5L2KE 4FG6C 1EAPA 4LSDA 4X9BA 1Q94B 1EO8H 3C09C 2GJ6B 4YXKH 1JTOA 1YYML 4DVBA 4TTDC 3RI5K 5FV1L 3SCMA 1PW3A 2Y36H 2GTZB 1GGBH 3X14A 1B0GA 2X10A 4JFYB 4JFQB 4PGZA 3X3FL 4RMVA 2WBWB 4HIIA 1J1OH 2DBLH 5D1QA 4JN2A 5FYLE 3G5VB 4JRYD 4G9FD 4X4XA 4YK4B 4UQ3A 3HR6A 4GW5B 3UTOA 3O41B 4ELMA 3NFPA 1C12A 1S3KH 3GGWB 4WNQA 4B53A 3DO7A 5FA3A 1FE8L 3CVHB 3GSVB 4LSUL 2VIRB 3BE1L 1KGCE 3VDAA 2VDQL 5JW3H 3BVNA 3KLSA 5DHXB 2N4IA 3E0GA 1T6WA 2ICEA 4YBQC 1T5XB 1UGNA 5D7LA 4OZGA 4K3DL 4L8BB 2JCCE 2PR4L 4JFFE 2GSIB 4L9LB 1YQ2A 3P30H 2HAZA 1KJ2B 1TCRB 3JVGA 3MLYL 3OJDA 3IB4A 5HY9A 1FL5B 2NY3D 3PJSB 4LMQI 3N85H 4P5MB 4EEEA 4J7RA 4L4TD 1EERB 1H3TA 3EFFB 4JFHD 2IBGA 5JIIA 2DQEL 3IGAB 2AABH 4Y4FD 2E7MA 2F8OA 2VLKE 4AMKL 2AJVH 5F71A 3ARDD 3PUCA 5JORA 1T89C 1FBIH 4PJFB 4UT9H 2R2BA 1VKXB 4D0CB 2O5ZL 4KTDH 2R39A 4DKEL 4HF5L 3LKSA 1JF1A 3EAKA 5KSBB 3GI9H 5EUOE 1B0RB 2FGZA 3RVWD 4M5YH 2EEAA 2RJMA 1TQCC 4OCNC 4JDVB 2Z4QB 5SWSB 3TA3C 1BQLL 1OSZA 3LKOB 1S7XB 2XNAA 5FOBA 4NNYB 2XZCH 1ED3B 5KS9B 5HHXH 2EYTA 4X4YA 3GHEH 3FT2A 3TFKD 5J3HC 4PGBB 3OKOA 1LO5B 3MA7A 3IDJA 1BQHG 1TPXB 5DF0A 2R8SL 4XC3H 1RVFH 3L7EA 1PVHA 4HUUB 4LCWE 5D2LF 4UILL 5ESQB 2QHRL 1T0PB 1CL7I 1MI5A 2FD6H 3LS4L 4ZMAT 5ILTH 1K8DB 4X5XA 1U3HC 3BQUC 4ZDHA 3U4BH 2WANA 1GPOH 5IROA 5EIVA 5C2BL 1FVEB 3DHJA 1T21B 3E6FB 3P9WB 3NACL 4FFYL 4U1LA 1IAKA 4FTVD 2ED7A 3QDMD 5ALBL 4P49A 3UJJH 1FNEB 5CSBA 1C08B 1MHPH 5F6IB 4MAUL 2X9XA 4GLRI 4WEBL 5BO1H 5I74B 1UC6A 4QCIB 4UAOB 5EN2B 5EG6C 5M94B 1MFBL 4U1GC 4KDVA 5C0JA 5LGKA 3GSQA 2EYSA 3QT2A 5LWYL 3B3IA 4F7EA 5J13C 4HUWB 1INQB 3GIVB 3KPSE 3G5ZB 2QR0B 2IAND 4JJHA 1QA9B 3FB6A 3KPMA 4P2RE 3D0VB 4MNQA 3IDXL 4ZUVA 5D7IF 2MKLC 1QFHA 3ULVH 4L29A 2B8OT 1D5BA 3SCMD 1D6VL 5IWLC 4KK5C 2YMXL 5IW3A 3VXNA 2ERJB 2B1AH 2VZSA 5INCB 3WFHA 5CEZH 4V1DB 2NPLX 4HH8A 1MJJB 3B9AA 4ODXB 1AGBA 3GO1L 4Q97A 2NLJA 4Z77B 5BZDB 2VXQH 4OSUH 5HI4C 5IJKC 2WUBH 1CDYA 3MFFA 3VFOA 4KUZL 4XT1C 4JO1H 1ZT4A 3U6RA 4M7LT 1T1YA 4P3CL 1CGTA 1QACA 5IEHB 2HVJB 5BV7B 4R8WL 4LKCB 2XG5A 4MDJB 3QUYA 1HNFA 3FZUD 5DURD 1HNGA 4X98A 3FKUS 3ILPA 1XGYL 1ZGLM 1HYSC 1QG3A 5KSVA 5D7LD 3IFNH 1YY8A 1X4ZA 4X0KB 1PG7H 5C07A 1IGJB 5DR5H 4KI5D 4O2EB 4IRJB 1RZGA 4NQEB 4JHWL 1F3DJ 1RJCA 1EO7A 3HRPA 1QFWH 4ODBD 5L6YL 3BKYL 1KEMH 4G8GE 1QLRB 25C8L 1ONQB 1IBGH 4EIZC 3LRHA 4OFYA 3MLSL 5DUMH 3O3DB 4TVPE 4LSUH 5HHOB 1VSCA 3M17A 4JVWA 2VAAB 3OKLB 4ODUA 3U30B 1O7SA 5CZVL 3EDJA 5IK3B 1XF1A 2AEPL 3HZMA 4ETYA 4R90L 4HKJB 4NQDB 3PP3H 4YH6A 3OXRB 4OJFL 2BNRE 1P69B 5CIPA 1QKZL 1A0QL 2CUIA 3OSKA 5C09E 3VGFA 5IG7A 4IRSD 3RKDD 4R7DA 3LH2H 2G5BB 3O6FD 4KQ3H 4K94L 4AM0A 5FUOL 3W5NA 3EBAA 3QDJB 4UV7H 1QLFA 2DL9A 2WIIA 4Q6IC 2OX5A 5IMKB 4NHCL 4TSBL 1G6RA 4WW2C 1NFDB 3MV8E 3PL6C 4U1KB 1HWGB 1JHKH 5FOJA 3GRWA 3V79C 4IJ3B 3I6KA 2FEDD 2PKDA 4YGVA 1SY6A 4OAWA 3VXOA 3S6CA 4M61B 3VXQA 1MI5D 5BMFL 3GMMB 1BOYA 3RL2B 3VWJC 5DVKA 3VE0B 1QNZL 1OGAE 2F5BL 5BS0A 5EO1A 4QYOB 1DFBH 2G5RA 1NLDH 2E8YA 1NEZG 3O11A 4B50A 1L6XA 3GFUA 4FQ1L 3I6GB 2CK0L 3Q48A 3BYTA 3D0LA 5JXEA 3RBGA 4N1EA 3WDJA 2IH3A 3QQ9D 2WLZA 2YRLA 4N0UE 3WO4B 1AIFA 1HYRC 4OF5A 1H5BC 1KCLA 3WE6B 5FO7B 3SQOL 4N8VG 2I9TA 1KIPB 1UKSA 2UUDK 5AG9A 5I18H 1U2HA 1FNSH 3BT2H 1T3FB 2VDRH 4I2XA 3HNTL 1OOAA 1KG0B 3MR9B 5FCUH 2P8LA 5DQDL 1B2WL 2K3TA 3O6KH 5DFVC 1KFAH 4MS8D 1BP3B 1IJ9A 4JFYA 4XI5D 4JFQA 1ZLWH 5JNYA 1VESA 4Y8DC 1MAKA 5F7YC 1OP3K 1G7MA 3QFJA 2AJYH 1T7ZA 1LP9E 3T04D 4PJBE 1G6VK 4RIRB 1ZLUK 3RAJH 3LB6D 3RDTC 4WTZA 3O41A 2AQ1A 1YYLL 5GGTH 5SX5K 3GGWA 1OL0A 2R1XB 3MRPB 2G9HA 3CVHA 3GSVA 1JNHB 2VIRA 3QUYD 3V6ZA 4YHPB 2CK2A 4KK8D 2ZCKH 4EIGB 1BQHB 5IQ9B 2D31B 1OPGL 2ADIA 3PGFL 3GSOB 3GHBH 4H1LH 5CLWA 1T5XA 4MNGB 5FUZH 1LDPH 3MNVA 1JVKA 4YFLI 1IC5L 4TTGA 1KJ2A 1TCRA 5BV7L 2NX5E 3VWJA 1IZJA 2Q6WB 2YXMA 2W9DH 5A2JH 1VEPA 2PETA 3WDIA 4MXQC 2AEQL 4PYHA 1QR1B 3BGMB 4R4BB 3EFFA 1HOCB 3EUUA 5MEPB 2AJ3A 3QA3A 2WZPD 2R56L 3NFSH 5DD5H 1G7IB 3MRJB 4K3JL 4AIZA 4Y19E 2XZAL 2HA1A 5AZ2L 5TE7L 3ZE1F 3MREB 3DMMD 3WJLA 5DS8B 2VXUH 1KPUA 4Z78B 4YUEL 1VKXA 1YNLL 3GJEB 1CIDA 1NPUA 1A6WL 1H5BA 3L3DB 1Z0NA 3CDGB 3RPIB 4P0DA 2HTLD 3AC0A 3MODL 2D7TL 2V2XA 3VI4F 4XWOD 5FIEA 1B0RA 1NGZB 2ESVB 1AO7D 3QISA 4LRNH 2Z4QA 4FQXC 5JIHA 4N90E 3O2DL 4KKNA 3HPJB 4GW4B 3LKOA 5JXAH 1S7XA 3BUYA 4NNYA 1ED3A 2AS5M 3FT3A 2E6PA 1JZ6A 1DE4A 4NNXB 1AKJB 3MJ8B 4PGBA 2Z93A 1TVHB 1LO5A 4YC2C 3WD5H 1LE9A 1UH2A 5L2JA 4P4RA 2VOTA 3FONB 4M9OA 4HUUA 1OTTC 5SX4I 2V17H 2AJSL 3K8MA 5ESQA 2X4TB 1J7VR 2D0FA 5FV2A 5JW4Q 5HBBA 4GFTB 2XRAL 1RU9L 5FKPB 4CADB 4WI3A 4LLVA 5AUMB 4K94H 4UQ2A 1T21A 3E6FA 1MFEH 2CRZA 3VFVB 3CZFA 4E9LA 5BS0D 1SM3L 2R4RL 2W38A 2YN5A 2YPVH 5D96B 2NY2B 3Q6GL 4OUUB 4LGRB 4LGSB 3VFMB 1FNEA 1NC2B 2OS7A 5BZWB 1C08A 3U4EB 5EC1B 1H3VA 2W0KA 4NRYB 5JXED 1MRDL 3L5WA 4ODTH 5EN2A 5BQ7B 3HNSL 2BVPB 2FL5A 5E1AA 1E4JA 2XKUA 3OAUL 1T0MA 4OZFA 5GS0H 4KGJA 4WDIB 4HUWA 5DD1L 5EBLA 5CKGA 1CGUA 3GBMH 1INQA 2CJUL 3GIVA 3D69B 5CBEB 1RUMH 1ETZB 2QR0A 1ZVYA 1QA9A 1BFVH 2AQ2A 3D0VA 4BH7A 5JOEA 1E6JH 1S5HA 2GJ6D 3DYOA 3WO3B 5IUSA 3P77B 2BOBB 3C2AH 1VGKA 4Z7NE 5FB8B 3QAZC 4ZFZB 2XY2A 1G0XA 5INCA 1RUPH 2VLKA 1OAQL 3IJHA 4YE4H 5B21A 4MD0B 3FOMA 5JW4M 1EEQA 3QFJD 4R26H 3QDGB 1NANI 4U49A 1PGRB 4ODXA 4S1DC 4F9PC 4G6JL 1RZKC 1MJ7H 1MUJB 4H5SA 4PREA 4Z77A 4JO4L 4LVEA 3G6JE 5BZDA 1DLHA 1MNUH 3C9NA 1IQWL 2GQHA 5CZKA 5EC2A 5IEHA 3SGDH 4RZCB 4MDJA 1JPGA 1QRKA 1U95B 3H0TA 3BN3B 4XBPB 2GUOB 2GJZB 1A1OA 3S7GA 5DQDH 4QKXB 1LE5A 4TPRL 4DN4L 4K2UH 1NAKL 5HGDB 4JY4A 3MRLB 2R69H 1JV5B 3QXDA 4NQTA 4S1RH 3LCYA 3BD4A 5C70A 1F58L 1IGJA 3RUGE 4OT1H 1A6VH 3VI3E 1WQVT 4ENEC 1QLRA 1KSRA 2ZOLB 4OI7A 1ONQA 3VFSB 1IC4L 3CFIC 2GW5A 1NLBL 4QRPB 3CD4A 2X1QA 2NY6C 1G0YR 4JM2C 3BDYL 3LIZH 5IK3A 4PJXB 1KJ3H 2A6DB 3O2DA 4JFEE 5F9OH 3UAJC 4KKAD 4MNHB 2FX7H 2OR7A 2G60H 1L0YA 4Z95L 1N0LA 3RTQB 3TM6A 1IAII 3SDDB 1VFAB 4Z7OF 3FQTA 1S7VB 4WW2F 4XNYL 3U82B 2R56H 4IMKC 4F8QA 5T1MB 5FO8B 2HRPL 1A3QA 5HDQL 4RMRA 1NFDA 4Z7WB 2G2RA 4F9PA 3WUWB 2EDDA 4DGYH 2Z91A 1WIUA 1YNLH 3TZVC 1P4BL 2A6KB 1HILB 2FJHB 5TDPA 1A5FH 1BQSA 4J4PA 2NZIA 2EDLA 5I71C 3AY4A 4UOW0 3AS2A 1HQRB 4LOUC 5J11C 4TUOB 1U8KA 3RL2A 3HE7C 4LPYA 3VE0A 4DGVL 4F7PA 1F5WA 4KI5E 4M1DH 2VDLL 4GG6F 1K8IB 2YZ1A 3O3BB 2DQTH 2VXSL 3EYOA 3BZDA 1I7UB 2XT1B 4JREC 5KTEH 2O61A 4EDWL 1HQ4B 3PWNB 4P57A 4XCCH 2C3HA 3JTTA 1T80A 3CFJB 4JANB 3SGKA 2A73B 3C2SA 4GRWH 4JO3H 1MIEH 1AC0A 2C3GA 4UUJB 3WE6A 1U3ZA 4HJGB 3SE3C 5FGSA 4R2GD 1KIPA 5IHUH 4N0YH 1QD0A 2IGFL 4KTEL 1CLYH 3A6BH 5IB3B 1WCBA 1DBKL 3MR9A 3BGFB 3ZE2F 4JM2A 4J3SA 1A7NL 5IVXF 3VXSE 1KIUA 5C0ND 2EDFA 4HIEB 4IOIB 3WSQL 5F44A 5JHDE 3ALWA 2CDEB 2COQA 3NN8B 5HGGS 4V1DD 5E2WL 5IB2A 1V05A 4BUGA 4DW2L 5GGRB 3VRJB 3AS3A 5HGBB 4HQQL 3HUJE 4LPUA 3ULVE 2IPUK 1JPFB 5ESVB 3OJVC 4NOBA 3VH8G 1MCOL 3AREB 3T65B 1JNHA 5FA4B 2FDBP 1LO0L 2D31A 5IB1B 4YDLB 5KAQG 4AH2B 5T1DL 2BSED 3BPCB 4D0DA 1KCRH 3SO5A 1Y18A 4F9LA 1PSKH 2HJFB 4N5EC 2NY4D 4RMSA 2J8UE 3DIFA 5ERWB 4IRJD 4LVHB 4OZ4A 2CQVA 3GNMH 4BELD 4YDIH 3RVUD 1QR1A 2JCCF 1LEGA 5DK3A 5BRZB 4OLYL 4QRTB 1UH3A 4QY8B 5E8PB 4Y2DC 4LQFL 4O58H 4P4KB 3BOVA 2VRAA 1OT2A 2XG4A 2BRQA 2NXYC 5DHVB 3DO3A 4R4ND 3MREA 5HVHB 3OKDB 1INEH 4QOKB 3RX8A 5HHOD 8CGTA 4NQUA 4UTBL 1OGAA 4KJQD 3GIZH 1ITCA 5T3XH 3RPIA 3OR7B 3SE3A 4NQCB 1ZVSB 4ZO8A 5J12C 1JZ7A 4RRPA 2D7PA 2R0ZH 1IQDA 2W92A 5SWZE 4BSWA 1NGZA 2ESVA 3U83A 3QXTA 2Y23A 3UYRL 4N0UA 3OKKB 3HPJA 2YHGA 3Q2CA 4GW4A 4NJAH 5EUOF 1NH6A 3QDJD 3UPRB 4KKCD 1FL6A 4NNXA 4X9HA 4ETQA 3AMKA 5A3IC 4LGPB 1TVHA 1JE6A 2H6PB 3JSSA 1RAMA 3IVKA 4GXUM 3LMJL 1BD2B 4MLSA 5C9JB 1J05B 4FXLA 1C5CH 5HYJE 5I1LB 1G7JB 4M3KB 3QNXB 3IFPB 4ONHB 2X4TA 4J4PD 3SOBH 1G0DA 5CD5D 3O9WB 3WS6A 4XVTH 4CADA 3X12B 3T4YA 4FNLL 4JFOB 5AUMA 4XGZB 5AEAA 1FRGL 3RJDA 3MROA 1E27B 3VFVA 4XNYH 2DF3A 1FV1A 2DQIH 1TJHL 1RURH 4NO0B 2NW2B 3VFMA 4ZSOB 2EH8L 5BZWA 4IMLA 3U4EA 3QEHB 1UM5H 4FQLL 4NRYA 1GHFH 3KLAA 2PW2B 4GBXC 5DJDB 4LVOC 3CSBA 3HHRB 3MZTA 4Y2DA 3F6IA 4BK5A 2HWZH 1EA9C 2A9NH 3D69A 5CBEA 4H8WL 3HC4H 3KS0J 4PJIE 3VRLE 4DGVH 1QSEE 3UMTA 2EE6A 2P8MB 4JFZL 2FB4H 2Q86A 5FB8A 4ZFZA 1ZGLP 3TPKA 4BSVB 3HB3C 2XFXB 4CRPA 3UTPD 1BGXL 4ZFGL 1JPTH 4MD0A 5E4EC 2XKSA 3L3GB 3QDGA 1NCDL 2DMBA 3L5XH 4MWFA 1P9MA 2XQYG 4CKVX 4ZUWA 1MUJA 4BZ2H 3CFCH 4YHLH 3RVWC 5BXFB 4KKBD 1KYOK 2NY0B 2BOCB 3TCLB 2VWEE 1JZ4A 2IPKB 5F7FA 1WK0A 2VQTA 3MOBH 3O81A 2H26B 4RZCA 5D7JB 1QPPA 2GUOA 2C5DC 4NN6C 2GJZA 3TBWB 2D7NA 3TFKC 2XA8H 3KVQA 4JFXB 5HYIA 4D8PB 5C0IA 4HCRA 5HGDA 3MRLA 4MQXD 1JV5A 1N7MH 4NFCA 1G9EA 2H32H 1QYGL 2XWTB 4H0HB 4C83B 2H1PL 2X4OA 3M8OL 3PP3K 3BJLA 4U1HB 1KPVA 5D71L 4PP2B 1EUTA 4LNVA 1WBZB 3FQUA 4JR9H 4WWID 1X5IA 2ZKHL 3VFSA 3WIHH 4NFBA 3QQ4B 1BEYL 4RAVA 2A1WH 3QZWG 2E7LA 5JDSB 4U6TA 3RA7H 4U33A 5FYJU 4PY7B 2BMKB 1F4WH 3GI8L 3O6MH 1UZ8B 2FGWL 2YA0A 1NGQL 3DGGB 3ARFC 2OM5A 3EGSA 1I7ZB 5SV3A 4MNHA 5CJBA 5A2LH 2EXWD 1QBML 3ZYJA 3FT4A 3HFMH 3BDXA 2ESVD 1QBLL 4WU5A 2WSKA 3EZ8A 3RTQA 1FNLA 3SDDA 1VFAA 4X6EB 4L3EE 2CKBH 3JV6A 1S7VA 2NY5L 3LVEA 2FO1A 3SGEH 1WC7A 4GQ9H 5T1MA 4WU7B 3NH7L 1DL7L 2PXYC 3TO2B 4AG4H 1B3JA 3PP4H 4N0FA 5DJYB 1AKJD 4Z7WA 3H3BC 5CJOH 5ICXB 2L7JA 1X9QA 4I18C 5IW6B 1NCNA 5DC4B 4XX1G 3B9DA 2A6KA 2FJHA 3WKNA 2OL3H 4M48H 3DSNA 1ES0B 1F6AB 1OLZA 2VZUA 3KPQB 4TRPL 4OQTA 3FFDA 1MAJA 5CSZB 3CAFA 3OGOE 1YEHH 4YHYC 3O3EA 2P7TB 5C71A 4NKIL 2RHEA 3G6JA 2QSVA 3O3BA 4LSPH 2NY2D 2C1PB 2F54B 1I7UA 5LQBH 3D3VB 1N5YL 4IM8A 3IU3B 5LBSL 4KPHH 5GISH 4MJ6B 2GK0B 5DZOA 3W5MA 1ZLWK 2AGJH 3LMJH 3CFJA 3DV6A 1HKLH 3FHQA 3S5LA 2FBJH 2GK2A 5J56B 3QUXC 4H88L 4KI5C 1CFBA 2A73A 5MENA 2VN4A 2AKRA 4ZNEA 5F89B 2AJZB 4UUJA 5JZ7D 4W6WB 4XP5H 3HA0A 5HHVH 2QQLH 4R4FH 1J11A 4M5ZH 5I8EB 2DLFH 4Q9RL 3VFWA 1R3JB 2K1MA 5F7DB 5JW4N 4NZUL 4P59H 1YZZA 1DQTA 3FRUA 1RZFL 5A16A 5SWSE 1JGVH 4PRHE 1YMMB 3OB8A 4Y16B 4FA8A 1A7QL 2CDEA 3WFBL 4EXPX 5KS9E 4MHHI 4ZS6D 1I8LA 3QDGD 1UB6B 2C3XA 2MQ3A 3IXTB 4OLVL 4OIIH 4QWWC 4ONGH 5GGRA 1XZ0B 2B20A 3LQAH 3LPFA 1A7RL 5CLTA 1BIIB 1JI1A 1J1XL 4O9HH 1F13A 5ESVA 4FZEL 1VPOL 4PJBF 3UO1L 1FDLL 4OLXH 4GMTL 5E99L 5FA4A 4LF3A 3GSWA 4I18A 3KDMB 4J6RL 1GC1L 4OCLC 5IB1A 3GM8A 4PJ7A 1JUFB 1KT2A 1QFWM 1YPZB 4I3SL 4OGXL 2OXHA 4UB0H 3MA9H 5CJ5A 1RD6A 3VRIA 3RIAF 3ULVC 3KPNA 4OD1L 5ERWA 4GUPA 4JO2L 3G04A 4YPJA 4LSSH 4HS3B 2QQNL 5GZOD 2HT4D 5BRZA 2HFGL 4ZFFB 1MCRA 4QY8A 5E2TL 4MVBD 4RBPH 3MBEC 1MY7A 2J5LC 3N9GH 4RAHA 1A02N 5EIIB 1CI5A 4PGEA 5F70A 4WUKL 3I50H 3OKDA 4QRPD 1JFQL 4LCIL 3T2PA 2YD4A 3EYFB 3VFTA 4IDLA 3CMGA 5DVOA 4F57L 1UM6H 2X44D 3OR7A 4ZO7A 5EOCH 2VR9A 5I30L 3BW9B 3O4OC 4BH8B 5K9OB 3V95A 4XVJH 4JZJA 5I66B 3F7YB 4WFED 3BDBA 4LLAA 2H1PH 5D6CA 4OBSA 3EOAB 4V1DE 3RTQD 3S8WA 3A67H 3PWPE 4YZFF 3ZO0A 4JG1L 3SDDD 5HXMA 4RGOL 3MQIA 1HHHA 5GRUH 2XZQL 3UPRA 2M2DA 2W9EL 3L3HB 3FQNB 3S37H 1P7KA 2ICES 4C54A 3F8UB 3REWB 3B2UC 2H6PA 1BX2B 1DLFH 3OPZL 1BD2A 4PJGA 5D5MB 5C9JA 3FOLA 3OR6B 1BREA 1OGTB 1OD9A 4PJ8C 3V0VA 3VD5A 1J8KA 1MLCB 3QNXA 1QOKA 3U1SH 5ECJE 3QUZC 1I1YA 4WEMB 3TWCL 1ZLSL 2I60L 3GSRA 3O9WA 4U7MA 5F1NB 4UINL 3X12A 4DQOL 3RX7A 4NQEE 4UNTA 3B9EA 1NCBL 2AK4B 1CGYA 4GMSH 4KK8C 4LRIC 4AK1A 2V9RA 4NO0A 4PJEA 2NW2A 3OV6A 4YX2L 3B43A 3KG5A 2A2QT 2W07A 3HRZB 4JN1H 4Y4HA 3BD5A 3MV9B 5J6GB 1GAFL 1A3RL 2PW2A 4APQA 4GAYB 1E4KC 3MBEA 1WAAA 5MEND 1MCHA 1K6QH 4TRPH 4GKZA 4NQDE 1IGIH 4DUVA 4PJ9B 3QZWB 2P8MA 4XNXH 4XAKE 1I3GH 4JPKL 1GXEA 3TP4A 1HZHH 2V7HA 1KIRB 3KYOA 5I1KH 2DI7A 2ZSWB 2XFXA 1QSFA 3O2VH 4KMTH 4E41B 4GRWE 3L95B 1INDH 1FLTX 2YD9A 3L3GA 4IOSD 4XWOC 4Z7NF 5CP3A 4HAGA 3H7BA 4FXGB 1PY9A 3GDBA 3TN0A 4Z7UF 5KVDH 1NDMB 3UTTE 4EQ3A 4G6KH 3TCLA 4NQVB 1IVLA 1S7SB 3LOWA 2VN7A 3DGCR 3EJZD 1NCTA 4JQIH 3ARED 3EYUL 1X5AA 4FMFA 3TBWA 5K93A 5EBWB 1Q1JL 4D8PA 2ZPKH 3QNZB 4MB3A 3QUZA 1H15B 1CFVH 1TNMA 3U9UB 4Y5VC 4HWEL 3NPSB 1RUKH 2YSSA 4LQ1A 4HX1A 2VWEC 3E8UH 4K7PH 4LSRL 4OGYH 1EVTC 3K1DA 2YN3A 2XWTA 2DLIA 1FZMA 5BRZD 3HPLB 3RIFF 4LRIA 1AHWC 1C1EH 5HYJA 1MY5A 1Z9LA 1WBZA 1G9MH 3RUGF 3MGOB 5A40E 5GGVL 3BIKB 3TV3L 1UWGL 3VI3F 1N4XL 4U3XA 3QQ4A 5CJXC 4ZO9A 1QZ1A 5GRXG 3QDHA 4UTAH 3R4DA 4ORZC 5IGXH 2RIKA 1LQSR 5DJAB 2YRZA 1GGIH 4PY7A 4X7SH 2BMKA 3BH9B 3MV7E 1CR9H 1IT9H 2OR8A 4NZJA 4K3GA 4X99B 5F96L 5I1GL 2HFEA 3MSPA 3I75A 4NQCD 1I7ZA 1ZK9A 4HZLB 35C8H 4OCWL 4U1MB 5C0RL 4XNZB 3MJ6A 1FCGA 1VEMA 4GRLA 3K4AA 1EEZB 5F7UA 4JCMA 1CE6B 1XGPA 4X80H 4X6EA 1I1RA 5EOQL 4HS6A 1FZJB 2AXGB 3MV11 1MAML 1MIML 3QQ3B 3BESR 4WU7A 4WWKB 1KTRL 4XNQB 5DA0B 3TO2A 1RIUL 3I9GL 2J1KA 3SDXE 1VB9A 5T3XE 1CDBA 1CG9A 1GGCL 2O5YL 4KUCF 2GFBB 4PJIA 4JM4H 1BD2D 1UA6L 3RY4A 1JIBA 2Z8VC 1M6OB 4TNWK 3W82A 5KVMC 5LJYH 3DI2B 1JHTB 4MNGE 1F6AA 1S78D 4F58H 4NHUB 1GOHA 4BFEA 3O9WD 4LLWB 5L8JB 3PGCA 5CSZA 2ZSVB 2YKLL 1AGFB 1ZSDA 3C87A 3MLRL 3WIIL 3S36X 4WY7L 3UBXG 4JG1H 1Z5LA 4UIMB 4RGOH 2P7TA 3F58L 3RWJB 3VWKA 1J1PH 3LN5B 4ODHH 5ACZB 1Z9SA 1T1ZB 2F54A 4NO0D 4KI5F 3T0XA 4HPYH 2HMID 5IMLB 3IU3A 1UWXH 1SJEB 4MJ6A 4L9LC 2GK0A 1CT8B 2AK1H 2AI0H 4I0PB 1L7IH 5MP6H 4D9LL 4LARH 1T66D 3D1MC 5CEZD 5F89A 2AJZA 3D85B 4LSQL 2HN7B 4Q0XL 4HXBL 2I60H 5CJXA 3X3GL 5I8KH 1RI8A 5DUPL 5CEYB 4OF8A 3W39B 5GGTA 5JR1L 3FQRB 5F7DA 2R1YB 1HXYA 1IRAY 2XY1A 4W4OA 1E6OH 4QHMA 1MCDA 3UDWC 4Y8AA 3RRQA 1HINL 4W81A 5ENWB 4K94C 1QSFD 4OZIB 3D39B 3MYZA 4XRCB 3MCKB 2YD3A 1RHHB 5F3BB 1GAFH 1ZA3A 1UB6A 3L3OB 5HHME 5DRWB 5B22A 4TN9A 5CJQH 1YEIH 1CQKA 2AQ3A 3TN0D 4JZOB 3VDCA 4JHAL 3EDKA 2NY0D 3L6FB 1AQDB 1BIIA 4PRIB 5E5MB 4A2LA 4O00A 3RQ3A 3FB5B 4OF0A 3BZFA 4LHUB 5EIQA 3RY6C 3LEVH 5L7XH 4HBQA 3KDMA 4J1UA 1QBBA 2IJ0C 1FYHB 5GS0C 4NBZB 3RGVC 3HUJF 1YEJH 1JUFA 3ULVF 2K7QA 4L3EA 3I2CL 1TPXC 3ULUL 2ZZUT 3OJ2C 5TF1L 2OP4L 2VABB 1U8IB 1DQDL 1OM3H 4XP6H 5KG9B 4HS3A 5M95B 2VLJB 3IDUA 1QO3B 2Y72A 4DOHB 1PYWB 4MD4B 5ANMB 3MO1B 5EIIA 4D9RE 1FGVH 3FCTA 4HS8H 5INDB 4ZXBC 1BVKB 1HCFX 4QTIL 4DJMA 3KJ6H 3C8KA 5F6IC 4KDTC 4XBGB 5DVNA 5I74C 2DJSA 1CDGA 4X7TA 1A1MA 1NCAH 4UAOC 4C58B 4G80B 3EFDL 3DVNB 1X4XA 1DEEB 1CFSB 2OR9L 1FVCA 1ZWIA 5JDJA 1DEDA 1DUYB 3F7YA 4Z0XB 3S98A 3EOAA 1MFDH 4F2MB 4GRLD 4YQXL 2FWOA 3GMRB 4X6BB 3ZYZA 1XAUA 4I9WE 5MHSE 5DJ6B 3S4SA 1R3KB 5LGHL 1RJLB 3L3HA 3D9AL 1NGYB 5JPMB 4G7YL 1BLNB 3QJFA 3REWA 3TT1H 1WWBX 1BX2A 2BDNL 5D5MA 2OZ4L 1F97A 1SBSL 3KYMB 1R6VA 4F7MB 4K8RH 1E0OB 3HS0B 1MLCA 2XICA 5JHLL 4K9EH 2BK8A 1CD0A 5TQ0L 4ALAL 5KVFH 4TSCH 5C0BB 3RY6A 1B4JL 3MOAL 4G42B 2YWZA 2OTWB 2UY7A 1A4KB 1ZHNB 3UYPA 3U0WL 1MAMH 1WZ1L 4PJAE 3VWKD 4PP1D 3FL7A 2A9MH 2F54D 5GSRB 3D3VD 3HRZA 2DIAA 3LV3B 5J6GA 4DFIA 2LTQB 3O45B 4QRPE 3SKNB 1LWRA 1MCPL 4NO5B 1RJYB 4GAYA 5DD6B 4IRJC 1NBQA 3IU4L 4M8QA 1PD6A 1A8JH 1GZPA 2R2EB 3KYKH 3GSUA 4Z7QE 1I9IL 5EULV 1UB5B 2B0SH 4ZXBA 2B5IB 4PJ9A 1EXUB 5AYUL 5ICYA 4F8TA 4PTTA 2CIKB 3A0OA 5E2UL 3UJIL 1KIRA 1WBXB 4HGWB 2BVQA 1YMMD 4Y16D 3U30C 5CCKH 3L95A 5DMIH 1NAMH 1OCWL 1GH7A 1D5MB 3HI5H 5D2NE 4OV5B 2IQ9L 4M93C 4FXGA 4L1DA 3LKPB 2BJML 1SMAA 1DQMH 2B1HH 1MCEA 1NDMA 2FO4B 2D0HA 3L9RB 1FYTB 1S7SA 5DRNA 3T0BA 4AT6B 5FM5O 1KUMA 4RGMB 4HKXA 3D2UA 1Z3GL 3RVTC 1U9KA 2OQJB 1JZ5A 5FYKL 4X6CF 4O4YH 1R0AH 5C8JB 3QNZA 3SBWA 4LSTH 4I0KA 1I8KB 1H15A 4S0TD 3U9UA 4IJ3C 1A6PA 4K71B 5B38B 1FORL 1OSPH 3LKNA 2XQBH 4UV4H 3O4LB 3INUH 2EC8A 1KCUH 4NM8H 7FABL 1Q8MA 3CK0L 2BY2A 3QCUH 4EI6B 5HTSA 3PQYE 2ARJQ 4BZ1L 5TDOA 3HPLA 3RP1A 3PIQB 2Q8BL 3MGOA 1MHCA 3BIKA 2FZ3B 4WI6A 4CDGC 3MRDB 5BVPH 1HDMB 3MLZL 3QUMH 4KZEL 5K9JL 3TIDB 4K3EL 1H3WM 2W60A 2WUCH 2VDKL 4HWBL 2CR6A 4HWUA 4OCSH 3NABL 4P5KB 4AY0A 4U31A 4YXHH 1I3RB 1XF4A 1BIHA 4HZLA 3L3IB 5EU6E 3V52L 5CZXD 4TQEH 4XXCA 5GGRY 1YN6B 3SE8L 4QRSA 5L8LB 1EEZA 2GAZB 4OM0L 4U1NB 3DRQB 1CE6A 2OZ4A 3QG6B 5DYOA 4GKNB 2AXGA 3WNPA 4WWKA 1OF2B 2JTDA 3A6CL 2PO6B 2VLMD 1XF3B 1A9BA 5DTFB 2GFBA 4XPHL 1YDPA 4HLJA 1C5DA 1E4XH 5GSVB 1V3KA 5ADOH 2OMBA 1M6OA 4N8PA 3QEGL 3U0PB 5B4MC 1XIWA 1JHTA 3MJ9H 1D5ZB 4WTXA 1EHLH 4LLWA 4C4KT 4JQXA 2IG2H 2ZSVA 3VXMB 3FO0L 5HYQA 3VXUE 3MUJA 4UIMA 1U58A 4Q2ZB 3EOBA 5DRXA 4RFNB 2FHCA 2AK4D 3IDMB 1CD8A 2ZJSH 1L9NA 3S35L 5D1XC 1IGYB 3UTTA 5ACZA 4RCAA 1Q38A 5IMLA 2DM3A 1SJEA 2Q20A 2HH0L 4WHCA 1CT8A 2Q7YA 3MV9D 5AAWA 2X4UB 4I0PA 4QOKE 4G43B 4ODVH 3BHBA 3VD7A 4OB5H 5C08E 1G9NH 3QNYA 4KMLB 4UZGA 5DJZA 4WO4B 4POZC 3D85A 4CVWA 2BSRB 5D7SL 1FJ1B 1AGCA 5KJRH 1FO0B 5CMAB 5EDXA 5GS2D 1OAXL 3WHE1 1UWEH 4PJFF 3V0WL 5E03A 3ZT5A 4KC3B 5HJ3B 4PJ9D 3FQRA 3TT3H 3WFDH 2R1YA 1N26A 3GEWB 4QRRB 3EJJX 3P9LB 3KJ4B 5DD0L 4EN3C 5KSBF 5ENWA 3NCEB 4H20H 4XPGL 1F4AA 2HFTA 3BZEB 4OZIA 2BY1A 1RHHA 5F3BA 3CU7A 2K9UA 3L3OA 4HZAA 1KPRB 2YK1H 3B9KC 5JPNA 4JZOA 5KS9F 4PLOB 3U2SB 4PRIA 4XNMA 4LPXA 3ULUD 4HMDA 1IM9B 4RBPK 1IEHA 1KC5H 1A7OH 5I1DA 5CHNB 1MOEA 3AU1A 1K4DA 3JUYA 1H0DA 4AEIL 3PF2A 1BJ1J 4GSDH 2VUOA 1QQDB 3HMWH 1FG2A 5L9DL 2VABA 4FQCH 4LSVH 1QVOB 2C4XA 2XOTA 5IHLB 1X6NA 1R3HB 1MRCH 1QO3A 1QLEL 4MD4A 4LFHD 2RQ8A 5ANMA 1QFPA 3NAAH 3MO1A 1TQBB 5J7CC 2NY1C 3IDNA 4NWUH 2EH7L 1QFOA 1BVKA 3CFDB 1HKFA 5KVEH 1KCKA 4NRZA 5JW5B 1AGDA 4WW1A 4BZYA 1JGLL 3ZTJG 1CLCA 2UWEB 3QXAA 1CZ8H 3AS1A 3FRPA 3ZDXE 3I02A 5D93B 5SWQA 4G80A 1EVUA 3CC5A 3DVNA 1XR9B 3WLBB 1SVZA 4OCXH 3K2UL 4YBLC 5DWUH 5J1TC 3QIUB 4P2OC 1CGSH 2DKMA 3GMRA 2BSSA 1UYWH 1JI2A 5EZIL 3FO9B 4ESKA 4WWKD 2VTFA 2ARJA 1RJLA 1FSKB 5JPMA 5DUBA 1AH1A 4LLQA 2YRPA 2VE6B 2P48B 1MQKL 1NCWL 3SDAB 3STZB 4LLDB 4YHOL 2A0LD 2P49B 2VNCA 4J3WA 5KSUB 4OLUH 5TPWL 5C0BA 1F3DH 4DKAA 1FZKA 3HG1B 1BWMA 3AXLB 3U7WL 2BVOA 3CFBB 4G42A 3QDAA 2OTWA 4TSAH 3IAGC 1ZHNA 2XN9A 3F6LA 1UXSB 5EB9A 3MRBB 2O5XH 3ILQD 3QB7C 5I1EL 4WHYG 1JGUH 3P0VL 7CGTA 3F7VA 3QP3A 3KYNA 2E7HA 3O45A 5E6IB 5D72L 3S96B 1RUAL 2ZUQB 4I0PD 1RJYA 4AIXA 5DD6A 3SDCA 5HGHB 5GGSB 3LEXB 2R2EA 3DX7B 3D85D 4PLJC 1UB5A 4MVBC 4UOJA 1CFNB 1IGFH 4M7JH 4URTB 4I4WB 5ESAB 3ZKXC 1DQLL 1BOGB 5DVLA 1WBXA 3ISWA 4H0IA 3L1OL 1FO0L 3PWUA 4L8CB 4UI2A 3M45A 4NM4H 4ZUUA 3ZKSD 3V6FA 3D5OF 4S1QH 1RK0A 1F4YH 5FYKD 4HFUH 1JJUA 3MACH 2FO4A 5I15L 3L9RA 4XP4H 4PRID 1NBYB 1AY1H 5TE6H 1D5XB 4LHUD 2W9LA 5IFJB 4CNIB 4RFOH 3S88H 3LKQB 2OQJA 5D2NC 1RJZB 1EGJA 4YR6B 5JA9A 3C6LA 4FQPA 2Y6SD 3MMEA 2Y07L 4Y1AB 3X11B 5B38A 3FJTA 4MXWH 3MNWB 3OKEB 4CUCA 5EZOH 3O4LA 1CU4L 3GB7A 4HAFA 2HKHH 3RWEB 2B7DT 2FSEA 1NEUA 1CLOH 1I85C 1YECH 2VLJD 3CSPA 4PRPE 5IKCB 3MUHL 3C5SB 3PIQA 1PLGH 1XFPA 1MCWW 3AFLA 1ULVA 3KHQA 3WBDA 2Q3AA 4ZG1A 5DRZB 3LQAC 1IKFL 4NUJA 1CBVL 4KWUA 4AJ0A 3O2WL 4P23C 1ERNA 4H8WC 3TVMB 1AXIB 1FVDB 1MFCL 1FNAA 3BYYA 1JPSH 3ABZA 3L3IA 4O51B 2FIKA 2F5AL 3C5ZC 3BRGC 1WV7T 2FX9H 1RQ5A 1YN6A 2OL3A 3W11C 2VDPH 2GAZA 2HJLB 5IB5B 1DZBA 5T1LB 3MRQA 1PKQA 3QULB 4JPVH 2DD8H 1BM3L 4GKNA 3BH8B 1H3PL 4Y4KA 1A14H 2ZUSA 2EIZA 1PZUB 2NZ9D 3GJFB 5E8NB 3IDYB 3RWCB 1XF3A 3QCTH 1TITA 5DTFA 3BPNB 4N8VA 3THMH 3H9HB 1UKTA 2PYEB 5GGVY 4I48A 3AS0A 2X4NB 4OCRH 1J8HB 3U0PA 3UJTL 3HNVH 2MMXA 3HZVA 5C0BD 4S1SL 3LN9A 4ZD3H 4LAQH 1R5IB 3QJHA 3VXMA 4A2MA 2XXCB 5E94B 4NZRH 1RMFH 4Q2ZA 2YPKB 5DK0B 1A64A 2XN9D 4NN5C 3DLQR 4Q9QL 1IGYA 5JMRA 4YDLC 3VFNB 5KSAB 4OKVB 3SKJL 2FATL 3JV5A 4MA1B 5T3ZL 4NKOB 5B39B 3EZJB 4P9HH 4QEGA 3CMOH 2X4UA 4K3HA 3CH1B 2H2PC 4PB9L 4PGJA 2VLRE 5KANI 3SDCD 2ATPB 4LVHC 4Z7VB 1GGUA 3LQZB 3MC0A 4GH7B 1K5NB 2BSRA 1FJ1A 1EJ6A 3KPRE 3MRMB 4XPBH 2X05A 4KROB 3JWDL 4HLZG 4YDVA 4P4KC 1YEKL 4YXLH 5HJ3A 4AIOA 5CGYD 3U7WH 1FIEA 1WCQA 2EDQA 3PQYA 3P9LA 3RNKB 5IQ7L 5C0AB 4WRLA 1B6DA 2RBLA 4L4VB 3FQXB 5HHNB 3VXRB 4DKFL 5GZND 2NY5C 3VGBA 3VFRB 1EUUA 3QO0B 1OAKL 4XP9L 4U6VH 3E6HB 4HWNA 4CGTA 2XA3A 4NZTH 4XMLL 4O02H 4K7FB 3LS5H 1T22B 4H25B 3U2SA 1FYTD 3MOQA 2F53E 3T0EB 4YWGH 4MZ2A 3DETD 2R0WL 4JQVC 3JWOL 2BXYA 5GHWH 3K4ZA 3T8XA 1OAUL 4HJJL 1T7WA 3GMQB 5D2LE 4FP8L 1W0WA 2AXFB 4QF1B 1LK3L 3C6LD 4EDXB 4IIQC 3ARPA 4HC1L 3T77A 4G3YL 3U36B 5DJXA 1QVOA 4PTUB 3O4LD 3N1MC 3TNMB 3OZ9L 2AAVA 1XGTB 2NR6C 4DK3A 1R3HA 1S7WA 1WT5A 3MV9E 3NOIA 4OZHB 3U46B 1YA5A 4CVXA 1I8MB 4RNRA 1TETL 1UACH 3TF7C 3J7HA 4G9DB 4HSQA 4R0LC 1C7SA 3Q3GA 5HYFA 1XCTA 2ICWB 3CX5K 4WHDA 2DKUA 3VCLB 2XWJA 3QBTB 4O5LH 4PYGA 2ADGA 4KVCL 3IS1X 2IAMC 3VXUA 1FFOB 3BKCL 1A6UL 1J12A 1T2QH 4YHIA 3GMLB 5C6TL 1XR9A 1T66C 4P9ML 4E41E 2E27H 3ZYOA 3QQNA 1WTLA 2F8VA 4JDTL 3QIUA 2CXKA 3I3EA 5ITBL 4ZOEA 4PUBL 3WN5C 4Y4KD 5I1CH 3FO9A 2X4PA 3CXHK 3MUY1 4MAYA 1UVQB 3EW3B 2CLRB 4MJ2A 1P84J 2BHUA 1G9MC 1YQVH 2VE6A 2DWDA 4MA7L 2WLYA 3SDAA 4DVRH 4HT1L 5EOCJ 3WL9B 4LLDA 4JRXB 2B4CL 5IBLC 2JJVA 4U1JB 4XX1E 3MRCB 1FFQA 3NCJL 1KNOA 4G8EB 3RWGA 2B2XH 4NKDB 2JB5H 5JOPE 2X41A 3VFUA 3HG1A 2ZG2A 3VXMD 3AXLA 2J12B 1WGOA 1KN2H 3UC0H 2CUMA 4UT6H 5D7JC 4DFHA 2IPTH 2EKJA 3IS0X 3CFEB 2JJSC 1UXSA 2OMNA 3E2HB 1CLZL 1Y6NR 2VDNL 3AM8C 5JQHC 4H0GA 1A22B 4WFHE 4PS4L 2Y9RT 5K59E 4JFPB 3EYSL 3OKNA 1HHKB 3RL1B 3MXVH 4BFIA 5E6IA 1KENL 1ADQL 3S96A 4TNVF 1FH5L 2DI8A 4PJAF 4XMPH 1RULL 4ZOAA 1I1CA 4HGMA 4LCYA 1NAMB 2LQRA 4WGVB 2D03L 5GGSA 1JHLL 3LEXA 4WO4D 2WBJB 3DX7A 1MRFL 4LLMB 4ZYKB 1IC7L 4L4TB 5DO2D 5IV2B 4JZNB 4LBEB 4M62L 3L3JB 5EZJB 5ABDE 4PJXF 4X83A 1BOGA 4QRRD 4Z7QF 2JELL 2ZCLH 5LCVH 2GITB 4L8CA 2I26N 3O3AB 1HHIB 1M71B 4XHJC 5DHYA 3BPOC 4XWGH 1O7VA 2V9QA 3WS3B 4JPIA 1FC2D 2ADJA 3T4AB 5L88L 4ERSL 2ADFH 3ESVF 1EFXB 2MKWA 5TE4L 2ORBL 2W0LA 3PNWB 1TMCB 3UTQB 1KLFA 1SHMA 5DQJB 3TO4B 3VGAC 2FIRT 1Y0LA 5AD0B 3SJVE 4Z7WF 1MPAH 4QHKI 5CGTA 1D5XA 4HC1A 1CE1H 1ODAA 3W0WB 4NQXB 5IP4A 5KVGL 5IFJA 4KAQH 1RIHH 3SPVA 3LKQA 2J4WH 3H3PH 15C8L 3L5HA 4Q9CA 5IBUG 3EYQD 1ZA6B 4Y1AA 3AAZB 4NP4H 3S37X 3X11A 1HH6B 4DKFH 1X5LA 3OKEA 1KEGL 3RWIA 4AZ8A 1TJGL 4J2XA 3RWEA 2DDQH 5DMJB 2DQDL 2C4FU 5IKCA 1QEWB 3NCYS 4PRAB 2V7NB 3RHWF 3MUGB 3U7YH 1P4IL 5GRVL 4PP1C 5TDNB 3KLHC 4KMQA 2J2ZA 3O8XC 4XPTL 2KKQA 3TVMA 3V8CA 8FABA 4JGUA 4RISH 1J0JA 1CL7H 2X6MA 4UT7L 3HC0B 2LAAA 4Y5YC 2C7UB 1N6QH 3FQWA 5GS1A 4O51A 1CXLA 5JIKA 5JIPA 3VMPA 3D39E 1NC4B 4NRXB 4U0RC 1QUNA 3B9VA 3VFGL 1JNNH 2HJLA 2CIIB 2I9LB 4BFGA 5IB5A 1IKNA 2MQ0A 3ME0A 3CGTA 5ADPH 3QIUD 4M4RA 3WJJA 4DZBA 3BH8A 1MFAH 1TETH 1S9XA 5AWNH 1EH9A 1BAFL 4CJ0A 5IM7A 1EAPB 3GBNH 5TQ2L 4MAYD 4HUNB 3NVQA 4DVBB 1P4LA 5LXGH 1FZOA 3U9PL 3AB0C 4Y16C 2QQKL 5HDBF 1B0GB 1DSFH 1LO2H 5C0FB 3OX8B 2X4NA 2Q8AH 3SDAD 4LL9A 5E0QA 4HIIB 1J8HA 1S5IL 5D1QB 4X5WB 4JN2B 4IDJL 2D2OA 4Y0GA 4QHUB 3G5XB 3F7RA 1T20B 4POYA 5TF0A 1V7NL 3C6SB 4JFDB 1R5IA 1JNLH 2WIMA 5T3ZD 3HG1D 1CF8H 1ADQA 5ACMA 5E94A 4RGNB 5E9DE 4HK3J 1UJ3C 1C12B 3QO1A 2OTPA 2YPKA 3H42L 3R1GL 5FDWA 4PJ5E 5BW7C 5DLML 4CDHA 1BF2A 3DO7B 1I9JH 2DQGL 5DEZA 1P7QB 3MGTA 3BVNB 5KSAA 4OKVA 2E3VA 3TJHD 3L7FB 3U79A 3CVIL 2G75B 2ICEB 5B39A 4OZGB 3OKYA 5E6ID 3CH1A 2VH5L 3VDBA 1AD9A 1ZS8A 3G6DH 5MEOA 2BERA 4HT1H 4N0CD 4R97B 5E00B 5I2IA 4LEXL 3D25B 1TIUA 1AR1C 4Z7VA 4RSVA 2GCYA 3LQZA 4M7LL 4EVNA 3MRMA 3KXFB 1H8OA 3CSGA 3WNOA 1D5IH 1DDHB 3BAEL 4K8RC 5FYJH 1MJ8H 3IDIA 4OD3L 5JQ6H 1CFQA 4QLRA 2UV3A 3KR3H 4KZDL 2CGRH 4X6DB 5C0AA 1CLZH 2QSCL 5EU5A 1L7TH 3P40A 4HJ0C 4P2QE 4Y5YA 2VDNH 4Z5RA 3VI4E 4GAGL 4L4VA 4LASH 3VXRA 1QRNB 4NUGH 2R2BB 4GKSB 1FLRH 3MLUH 1PAMA 3B6SA 4TUKH 1N64L 3QO0A 4D3CH 4UIKL 1QFUH 2UYLB 4OGAD 4G7VH 3HMXL 4MMZC 5IFAH 1JF1B 4P46C 3HE6B 3MBXH 2D03H 4K7FA 1JHLH 4LIQL 1T22A 1T5WB 3BPLC 3NGBC 2J88H 1IC7H 1YY9D 1RZ7L 1TTGA 2Y5TA 1QTYT 4KHXL 4NWTH 1OSZB 4WTZG 5FOBB 3RU8H 3MZGB 5D8JL 4XH2B 2EYTB 2XYCA 4DKDC 4X4YB 6FABL 5J57B 1ZHBB 5E2VL 1N3NB 2AXFA 2NTFA 4QF1A 3TBTA 3OKOB 2GIYA 3MA7B 3IDJB 4KK9D 4EDXA 5IBTL 4Y1AD 5AAMA 5AZEH 3U36A 1W72H 3I6LD 3L7EB 4TULL 1C5BH 3IJSB 5F9WB 4UNUA 1XGTA 4L8DB 1D9KC 2DQUH 4JKMA 1T03L 3V2AR 2HT2C 3RY5A 3ZTJH 2ORBH 5BW7A 1CK0H 1UM4H 3VW3L 4FQ2H 1RIVL 1YNKL 4EUPB 2FLRT 4HMCA 3NZHL 4ZDHB 5C0DB 2DQJL 3KS0H 1F4HA 3NTCH 5I8OL 4U1SA 4CBPA 4I77L 4WGWB 1DR9A 2YBRB 1N0XL 4MA8H 4CVUA 2EIDA 5TJWK 1WAAF 3TVMD 4MCYA 4HUVB 4XNUL 1Q0YL 4M43L 1I1FB 1CFTA 1EDQA 3GMLA 3RZCC 1UJTA 3BUTA 3GSXB 4WFGD 4FQIL 5C0JB 2I25N 3VU2A 1NJ9B 2Y1VA 1BZ7B 2EYSB 2R0KH 3B3IB 4YHKH 1WF5A 5F8RC 4F7EB 2IWGA 1CXIA 3MLVL 1EX0A 3UYOD 4X9FA 1J5OL 1X44A 5C3TA 4FS0A 3FFCE 1UVQA 1KB9J 1RFDL 3B2VH 4MNQB 1Q72H 1YEDA 2Y5EA 2R23A 5I1AA 4ZUVB 2EZ0C 3MJ7A 1D5BB 3QHZL 3MYJB 3ARVA 4P46A 5GRJH 1I3VA 2PYED 3JV4B 4XP1L 1S7RA 1J8HD 3MRCA 4FOMA 1U6AH 4WHYH 1AGBB 3TA3B 1A21A 1DN2A 2E7CA 3W2DL 3VFGH 3VFOB 2P47B 3ECBA 4KQ4L 4XVSH 1WEJH 1ZT4B 3P0YL 1T1YB 3GSNB 4XBEH 1MJUL 3TJEL 5DMKB 5HHQA 2EDOA 1T1WA 5L8KB 1VFMA 2WWMD 5ALCH 5MEQB 4KY1L 4X4ME 5ISZA 1MELA 4JFPA 1JRHI 3DX9A 3RL1A 5KSAD 1V8HA 2F53A 3ILPB 4HPOH 3BO8B 2P5WA 3VG9B 4WENB 3SE4A 2BZDA 1ZEAL 1LO3H 1NAMA 2H2SC 4MQTB 3CXDH 1U3HB 5C07B 2BVEA 2WBJA 2DLGA 3R06B 1JL8A 2MPAL 4ZYKA 3WFEH 3DROA 4KROD 4MHHG 1BBDL 1NGPH 3H2WA 4JZNA 4OZFG 3L3JA 4HIXH 4XCYB 3QCVL 1NMAH 4M6NH 3EOTL 4OF3A 1F8TH 4AENA 5C0AD 2PTTB 5C2UB 1V3MA 1HHIA 4L4VD 4U1GB 5EWIH 3VXRD 4O2CA 1DANT 4I3GA 4DN3L 3WS3A 3HZMB 1V3LA 1I9RL 3T4AA 5J13B 3QI9A 3EO9L 4Z7OE 2APXA 4LCCA 5FXCH 4F7TB 5EA0L 3KGRA 3C8DA 5CIPB 3UTQA 2WMPA 4LU5L