1OTUD

Structure of the escherichia coli clc chloride channel e148q mutant and fab complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated ClC-type chloride channel eriC
molecule tags Membrane protein
source organism Escherichia coli
publication title Gating the Selectivity Filter in ClC Chloride Channels
pubmed doi rcsb
total genus 47
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuD01
5A2KH 1UEYA 4YBLB 1XGRA 2X4QB 5FUOL 3L6FB 5DK2A 1U95B 4WEUD 5E1HB 4F9LA 1I7TA 5F7KC 5CJXA 2GAZB 2E7LC 3RVXD 4LLDA 1UCTA 2H6PB 4RMUA 1UCBH 4YIQB 1NH6A 1J10A 4P9HH 1Z3GL 2E7HA 3D9AH 3LMJL 5I30H 2NX5A 4BK5A 3FQWB 4Q74A 1D5IL 4HGMA 5AWNH 4EI6A 1N5AA 1MH5A 2FX7L 1IEBA 1UVQA 1Y0LA 2W92A 3AB0B 3C60C 4PD4K 2R8SH 5KN5B 4OM1H 3WIIL 1OP9A 3BGFC 1UADC 3EYFB 3FMGL 5DMKB 5EU3A 4RGMB 1I75A 5F7LB 3FONA 4GRWB 4NQEB 4PB9H 3PF2A 5HHOD 3C2SA 1G7MB 4KK5D 3OAZK 1UENA 2AJZA 3KYMB 3P9LB 1JGEB 3PL6D 4KDVA 4RCAA 1WT5C 2NY6D 2CD0A 2XXCB 2V6HA 4NKOB 2OZ4L 3IFPB 5EU6E 2NPLX 5CD3A 4ZFOB 2WWMC 1X5HA 4PJCB 4JO1L 3KPMA 2A6KA 3K4DA 2DWEA 4CAGA 2LABA 2BOCA 1I85C 5IEHA 4RZCB 1XMWA 2JE8A 5EULV 5HYJE 3QUKA 4LU5H 1QFWI 5AYUL 3OAZH 1P9MA 3CD4A 2QV2A 4Z7UF 4Y5VB 3O0RL 3GNML 4YHPB 4ZFZA 1G9NH 4ODXB 5F9OH 2FD6L 4IOSD 4R4ND 5IFAH 1QFOA 1OT2A 4OFYA 4CVWA 5I1GL 3B2VH 1TETL 4OLWH 3BIBX 4YDLC 1JJUA 1UM4H 1LO2H 2Z4QB 3VD9A 4F7PB 5IB5A 4LARL 3T2OA 3LKSB 2NY5C 2VISB 3ARUA 1ORQA 4HLZG 3DV6A 5F88A 1TZHB 1SJHA 3U48A 3HFMH 4MHHG 1ZOXA 3WLWC 1U8PA 1EERB 4XMLH 1UXWA 1BWWA 2AVGA 4GRLA 5JW4M 2GJ6B 3E8UL 4KV5E 3DARA 3VRJB 1NGPH 3P4NA 4KK6C 1YUHA 4ODTL 2IAND 4JQVA 2F19H 1ZANL 5K9OB 1EA9C 4ZAKB 3GGWA 5GIRA 1WZ1L 3MLUL 2F5BH 1A2YB 3MLRL 3BP4A 2H32A 4EI5A 3ZE0E 1Z6JT 1J87A 3SDCC 5ITBL 4AENB 5JXEC 1CICD 1IEAB 1S7SB 4M6MH 5DA0B 4ZUUA 3ILQD 4GG6B 3UTTA 5EZLA 4NQSB 1NGZA 1CT8B 2PYEA 3T4YA 1U9KA 4C56B 1M05A 3BGMB 4FZ8H 2FJFA 1MQKL 4I3SL 4U1KA 4H0GA 2ESVA 4XBGA 4S11A 2EE6A 4K7PH 3LEVL 1RIUL 4J23A 5DF0A 2VE6A 3F6LA 1ZS8A 4HAGA 3N85L 3TH4T 5C0JB 3MODL 1CFTA 1IGFL 4FXGB 1IAKB 1P9MC 5E6YA 3PP4L 1KOAA 4ODUB 4ZFFA 4Z76B 1NJ9A 4J3VA 2QLVB 4PJFA 1HDMB 4ZDHA 4ORZC 3QQ9D 4U6YB 3RWHB 1KIPB 3MC0A 1OAQL 3B9AA 1CGVA 1EEZA 1U8JA 3G5VA 3KYKH 2IFFL 5C08E 3P4NB 2DQIH 2R1YA 4CADB 5T1KB 2UUDH 3CFBB 1ZHLA 1BD2B 1MCOH 2ERJB 4GFTB 1MUJA 5HXMA 3QI9D 3S36H 1NQBA 4GG8A 3UBXG 2XACC 5IB1B 1MRFH 5IVXE 2H32B 3HNVH 5C0IA 4D8PB 5KS9E 3D2UB 4LSQL 4ORGB 5JW5B 2D31B 4NZRH 4BM7A 2HTKC 5AAMA 2XZQH 4ZUTB 4QRSB 1R3JA 1IC1A 4TSAL 1QVOB 1SEQL 4ZQKB 3JUYA 1DQLH 1VSCA 5J6HA 1JPFB 1D9KA 4WW2A 2C7UB 2DTML 3AS0A 1KYOK 4LDLB 4N8VA 5KZCD 1TVBA 2OR7A 1RK0A 2P45B 4OZFB 1AO7A 3AAZB 2GW5A 1A7BA 4MMXC 5E2WL 3KJ6H 5CINH 2WINA 2HWZL 2FX9H 4HGWB 4MQ7A 1QSFD 1R5VB 5D5MA 5JQ6L 3QUZC 4G8GE 5C8JB 4ZDHB 1BQLL 3WHE1 5E5UB 4CL7A 1S5HB 4NQVB 2N7BA 5FUZH 4F37F 4AH2A 5DC9B 3VD4A 3WXWL 4ELMB 2V17H 5EFIA 3S36X 3EHBD 3DYOA 5DRWA 4Y5YA 4KZDH 3NIGE 2P24A 1FO0H 1R5IB 2EC9T 3ULVF 1DVFA 3QEHA 1HEZA 4LIQE 2MKLC 3MOBL 1ZK9A 2Y07H 4JG1H 1VDGA 4L3EA 3VXQA 1UT9A 1F2XK 4LSSH 2C3VA 3PIQA 4YHOL 5F1KC 1Y18A 4CDGC 4DZBB 3H7LA 5E99L 5DHYA 4OUUB 4HS6B 1VEOA 1CS6A 2AJUL 1ZVSB 2QQLH 1T04A 4MXQC 4XXDA 5GS2D 4PLOB 5KOVC 1K5NB 4QF1B 4KK5C 5CZVH 3R8BB 3IAPA 1DN2A 4X8JB 2ORBH 4L4VD 4HT1H 4OCRH 4XNYH 2A83A 4D3CH 4J12A 1FCCA 4I2XB 5FHAL 4PGCA 1F13A 4ONFH 1ADQH 3ARGB 4F33A 3DYPA 5DXWA 1K6QH 5D96B 3T2NH 4Z7NF 4A6YH 2VABB 1CL7L 4FQXC 3X12A 1AP2B 3SE3A 4Y4HC 3TJEL 3CSYA 1FYTD 3O6FB 4CDHA 2HVJB 5EIVA 4MVBC 4XP9L 3OKNA 3C08L 1JMZA 4WV1C 5DJXA 3KPQB 2ATPB 2PNDA 3L9RA 1XH3B 3V4VH 1ZTXH 5EPMA 2Q8AL 1NGWB 1KLUA 3FB7A 3GB7B 3N9GL 2DLFH 3Q6FA 4L9LC 1G7HB 4MJ6B 5D7IB 4M93B 3FO9B 4PV8A 5TF0A 1JPGB 1SYSA 3X3GH 1T83C 3PQYB 3MXWH 1OPGH 4ZXBB 5HBBA 2BHYA 2A77H 4QNPF 4OBSA 1QG3A 3QZWA 3FO0L 1KJVA 3OXSB 4KQ3H 4WJ5A 5HJ3B 4L3ED 3LEVH 3MTRA 2Y36H 4GJTB 5JZ7C 3O3EA 1Q94B 3PWJB 1BEYH 3MRPA 1RURH 5ANMB 2OMNA 5FOJA 4FQIL 3Q0HA 4ODVH 3MFFA 2AJSL 3ROOB 4BZYA 1WJ3A 1NBVL 5CIPA 5EU7C 4XPTH 4U6HA 5DQ9A 5IB3B 2Z35A 1FAIL 4PP1D 4JVUA 4KY1H 4PJEF 1JNHB 1JZ5A 3MJ6A 3OHXB 4YHKL 4G8IB 3WS6C 2R29H 4RIRA 3S37L 5BCAA 3K4AA 5IHLB 1HSBB 1Y6MR 5JW4N 3FKUS 3V8OA 3QUXD 1OW0C 4U1SB 1ORSA 5DTFB 4A2MA 1MJUL 4XH2A 3VE0B 1YEEH 4HFWB 4NFCA 3WJLA 4DK3A 2BVOA 2ZNXA 2HFFA 3PABA 4HK0A 1ZGLB 3VFRA 4DK6A 4OFDA 4R4BB 3ILPB 5EDXA 4Q9RH 1WIPA 2F8VA 3CVIL 3BGFB 5I1HH 4XNQB 2BNQD 3TZVA 3EYSH 4WI3A 4LCWD 1QOKA 3G6DL 2X41A 3KR3L 4LLVA 4LCYB 1P2CB 1OOAA 3AB0C 3DETD 1P5VA 5GRVL 4R3SB 2NY1C 4HZAA 1X5LA 1DQTA 5TE4H 1BFVL 5FO9B 4K23H 1LK3L 1EMTL 3UTSB 1J11A 3WFEL 2A6DA 4HIEA 2JJSA 3W82A 3CLFH 1UH3A 4MS8C 4GRMB 3BESR 2JELL 1T5WB 2FH6A 3IDGB 2XQYG 4DGIH 4LKCA 3QDAA 1KXTB 4PFEA 4BQ9A 2PETA 3OHXA 3QNXB 2GCYB 4YXHH 3SDDB 5FEBA 3MLYH 4NO5B 4NYLA 3QI9C 3BIAX 3RVUD 4YDJA 2VERN 2EDNA 2OMBA 3C6LB 3IFOB 3RNKA 4XAWH 4QHUA 2YRLA 1BFOA 5EZOL 3VRLE 4QRRB 5F6IB 1XGTB 2GAZA 4XWOC 3U0WH 1S9WA 4LLDB 1JI2A 2NY3C 4F8QA 1HQ4B 1SM3H 4POUB 1QBMH 5FYLE 4R7NA 4GS7C 1ZA3A 1H3GA 2D7MA 4JB9H 2DMKA 3O3UN 1BIIB 4NN7C 4QY8A 4JPIA 4NC1E 5B8CA 1U93A 1A0QH 4EZMA 1N3NB 1FSKC 3ZYZA 2IGFH 4GXVH 3QDJE 2J8HA 1QEWA 1LNUB 3IXTB 4PJHA 4MD4B 1IM3A 4ELME 2XRAH 5JOPE 4OSUH 4GRLB 3OG4B 4HC1L 4LPTA 3T3PE 1CYGA 1KN2L 1CIDA 3VDAA 4PRIB 4P49A 5JUEH 3BAEL 4ESKA 1KACB 1W72H 1G7IB 2MSPA 5ALBH 2V7NA 1I7ZB 4FQPA 1PSKH 1FN4A 2NNAB 1YNTB 5IMLA 3GZKA 4NO5A 4NYLB 1P4LB 1NEZB 3FFDB 3BN9C 1B0GB 2ZOLB 1RHHA 4KTEH 4JO2H 5C0BE 4OTXL 1A1OA 4LSVL 2R0LL 3SKMA 1CT8A 2B39A 5CSGA 2EC8A 4GOSA 3T4AB 1G7LB 5EU4A 1OTSD 3FO1A 5JA9A 2C1OB 3C5SB 3TIEA 4NGHH 3VFOA 1PAMA 3V4VL 1OT1A 3LH2L 4RZCA 5I1LA 2IPUG 1IQDB 4YNYA 1KLFA 1JF1B 1NCUA 4MSWA 3VXUE 2NLJB 3BKJH 4TSCL 3RJQB 1J5OH 5FYKD 2E9WA 3B4NA 5T3ZL 4I18A 4GKSB 3S4SB 4Y1AE 1T22B 3P4MB 3MV11 1T6VN 3K81A 3UX9B 5SWSA 3B2UD 5C7XH 3HB3D 4WO4A 1AXSB 1ND0A 3PV6B 1KTLB 5FOBB 1BWMA 4M7JH 5C1MB 4Z7QE 4ODSH 2VZ3A 4LLAA 2CKBH 2HJKA 2XZQL 4RA3A 5TE7H 3HE6C 1E27B 3QUYA 4TQEL 4RFEB 3S8WA 3VMNA 4EIGB 1HKFA 3A6OA 3H9ZA 3VXSA 3K1KC 3WE6A 4ZQKA 1F42A 3VFSB 2A73A 4UQ2A 2NY4B 3L7FA 3GSQB 2EDHA 5EUOF 5HHQB 3MV7B 4FQLL 4JN2B 4MJ4A 3NFSH 5I1EH 3DBXA 3TBYA 5MI0B 4NCC2 1AGEA 3OJDB 3G5XB 3NN8B 5B39A 1MFEL 5FCUL 2D3VA 2XFXB 4KJPD 1EX0A 4Z77A 4L1DA 1X4XA 5TQ0H 3EYSL 2A6IB 2M2DA 4ZOEA 1QFHA 3MGOB 2ENYA 3B9KD 5K9JL 4XXDB 4R96A 1AXSA 1ND0B 3D2UD 4YAQB 4A2LA 3QPQD 1LP9E 1FO0L 5D7SH 5IW6B 2OJEA 1RD6A 2CUMA 1KELL 2OS7A 4QCIA 2WWMD 1A22B 3AREC 4WFGD 4WUUB 3MRQB 1EDQA 4MJ5B 4GT7A 3M45A 2R1WA 3T1FB 2YN5A 1UWXK 4C56E 2XG4A 5FKPA 4Z8FL 1DTUA 3UPRA 4PJEA 2JELH 1ZLWK 3X14A 1IFHH 4DWHA 4NJ9L 4RGOL 5ITFB 1TJHL 2DBLL 2A1WH 3FQXA 4NZUL 5TQ2L 4NHCL 2DN7A 4OBRA 2Q76B 2IQAB 1S8DA 1OWWA 2WUCH 5SV4A 1C8PA 2EICA 4HV8A 4P2CG 5EZOH 1KLGB 3TIDA 1SMOA 4WW2C 5IESH 4M48H 2B20A 2BSED 3O4LA 4JDTH 3U82B 3VDCA 1VFBB 1F8TH 4LVHB 2YUZA 3FRUA 3UC0L 3CMOH 4MXVE 1W0VA 4S1SL 4LSUH 2O61A 4JHBA 4X7EC 1R5VA 3FO9A 1IGIL 5A2FA 1MFCL 3C5ZA 1A0QL 2I24N 1Q9LA 4PRNA 3ET9F 5FKAB 1PQZB 3AS2A 4K3EH 5KANI 3V52L 5FAAA 5I1AB 4KHXL 3ZLQC 1YMME 1KPUB 5EUOA 5K93A 2OP4L 3KLAB 4UOW1 1HINH 5A43C 5DRWB 4Q6IC 3G5YA 2PTTA 4P23C 4Y4HD 1RJZA 1L0YA 4HZLB 1JNNH 3G6AB 3NZ8B 2ID5A 3O3AB 2I9LB 3CDGB 2ZSWB 3QYCA 3QDMA 1YEIL 4NQVA 2VQ1A 3PIQB 3U0TB 1I85A 1P6FA 4NM4H 4OCLC 4OTXH 4GW4B 3MJ9A 3PQYA 3U30B 4XI5C 4HEME 3PWLA 1AXTH 5D1ZD 3HHRB 3T77B 3LY6A 3SDYH 4APQD 1TFHA 4Y5YB 2VDRH 3ZDYE 4OLYH 2PTUA 3QFJE 2X10A 3HC3H 1EGJA 1Q94A 4K3GA 4OT1L 4MAYB 3WHXA 4WY7L 3WEXA 3ECBA 2DQUL 4K07A 3BZEA 3CJJA 1G0YR 4K7PX 3A6BL 3LQZA 1BOGA 1SQ2N 4Y5XA 4L5FL 5KVDH 4U1MB 1ZLUH 1C5DA 2WLYA 4IOIA 2VYRE 2HTLC 4YFEA 5GGTL 3MRCB 3TPKA 4CVUA 3MRRB 3SQOH 3MCG1 5D5ME 4Z7UB 1U3YA 4M7JL 4ZUVB 4ODSL 4MAYD 5E00A 1CLZH 4Q9RL 3KPQA 3NBNA 4AYFA 2GEEA 3MRIA 4TNVF 3QDMB 2GSIB 4XC1L 3T8XB 3U46A 2O26U 3OKOA 3BQUD 3S7GA 4LU5L 4D0CB 1TLKA 1FC2D 2OLDA 5HVFB 3MACH 3MRKA 3GSUB 4GXUN 1HHGB 5EO9B 4MX7A 3GNMH 3GRWH 4PLKD 4CUCA 3I6KB 1KPVA 4HKZA 4N90E 5TE4L 1BFVH 5TDPB 3QQ4A 5D2NA 2NY2C 5LCVL 2VAAB 4CNIA 4Y19E 3VWJC 2QQKL 4S2SA 5JDJA 1KB5L 3D18B 2GUOB 3QO1A 3O9WC 1GPOL 5CSBA 4WV1A 1I3GL 1DQQB 2Q8BL 1BP3B 1MVUA 3SE9L 4EBQH 3V6ZA 1TTFA 1SYVB 3ARWA 2DJSA 4YDKH 4OI8A 1QFUL 5HGDA 5DJDA 5I1DA 4Z7UA 4ZUVA 1MCQA 3HE7B 3F6IA 2GSIA 5DLMH 4FRWA 5J8OA 1I7UB 1AHWC 4ZD3L 3LRGA 3GM8A 1TJGL 5DZNA 5T1LB 4NWTH 4BFBD 4GXVL 3CLEL 4HWBH 3QCTL 2VDKH 4FA8A 2R2BB 3I9GH 2AJ3B 1MCCA 4RX4A 5JIHA 1UH2A 4KPHH 2HMIC 5KSUB 2ERJC 1N5YL 1UCBL 4GKZB 3EFDL 1QFWM 5JUEL 3BAEH 5MEQB 3D25B 1RPQA 1UB6A 2XTJB 3D18A 2ZUWA 5JW3L 2NX5B 4N5UA 5KJRL 5LGKA 3EUUA 4X5WB 4MJIA 3UTSE 5C09B 3KYAA 2CLVA 1MFCH 4KTEL 5DJZA 4YJZL 3U79A 3ARSA 2ZPKH 5T1DH 1MNUL 5J1AA 2N1KA 2VLKB 1I7RB 1AD0A 2QHRH 5J89A 4YDJB 4UT9H 1XIWD 3FQNB 4N90D 3PV6A 2IANE 2H1PH 5CZKA 2W07A 2RCSL 2P8PA 4XP4L 1E4XL 4JE4B 2D7TL 4ZS7H 5LGHL 4ZO8A 3MV9B 1C16A 1A6ZB 4NC0B 2AW2A 2ZNWA 2WANA 3MV7D 5L0QB 3E1F1 5K9KB 1HHJB 5JPNA 2E3VA 1ZT1A 1AJ7H 3GMMB 5KVFH 1WF5A 5FYKH 2YKLH 4HPOL 1T4KB 4P57B 4S1QH 3DO7B 1FZJA 4P3WA 1CI5A 2K1MA 1MH5B 5HGHA 3I75B 1D5ZA 5JR1H 2Z4QA 1S7QB 2A6KB 2H2PD 4TPRH 4CRPA 5KN5A 4ZFOA 1A7PL 3MROB 2D0FA 3GO1L 5GGSA 3B9KC 2FX9L 2BRQA 2XV6B 4O5LL 5BV7L 4W6YB 4H1LB 1HOCB 4LMQE 5CJ8A 4YFDB 3SO3B 4HULB 1E4KA 2RFXA 4PJGE 4D2NA 2GJ6A 2XA3A 4WTZG 2ITDA 3B2VL 4AIZB 3EOBB 2GFBB 4LNRB 4MB4A 1G9NL 1S9YB 3OZ9L 3IU4H 4TRPH 4MJ5A 2EEAA 1BX2A 3B5TA 2H6PA 3LDBB 3VWKD 2VISA 1J8HE 5FB8A 3EDDA 4K7FB 3KAAA 1D5MA 3HE7D 1A6TB 4UIMB 3QWRA 4MZ2A 4P3DB 1YNKL 3IDXL 1OP5K 4W4OA 2EEBA 5FYLL 3QJHA 4O2FB 5DGQA 1MHPL 4XBEH 2OCFD 2IALA 3T4YB 4IHOB 1JUFA 4C4KO 3ZE1F 1U8OB 1BVKA 1PZUB 25C8L 5EORL 1D5ZB 1QFPA 3BSZL 3GRWL 2GSGA 4ODTH 5IMKA 4ZYKA 3J8F7 4OM0H 3E8UH 1FVEA 2LTQB 3HNSL 2NY3B 2HA1A 1T1XA 1FLRH 3OGCA 4Y4FB 1W72A 2JB5L 2VLRA 4P2QE 3T4AA 3UTTE 4AEFA 1CDCA 1W0VB 3GGWB 4OI9A 3BUTA 4JDVB 7CGTA 2YBRA 1I1CA 2E9BA 5AZ2H 1CG9B 5IHZB 1RIHH 1MSPA 3WSQL 2X4PB 2WUCL 4MSWB 3ULUE 1GGCH 1ZWIA 1A7NL 1ZVYA 1NCBL 3V0AC 1T2QH 4BUHA 3ALXA 1G1CA 5IESL 4M48L 5CZXD 4PJ7E 3WE6B 3QUXA 4X4XA 3BGMA 4XNXH 4JPWL 4WI6A 4MQXD 1LD9B 2IBGA 1AC0A 2HMID 2PO6B 1U8HA 1LO4H 2VLJB 1H0DA 4F3FB 4U1JA 1U2CA 5DLML 2NY0B 2EDTA 1K2DB 1NEZG 4YBQD 2KL6A 3TBYB 3VH8G 3ULUF 3HCVA 1EAPB 4EI5B 3IETB 3RGVB 4F58H 3P9WB 2IEPA 5D72H 1MCJA 3MRHA 3QIBB 4MXQD 3JUZA 3BD3A 3OR7A 1M7DB 1B3JA 5F89B 2NXYC 2FO4A 4JKLA 3SDDD 4O2CB 1MJ7H 4E0RB 4Y4HA 4ONHA 1HKLH 5JHDD 3ZE0F 3QIBC 2YD9A 2Q7YB 4W4NA 1L6XA 4LQFH 2FBJH 2VXVL 4JFFB 3RA7H 5BQ7B 3S35L 4JQIH 3P77B 5FO8B 5IHBA 4G6MH 5HI4C 3G04A 3BE1L 3VD7A 1IM9D 1NAMA 3MGAA 4PJFF 2X70B 4HLJA 3VI3F 4OF0A 3MJ8A 2ZUUA 5J3HD 4LBEA 3O4OC 4MNQE 1B9ZA 2BOBA 1MCWM 4GQ9H 2VDRL 2OSLB 1G0XA 1H9VA 1JK8B 3LEXB 1A1MA 3SDAC 4HIJB 3KXFA 5DK0B 3KJ6L 4XMPL 4OKVA 4ZXBC 4KROC 3TC9A 4H88H 5D7KD 5I1HL 5C09E 1AKJB 4HJJL 4RGNC 1RUPH 2FHBA 3WXWH 1AJ7L 2AJYL 1ZVSA 3V0WH 2DL9A 1CE6A 2PW2A 2YXMA 3TH2T 5L2KD 3EKCA 2C26A 1T89A 4Y4HB 3RI5F 1CFSB 3SBWA 4UTAH 1F4WL 5GGTH 1WUNT 3KWWB 3PWNA 4DVRL 3RY6C 1LO2L 4JO3H 2NY3D 1R24A 4M8QA 3VGEA 5EIIA 5T3XE 3QUMB 4M03A 5BV7H 4Y0GA 4U31A 4PREB 1PGRB 4JFHE 1JZ7A 5SWQA 5L6YL 4XHJC 4L3EB 3NCJH 5F93C 4EIZC 5A16A 3MNWA 2BOBB 1MHHA 1AR1D 3PWPB 4IRJC 5KTEH 5EO9A 3OKNB 3QXAA 4XVJL 1ZT4A 1WGOA 4TULH 3V9FA 1FZKA 1MRCH 4L8CA 4GAFB 1AQKL 1PBYA 4RAHA 2GK0B 3DUSA 1I1YA 1BAFL 5ACZB 4G6JL 5TDOA 3OTTA 4E41B 1FNFA 1DSFL 3MLWL 3ARGA 4URTB 1DQJB 5ITBH 5T1LA 4I2XA 4O58H 2DYPD 3R1GH 3UJTH 3WIFB 4MA8L 1XF4A 1VFAA 3DVIA 4XHQA 2VZ1A 5EWIH 1KN4H 1R3KB 2NCMA 4Y5XC 4OD1H 1ZHBA 1UQSA 1QLEL 1JNLH 4EJ1C 4Z7VE 1S7TA 4Z18A 1ZTXL 3IDJB 1F4XL 2ITCB 2ZKHL 2I5YL 3P4OA 1JFQH 1EZVX 5D1QC 4LDOB 2EC9U 3FQTB 2D0GA 3SE8H 2HG5B 5CZXC 1T7VA 4AG4L 3T8XA 3U46B 2QSCL 4Q97A 5IHUH 2VLKA 4H8WL 4JFZH 5EBGA 3W81A 5FA3A 5C07E 3MXWL 3LKRB 3C8DA 1MF2L 2EDDA 5I6XC 3PWJA 1MAJA 5ANMA 4HKZB 4IOIB 3LEYL 1CFQA 5F7FA 1ZLVK 5HJ3A 2A9NH 4IRJD 3HI1B 3DUHA 3KPLA 1AO7D 3ILPA 3LH2H 2IPKB 3VFMA 3NPSC 1Z2KA 4N0CC 3SGJC 5J56B 1CWVA 2AJXH 4PJDA 4RWYL 3NTCH 4YGVA 3OKOB 3QUML 5I71B 4JO4H 3H0TA 4IJ3C 3RBSA 5MEOB 5DMYA 1YY8B 1UQSB 4YK4C 2APTA 4MVBD 3ARGD 1E4XH 1KCVL 4FZEL 1YEEL 1JYVA 2HKHH 3MNVA 5GZNC 5IW1B 4R4BA 2BCKA 5K9QG 4EQ3A 5C6PB 2CKBL 5KVGL 4HFWA 1CGYA 1FE8H 2HG5A 1DVFD 2PW1A 4JFDE 3DOSA 1C16B 3LN5A 2G60L 5E2VL 3KR3H 4F33B 4P4RB 1BBJB 2V17L 2QKIB 5CUSH 5I8EA 2J88L 5INCB 1DLFL 3IGAA 3LS4H 1FZJB 3LKPB 4F7TA 1OHQA 5I75B 5L88H 5E4EB 1XR9B 1WCBA 3HI1A 4Y4KC 5F7UA 5KG9A 1MCEA 5I19H 3MZTA 1JGDA 1LO5A 1R3LB 3O6MH 3BN3B 4H26A 5I1JL 2X1XR 1HYRC 5I8KL 2WK2A 2F5AH 5D71L 1TQBC 4LSSL 4YHLL 5FUCC 4HC1A 5FF6B 1HXYA 2E9IA 3D85D 3F58L 3S98A 4S1DC 1R3HB 5E2TH 5I15L 4Q58C 3HLAA 1KCSL 2PR4L 5BZWA 2P8MA 3F5WA 2IWGA 3SKUD 1RMFH 3DX8B 5LWYH 2DM3A 5CJBA 4JO3L 3MUGA 4PJCF 1DBML 2HTKD 1NCWL 5HPMA 2BOCB 1OTUC 3HNTL 4FXKB 1TQCB 3QDJA 1QBAA 4WI7A 3O6KL 1CN4A 4L29B 2HFEB 1EBPA 3NPZB 1P84K 4R2GC 2CDGA 4LEXH 3UYRH 5CEXA 1I1RA 4A6YL 5BS0E 5ACLA 4XB8A 2PCPA 4KRPD 3TBWB 2A73B 4UQ2B 2B1AH 3X11A 2CK2A 4PJ8A 4AJ0A 4YH6A 1TZGH 3ARFC 1KENH 3KPMB 1A7QH 5F7NC 4EN3B 2ZZUT 3HUJF 3VA2C 4NO0D 4I48A 2EDQA 5ESVB 4OZFH 2NNAA 5C0BA 4XI5D 4ZO9A 5ADOH 5F88B 1J1OH 4EUPH 2HAZA 4ZAKC 5FYJE 5GZOC 3FT4B 5A3IC 1KJ3H 4PBVC 5HY9B 3OGOE 2P7TA 5IM7B 3X3GL 4RQQA 4OGYL 4R0LC 1GGYA 2XG5A 1FO0B 3ULVD 1BLNB 3WDJA 5D6DA 4E0RA 3DSNA 4MD4A 1IBGL 4LCCC 3BEWA 4WUUA 1N7MH 1RFDH 3GIZL 3D3VB 1EXUB 3P0GB 5I66B 4MDIB 4YR6A 1ZLSH 1U8MB 5IGXH 4UILL 2B5IC 3BMVA 5GHWH 1JGLL 4ZMAT 4P46D 2KQMA 4HXBH 2BK8A 3TP4A 2EECA 4V1DB 3WJJA 4XPTL 3WL9B 2FDBP 5EZLB 3RVTD 5E5MA 3C5ZD 3HPLB 3RZWA 5C0DA 1WWWX 1YEJH 2R9HC 4WCYH 5LBSL 3S96B 3V5HB 4PJCA 1EVUA 2VITA 1QO3B 5FOBA 5DMIL 2VE6B 5GIRB 1IT9H 2WZPD 5A40E 5F7MC 4N0UB 3TCLA 1IC5L 3WFDL 5CEZL 4WWKB 5D93C 1A7RH 1P7KA 4UT7L 3BE1H 4Z77B 5TE7L 5BQ7A 3P73B 3DTXB 4KKLC 1IQDA 1KF9B 2NY5H 2MPAH 3CUPA 4Y89A 1A6VH 2NXYB 4U1KB 3U30C 2DKSA 2MJWA 1CBVL 3V4UL 3OKEA 2Y1VA 1CGSH 1R6VA 4A6YB 1GHFL 4CMHC 1R5WA 1S7RB 3G5YB 5IKCB 1FRGH 3ME0A 1VENA 1HYSC 3NN8A 3NABH 1A1MB 3G5XA 5FKPB 4NBXB 3HC4H 4RGMC 2D7OA 1NAMH 2G5BA 4X6CF 3ALWA 5BRZA 3SKOB 4XC3L 1DBAH 1ONQB 4UNUA 1LP9A 1KTKE 1JWMA 2R0ZH 4BELD 1S8DB 2YD4A 2PF6A 2XZCL 3NFNB 3RGHA 4CN4A 2AK4E 2DDQH 5CUSL 5I8CA 3PWLB 2FEEI 4FOMA 1JHTB 4H25B 1EO8L 5MEND 5I1CH 4PRBB 4KDTA 4P59L 3X3FL 1QBML 2DLIA 1UM5H 1P7KB 4JN2A 4YEFA 3X13B 1MLCA 4RMWA 3W0WD 2YPVH 4XMKH 1DQDH 2JK5B 1HQRB 4HUWB 3H9YA 5DUPL 1BF8A 3VCLA 2AJVL 4XHJD 4YHLH 2ATKA 4OZ4B 1IFHL 3ARZA 3C60D 2IADB 5HDOA 2F53B 1TMCB 2EXWC 3G04B 1QRNE 4NNXB 1DBBL 1JGUL 1EH9A 3NIFF 4U1LB 1YQ2A 4K94C 4XBPB 5A16B 5J06A 2XWJB 1QFUH 4JDTL 3KPOB 1PKQA 1FFOA 3BJ91 1AGFB 4F57H 1BAFH 2G9HA 1I8LC 2ZCHH 3JV4B 2OBGA 1CFNB 3DI3B 4GRWE 3HNTH 3LMJH 3D48R 3O3AA 3JVGC 3DUSB 3OAYH 1IAIH 2GKIA 3MV7E 4G6AD 1RZKC 5I73C 1NSNH 3TBVB 1JHKH 1IC4L 3RVXC 4U6VH 4KROD 1N6QL 5AG9A 5MERB 2WBJD 2X9WA 1BQUA 4PY7A 3H42L 3WS6A 3OKLB 4X9FA 4HHAA 5DFTA 1V3KA 4HK3J 1F4AA 4JAMA 4HS8H 1C08B 1T83A 3FTGA 1D6EB 2AQ2A 1WT5A 5CWSB 1OP3K 4XP5L 2Y06L 4UBDD 3B9KB 4F9PA 3C6SB 4PGCB 2LV4A 2Q7NA 1KULA 4QHKJ 3MGTB 5JW4Q 1KBGL 4IM8A 5IROC 5MHSE 4OLZH 1DZBA 4QYOA 5DC4B 5DRNB 4WNQB 1G9NC 1Q0XH 2I27N 1MFAL 2VJXA 1AFVH 1HZHH 3D69A 2P42B 2V2TA 2AXFB 4OGXL 3CZJA 1IBGH 1NFDA 5GRJH 1S9VB 1FDLL 3DX7B 5EZJB 3LEYH 1FNGA 3FL7A 3QXAB 2R23A 1KJ2A 1NFKA 4JM2B 1FG9C 2AV7B 4J4PC 4OLYL 1DP0A 3Q6FB 1GSMA 5GHWL 3SEPA 1NANH 4X98B 1F4YH 4MJID 5IB4B 5HYQB 3P4LA 3ZL4H 4KK6D 4HUMB 5EO1A 2BNUA 1QVOA 3G5ZB 3S5LB 3HUJA 3BW9B 3TVMC 4XXCA 3HE7C 5DC0A 5T1KD 2P49B 3V6BR 2FD6H 3MPCA 4RRPG 1K4CB 5C9JA 4DVBB 1NDMB 3O45B 3WNLA 3JWDL 4G80A 4NQDB 2R56H 2J12B 4Z95L 5C09A 2BSSB 1CGTA 2HFTA 4KZEL 1SYSB 2J5LC 4U6HB 5DQ9B 5IB3A 1B88A 1NGYA 1LE5B 2X89A 3VGDA 3ZTJH 1I8KB 4YO0A 2XKSA 2J8UB 5GRZA 1FNEA 1YYML 4G7VL 4HWBA 4Y19A 2XTJC 1NFDB 1J8HD 5IVNA 5J4MA 3QQ4B 3M8OH 1U95A 3QNZB 3IU3B 5HHNB 5L8JB 1C5DB 2NY2B 4OF8A 3S3PA 4OIAA 1QLFA 3O6ML 3W5NA 4R90L 3ZE2E 3EOTH 2BVOB 2F58L 1FGVL 3HC4L 3I2CL 4X4YB 1QKZH 2EIBA 3R4DA 3LHPL 4G8EA 2EH8H 1QPPA 3ZKMD 2GUOA 2JCCF 2O93L 5T5FL 4NZUH 4JKKA 5TQ2H 5J1SC 1P2CA 3MRNB 4KUZL 1F58H 4UDUB 1AD9A 1RQ5A 4HXAL 2CIIA 4M4PA 4Y2DA 5DZLA 3WFHA 5DJXB 6FABH 2VR9A 4KK9D 1WSST 3AVEA 5MEQA 1CLYH 5JDSA 1F8TL 2B1HH 5GS1C 3VFGH 5E9DD 3MODH 5JXEA 1U3HC 1ZA6B 1FJ1B 4P23A 1I8KA 2VR4A 2Q8AH 4MAYA 4LLQB 5H94A 1GH7A 5SWZD 2HFEA 2R2BA 4YHMH 1MWAB 4LCYA 4R4FL 4ERSL 5CILL 4OFKA 4HUVB 4WGWB 1KENL 2C5DC 1FFRA 5E03A 3DVNB 4TNVK 5I18L 3C2AL 3KXFD 3FZUC 2LU3A 2YD5A 4WUKH 3BPLB 3JV5A 3LKPA 3MYJA 5J12C 4X4YA 4FFWC 2VXSH 5ERWB 3HI5H 5C0AE 2R69L 1H8NA 3FB8A 3LRSB 1F00I 1DBKL 5T3XH 3WBDA 3ARVA 1VGKB 5ESAB 4F58L 3UJIH 2VH5L 4AIXA 5H8DA 2CLVB 4M6NL 2XKUA 5D2NC 2WP3O 3RIAF 4RQQB 2CK0L 1QO3A 3ZT7A 1YYLL 2B0SL 5ANME 5GS0C 1INQB 3QEUB 4U1IB 1WIOA 2D7TH 5LGHH 1KGCD 1NGQL 4JHAH 4H0IA 1TIUA 1I8MB 2EDBA 4UILH 3VXNB 1R3LA 3Q5TA 1HH9A 1KG0A 2KUTA 4NPYB 4OD2B 3T0AA 3OR6A 1OTUD 4LCUB 6CGTA 3FFDA 3AFLA 4IOFC 3MOAL 4WV1B 1Q0XL 1T20B 3DURB 1U42A 1MFBH 2B5IB 3HZVB 1FIEA 2ED7A 2OXHA 3DVNA 3OKEB 1AD0B 5JR1L 4WU5A 4AZ8A 2X4RA 1QR4A 3E3QC 3V5HA 4M43H 4NNYA 1A4JA 1CFBA 2OL3L 4RAVB 5C0RH 3HG1A 4RISL 1SEBB 3ZHLA 2RBLA 4LLYA 1XGQB 3RQ3A 5DI8A 1WEJH 3S9DB 2B2XH 4LKCB 3STBA 2VTFA 4HK0B 4HKXA 3IS0X 3ZYJA 4H1LA 1WBXB 1QBLH 3VMPA 1QR1A 3BP5A 3EYQD 4ZPVA 3PHQB 4K2UL 4DFIA 4YXHL 1CFVH 4JLRB 3GSRA 3V0VB 3ARED 4PG2A 2Y5EA 2OK0H 3L5IA 4HX1B 3S3JA 1DL7H 3TJHD 1CGUA 4IOFD 4XBGB 1U0QA 3GUTA 3QWOB 5DD0L 4K9EH 5ISZD 4LCWE 3KYOB 1N26A 2DM7A 5D1QD 4LF3A 3ARBC 3LKQA 1JV5A 2PYFA 1JHLH 5JZ7D 4MXWH 1INEH 1M7IB 3RGVD 4OZ4A 3AREA 3OAYK 1AI1H 4Z76A 3QUZA 5FYLH 2W0FB 3O3BB 3R06B 4OB5H 1CF8H 1S7VB 1QLRA 2N7AA 3D0LB 4P5MB 5ACMA 3GSOA 5TGBB 3WMSA 2VLRE 1UXSA 4ZTPL 1EO8H 5HYSA 4X6EB 4M7LL 5L2KA 5KTEL 1Q9WA 1FLRL 2ARJQ 4UZGA 3SDXE 2UZIL 4OAWB 3RKDD 3T3ME 3MFGB 5HYJD 5F1OB 4BZ1H 4XP6L 3BIKB 1YPZB 3BEVA 4ZOBA 5ALBL 4EN3C 3S35X 1NEUA 4AMKH 5GGRA 4V1DA 2NY6B 1SY6H 3U9UA 3V0VA 4FTVA 1CXFA 3QG7L 4JR9L 3L7FB 1U8KB 3H7BA 1UZ6F 1J1PL 4KUCF 4KXZI 3B3IA 3T0VA 1P69B 4MCZA 1ZEAL 5JTWA 1DUYA 3HI6H 1IGTA 4PJ9B 2VDLH 1UH4A 3LZFL 4FQ2L 4OD3L 1D5BB 2WINB 5JW3H 5KJRH 3WUWG 4XPBL 4F3FA 3VXRB 4M5YH 1C12A 4UUJB 1RZGB 2A6IA 1MCFA 2DYPA 3QHFH 2OJZL 3U7WH 3QWRD 2QJDA 5MI0C 3OMZA 3HR5A 4CJ0A 2H26A 4WO4B 5T3ZH 3L1OH 4B7LA 4JZJA 3LEXA 5ISZB 4P3CL 2FBJL 4AEIL 4O2CA 4MA3A 4ZUWA 3MLTA 4U3CA 2O61B 3S35H 1J8KA 5E8NA 1DBKH 2PN5A 1NAMB 3FQXB 4RWYH 2WWKO 2HFGL 1XF4B 4I0PB 4C56A 2BY0A 1JE6A 5BV7C 4S1QL 1YYLH 3P4MA 3CDCA 2MHAB 1JHTA 1VFBA 5KW9H 35C8L 4KHTL 3IDJA 2Q1EA 5C0JA 1DFBH 1FNGB 3BWUC 1EEYB 2P5EA 5D1QB 2AEPH 4PB9L 4NUJB 3PL6A 4KDTC 4TTGA 2PYEE 1FORL 1JPTH 3SGJA 5ICYB 3NGBC 2BFVH 1GJIA 3DPBA 1EHLL 2YD6A 5HPOA 3R8QA 2YN3A 5BXFB 1LHZA 1QFWH 1SJEB 2NZ9D 4P5KA 4DVRH 5D9SA 2G9HB 1PVHA 1WEJL 2RQ8A 3C6LC 4ELMF 3OJDA 1YNKH 5F1SA 4L4TA 3UYOD 1MIMH 3WJLC 3NCJL 4E42B 4R9HA 2DS4A 1KCRH 2XICA 5C0CD 1GCFA 2FECL 3MNWB 1I8LA 5L6YH 2WBJB 3N1GC 4X6FA 2UZXB 2AKRB 4QYOB 4LVOB 4YHNB 3EDFA 2JKXA 4HV8B 3TIDB 2A1WL 3GBLA 3DECA 1IM9A 1KCSH 1EHNA 2PR4H 2Z31D 1I1AA 4OM0L 3FOMA 5C07D 5E8OA 5IVXA 1IC7H 1F3JB 1KN2H 4ZOCA 1FVCB 1JL8A 4FQCL 3QDHA 4JFXB 5B38B 3OG6B 5HDBE 1KXQE 3MLWH 1I3RB 4M61B 4QNPE 1DQJA 3MRPB 3QBTB 2Q87A 3IDMA 3U0PB 5AZ2L 4PGEA 4OLUH 1U8IB 4OF6A 4WW2F 2ADGA 5JORB 2ZSVA 2Z91B 4YWGL 4NOFA 4P2RE 2Q76A 1OF2B 4KKNA 3UYPA 3MRDB 4BSWA 4RIRB 3STZB 5C3LD 5D5MF 5JHDB 1X6NA 5CMAB 3BKYH 5DR5H 2F5BL 3RAJL 5B8CC 4WI5A 4PJDF 5IQ7H 2JJVA 3K1DA 1VPOH 1B4JL 2XN9A 1NCCL 4ZTOL 1YEFL 3VFRB 1O7SA 4M6ML 2OTWB 3QXUA 1Q9OB 1H15B 5FUOH 4XAKD 1MY7A 4CVZB 1SMAA 5HHOB 4WDIA 2R1XA 1S9XB 4JANB 3S5LA 2NYYD 1X5YA 4OKDA 4Q6YA 3DMMB 4DGYH 4PRAB 3RNQB 5KAQG 4NRYA 2FRGP 4YC2B 3LAFA 4P2OC 1YN7A 5F1NB 2EEDA 4RWHA 3NOIA 4AM0B 3QWQB 1R24B 2VH5H 4P48A 4KJYA 2BVPA 4G6ML 1IL1B 3KYMA 5EBLB 2F15A 3DHMA 3E2HB 3WV0A 3QUMH 1WAAE 1ACZA 2DQFA 4FP8L 3VFPB 5JOFA 3OB8A 4RGNB 3FMGH 5LQBH 3UEZA 4DN4L 3TWCL 3JV6A 4NHUB 3VG0L 4OQTA 3RVUC 2E27L 4Z7QF 3O6FC 5MEPA 3T04D 3UTSD 5JMRA 4NZRL 4UIKL 1IGYB 3O9WD 3SE4C 5HHVH 4DZ8B 4XC1H 3DMMC 4PRPD 1U93B 1BQHG 3QFJD 3CH8A 3V0WL 3HZMA 3VWJD 3MV9E 1TCRA 2DTMH 4JVPA 3TA3A 1OSZA 1GHFH 5SWZB 4U4BA 3IJSA 1KELH 1UWGL 4YR6B 5DVLA 2FSEB 1OAZH 2CLRA 3PWUA 1UA6H 2AGJL 4HWEL 4DW2H 1FIGH 1T7YA 3HB3C 3F58H 4JRYD 5E5MB 1J1XH 1MRDH 2V5YA 4OUOA 3BPOB 5KSBB 4NC2B 2V9QA 4MGXA 4XPAH 4HIIA 1FV1B 2AAVA 2EKSA 4HH8A 3VWKC 3GM0A 4LCCB 1I7TB 1YMHB 1Z9OA 3JV0A 3TJHC 1P4BH 4KJWD 4PS4H 2NY0C 3UC0H 3CMOL 4WWKA 2F54D 4XRCA 4TUOB 1INEL 4XMKL 3TNMB 2ZG2A 5E7BA 5BW7A 2YWYA 4Q0XL 3GHBH 1PEZA 4IRSC 3IJYB 5EC1A 2MCG1 1EO7A 1C7SA 1T4KA 4P57A 5SWSD 4F9PC 2YPKA 4NWTL 4Y19D 3CMGA 3S5LG 4R3SA 1LEKA 3GMRA 2DQEL 4QHLA 1EK3A 3GMQA 2BC4B 3VXSE 3MA7A 1CXIA 1OTTC 4LFHG 5I66A 1EGJH 1EJOL 3C8KA 5GGSB 5DHVB 2GK2A 3MJGX 2NY4D 4LFHD 4GRMA 1MI5D 4XTRD 4XCFH 2VXTL 5EBMB 2FIKB 2VC2H 4LSTL 1OAKL 2YUWA 2F53D 1JRHH 1I7RA 4YEEA 1W8OA 3S96A 1XAUA 2R4SL 4JHWL 3PGCB 1D9KC 5DRZA 3QH3A 4JM4H 1ZEAH 5SX5H 2I9TA 3F65A 3VXOB 4GRWF 2MQ0A 3GUTB 1QSFB 2HT3C 3C9NB 4ZUTA 5ICXB 5DJ0B 1XIWA 4OLZL 1HILB 4K94L 3MJ9H 4QOKB 1YEJL 4C57C 3T2PA 4NRZA 5FF6A 3ARQA 4ZYKB 2W0FA 3PHQA 2X2YA 2AEQH 2V5MA 3FN3A 5C0DB 1BLNA 4JGUA 3REVA 1D6VH 3L3GB 3KLHC 1RUQH 2EXWD 4GSDH 1R5WB 3BH9A 3REWB 4PJ9C 3GMLB 1W72B 3UDWA 3L3HA 4M4RA 4U6TA 1K4DB 4JFDD 4K3JL 1P4IH 3M1BB 3VXUB 1SJVA 5HD8C 3ZKQD 1IT9L 3QWOA 3O4LE 4NSKA 4X6CA 4OAWA 4NM8H 1JGVL 4N0UA 3H3PL 5FO7B 5DURD 4FXKA 4NDMB 1IKFH 1A6ZA 2IC2A 3BJLA 4ODWB 3JTTB 5CD5C 5ESQA 4MMZC 3A0OA 5DVOA 3EOBA 1CBVH 1F6AB 2CXGA 2XZAH 2G2RB 3MR9B 4JFFE 4ONGL 1FVDA 5C92A 5ECJE 3S37H 3EOYG 2EDKA 3O81A 2YWZA 4X8XA 1YUHB 5GS2H 4POZC 1P84J 1WTGT 4RFOL 5D7LD 1BVLB 5IVOA 3VFTB 2EYRA 5TF1H 1J05B 3VGAB 1AO7B 3AAZA 3EHBC 1MCIA 2A38A 3UPAA 4R0LA 1ONQA 2A9MH 4U3XA 3BFOA 3V4PH 2R0ZL 5HHVL 2BFVL 3PXJA 4XC3H 3QNYB 3ZKXC 5LG1A 1MHPH 4LP4A 4U6YA 1GOGA 3S6CA 2CRMA 2EDYA 3SJVB 5F9JB 4P59H 4JFOB 4MD0A 3QEQE 4FG6D 1JTOA 2H9GA 3C87A 3ULUH 1NCWH 4GG8B 3ZHKA 1N6VA 5FYJL 1QRNA 5ICZB 1SY6A 4R7DB 5FO8A 3LHPH 5T1MA 4TUJA 2OQJB 3T0DA 4NOBA 1LE9A 5IBLC 2BNRA 4J7RA 1RZGA 2V2XB 5C71A 1YC7A 1FVDB 3MO1B 3T0BA 3LQAC 5H37G 1PYWB 2J8UF 4WHDA 4LLUA 1WQVT 2VITB 3W9EB 4QHKI 3ARFA 3FCTA 5ISZA 4JPWH 3ARBB 3NA4A 2YA1A 2ZJSL 3WJJC 5IOPA 1BZ7A 3ZMRA 5B39G 1F02I 2XNAB 3AMKA 3BZFA 1QSED 4YDLB 3ULSA 3V6FA 3MLPA 4WFFE 1B90A 2P47B 1FZMA 2JJTC 4NKMB 4XGZB 3O6LL 4QCIB 4W6XB 5LKNA 3I3EA 3LB6C 3H42H 1DDHA 1N7ML 1RFDL 3GIZH 3U7YH 3NA9L 4WUKL 4XP5H 3TO4D 2HVKB 5IQ7L 3N9GH 3ZDZE 2R69H 5C0GA 1FNLA 4JCLA 1CE1H 1GGBL 3BDYL 4WNQA 5HYQA 4YPGB 5C0NC 4PRHD 3SDCD 3MSPA 3MUHL 3OPZH 3ZE1E 1MFAH 1VCAA 3GJFB 5JNYA 4QRTB 2Q86B 3W0WA 5CCKL 5KVFL 2DLEA 4TVPL 4OLVL 2A77L 5LGJB 1FDLH 3T08A 1CICC 2Y36L 5DJCB 4KDWA 4OM1L 5T5NF 4FQIH 3FQTA 4O02H 3ARBD 4BH8A 3CNKA 5IFHH 5LXGL 3DWTA 4D94A 1FJ1A 4P23B 3RWJB 4C55A 1TVHB 4MCYA 4N1CA 4O2EB 5GRUL 3VXQB 3WLWD 3DI2B 3BW9A 2J8UA 4LPVA 4N0RA 3NAAL 4O4YL 1NLDH 1IL1A 1MCBA 1A6VL 1MFBL 1R3KA 4PTTA 5DD1H 3P0VH 2NR6D 2Y9RT 3RTQB 1WFOA 1HK6A 3GSWA 3MXVL 1A1NB 4CVXB 3EO1A 3O4OB 3IU4L 4LPWA 2E27H 5EU5A 1CVSC 2D03H 4Z95H 1MREL 2YS4A 1JGVH 4OCXL 4P5TC 3W11C 1YEGL 2ZSWA 2R56L 4HPYL 4GBXA 3QT2A 5EB9A 2EYSB 5CEZE 4MS8D 3WFBL 2DF3A 1TJIH 4HLZH 4KRPB 2BNUB 3F7PC 5LJYH 3I02B 5E1AA 25C8H 3IDNA 2NZIA 2CIIB 3B6SB 2PW2B 4KMTL 4UOJA 5IJVB 1IAMA 4JFDB 1ZGLP 3EYFA 2AGJH 2IANA 1M6OA 2MCPL 4HWEH 3GEWB 5DD0H 3LKNB 3RZCA 2IPTL 1FQ9C 3O45A 4XRCB 1BZ9B 2VLJD 3LV3A 1GYAA 4FFVD 2DKMA 2BSSA 1RIVL 3PL6C 1N3NA 5TH2B 4GBXC 3QXVA 2VRAA 1JZ2A 3O2VL 1X5FA 4GW5B 3L6FA 3E6FB 3ROLB 3HMXL 2PO6C 4FQ1H 3TVMD 3GSXB 3WIHH 4F15C 2MQ3A 4S10A 1JWSA 3VRIB 3RVWC 4YHIA 1HHIA 1KJ2B 2VZUA 2GK0A 1J86A 1ZA6A 4Z8FH 3JV6B 1X5KA 1F4XH 1ZSDA 2ZKHH 2QHLA 5IBTL 5CSZB 1BM3L 3ARRA 3TNMA 1JHKL 1XGRB 2X4QA 4NO0A 4QY8B 4EI6B 4LLQA 5EO1B 4XNUH 4JRYB 1EEUA 1T7XA 3DRTB 1N8ZB 3ILQC 4UDUA 5C0AA 4QOKD 1MI5A 4OV6F 3ARTA 3MYJB 3RY6A 4GBXD 1OSZB 4X6BA 1BZ9A 5F9WC 2C1OA 3C5SA 3QB7C 4LQFL 3MV01 2E9JA 2E7CA 3UTPD 1FH5H 3HKFA 4QRRE 4PRIA 1CDGA 2BVQB 3DRQB 5T3XL 5BZDA 4OV5A 2WUBH 2W65A 5EBMA 2DJ4A 3CK0L 3BHBB 4E5XA 3IDGA 3KPSD 5H94B 5I76B 4NKOA 3OJVC 1KB9J 2NX5E 5I1DB 3O6LH 3RKDC 4L8BA 5D1XB 2X6MA 4ZO7A 1T0PB 4MAUL 1NANI 5DD6B 5HHNA 2NW2A 5KAQF 4EOWH 1MLBB 5DJ6B 1XIWC 1CFQB 2C1PB 4PG9A 3TVMB 4NQEA 1KIQA 2A6DB 3AY4C 3BIKA 1LGVA 3QUYC 2KZ1B 1GZQA 5EC2B 3HG1E 3BVNA 3SDDA 3PDGA 3BPCA 1MI5B 4PGDA 3ISWA 3JWOH 1KEMH 2VLRD 3SDAA 4UT6L 3SGKC 2BDNL 2Q6WA 1VACA 1NDGB 3NGBB 3G9AB 3JWDH 3RP1A 1HHKA 3DVGA 3PP3K 1PW3A 4I18C 4Y16C 1CCZA 5AD0A 3SE4A 5DS8B 2HJKB 1WZMA 2Z92B 3IFNH 2K7QA 4UQ3A 1I1FB 2BJMH 4NN5B 3VI3E 2QR0B 5F9OL 4JFPB 1VB9A 5IFAL 5DK2B 4K2UH 4IIQB 4K3DH 3MUGB 3GSRB 1K8IB 5DD6A 2H2SD 2Z9TA 1G9MC 1OGAE 3PDOA 2OK0L 2IAMD 2SEBA 4G6FB 1FBIH 3ZTNL 4RBPK 3MRLA 2AABH 4L8SA 5JLZB 3KNBA 3PP3H 1V7NH 2WIMA 5DJ8A 1FGNL 5KSAA 4JG1L 2V7NB 2UY6A 5ITFA 2IH1A 1I4FB 4MWFB 2BNQB 4MQXC 4F7MB 2HT3D 1B6DA 5HGHB 3VWJB 3FB6B 1CF8L 2ICWB 5D7SL 2DIAA 2W9DH 2B1AL 1NDGA 3ZE2F 4RAUB 3VI4E 3DX8A 4UINH 1MCRA 5I9QB 4HUUB 4QXUH 4NWUH 4KMQA 4WHYH 3KLHD 1I9RL 5HVGB 5FFLA 2QQKH 1H5BB 7FABH 3GSVB 2WBKA 1WZ1H 3P73A 3SKOA 1CD1A 4IDJH 3GBNH 4J3UA 2V7HA 3E6HA 4XPGL 4J3TA 1FZMB 4NKMA 3GBMH 5HHXH 3HMXH 3SGKA 1INDH 2H26B 3SE9H 2COQA 4NQXA 4Y1AD 4FTVB 5DQJB 3KPPA 3S34H 2FGZA 1RIUH 3QG7H 4JR9H 1R5IA 1KB5A 4F15B 5CJXC 4FQ2H 2X9XA 2E7LA 3W39B 4XB7A 3BRFA 3H9HB 5FB8B 1VEPA 1TXKA 2A9NL 4S1RH 4HIJA 3HI6L 4I48B 1DE4A 2G5BB 3RAJH 3F62A 4G8FB 2BMKB 1D5IH 3MCKB 3RHWK 3BT2L 3DROA 3MRJB 2DQIL 1UB5B 4N8VG 2Z31C 3F8UB 1QHOA 2P7TB 2DD8L 5IM7A 3TESA 4QKXB 4YDVA 1LEIA 1FLTX 2WW8A 2DQHH 1HINL 1ZHNA 5DA4A 5EUOB 4PRDA 3VH8B 3BDBA 1MUJB 1TZIA 1XT5A 5DFWH 3O8XA 2EYRB 5IF0B 1T66C 3LD8B 4LIQH 1YEIH 2YK1H 4P99A 2IADA 1F6FB 1NBVH 3HZYB 1DQMH 3H8NA 3BKCL 3SY0B 3ZT6A 2EXYD 1AP2A 3QNYA 2BNRB 4YZFF 4L3CA 2VZOA 1BQSA 2ARJB 4ZPTB 4W81A 5BXFA 4OZFA 1SVZA 4FP8H 5DDHB 4GUPA 1XGPA 3K2UL 4NJAH 5TE6H 1H0DB 4M1CC 2YC1B 3L9RB 2RCSH 4XP4H 4O02L 1S3KL 1HEZB 4TNWF 1IJ9A 1FYTA 3BO8A 4WU7B 4MJ6A 4X6DA 4R7DA 5JQ6H 1FORH 1JPTL 3MRJA 4MAYC 3QEQB 3CPLA 5C8JA 3IFLH 3U1SL 2AKRA 4P2YA 4IEFB 3TBSA 4NCDA 3ES6B 1JPSH 4AH2B 5I15H 1TQCC 43CAA 5DZOA 2C3GA 2ESVB 2D03L 2Z31B 1EJ6A 1N64H 1OAUH 1ROWA 4KTYA 4JRWA 4P5KB 3SCMA 2NR6C 3CSBA 4ZSOB 5HGAA 4YX2H 1DBJH 3MFFB 4MA1B 1JHLL 2AI0H 4KI5D 4PJAB 4DGIL 1HHHB 4KGLA 5HHOE 1B0RA 1S7UB 1HN1A 2O5XL 4DJMA 2ZCLH 4M1CD 3L3IB 4G43A 2EO9A 2XWTB 4NBZB 3HC0B 5C2UB 1XFPA 2ARJA 4HWUA 4ZPTA 2ZUQC 4Z7NE 4XGZA 3GSUA 1IC7L 3MJ7B 2CKBA 4OCNC 3PJSA 1WBZB 4HFUL 1UYWL 2XY1A 3OZ9H 5DO2D 2H41A 1DDHB 3RVVD 1U3JA 1P53A 1SJEA 3KVQA 43C9A 1QRKA 2JJTA 1OAXL 2LE9A 5E8EA 1Z0MA 3PXHA 4XTRC 3KPRE 4Q9CA 1HSAA 4G9DB 4P2RA 1NC4A 3O2VH 4X7TA 1VADA 3GHBL 1NLBL 5FGSA 4UTBH 3UZQA 3MLSL 1U2HA 2VDMH 1F11A 4N9OB 43CAB 4FZ8L 3IJSB 3HPJB 8CGTA 1MCNA 3WS3B 1CXKA 4Q7DA 3GIVA 4NRXB 3MV8B 3PWVA 4X6DF 4AK1A 4XVUD 1NCCH 4ZTOH 1HHHA 1S7UA 1YEFH 1C5CL 1HNFA 4KGJA 2CDFB 4I3GA 3CLEH 2ESVD 3R0MA 4AL8H 2W0KA 4X0KB 4EQ2A 2Z93A 1BBDH 1U6AH 4DGYL 1MEXL 2QKIA 4B41A 1GC1C 4I0KA 1ZLUK 4BSJA 1QSEE 2ZCKH 3S36L 4MLSA 4PJ8C 5GRJL 2J7LA 3CXDH 5TDOB 4V2CB 3ARDB 3MMEB 4PGJA 1T0MA 4G9FD 5SX4H 1HXMB 1LMKA 5DHXB 4AEHL 3CZFB 2BVPB 2H8PA 1AGDB 4KVCH 4XCYA 4JZNA 3IYLW 4HAFA 1S78D 1T1YA 4JN1H 4RMTA 4EVNB 1AD9B 1FAIH 1ZT7A 1U8QB 3RL2B 1FG2B 1RUQL 4GSDL 4KJPC 2GY7B 4U7MA 3EDEA 3GIVB 2FATL 4WFED 1KJVB 1YEKH 3OXSA 5D6CB 4OZHF 3U7AA 5DRXB 4NN6C 3MLZH 1MFDH 5TJWK 3O41A 4XX1G 5CJOH 1PG7H 2Z8WC 1IKFL 3SDCA 4JJ5A 1YN6B 3L3JB 2F53E 4JVWA 1RHHB 3I6GA 1K8DA 1T1WB 2XTJD 3MNZA 4UT6H 3NZHL 3BVNB 3GSNA 1HYSD 2HJLA 1XGTA 4N0FA 3QEUA 4YIQA 2C3HA 5I6XB 1ACYL 4TSBH 3RPIB 3QISA 5TF1L 3ZDYF 4PY8J 1T03L 5CMAA 3U4AA 1UA6L 5F44A 2P46B 3OR6B 4K8RL 1I4FA 4MWFA 2VXUL 3HAEB 2AS5M 2PXYB 3RL1A 4HJJH 3BP7B 5TQ0L 5DJAA 2QR0A 3EBAA 2DQCL 3EJJX 2H32H 2FECI 4RAUA 4DCQB 2WV3A 5HHPB 1FBIL 3ZTNH 4RGND 3JWOC 1GIGH 4PJCE 4JFYA 5CZVL 1SVCP 4JB9L 4Z7VF 1PG7W 1FGNH 4G5ZH 4HJGB 2X40A 1SM3L 4NPYA 1QQDA 1X5ZA 2C1PA 4GKOA 1RJYA 4OD2A 3VFGL 5FHAH 4DOHB 5B4MC 2AI0L 2LFGA 3TV3H 4PBXA 1EFXB 5KSAB 3SGEH 1FPTL 4OIIL 4OLUL 1B0GA 2ZOLA 2VLLB 3GMOB 1TJHH 1TPXB 2DBLH 4KK8D 4XVTH 4Y5VA 1N6QH 3H6JA 3EYOB 2X4UA 4XNZB 3VFSA 5CKGA 3CFDA 2FZ3B 3JSSA 5I76A 3KPPB 5CILH 2D9QB 1KIUA 4QXWA 3O11A 2I9TB 3SDAB 5DUBA 2DWEB 3C2AH 2ESVE 2XPGB 4K8RC 3BZDA 1MLBA 5DJ6A 4PG9B 2VLRB 1U3ZA 3CVHA 3RU8L 4X9IA 1NBZA 4LRIC 1YPZF 2BXZA 4AY0A 1UB5A 2VB5A 1JZ6A 5J6GB 4MNHA 1IAIM 1KFAH 4TNWK 3MGOA 1A3LH 1JRHL 4F7CB 1T22A 2X44D 4IS6B 2D4FA 3CSGA 4JPVH 5EU7E 2HN7B 2R4SH 4OD1L 2R0LH 4NT6B 3HMXA 3T0EC 2X1PA 3QH3B 1UEMA 5EU3B 3MRMB 4KI5C 3E2HC 5DD3L 5DD5H 2J6EL 1GOHA 4GAGL 1G7IA 2YA2A 3TIEB 5BMFL 4FFZH 3ULVH 5D72L 3HZKA 4P2QB 3DURA 2HJFA 5FHBH 5ESAA 4GKNA 4TVPH 4U3HA 1RZKH 1N6UA 2HLFD 4YHKH 2HT4D 2X4OA 5F71A 5CD3B 3Q1SL 1S5IH 4K3JH 4GQPH 3OKDB 4LCCA 1U58A 4NQEE 1E4KC 1JBJA 2SEBB 5F7EL 3CX5K 5IR1A 3V2AR 4JRXA 4LSPH 4AEHH 4N5ED 5EO0A 2YK1L 3BKML 5H37H 4ZFGH 4FQXD 4JFFA 4UIKH 1N0XH 4NNPH 1OP5H 4RMQA 2YBRB 3WLBB 1OCWH 1LVEA 3DETC 3NAAH 1NLDL 4Y16D 2W60B 1QBLL 4LHUA 4KAQH 4IBLT 4XCNB 1YC8A 3GSQA 3I84A 4GQ9L 5JOPD 3WKML 1RZFH 1U8MA 1S3KH 3ZSSA 3DLQR 4FTVE 1T1XB 3WFEH 2DQDL 2F58H 3SKJH 4OCMC 5CEYB 4I3RL 4Y16A 4N68A 1NUFA 1B0RB 2HJFB 3FHAA 3EOAA 3EDKA 1B2WL 1CD0A 2V7HB 3LQMA 2RAMA 2G75A 1DEEA 1KT2B 3HFML 4P2OA 4X5XA 1H8OA 1WLHA 5C6TL 1I9EA 4UDTB 4LEOB 1V5JA 3KPTA 1NFIA 4MB3A 4QOKE 5H2BB 3P40A 5D2LB 3ZYOA 2EZ0C 3EJZC 6FABL 2P4AB 1RJLA 4U1GC 1RI8A 3BRDA 1T0NB 4ONHB 5M7QA 3BD4A 4KWUA 4LP5A 3MRGB 5I1JH 4S1DD 4M02A 4U1JB 4UV7H 3VFUB 4K8RH 4RGOH 3RRQA 2ZCLL 1CK0H 1NUNB 4BQBA 3RBGA 5DFVC 2V9RA 4H1LG 2UWEE 4UOW0 5HVWA 2OTPA 3ULVC 4QWWD 4E9LA 2DLGA 2ICES 1EGJL 2EDWA 3QDJD 5KSBF 4FQXB 4X9GA 3CVHH 4XCFL 1MPAH 3GMNB 4X80L 2CDFA 4UB0H 3VD3A 5I30L 1LK2B 1RZ7H 1OAKH 3R1GL 2ED8A 3UJTL 3V7AG 3RWGB 5BOPA 3D39A 1E4XI 4XVTL 5IB4A 5J9PA 2P5EE 3M17A 4JZJB 3MO1A 1CGXA 1OSPH 2IFFH 3LN9A 5IJVA 4FFWD 2B0SH 5TDPA 5I1KL 3SO3C 1JNLL 2DL2A 4GW1B 3VXRE 1R3IH 3PWPE 4MCZB 5LVEA 3ZKXB 4LDEB 3W0WE 4BZ2L 2Z31A 4OCYL 3CZFA 3ARBA 1LP9F 5TPWL 5ADOL 3JVGA 2WUBL 1JNNL 1YEHH 2NY7L 5CGYD 1O0VA 2I9LA 2AK4A 3CDGA 1U3HA 5LGJA 4OGYH 4AT6B 3W0WB 3U4BH 3PUCA 4LOUD 5SV3A 3ZKSD 2XA8L 5GRVK 4G9FA 2UVEA 2D7PA 1K5NA 4QF1A 4I1NB 5DFVD 5KSVA 3NCMA 4ZS6D 2EE3A 5CS7A 2LAGB 1W0WB 1DFBL 1KLUB 2UV3A 3FB7B 3UJJH 4Y8AA 4KK8C 2ZG1A 1J0KA 3MLTB 2JLLA 4W70A 4XWOD 1BOGB 5ALCL 3L3DB 5D7LE 4PR5B 1CFVL 1E4JA 2ADJA 2Z8VC 1A1NA 4CVXA 3ZO0A 3MRFA 1DL7L 4JY4A 1J0ZA 5CWSA 3LKNA 5CGMA 1NGWA 1XEDA 4N0YL 1LO3H 3PWVB 2DQTL 2AXGB 12E8L 1J18A 4M1DH 4D9RE 3MV8E 4NUJA 3SDCB 2ENSA 2ILLA 3Q5YA 1HHGA 3OB0H 1NCDH 1T04B 1X7QB 3LS4L 2X4NB 1BBJA 5HGDB 3TO4B 1X5AA 4ZUSA 3GSNB 4KI1A 4OLEA 5GGVL 1PY4A 2CUHA 4M61A 4YXLH 1NMCB 4HSQA 2V5SA 4MA7L 3SE3C 3MLRH 3WO4B 1I7UA 1V7NL 3QEHB 5D71H 3T65A 3GFUA 4DKEH 3NPSB 5C0GB 2LU7A 1BFSA 2HLFC 4D3CL 1F45A 1CD8A 1ZT1B 1CZ8H 2GYSA 1FNHA 3CSYB 1MCHA 5L8LB 2L0DA 2DQCH 4X83A 3U0TA 4X6FB 1MCKA 3H0TB 2OR9L 4YWGH 3QPXH 4JY4B 3VA6A 4JY5L 2D9CA 2OM5A 4LSRH 5JOEA 3O9WB 2W59A 4IRSA 2P8MB 4W68A 5HSFA 1RSFA 1T3FA 2EDRA 4JJHA 1A64A 3IVKB 5FECB 4YLQT 4UBDC 2XOTA 1NGYB 1L9MA 1LE5A 1DQDL 2I07A 4OIIH 2H8PB 2A6JA 2O5ZL 4L29A 4XNUL 5EBWB 3KPSA 1D9KD 4TN9A 1UJ3C 2OJZH 3UBXI 2FCBA 5JO5A 3BXNB 1IARB 1INDL 1WBYA 3U36B 1NCBH 2YXFA 3L1OL 5DURB 3NFPA 4NFBA 5TFSL 2FSEA 4KPHL 4Y5YC 3NIDF 4XNXL 3VXUD 3PV7A 3FO0H 2GITB 3ARYA 3DV4A 4PGBB 5D6CA 3MREA 3RPIA 4UV4H 4TUOA 1F3DJ 1J8HB 4M7LT 1PDKA 4LCWA 2EIZB 4XCCL 5CBEB 1IAIL 5KOMC 5KBNC 3STLA 3IJHB 3BDYH 2OZ4A 3HPLA 3EYVB 1MNUH 3F7QA 3MRNA 1CLCA 1IC4H 4JEGB 2P8LB 2IBZX 5HI5C 1OSPL 2O5YH 1AXIB 1QA9B 5E8PB 2QHRL 5INCA 3ZDZF 3IGAB 1T3FB 4PYHA 35C8H 4KHTH 4M9PA 3T0ED 1NL0H 3ZHDA 4GKZA 1YEDA 5D2NB 3V5KA 5ID0B 2YD3A 2EDEA 2FNBA 2VXVH 2KH2B 3GSNL 3O6FD 1CD1B 1AH1A 1PY9A 2EDOA 1E28A 2JCCA 3UBXA 4P5TA 2DLHA 3IF1B 4WTZA 3VI4F 3CVIH 4KJYB 3TYGL 3HAEH 5GSRA 1SJHB 1WVZA 2AEIT 4DOHE 3U2SA 4CN1A 2NMSA 3O2DA 1H3PH 3OF6D 3Q1SH 1KPRB 2X4TA 4ETYA 1AGCB 5IEKA 4NC1C 1A7PH 5DJDB 3JBG7 1IC5H 3LRSA 1T6WA 1NC4D 4ZFGL 3WUZA 1WITA 4MYWB 4NNPL 3GO1H 5A1AA 5GQBA 1P4LA 3CFJA 4B0MM 3G6JA 3QIBA 5EN2A 4PJBA 1FC1A 5CEXB 4HIIB 1H8SA 4P2OB 4X5XB 3FT4A 4G8GB 1K3IA 4YC2C 4GKSA 4HGKC 4IIQA 5E2UH 1VFUA 3HZMB 4LHUG 4D0DA 4F7CA 3BH9B 4FG6C 3REWA 3GI9H 4JFPA 1F4WH 4XAWL 4PRDB 1FZOB 3NH7H 4RSVA 1T21B 2QTEA 3VFOB 4EN3A 2E7MA 4R4NC 4RNRA 3I50H 4CBPA 5DJ8B 3GSVA 4ODHL 4XVUC 5ICXA 3DSFH 5DJ0A 3KNBB 2VZVA 12E8H 4P2OD 4Y16B 2O5XH 2IALB 5FV1L 2AQ1A 2CIKA 4LCIH 2QSTA 2X1QA 1U8LB 4HG4J 4QRUA 3SGDI 3IFPA 4GKNB 2MKWA 4TYUA 2J8OA 2F54A 3HNSH 4LGRB 4GUPB 4ONOA 4K71B 3B43A 3HG1B 2EKSB 1LD9A 1I9RH 5L8KB 2BP3A 1CFNA 2OX5A 4ALAL 1TITA 2VR5A 4DKEL 4HBQA 4K8RD 4JPIB 3C5JA 1MAML 2IH1B 1A1OB 5MERA 3UAJD 3CFCL 4UI2A 2GI7A 4YAQA 1KN4L 2VLKD 3BPCB 2QADC 3QPXL 3UP1A 4QHLB 5ETUA 3GMQB 3AM8A 4JFED 1QLEH 5DEGB 2B1HL 5DHVA 1AGFA 4C58B 4ZFOL 1CR9H 4NO2B 1IGMH 4XP1H 3MGTA 1HHKB 1TCMA 2PO6A 4XVSH 3AGVA 4NGHL 4ODVL 4PJBF 5EO0B 5DUML 2Y72A 4K3HA 4C59B 4TUKH 1PEWA 3H2WA 4KY1L 4C4KT 3LOWA 5J11B 3RY5A 3MJ7A 3OR7B 1IILE 5I8OL 1MEXH 4UDTA 4HS8L 4PLJC 3M1BA 4QRQA 3FAXA 5DQJA 5AEAA 1WK0A 3PQYE 3EIFA 3MRQA 5E6IB 4BFIB 5LQBL 2ICEA 1EVTC 1K8IA 2R2EB 4BZ2H 5KZCB 4W4OC 4BH7A 1U8HB 1B0WA 3K8MA 1IEAA 1S7SA 3BZFB 2J5LB 1HH6A 1WWCA 5GJTH 1U92B 2XKNA 5C0EB 1I9JL 2P5WB 1XIWB 4LIQL 2MMXA 1PKQE 2HKFH 5SX4I 4YQXL 5A3ID 1JWMB 2FR4B 4KVNL 4WI4A 2CPCA 3MZGB 1M7DA 1JYNA 1FYTE 4YHNA 3KWWA 3PWNB 4I9WE 1OGAB 3MV7A 1ZS8B 1RJLB 5HYJB 4RFOH 1QSZA 2VDQL 3UTQB 3CLFL 2IAMA 5ENWB 2KZWA 3RWEA 4KKCC 2ICWJ 5I73B 2DYPB 1MFEH 5ALCH 4ZNEA 4N1EA 3KDMB 1GZPB 4MNGA 3FFCA 2FHCA 1GXEA 5IK3B 4UTAL 3QIWB 4H5SB 3N1MC 1M71A 2R9HD 1CXLA 5J9PB 4HUXA 4U1LA 2DIJA 2R2EA 4WO4C 2VMFA 1CTNA 3SPVB 1OF2A 5IBUB 1ERNA 3QUXB 4XNMA 2HVJA 3FAWA 1K4CA 4HMEA 3DVFA 3F7YA 4JO1H 5J11C 4JRXD 1KNOA 4PV9B 5AG8A 1AC6A 2GT9A 4PS4L 4AQOA 2FYYB 3RWCA 3EYQC 4FQXA 4JFFD 1TVHA 3T0WA 1AQDB 5DYOB 5INDA 4PRPA 5E94A 2JIXD 5T33H 5IBLD 2XFXA 2VDOH 4MJ2A 2M8XA 3SDXB 3VWKA 3HS0A 1NAKH 2XY2A 5HD8D 1QUNA 2VQUA 4TULL 3GI9L 3INUL 4QXGH 3VXPA 2FO4B 5GGVH 4NBYB 2I26N 1KUMA 1T5XA 4XVJH 5I74C 5IWLC 1OAXH 4PJAF 4G6JH 3H9SE 1EEYA 3OAUL 4GS7B 5HI3C 2UZYB 3RWJA 3AY4A 3T3PF 3L7EA 3OXRB 3O3DB 3PL6B 4M62H 5F7WC 5J7CC 1FAKT 1V3LA 2F8OA 1PZ5B 4J1UA 1NMAL 5T5FH 1OVZA 2VDPL 1A4KA 3ARFD 4KKCD 1C7TA 3RTQA 4KMLB 3QIWD 1WZKA 3FRPG 4OFIA 3MCLL 5FCSH 4LASH 2VDML 4WW1A 4JY6A 4PP2A 1MFNA 5FDWA 2XQYK 1CLYL 2Z0BA 3PNWB 1WFTA 1S9VA 3DX7A 2VAAA 1DLHA 4CNIB 3ULUD 2A74A 4PUBL 1JK8A 1A9EA 1MAKA 1GGTA 1HI6A 1IRAY 4FN0A 4HCRA 4NCC1 1L6ZA 2EIZA 5CBEA 4NRXA 2O5ZH 2UYLB 3PABB 1ZGLA 4WWKC 5D93B 4Z7VA 5AUMA 1WC7A 2E8ZA 4JFZL 4PJXE 1AKJA 5ELIA 4JFEB 4YBQC 4N8PA 1KFAL 3DHJA 5CCKH 4N5EC 1MF2H 5E8OB 5IVXB 5TFSH 4TOYL 2EDJA 1WBYB 1UM6L 4OZHA 2NXZD 3DO3A 1YEDB 1KXVC 4U49A 3RUGB 4PRHA 1YDPB 2FLRT 2CR3A 2NYYC 3EAKA 2BCKB 4PJ5E 2WSKA 1CR9L 4F2MB 3DX6B 4EKXA 2NTSP 4JZNB 4JJ5B 1EIBA 1PLGL 1F2QA 3RWIB 4PJ7F 1KC5L 4JN1L 3FT2A 2Z91A 3CGTA 4KVCL 3X12B 1GGIH 1MJJA 3KS0H 1SYVA 1SHMA 3HC0A 4G9FE 1X5GA 3O2DH 4EEEA 4PGZA 5B22A 4PJDE 5DQDL 1ZT7B 4K9EC 2FATH 3WD5H 3RL2A 5DUBB 4U1HB 5B3JE 5DJCA 1MFDL 1E6OL 1XF5A 3KHQA 1YECH 3KYNA 4LKXB 2G60H 3BH8B 2WM0A 1CGWA 1K8DB 4NZJA 1RUAL 3ECBB 4CMMA 5J1TC 1U91A 4JLRA 1IMHC 4IS6A 2J88H 5BZWB 5JO5B 4N9GA 4JGJA 4XZUA 4JFDA 1U8QA 2DLTA 2CDEB 3V4UH 4WI2A 4KC3B 4PTUB 4JFYB 2IPUK 4MDIA 3GSWB 5KW9L 1KCUH 1JGDB 2WP3T 1OM3L 2XTLA 2BNQE 1WCBB 5E9DA 4K55A 4U7KA 4X7SL 4LLYB 4J4PD 3PE9A 4HH9B 2X4SB 3TT1L 4HJ0D 3TZVD 2B4CH 5AZEH 1RIVH 4C54A 3V6ZB 3IRPX 4P2QD 3RZCD 5C6TH 2R15A 3T2QA 4ZPVB 3T09A 1TETH 4OLWL 1Q9WB 1ORSB 3NFPB 5E8PA 3L5WA 3SGEI 1NCNA 1ZGLM 5HHMB 1M6OB 1RJYB 5C0BB 4IDLA 4L4TD 4XT1C 5ERWA 1DSFH 1I8MA 2MOVA 4FNLH 1YPZA 3BEVB 3BUYA 2K7PA 4WFGE 3CH1A 1JV5B 3IJHA 2AJVH 5CBAB 5DGRA 3MBXL 3OWEA 5D1ZC 4YGVB 1JIBA 1G9EA 2ZG3A 5BVJB 5GSRB 4M7LH 3QXTA 1DBBH 1JGUH 3H7BB 2I25N 5FGBA 1A7QL 1XCQA 1YY8A 3P3YA 5E4EC 3D3VA 3MLVL 3MROA 5HGGS 5HVHC 2Z8SA 2YZ8A 4NZTH 3V5KB 4BZ1L 2I5YH 4HH9A 2FEDD 3WDHA 1JRHI 4AEEA 3ARPA 4CN6A 4WHCA 4NSKB 4X6CB 4JRYE 5D70L 5FK9A 3WDIA 4FXLA 2ZUTA 4AMKL 5GGSY 5E08H 5BW7C 2G75B 5F96H 3CFCH 4LVHC 2R2HB 1CL7H 1Q0YL 5CP3A 2ICCA 1BGXL 3BPNC 4JPVL 5IG7A 3IKCB 1T1WA 3TO4C 1RZ8A 4PJ5D 1CVRA 1EXUA 2X4RB 2MFNA 4I13B 3GKWL 4KI5F 4YK4B 3QCVH 3B3IB 3A67L 2J6EH 5I71C 5LXGH 5DT1H 5IB5B 1DANT 2EYTB 3GMPA 3EO9H 1AR2A 4XPHH 1UKTA 1TQBB 4LVNC 2BHZA 1JNJA 2FWOB 3FB5A 5JXED 3ULVL 1O5DT 3BDXA 3VWJA 1WZLA 1WAAF 3SO5A 5GGTA 5GXBB 2BC4A 2FEDC 2C7UA 4JZOB 3VW3H 4OQ1A 3RVVC 3BZ4B 1MHCB 1WTLA 5I75C 4V2BA 1TDQA 2B4CC 4O51A 1ED3B 4XCEA 3VJ6A 3EFFA 3BQUC 1S7WB 4NP4L 5DMIH 4MHHI 4DQOL 4M3KB 1CDHA 5CEZH 2R1WB 5CJOL 2D2OA 2NY5L 4O5LH 2RB8A 4NO3A 1FYHB 2HKFL 1RJCA 2CDGB 4EDWH 5IK3A 1P6AB 4QGTA 1U8PB 2DM4A 1G1YA 2V2XA 3C6LD 3TM6A 3TEUA 1EUUA 1D9KB 1JPFA 4KMTH 4YUEH 5DQDH 3WD5L 1P1ZB 1I1AC 3WKMH 4RMVA 2IPTH 4ZAKA 1U8NB 4IJ3B 3FCTB 1N4XH 2DQJH 1F4HA 4PJ5B 5J13C 5I8KH 1ZLWH 1HILA 4DKFL 4HW6A 4QOKA 3NACH 1Y18B 1OARL 4KKAD 5F89A 1S5HA 3O2WH 5KVEL 1OQOA 1NFIB 2HRPL 5H2BA 3TA3D 3GJFH 1KT2A 1ED3A 4XCEB 5I1CL 4CADA 1X5JA 5KSVB 5D4QA 2XI9A 3EDJA 1KPUA 1TZIB 3O8XB 3KXFB 3ETBF 5D1ZB 3TYFB 2Y23A 4M6OH 1Q8MA 2EO1A 4D9LH 1F90H 1XGUA 5GGUA 2V2WB 3NCFB 4B5EA 1RHFA 1CFTB 2XWBA 1FIGL 2VDOL 3AS1A 2QBWA 3SY0A 4R6UA 3VFUA 1OGAD 2F9BT 4X7DC 1RIHL 1AY1H 4PJIA 2VDKL 4QRPD 4CU6A 2F54E 2NXYD 4IHOA 4QXTA 1RZIB 1FFQA 3WN5B 2CGRL 2X4OB 1N5YH 5C0ND 3T0EE 4NUGL 1YA5A 2CRIA 5E8DH 2A74B 2VLJA 1TVBB 5BS0D 3BPOC 4WRLA 4Y4FA 4F57L 4JFXA 5EIIB 1YMMD 4I4WA 4JRXB 1LO4L 5BO1H 1NSNL 3NCBB 3D5OF 3EZJB 1PKOA 1KIRB 3RU8H 3RWEB 1WC7B 3T2NL 1NUDA 3L5XL 1PZ5A 1U3HD 4J1UB 4CU8A 5EH1A 1CFSA 1MHHB 3PWPA 3RWGA 3IDYC 4QT5A 5HI5D 2VKWA 2OJEB 4OSUL 1BJ1J 3PGDA 3OBAA 2VIRB 2HT2D 4MAUH 4QTHA 1KB5B 4GG6E 5L7XL 4YGAB 1G7JB 4XNMB 2R4RL 4HJ0C 1Q38A 5DD5L 3DX6A 5TPWH 4GW1A 5HHME 4Y5VC 3D9AL 4TUJB 1A14H 4G8EB 2IAMB 3GHEL 4FFZL 5ENWA 1PSKL 1K2DA 3LD8C 4L9DA 3TBTA 3N50A 5E08L 3L3DA 4R97C 4G8FA 1RVFH 4KRNA 5ICYA 2AK4B 4LBEB 1V3JA 5DJYB 3MRFB 2CH8A 3Q5OA 4H0HB 1IE5A 5C9JB 1AFVL 5HHOA 4WDIB 3AC0A 3QFDB 5GPRA 2AXFA 1W0WA 3D87B 5C70A 5K59F 4TPRL 3ZSTA 4R97B 4BQ8A 5KS9A 1NC2B 3DXAA 4LPXA 2F8XC 4JREC 1XCTB 1FFNB 2YA0A 1YQVL 3RZCB 4RFNB 4EI5C 2BNRE 2MQCA 3RGVC 3TZVB 3RDTA 2W38A 1J9CT 4YO0B 1F4YL 2MPAL 4R8WL 3LIZL 3FQRB 2VOTA 1A3RL 1RUPL 1UKSA 3KPRA 4GW5A 1V7ML 1W8NA 5FGCE 1HNGA 4MD5B 4D0BB 2XQBL 5EOQH 3D39D 3KG5A 1Y6KR 5DO2C 3GSXA 3TZVC 3VXPB 2OSLA 4HCRL 1TPXC 3K4ZA 3TN0A 3EZ8A 1FRGL 2YEZA 2AABL 2BVYA 3QZWG 3JV4A 5ADPH 3B83A 2AXGA 3VGGA 5F72S 1RV6X 1I3RA 1QPXA 4I0PD 4M1DL 3TBTB 4X4ZA 4Z78A 3OB0K 3U4EA 4TQEH 4B50A 1IGYA 15C8H 4PJGF 5E2UL 1UVQB 1Y0LB 1M1SA 4WVRA 3NCCB 4JFEE 4P46A 4PY7B 1N8ZA 1NBYA 1OAZL 5GZOD 4HFUH 3DMMA 4BQ6A 4WJ5B 1NDMA 2QL1A 4BH8B 4NWUL 4WO4D 4E41A 3QJFA 2CXKA 1ZA3B 3MRBB 4GRLD 2CLRB 3PWUB 4QRPE 1CL7I 5M94B 1WAAA 3C6SA 1QSEA 1VERA 3BZEB 3TO2A 4HIHB 3EW3B 3F7VA 1GVIA 1AI1L 3MLYL 2C3XA 4HWNA 1F58L 4O58L 3LPWA 3GBML 3BHBA 5HHXL 4E5XB 3TFKC 3CFIC 3LDBC 3VFVA 3U36A 5IWLA 3HE6D 4AQ1B 2XTJE 2X1WL 5DJZB 3MOQA 2GCYA 4P23D 1JNHA 4MA8H 4NKIL 5KS9F 2HLAA 4IIQC 4P46C 2UZIH 2YEZB 2FIRT 5BV7B 4LSRL 3MREB 2N4IA 3ULUL 5FECA 4PY8I 3O41B 2Z8RA 4XH2B 4OFPA 3VE0A 3HE6A 2BNRD 3MV9A 4N8CH 1HXYB 3W2DL 2C4XA 1BIIA 4PJ8D 1L0XA 3IDIA 4GRWH 1Q1JL 3AU1B 1CDYA 4NKDB 4FMFA 3WKNA 5EOCH 3CFEA 4WFHE 3IKCA 4AL8L 4YHML 5EBLA 4YPJA 2C9AA 2AK4D 1F11B 3DO7A 2LTQC 5HHPA 3GMRB 5I1KH 1IAII 3CFKA 4RGNE 2E6PA 4G42B 1ZXQA 5IFJA 1T21A 4K7PL 1Z3GH 2Y4SA 5IP4A 2PXYC 4S2SB 4UNVA 4APQB 5C0FA 4NQCB 3LN4A 3JTSB 3TPUB 4XCCH 4LHQB 5DSCA 3MA9H 4UV4L 4LSUL 1RUKH 4X4ME 5F7YC 1T1YB 2LAAA 3FB5B 3ROLA 1YY9C 1G7QA 3ARDC 4P4KA 1MVUB 4OI7A 2XYCA 3LB6D 2X4UB 3V5DB 3TBWA 3X11B 5BJTB 1NEZA 4HDIA 4YHZL 2RGSA 4X0KA 4ZO6A 3K8KA 4JM4L 3QFJB 5F21B 2BY1A 2APFA 4OGXH 1FV1A 3VJ6B 5DMGD 2QADB 4YHIB 4JHAL 2P44B 3U7YL 4ENED 4LVOC 5KSAD 4HJGA 2J3SA 3HNVL 2OTUB 2JCCB 1DEDA 4L8DB 4QEGA 4PJIF 4KV5F 3V7MA 5MENB 3SDXF 5EU6A 4NN6B 5GS0L 2PCPB 4LPYA 4YNYB 5I8EB 1UFUA 4BJLA 3ZKNC 3ZZ1A 3K3QA 2GJ6D 5KSUA 1IEHA 1KJMA 5DEZA 4QHUB 4K71C 3W5MA 4XXCC 4Y2DB 3BZ4A 1XGQA 1U8NA 5IEKB 4LGSB 2RIKA 4X5WA 4I0CC 5IW1A 3EJYC 4M3JA 1AR1C 1BQLH 5L0QC 3QIUD 4PJBB 2CIKB 4EDWL 1QACA 2DQUH 5BRZE 3LIZH 3QXDB 5GS1A 3IT8D 4PLJD 5HYSB 1TENA 1EHLH 3NH7L 4JFOA 3RHWF 2P8PB 1XCQB 5HI4D 3RVWD 3NFSL 5IMMB 2PYFB 1CLZL 4ORGA 1LO5B 5T1MB 3KYOA 3VXMD 3Q3GA 1HHJA 5JPNB 3DSFL 3KS0J 2EDLA 5FK9B 3THMH 1QNZH 1CZ8L 1JYXA 4KKAC 4U0QB 1H3TA 2VN7A 3G6JF 4NRZB 4P5TD 1GC1H 3W11D 4X6CE 4ZXBD 3D0LA 1CLOL 2F19L 2MHAA 3AXLB 2W1NA 3F5WB 1XGYH 5IKCA