1OTUD

Structure of the escherichia coli clc chloride channel e148q mutant and fab complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated ClC-type chloride channel eriC
publication title Gating the Selectivity Filter in ClC Chloride Channels
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 47
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1otuD01
2EDWA 2J8HA 5T3ZL 4ODVH 1BLNA 4Z0BH 1CFVL 5D9SB 3LQZA 4JHWH 5A2JH 4XP9L 4UTBH 1JJUA 2AK4B 4H1LH 4G6AD 3QHZL 2BSRB 2NYYD 1KB9J 3ROLB 3LPGA 2F15A 4IEFB 5FUCE 4OTXL 1T5XB 5EZIH 4Y2DC 3BUTA 1ED3B 2WQ8A 4FQ2H 4C4KO 4PJIB 1CLYH 2BC4B 3L3IA 4ZXBA 1RUAL 3D2UD 4LCUB 3PWUA 3DUUB 1XCTA 1BFOB 4P2OC 2DL9A 4ZO8A 4AYFA 1XGRA 4RWYH 3UYOD 4WDIA 5EIQA 4G7YL 1WK0A 3W0WD 3V79C 5KW9L 1F11A 1UVQA 3IRPX 3C2SA 5IQ7L 3BKML 1E28A 2FD6L 25C8H 1QO3A 3KPRE 4MD5A 2EEDA 4IRZL 2YR3A 3WO4C 3GM0A 4JRXB 1QFWL 4OD2A 4F80A 1XGTB 3P73A 2VWEC 5ENWA 3K81A 5DTFB 3EDEA 4WEUD 1LP9F 4ONFL 4DGIL 4FQXA 4ZQKA 3VCLB 5BZWA 3ARQA 2H32A 4W6WB 4PJFE 1I3RB 3MOQA 4PLKC 1C16A 5DFVD 4PGCB 3D6GA 3GKZA 4S10A 1QEWA 4NKMB 2MCG1 1OTTD 3VFWA 1RD6A 2NXZC 1AGDA 3IF1B 4JY4A 5DDHB 1QLRB 5I73B 4R4NC 3SDCD 2XTJC 3LAFA 1WWAX 4QRRA 2VJXA 4HBCL 3E2HC 1NBVH 3O0RH 5JXEC 4ZS6D 1A1NB 2VLKB 2YD3A 4JFEB 2YPLD 4P23A 2J8OA 3QUXD 3B9KC 4XZUA 4NNYA 1JRHI 1MCPL 4Y5XC 2LQRA 3S37H 4PGBB 4TOYL 2X4UB 4XVSL 3KYKL 4MQ7B 2J88L 4J12A 2NR6C 4YDIL 1QLEH 3VMNA 2Y06L 2IMNA 2HTKC 4O4YH 1JF6A 2X10A 2O93L 2HWZH 4EDWL 2WQRA 4LSSH 1U93A 2IAMD 4IM8A 3FB7A 1LMKA 3UP1A 4XPFH 4LU5H 2OR7A 2DQDL 3QDJA 1EZVY 5E00A 1CS6A 4WHCA 1NMAH 4K8RL 2GFBA 2XTLA 2ZG3A 3UPRB 3VGAB 3BP5A 3CSGA 5IF0B 2DKUA 1KIRA 4WWKC 3LEVL 1H8OA 2DM3A 5ILTL 5IMKA 4G8GA 1ZSDB 4PD4K 5CMAA 3EJZC 2F53D 3NBNA 3MV9E 5ALCL 3WKMH 5EIIA 3SGKC 1UWGL 2JB5H 4IOFD 5C0FB 1KNOA 1ND0A 4GMSL 3O3EB 5FYKU 1CFVH 2MPAL 5DA0B 2R56L 5B39G 4XP9H 5FM5M 3WHE0 1J5OL 2EC8A 1MRDL 3QHZH 5ABDE 2D31A 3BGAA 3NPSC 2BVPA 4WFGD 5I8CB 5EU6A 1I8LA 4I3SL 1NFDF 4WW2F 3PDOA 4OTXH 3CSYB 2ESVD 5SX5H 5CCKL 1RJZA 4P9MH 5GGUA 4ZMAT 5FV1L 4CVWA 4QGTA 1ZK9A 1L7TL 1RUAH 1AGCA 5GRYA 1U8OA 4C83A 4M7KL 2HN7A 4JZJC 1P5VA 2G5BB 2G75A 4G7YH 4EN3C 3STZA 5I75C 1NH6A 4YHIA 4BSWA 3WUWA 5KW9H 4FFZL 2Y23A 1KOAA 3MGTA 5IQ7H 4JEGB 5CEXA 4B0MM 3P40A 5IB4A 5F89A 4UZGA 3TIDB 1QFWH 1I1AD 3OQ3B 1ZVYA 1BEYL 2EIBA 2FX8L 3JV0A 5GRVL 4HCRA 4DGIH 2GAZB 4ODXB 3FT2A 1K4CB 4U6XB 4GKSB 3KLDA 3DSFH 4QOKA 2DMCA 5E94A 5HY9B 5MENA 5C0RH 4GBXA 2A9NL 5IV2A 3MLWL 5DS8B 3DRQB 3N85L 4I0PA 3W11C 4JGJA 5ETUB 4P5TB 3V8CA 5DEFB 3VGHA 3CAFA 4F7EA 1FC1A 2NCMA 3U83A 2W0PA 2R0LL 1Z9MA 2CO7B 5E8DL 4HBCH 3BPLB 1F90L 1ZA6A 4KKAD 5AG8A 1Q1JH 3NIGE 5FECB 3O45A 1MY5A 2X4NA 3EOAA 1C5DB 2F8OA 3FKUS 2N1KA 1HKLL 4MJ5B 1MCPH 3CFKA 1SEQL 4MQSB 3ZE1E 4TOYH 2FJFB 5J89A 2GJ6E 3DHMA 4XVSH 3KYKH 1G7MA 2J88H 1UZ8B 3L7EB 4YDIH 4RAHA 4OI7A 5AG9A 2ZCKL 1FIEA 2Y06H 1NCCL 5A3IC 4BZYA 2GTWB 3GSOB 4EDWH 4HMEA 5LWYL 4UOW1 3BIKA 1T0NA 4PRPD 5FB8A 2DLFL 2DQDH 4NRYA 4LCWD 4NWUL 3BZEB 4P57B 5D7KD 4MDIB 3UTSD 4YQXH 4GW1B 4NO3B 5I71C 1N0LA 3IDGA 2R2EA 3NVQA 3V5HB 4X9IA 5HHQA 2Y9RT 3LMJH 4Q9QH 2DKMA 5DI8A 5ILTH 3QO1B 1JYVA 4OM1L 4Y4FB 3SY0B 5ALCH 4PG2C 3DX8A 1CK0L 2NW3B 5L6YL 1KELL 1UWGH 4K7PL 3TO2A 1ZAGA 2JF1A 3IGAA 4GMSH 4ZPVB 2CJUH 1HHKB 2R56H 4JFFB 4NQTA 1IM9D 4ZAKA 3AREB 1J5OH 4JY5H 4H0HB 5DD6B 2OTPA 4MJIB 5EC1A 4X6FB 4LEOA 3DX6A 2OX5A 1PZUB 2QADB 3SHSA 5EO1A 1NEZG 1NBZB 1QFUL 3P9MB 2NY0B 4Q9BA 4H20L 3ULUF 1YEKL 1YMME 5E8OB 3TN0B 3QZWB 3O3AB 1L7TH 4MHHI 1JGLL 1UA6L 1GGUA 1GVIA 2XG5A 2VDLL 4M7KH 4LLVB 5J57B 1CQYA 5LXGL 5EO9B 4P2QD 2O5XL 4FFZH 1WITA 3BWAA 3NCEB 3TVMB 4U05A 2FGWL 3RY4A 1C12B 1NC4A 2BVEA 2ZPKL 3KWWB 5K59E 3S3SA 3CDGA 1BEYH 2JK5A 2X70A 2FRGP 2HYMA 4U6HB 3QEGL 2FLBT 2Y36H 3VW3L 5C09E 4MDJA 4EI6B 5BS0E 3HLAB 5FO8B 4AMKL 3TH3T 4N5EC 3VXRA 5C0CD 3BAEL 2A9NH 4FA8A 3MLWH 3WN5A 5KOVC 4UDTB 3V6ZA 3EZ8A 2H26A 3N85H 1IMHC 1Z5LB 4PJ5B 2ZCHL 5I76B 1KLUA 4XC1L 3RWDB 5CGMA 5C07D 1AGFB 4AM0A 3BISA 3DMMD 2D7PA 4QXTA 2QKIB 4ENED 2OJEB 1BD2D 1FYTE 2R0LH 3QIBD 2NY1B 1CIDA 2CLRB 5E8DH 3MACL 4EI5D 2Z31A 1F90H 1TJGL 1JWUB 5TE7H 4LSDA 4XXCA 2IANE 4JFHE 1HYRC 1G7PA 1FFPB 1OGAA 4K9EC 1YYML 1HKLH 3I50L 1SEQH 3MNWB 2EYTA 4UDUA 4IMLB 1KC5H 1LNUA 5DUPL 3S5LA 4DVBA 3LB6D 5KVMC 5GZOD 5BXFB 4C4KT 3QPQD 1VFBA 4NQED 2ZCKH 3QEUB 3GRWL 2EC9U 4NBYB 1MJUL 2B0SL 4ACPA 3PWLB 3QEQD 5F97E 1FP5A 4EXKA 1N5AA 5LWYH 2B7DT 4QF1B 3FOMB 3RIFF 4KC3B 2XQYK 2FH8A 3LKQB 4OZ4B 3TBSA 4ZFGL 3OPZL 2OSLA 2ZOLA 3U2SB 3T0EC 4PTUB 1PY4A 4IBLT 2GJJA 1MRCH 5JW4N 1JZ4A 1I3GL 3SKJL 4HS3A 4LOUD 2W9EL 1L0QA 4ZOCA 1Z9OA 4NKDA 3B9EA 4FFWD 4WFHD 4NQXA 5DVNA 2Q8BL 2IGFH 1W0VB 4Y5VC 3QDMB 1TZGL 4G7VH 4X0KB 4P59L 5C6PB 1QKZL 4LSPL 2HFEA 4OCRL 1S9XB 3AB0B 5EBWB 3ZMRA 2R69L 5E6ZA 4K3DL 2AK4D 5KSUA 3I02A 1S5HA 4HFUH 2X44D 4G43A 4JN2B 2E9WA 1G1CA 3UZEA 4EKXA 2BVOA 4WNQA 3UDWC 5ANMB 4Y4HA 1QFUH 2VMFA 4LCCC 1KPVA 1QSVA 3GMQB 1LGVA 2BERA 4H20H 2VE6B 1YEKH 1EHLL 2C7UA 4NHUA 5L88H 4B5EA 4PGEA 4M61B 4RMWA 3RY5A 3VXTB 1UA6H 2R23B 3MLTB 2VDLH 4J6RL 1HHJB 5LXGH 1M7IA 2PXYD 3V0WH 1FE8L 5JHLL 5LBSL 3T2QA 1YPZA 1CD1A 1OSZB 2FGWH 4FFVC 3H7LA 2V6HA 4GSDL 2ZPKH 3EYSL 1FRGH 2E3VA 4IIQB 3WFHA 1QTYT 2PUQT 2CR6A 4HUVB 1T1YB 3QEGH 1V7NL 3CFEB 3VW3H 2SEBA 5HGBB 4V2CB 1RHHB 2P4AB 3WUZA 2GK0A 4TSAL 4AMKH 3T4YB 4JKMA 2JKXA 3TO4A 5HI3D 1TNNA 3BZ4A 3S7GA 2ZCHH 4X7TA 3S96A 3IDJB 4XC1H 3AAZA 3U4BH 2FGZA 3SGJA 5HDLA 3ZTNL 5DSCB 1IGFH 1ZLSL 5F6IC 2YK1L 4BSJA 1FL3A 5B39A 1MHPL 4KI5D 3LHPL 1U8IB 4JFED 1HHIA 2VLKD 3UBXB 3KYOA 4JRYE 4X99B 4YPGB 1TJGH 1BIIB 5D2LB 3SCMA 3BPNB 4KV5F 1XH3A 5K9KA 5K9JL 4PG9B 4MWFB 1YYMH 5MP6L 5GSVB 2CIIB 3I50H 3WEXA 2WP3O 4M7ZC 2PF6A 1FH5L 5DUPH 3HI6L 1MJ7H 4MNQE 3SDAC 1INEL 5I9QC 5C0BA 3GMPA 2XN9B 2F58L 2YZ1A 3KHOA 3PXHA 2PTTB 1CICB 4PP2B 3GRWH 4CVXA 4UNVA 2WSKA 1DSFL 1MJUH 1UB5A 2B0SH 5GISH 4QWWC 2HMIC 3DVFA 3N1MC 1GZQB 1RSFA 3FQXB 4L29B 4OCXL 4Z7WE 5CSZB 5ICXA 4ZFGH 2JCCE 5C0EB 4U1MA 1QSFA 2L0DA 5ACMA 1G6VK 2XWBB 4WEMB 3PABB 1W72L 3BX7C 2Q86B 1HNFA 1RIVL 4ELMB 5BJTA 4I9WD 2W9EH 4LVOB 3W9DA 1FFQA 3HE6C 2YPKB 3JWDC 2A6KB 4X7SL 4DZBB 4X4YB 3MV8A 3WIHH 1TZGH 2GJZA 4GS7B 1I9JL 4P59H 4XXDA 1QKZH 4LSPH 4OCRH 4WY7L 5C3TA 1RI8A 1BOYA 2R69H 2QL1A 4R0LC 4K3DH 3EYOB 3RGVA 1X3DA 2HA1A 4OFKA 3QFJA 1SYVB 4HXAL 2DWDB 2LU4A 1MJJB 3B9DA 4CJ1A 5DXWA 1D5MA 4X6BA 3TJHC 5EN2A 1B0RA 4Y1AA 2GEEA 3PWVA 3DXAA 1DQLL 4OB5L 4P3CL 3MODL 4NQDB 3O4OC 4HWEH 4JFYA 1PY9A 4E5XA 1EHLH 2FR4A 3VFPB 3VWKC 1A5FL 1QBAA 4X4MA 2WBJA 1L0YA 4S1DD 1VA9A 43C9B 5I6XC 1OGTB 5IMMA 3K1KC 3TNNB 4F9PA 1MCIA 2A6JB 1FE8H 3ARGC 2ZUQC 1LO2H 2EDKA 4JGMA 5JHLH 4GMTL 2J1KA 4GSDH 4LSVL 2VERN 3OKOB 4LAQH 3U46B 2WLYA 1OAQL 4HK3N 1P2CB 1F3RB 4WGVB 4ZDHA 5DMKA 2KQMA 4RFOL 2M1KA 4TSAH 1HI6A 1FZOA 1NANH 5EPMB 1EO7A 1UWXH 1HE7A 2G9HA 3C6LA 3VXSB 4N90D 4D9LL 4ZFFB 1YPZF 3H9HB 4LF3B 2IF7A 3PV7A 4BELD 1MCHA 4OJFL 4J3UA 4OFPA 4P5TD 2BZDA 3MZGB 4ODWB 3H9SB 3ZTNH 1CDHA 1QR1B 3MBEC 3OXRB 3TCXA 1ZLSH 3Q3GB 1MLBB 2E5EA 2YK1H 3KGRA 4Q74A 1ZHLA 4ETYA 1TCRA 4M5YL 1MHPH 1TTGA 3U30C 1K2DB 3QDGA 3DETC 4QHKJ 3VDCA 2BY2A 5F96L 1MHCB 1A4KA 5T33L 5K9JH 2NX5E 1NEZA 2XV6B 1QSEE 4D8PB 1DUYB 3BGFC 3C6SA 3HE7A 4H25A 5C92A 4IRSC 1FH5H 1MVUA 4YDKL 3HI6H 1E6JL 3L3KA 5E4EB 3T0DA 2BNRB 2GTZB 3MA7B 5E9DE 3PNWB 1ZHNA 5KS9E 1KXVC 2X1WL 1JHTB 1JRHL 2XZAL 3RUGA 2YBRA 4U1NA 4RBPK 3HZMA 3OKLA 2VR9A 2VLJB 3JTSB 3FONB 1D6VL 5EZLA 1QG3A 1CL7I 1KGCE 2CH8A 5GS0C 5D5ME 3QEHB 1A4JA 2X4SB 2F9BT 3AMKA 4QRUB 2D4FA 3W0WA 1DN0B 1W72H 5D1QC 3KPSE 5C0JB 1U92B 4R96B 4HG4K 1YMHA 5IHLB 1X5AA 4KZDH 4YHPB 1FGVL 4X7SH 4CMMA 4XP6L 4Y4FD 2ICEA 3IFOB 4FZEL 2VKWA 2P24A 1T1WB 3BMVA 1YA5A 4NRZA 4WY7H 1CVSC 5IT2L 1VEPA 4Y16D 4X7DC 5E8PB 3ARED 4WO4B 4HIJB 3GBML 4MJID 5ACZB 5JIIA 2NW2A 4Z76B 4PJ8C 2OXGA 2NXYC 2QADD 1WWCA 2NY0D 5LKNA 5IB3A 1SEBB 1DQLH 4OB5H 5ITFB 5SX4I 8FABB 3P30L 4P3CH 2A77L 3TN0D 2WIIB 3MRBB 4JM2A 1QFWM 3W5NA 1A5FH 5IJVB 4L4VE 5GZNC 4XGZA 4W68A 2I9TB 4HK3J 2QQKL 5CJOH 1WIPA 4PJHB 4CN4A 3TCLB 3HUJB 1H3PL 5IB5A 3TVMD 1Q9KB 3OWEA 1P84K 3LKSA 1XGUB 3MPCA 4GMTH 1JNJA 5DYOB 4W4OC 2FSEA 4KRPB 2V7HA 5IEKB 3N1PC 3H7BA 1EFQA 4EBQH 5CJXC 1H3GA 1OAQH 2IAMA 4AT6A 5A1AA 3UEZA 1FJ1B 3WO4B 1U8MB 4RFOH 5A2IH 1OARL 1R3KA 3K74B 5BRZD 2YHGA 4D9LH 4FQHB 1LDSA 4PJ5D 3PE9A 1DANU 4N5UA 1FVDB 1L4IA 4OJFH 3KPLA 1SJHB 2FJHA 4PJEA 4M02A 4CJ0A 3B9AA 5FGRA 2DWEA 1S8DB 3LQAC 3MRPB 4M5YH 2AEPH 4G9FB 3T04D 1JHLL 1E4WH 2EDYA 4KKCD 5ICZB 3MFFB 2F53A 3EYQC 4OF0A 2NXZB 4OKVB 4XTRD 5F96H 4HW6A 3NA9H 4AIZA 3D18B 5T33H 1JPGB 5CS7A 5GGQL 1INQA 1NUFA 1G7JB 2XTJB 2MWCA 2AQ2A 2OL3B 3E2HB 4HH9A 4L9LA 5TJWK 1T89C 4YDLC 1OD7A 4M5ZH 4YDKH 1OCWL 1E6JH 3MNZA 1NGYB 3X14B 2F5BL 4ZSOB 3I6LE 3FB8B 1JRHH 4HKZB 4LPVA 3PWPA 1A6UH 4F57H 5JNYA 4Y5XB 4YWGL 2GSGB 1XT5A 2ESVA 3CUPB 3DTXB 5FUZL 4DAGL 4KKLD 1AFVL 1IL1B 2J6EL 1MFCL 4Y19E 1D6VH 4K55A 1UT9A 4PIRF 4TUJA 5SWSE 3B5GA 1AC6A 1ZHBB 3LRGA 3WFEL 2VIRB 1JVKA 2VXUL 5F93C 5FCUL 4G42B 5JO5B 3G5XA 2P46B 3ISWA 1CBVL 4WU5B 1NMCC 5T1DL 3QUML 3O2WL 1DFBL 1IEHA 4BSVB 4JPIB 3SPVB 1I1AA 3N9GL 4L8BB 3QDMD 4YAQB 4XVTL 1WF5A 4E41E 4FZEH 4BUHA 4YFLF 4I5BB 2CQVA 4HS8H 5IT2H 3I6KA 3QDAA 5I16A 4Q6YA 2E7CA 4PR5B 4XBEL 3OKMB 1GC1L 3A6OA 3D0VB 4RFEA 2BVQA 4FQ1L 4MCYB 3WIHA 4P9HC 3GUTB 1J18A 4M00A 4UBDD 2A77H 1QHOA 3PDGA 3N1FC 4HPOL 4JJ5B 4JHBA 3TBWB 1FC2D 1D5ZB 3ME0A 2FECI 1G6RL 2QQKH 1I1RA 1GSMA 3WHE1 3GBLA 4MX7A 1LO5A 5D7IA 4LEXH 4R8WH 1H3PH 5KVEL 3NFPB 4BA8A 4U6YB 3NMEA 4XNZC 3BP7B 2GITB 4MNGE 3GSQB 2FIRT 1BFSA 1R24A 3SBWC 4JZJB 1V7MH 4JM2F 3WLBA 4BYHA 1JWSB 4I4WA 3RNKA 3OJMB 1G7HA 4DUWA 4DW2L 3KYNB 3WFDL 3IS0X 2FL5A 1SYSA 4PRPA 2D9CA 3FHQA 4QY8B 1UB6B 4LHUB 1OARH 3P0YH 3U9UB 5HHME 5DJ0B 1I7ZB 5IFJA 3UTSA 5ESQA 1QHPA 3T1FA 1DVFA 3CSBA 3V6BR 4NT6B 5B21A 4V1DE 4F9LC 1S7UA 5DHVB 1IAOB 5JW4R 5HYJB 1NGXA 5F88A 1JHLH 2ZUTA 3RPIB 3B2VL 3MFGB 1GJIA 4MXVF 5DK3A 3L7FA 3WLWD 5GGQH 2X40A 4XHQA 1GOHA 4HJJH 4KJPD 1AGEA 3ZT6A 3ETBF 1HINL 3MV01 1URLA 4PJEF 2VLRB 1HHHB 3H2WA 1CICD 1FBIH 2ITDB 4KQ4L 4L8DA 2CRZA 4PY8J 1DUZA 3DO7A 5IESL 4YDJA 5HJ3B 5DMYA 2GI7A 4DAGH 5FUZH 3T77A 3DVNA 1Q9OA 2J6EH 1WZKA 2VDKL 5JR1H 3OR7B 3VRLE 4FHBD 1FVCB 3D69A 3MV9A 4HIIB 4DZ8B 1SBBA 3LD8C 1CGUA 1AQDA 1KB9K 2HRLA 4P4RB 1CYGA 4L3CB 2VXUH 5FCUH 3DOSA 3WFEH 5FGCE 4PJCE 3E0GA 1D6EA 2IFFL 4U1IB 4XWOC 5H8DA 4D94A 1CBVH 1CIUA 5T1DH 3QUMH 3O2WH 4KMQA 1DFBH 3EOYG 1HOCA 4KRLB 4L1DA 4MHHG 3GB7A 4ZODA 1AI1L 5A16B 3N9GH 5I71B 5DJ8A 2IPKA 4BQ9A 4N8VG 2K1MA 1FZKB 1QACA 2VL5B 1JPFA 2AXHA 3B5TA 1CE1L 4NSKA 5D1ZB 5KVFL 4PBWD 5DJYA 1ZHKB 3G04B 4LCYA 2DRUA 4MA7L 3LVEA 5DVOA 4LPCA 2ZUVA 3BWUC 1F4AA 5E5UB 1GC1H 4HKJA 4NZRL 4FQ1H 3TFKC 4NQDD 4S0SD 4N0UA 3DMMA 1BD2A 2FEEI 1J8HE 4EI5A 5LQBH 4HPOH 3BUYB 2VWEE 3ZHDA 3QA3A 5I30H 1G6RH 1AQKL 4ZAKC 1FSKB 1M71A 1JE6A 2YD2A 3ROOA 3TZVA 5L0QC 2J8UB 5KVEH 5DC9B 4AH2A 3DURA 3ZE0F 2ENYA 4NDMB 1JWMB 4NQEA 2IALB 1U6AH 3PGFH 3QEQA 4PJBB 4ZUWB 1I4FB 4A6YL 1F3JA 5LGJA 4TNVK 1EV2E 4DW2H 1PBYA 3WFDH 1BJ8A 5D7IF 1T7ZA 3VXSD 4Z95L 2N7BA 4J8RA 5F1NA 1ZLWK 3U0TA 4TTDD 1EEYB 3EZJB 1U58B 4HWZB 3H9SD 4XT1C 4NM4L 3JV6A 5HGDB 3UZQA 4H8WL 5D2NB 4HIHA 1BIHA 2WW8A 3M8OH 3CFJB 1FNAA 3IFNL 5DRXA 5IEHA 3TT3L 3HC3L 3HZYA 3B2VH 2VZ1A 4C55A 3O4LE 4LCIL 5KSAC 3CFDA 1ZS8A 1PG7L 5DRNB 3G6JA 3VXME 1T04B 3O6KL 4G8FA 5D7KE 1RIHL 5F7LB 3VXNB 5E5MB 3RY6A 3RWJB 3IKCB 2BNRD 5D7LB 4LMQI 1MOEA 1KENL 3JV4A 1T4KB 1OW0C 1DTUA 4AIOA 2VLJD 2Z31C 5IESH 1XGQB 3TNMB 4C56B 5CGYC 5KSBE 4XXCC 4XNXL 4NCC1 2X89D 3OR6A 1KUMA 4NZTL 5JW4Q 2VSCA 4OCLC 2MFNA 3D9AL 1BFOA 3MO1B 4GRWE 3P4MB 4LHQB 4G8EB 3SDYL 1L6ZA 1S7QB 2G2RA 5HYFA 1D5IL 2PXYA 2X4RB 3VDBA 1FQ9C 1FPTL 2WAHA 2FB4L 4Y0GA 3L5JA 2X1PA 4XBPB 1YUHB 5C0IA 1PX4A 3E6HA 4QNPF 4KROC 1KIPA 3VI4E 4J3TA 3QIUC 5AZEL 2F8VA 1CE1H 1ZT4A 5KN5B 5EU5B 5KVFH 1YMMA 4WO4D 4MA7H 3NA4A 4OCYL 2V5RA 3QPXL 5C8JA 4NKMA 4P2QE 1SBSL 3MRJB 3C5JA 3C60B 2HG5A 3LN4A 5GXBB 5CLWA 4M1GL 3LS4L 3D85D 4PJXE 4MA8L 5EZJB 1PZ5A 2C4FU 5HHVL 1DEDA 4G8IA 2X1XR 2VLKA 3NZ8A 4M03A 4PTTB 1KSRA 1J1PL 3AC0A 3STLA 4LCCB 5BS0A 4LIQE 1IGYA 5FOBB 4X9GA 3DIFB 4UT7L 3NZHL 1NBYB 3TGXA 4Q6IB 3GJFK 1BBDH 2VDNL 5SX5K 3K4DA 3MLPA 1F5WA 5JHDB 2X4QA 3WXWH 3O9WC 3ARPA 4NC1E 4K23L 4KRPD 5C07E 1H3XA 2R2BB 2DJ4A 1DBJL 5TDNA 3KPNA 4G6ML 5DC4B 3BVNA 1MCQA 1FYTA 1H0DB 4WUUB 1EGJL 3LRSB 3MUY1 3GSRB 3HTLX 4Z95H 1XZ0B 4NFBA 4ZUSA 2I24N 3UPRA 1UGNA 2NMSA 1R5VB 3GMLB 3WIFB 4R4BB 1RUKL 4NM4H 4PLKD 5J11C 4OQTA 3LS5H 1VPOH 4KTYA 5CIPA 3ARDC 4G9FD 4I18A 4NHCH 1ZSDA 4PRIE 1WIUA 5MI0B 5AD0A 2E6QA 2NXZD 3OKEB 3TT3H 1W8NA 2VDPL 3PJSB 4OLZL 2JB6B 1RZKL 3NIGF 5CEYB 4R4ND 5F6IB 2JJUA 3MRIB 2XTJD 3LKPA 4XHJD 1GGTA 1PG7H 1TNMA 4K94L 2DM4A 5JXED 3CLEL 3UBXG 1MHHA 2V2XB 2BY1A 4JG0L 3SGJC 1TJHL 5CD3A 1IGCL 4XPHL 5HVFB 1KENH 3TBTA 5TQ0L 4QT5A 1TQBB 1FV1A 1KJVA 5JW5B 1UC6A 3UCRA 2Z92A 4MA1C 1LWRA 1HQRA 2NR6D 4BK5A 2EXYC 3SDAB 5I9QB 1RUQL 3MRQB 4NZTH 4ZFOL 3G6JF 2HTKD 4PB9L 3D9AH 5JUEH 3BZFB 5TGBB 3SDYH 3EJYC 3PL6A 1D5IH 2DQJL 3MOAL 1F00I 3QUZA 1LEIA 1CL7L 2XICA 3DYMA 1NKRA 4LP4A 4X6CA 4FNLL 3SKNB 1FPTH 5IIEB 4JLRA 5IKCB 3CFCH 3TIDA 2Y07H 3D39D 2P5WB 3PG2A 1YN6B 4O58H 4PV8B 4ODXA 3HG1E 4U6XA 1MLCA 5CLTA 2EDBA 1B3JA 2MOVA 1IARB 5CILL 5IBUB 2WM0A 2H1PL 2FDBP 4K7PY 5E6IC 3DUHA 2W91A 3I9GL 3IJYB 4OCYH 1YEHL 4Z7UB 3RWCA 3QPXH 3PP4H 4HUWB 3JWOH 5MHSD 5DEFA 4LMQE 1PFCA 4JRXE 4NKIL 4M1GH 4CU6A 4Z7OE 1BZ9B 2R9HC 2Q7NA 4MA8H 1QLFA 3D25B 4QHMA 5HHVH 1A7QH 2ATKB 1NDMA 2HFGH 5FECA 3FO0H 2DDQL 3CXHJ 4KHXL 4HULB 2ICWI 4PJGE 1AIFB 1UM5L 4XMPL 1G0YR 1QBMH 3ES6A 5TF1L 1EEZB 3IDMA 4UT7H 3VWKB 3KDMB 2VDNH 3MROA 3L7EA 1GOFA 4V2BA 1KJ2B 1VCAA 4K23H 5I6XB 3SGDI 5K59F 1DBJH 2XZQL 3EBAA 1R5IB 1JZ2A 1NFIA 2R1YA 4KI5E 3ULVE 1TVHB 4U2YA 1G6RA 4G6MH 4JFEE 4LLDB 5E70A 5HYSB 4LHUD 1EGJH 4JRYA 2XRAH 3TYFA 1S7SA 4F9PC 5T1KA 1VSCA 2C1OB 4MDIA 4YZFE 4JG1H 4NO3A 1BBJB 1I1YA 3CFBA 3NCYP 4N8VA 1LP9B 2DM2A 1S7VA 3MJ9L 4PJ9A 5D70H 1VFAB 1VENA 5J1AB 1RUKH 4WW1B 3F8UB 5GRVK 4N8CH 1Y0LA 5HYJD 4ETQB 1A0QH 3VFNB 5DT1H 1BQHG 4I13B 3U9PH 2PR4L 5DJXA 1F6AA 1ONQB 2E6PA 4H26B 1A7OL 1CCZA 1EJOL 3ZSSA 1RZKH 3KJ4C 4CNIA 4KK8D 5DMGD 4R2GC 4QYOB 5IP4A 2JCCA 4K94H 4Y16A 3QQ4B 1CT8B 1M7DB 2H2SC 3TM6A 2VLRD 4PRHE 1X5KA 4JFDE 4MJIA 4JG0H 3KPOB 4X6FA 1TJHH 4XNUL 2A9ML 1IGCH 2P7TB 1FVEB 4XPHH 5HHOD 1A6ZA 3D87B 4GG6A 2AXFA 4M3KB 2XQBL 4W6XB 5C0AB 1Q9WB 3GM8A 5TQ0H 3P9MA 1U8JB 1NBQA 4HUNB 3QULA 3FRPG 3U0WL 5E8OA 1X5LA 4ODUB 1OB1B 3B3IB 5A3ID 4PB9H 3FO9B 4O5LH 5F7MC 3G6AB 3OXSB 3BOVA 1EH9A 3WHXB 2PO6B 5IFAL 2F5AL 1V05A 4WFED 3KS0H 1L7IH 3V52L 3MOAH 2BNQD 1CL7H 1B4JL 2OBGA 1IEBB 2DMBA 4FNLH 1NCNA 3B2UD 3MSPA 3KYMB 3HRZB 2Q6WA 1PKQE 2X42A 3O8XA 4DCQB 3SE8L 3F12A 4Y8DC 3P11L 2HT2D 5D1ZD 1VFUA 4MQXC 4X5XB 1MCRA 2DQIH 4EI6A 4HZLB 3HLAA 5FO8A 3GSVB 5CILH 1KFAL 5I1IL 2H1PH 1DQML 2PTVA 4U0QB 3I9GH 4X6CF 4YBQC 5BRZA 1LVEA 4GAYB 1YY8A 2BVUA 5I76A 5SWZB 3L95A 5FYJU 1CXHA 3HNVH 2GCYA 2ZG1A 2OK0H 1N59A 4NKIH 3PHSA 1BM3L 4J2XA 5KBNC 3RTQB 2KQNA 3DGGB 2AI0L 4RNRA 4U1KB 1JWUA 2NXYB 2DDQH 3SJVE 43CAB 4KHXH 1UFUA 5HHPB 2MQCA 3C9NA 3UMTA 1QYGL 1UM5H 4JO4L 1NFDB 4X6DE 4WW2B 1S5IL 1A1MA 3LEXA 4DN3L 2AJYL 3QJFA 1V8HA 1BLNB 2OR9L 4UU9A 5CP7B 5EUKA 3QEUA 4XPTL 4LDLB 2EYSB 2XZQH 3B4NA 2NNAA 5I66A 1S7XA 2DQFA 5SV4A 4QXUH 1LK3L 3U2SA 5D6DC 1BECA 4XPBL 2NX5A 3RI5F 3V5DA 4MD0A 2EKJA 3MJ9H 3PWUB 4AEEA 4PJ7E 4N5ED 1JPSH 5HHNA 1XGRB 4WDIB 1MY7A 4Z7VE 2PW2B 3QUYC 1WAAE 1RMFL 4GG8A 1GPOH 3LEYL 1UVQB 4LDEB 1SY6L 2PR4H 1PVHA 1E28B 1N6UA 5E9DA 5KS9A 5MEPA 5D93C 4F33A 1QO3B 3QWOA 1A7OH 3RHWF 2DD8H 4OD2B 3P73B 4RX4D 5ENWB 3JWNC 3REVB 3MCLL 3BRFA 4DUXA 4HJGA 1U3HC 5D5MA 3PHOB 2Q3ZA 3AUVA 4FQXB 1ZLVK 4ZQKB 4XNUH 2A9MH 3UTZA 1M4KA 1C16B 2XQBH 5C08B 3ZTJG 4C56D 4Y4KA 4YDLB 3U0WH 3VFWB 1AGDB 3T3PF 4X4ZA 4HQQH 3RP1A 4E9LA 3OGOE 2R23A 3GGWA 1AO7B 3MLTA 5J6GA 4QRRB 2ED9A 5EIVA 4JFFE 3LY6A 1H15A 5IFAH 1F8TL 4GG6F 3V52H 1B4JH 5L7XL 4XZUB 3VFTA 4NNYB 1FNSL 1T7YA 1MEXL 4CL7A 2ZP0T 4LIQL 1K4DA 4X8JA 3SE8H 1AHWC 1AD9A 3P11H 2WNGA 4R6UA 2AV7A 5JTWA 1KFAH 1NMCB 3T4YA 1OWRM 4X80H 1DQMH 1U93B 2H9GA 4LLYA 1RUPL 3FB7B 3VH8G 1YEJL 5JIHA 3IDJA 3GI9L 1D5XB 1ERNA 4NQCD 1XR9A 5E00B 4YXHL 4FN0A 5I1HL 3LKOA 2EDDA 3BP5B 1ACZA 2CMRL 4QHNA 2AI0H 3CX5K 4GRLA 1BIIA 2APFA 4HLZH 4MZ2A 5DJCA 5DK0A 4WI6A 4OLXL 3QJHB 1IQWH 1J0HA 4XVJL 1UJ3A 4MWFA 4H0IA 4XPGL 1QYGH 4G8GB 3RVXC 3FQTA 5B38G 1S5IH 5F9JA 1VKXA 5CMAB 5F8QC 1A6VL 5EIIB 5JHDD 4DN3H 2AJYH 3J8F7 1KNOB 2VXVL 4POYA 2OR9H 5GGRB 4XPTH 4PP2A 4CADA 1AD0A 2KKQA 5D8JH 2D31B 2BVPB 4WUUD 4FFVD 4L29A 2RIKA 5EU6B 5CSZA 4GW4B 3GZKA 4TUOB 3PDOB 2Q3AA 1A64A 1RJZB 3IU3A 3S36L 1OY3B 2WUCH 2NY7H 1A3LL 1RURL 5GGUB 4MS8D 4XPBH 1BWWA 2VC2H 1B6DA 4J4PD 4HWBL 2Q20A 1AGCB 2ITCB 5E99L 5DD5L 1U8OB 5F7WC 1WZMA 5FKPB 2YZ8A 4C83B 2HN7B 5CJQL 4GRWH 1CZ8L 2G75B 3STZB 4LDOB 3WUWB 4LHUG 2P49B 3LEYH 4PLJC 3MGTB 5CFHA 1T7VA 1P53A 3F7VA 4M6NH 5FM4A 5CEXB 1NMBH 3NTCL 3U7AA 5IB4B 5F89B 2IQAB 3ARXA 3EYOA 4Y19A 1OSPL 3MCLH 5DURD 2YD1A 3KPMA 4O51A 2GIYA 1DVFC 4XP1L 4QOKB 3QHFH 1XF3B 2IWGA 2PYEB 4GBXB 5IV2B 5I1CL 2JELL 5KS9F 5HD8D 3SDAD 4I0PB 1EHXA 3S35L 5C3LD 3SKMA 5C71A 4LGSB 2X05A 4RRPA 4F7EB 1BF2A 3BN3B 4ODSL 5D5MF 4E41A 3GMRB 4XB8A 3P4NA 4Q0XL 1ZA6B 5ISZA 3I85A 1ADQL 4FTVE 2B8OT 3E6FB 2V2TA 3EHBC 4EIGB 1F8TH 3O45B 1AJ7H 1W0YT 2CUMA 2X4NB 3EOAB 5ANME 5L7XH 1N4XL 1FNSH 1MEXH 4TULL 3CFKB 4NGHL 4LIQH 1YYLL 3AU1A 5I2IA 1G7MB 1NGZB 5FXCH 1R5WA 4CU7A 3OF6D 4CVUA 3RX7A 1BQHA 3GKWL 1ZMYA 1F45A 3ULVL 3BIKB 3VG0L 3QHTC 1T0NB 1N3NB 3G08A 5FB8B 4LSTL 3JUYA 1CDUA 4NRYB 5I1EH 3U4AA 3C5ZA 4YXHH 5I1HH 1MLBA 1JNLL 3QQ3B 3IDGB 1K2DA 2CMRH 5DA4A 1N7ML 4OLYH 3MR9A 1IKNA 3BKCL 2IBBA 2WLZA 4KJWC 4WHYH 4OLXH 2VH5L 5DI8B 4XVJH 2BOCA 4XPGH 1G84A 3L5HA 1A3RL 3HS0B 4UAOC 3FJTA 3VWKD 1OAKL 3DVGA 3FRPA 3DX8B 1A6VH 5IJKC 4W6YB 3ULSA 1JYWA 2VXVH 3TO2B 2W65A 3IGAB 3MA7A 3MLVL 3PNWA 4ZAKB 3MMEA 1M05A 1N26A 3WFCL 5L0QB 2YD6A 4LLMA 1OLLA 5EC1B 4V1DA 1NC2A 3DX6B 4OKDA 2J12B 4Y88A 5D2LE 3RBSA 2BK8A 1TIUA 3EDJA 3UTPD 4I1NB 2X89A 4W70A 3U6RA 1G1YA 2X7LB 4X9FA 1KJMA 3S36H 3GBNL 3TZVC 1RZJL 4U1LB 1LDPL 1CXFA 4HWBH 1U92A 4H1LB 5DD5H 2XN9E 5CSGA 5CJQH 3BXNA 4OGAD 1CZ8H 3LIZL 3WDIA 3SE4A 1FNLA 1U95B 3C5SB 3IFOA 1IRAY 2FNBA 3QAZC 1NC4B 3MBED 3NTCH 5EFIA 3UJIL 4NN5C 4P2CG 1MWAL 1OSPH 2JK5B 2R2HB 2X70B 3IAPA 4XI5C 4WCYL 3IVKA 1RAMA 5ACZA 5FUOL 4MDJB 1I3UA 3ARBC 2BFVL 4XP1H 3VXUE 3RWIB 3VXRB 1KB5L 1LE5A 2NY2B 1E27A 5HTSA 3V6ZB 1ZVSB 4M62L 1ES0A 4PJCA 5CD5C 1RZFH 2H26B 4IRSD 5FYLE 1DP0A 2APWA 2XFXB 2WIIA 3D85A 4WHTA 3MRBA 2ARJA 3S35H 1H8NA 4EUPG 5DQJA 2CRYA 4LSRL 3VFOA 1UM4L 4AM0B 3VD9A 4AK1A 4ODSH 1CF8L 4QXTB 5C1MB 4Y2DA 4MCZA 3EO1A 4OF5A 2EICA 2PO6D 1NQBA 2Z31B 3X11A 4Q0XH 1ADQH 3VFGL 2P44B 4WJ5A 4F7CA 3WYRA 4UQ3A 4MMXC 3BP4A 5GS0D 3KXFE 4OGYL 1T2JA 2V2WB 4I48A 1NAMA 1OGAB 1KCSL 4P2OA 3OKNB 2EH7L 5JW3L 1A14L 5IW1B 2D2OA 4G80A 5F7UA 1L6XA 4RMVA 4JFOB 4NGHH 4TULH 2EYTB 4U1SA 5D1QD 4NQDE 4WI5A 3S5LB 1LNUB 2JJVA 3WDJA 4DVBB 4YHNA 3DI3B 4X5LA 4Y5YA 2DQCL 5T3XD 1VFBB 3H42H 1FJ1A 2N56A 1CFNA 5GIRA 4J23A 3NCYS 1I85A 3ULVH 2YRLA 5SWZD 3VG0H 3TBSB 4LSTH 3VRJB 2OSLB 2ZOLB 3CDYA 4GKNA 3BEVA 4M1CC 1TLKA 4QRTA 5DFWH 1JNLH 4POZC 1HQ4A 4PJ8D 4WI8A 3CH1A 4FQJL 4JR9L 1N7MH 2NXYD 1OF2A 1JI1A 4HS3B 3KG5A 3BKCH 3MFFA 4YGVB 4NKDB 2VH5H 4TVPE 4HGKC 4NQXB 3T08A 1G7JA 1O7SA 4R26L 4IS6B 3OB8A 5JXEA 3W39A 2HFEB 4TPRL 3X14A 1WZLA 1KTKE 3B9KA 4HK0A 3ECBB 4HMCA 4UQ2A 1U42A 3H9SE 1TPXB 5KSUB 3MLVH 3I02B 3ZYZA 4HKZA 5DO2C 1S5HB 2KDGA 3WFCH 3IU4L 1LK2A 1BZ7B 3N06B 4G43B 4NFDA 4M3JA 1GRWA 2UYLA 1IL1A 2BVOB 1GHFL 4GKZA 4Y4HB 3O9WB 3RKDC 1KPVB 3MV7E 5J13C 5ITBL 1DE4A 3GBNH 1P4IL 2MKWA 3BQUC 3EIFA 3ILQD 5TE6L 4NHUB 4Q97A 4PGEB 2VIRA 3VXMA 3MZTA 1EEUA 3LDBC 1CDJA 1TETH 3IETA 3OAYH 4GQ9L 3U79A 4A2LA 1M7IB 3VH8A 3D39A 3T8XA 1CD1B 2BMKA 2RAMA 4WWKA 5GQBA 3QB7C 3UJIH 5J11B 3OAZK 3WFHB 1INDL 1MWAH 1UXSB 4FQXD 5H37G 4WCYH 4I3RL 3EYQD 1UH3A 5FUOH 2DLEA 4BQ6A 4P99A 3SGKA 5EOCL 4EDXA 1PGRB 5C08D 2WWKO 4XPAH 3TO4B 1GGCL 1KB5H 5IR1B 4ZUVB 4M62H 5B38A 1JI2A 3TBVA 3F6IA 5D7JA 3S96B 3CU1A 1BVKA 3WE6A 4JJ5A 3GHEL 1OM3H 4LSRH 1AO7D 1UM4H 3VRLF 3QDHA 4UIMB 4QRRD 1WISA 3SDDC 3V0AC 1CF8H 1FL3B 3HNSL 5FO7A 1ORSB 1KTRL 1HHIB 4O2FA 3KYOB 3NFSL 4MA1B 2J2ZA 3VFGH 3SCMB 4ODTL 2W1NA 5IBTL 1XH3B 4UB0H 5K9KB 4N8PA 5JW3H 1A14H 1G0DA 4Z9KB 4EN3A 2AEQL 4OFIA 3GMPB 1RPQA 2DQCH 3KYNA 1UKTA 2OI9C 2DBJA 2IMMA 2FYYA 1UB5B 1UB6A 4LHUA 4PJHE 5IUSA 5I8KL 4HUXA 1TTUA 1I7ZA 3QUZC 3CMGA 1BFTA 5ICXB 4XBGA 2VZ3A 4U1MB 4LNRA 1QSFB 4NOFA 3K3QA 3HRPA 1IC7H 4YX2L 2UV3A 5AYQA 5IB1A 5IBUG 1YZZA 5E6IB 5ESAA 5HYJA 4JR9H 5DHXB 3AS2A 5BJTB 3W9DB 1Q0XL 4G8GD 3HHRB 4OZIB 2NY6C 4R26H 3GSWA 3MV8B 4B7LA 3ULUD 2GJZB 1FZMA 1UWEL 4MB5A 4XXDB 2VUYA 4BH8A 4YK4B 5IVZA 4TPRH 3AROA 4ZFZA 1U91B 3BPCA 4OV6F 5HHOA 3QFJB 1I8MA 5A2LH 3IU4H 5EU6D 1D5MB 4X6BB 5D71L 5EN2B 4JKKA 1B0RB 1J9CT 4X98A 4Y1AB 4PRIA 1RZ8A 4XWGL 3PWVB 3DXAB 2YUVA 3SGDH 1U8QA 3FZUC 4DZ8A 1IFHL 3R06A 1GC1C 3CVHH 1P4IH 4FQLL 2PW1A 4JFYB 4YHOL 4E5XB 4LSQL 2BVYA 4P4RA 4EZMA 3MRNA 1XEDA 4PJAE 2WBJB 3JWDH 1MCJA 4JQVC 2VXQL 2EDOA 2BNQA 4ZSOE 2XPGB 4GQ9H 1RJCA 4RIRA 2RBLA 5A16A 5F1IA 3V95A 3IFPA 1ZGLA 1QR4A 2JTDA 4O2CA 4R4FL 5T1MA 3FMGH 3NCFB 4JQXC 1UYWL 1INDH 4HWBA 5JZ7D 3G04A 1SM3L 5DJAA 4QOKD 3ZHKA 4PG2A 4ZDHB 2NLJA 5DMKB 4P46C 2CKBL 2PYED 2A0LC 4PJDE 4NO0A 1FZOB 5EWIH 1GGCH 3C6LB 3HAEH 2BSED 2G9HB 4IMKC 4NCDA 5JMOC 1KCKA 3VFSB 4I0PD 3BYTA 4P3DA 3PV6B 2AKRA 4RMSA 1K9TA 3BUYA 4WFFD 3ZDYE 4OD1L 2QQNL 1WEJL 1TCRB 5D7SL 4OSUL 3HNSH 3IFLL 4HUUA 1NCUA 4JAMA 4AG4L 3QDGB 2BDNH 1K85A 1OLZA 3NFSH 3S34L 1N6VA 1HKFA 2OJZL 2XXMB 3LKRA 4DQOL 2JJTC 4ODTH 3QCTL 5C0DA 1CWVA 4PBXA 5I74B 1I8KA 4M6MH 4KGJA 1NEZB 2LTQB 1YNKL 2EDFA 4NDMA 1KIQA 2E7LC 2EYRA 4F7PA 3C6SB 4GRMA 3HE7B 4H25B 2AEQH 4Z7NE 1MVUB 1QSZA 4ZUWA 3L3KB 1I4FA 2FJGB 2IBZX 1HWGB 4XWOD 1IGJA 3VI4F 3MRFA 2B1AL 1WV7T 1ZHNB 1HXYA 4JQIL 4IJ3C 2YBRB 1FG2A 4U1NB 5GJTL 3RUGB 1MVFA 3FOLA 3OKLB 5I8KH 4UTAL 4PJGA 3H9ZA 4ONHB 2CO6B 4R97B 5DJDA 5JDJA 1VACA 4JO2L 3PGDA 5EOCJ 1A4JB 5SV3A 4XNMA 5C6WH 1DL7L 4BZ2H 2A38A 2VQTA 3O8XC 3W0WB 5F7NC 1IBGL 1YMHB 3MRMA 5T3ZE 3TFKD 2W0FA 3HR6A 3LQMA 2ID5A 4OI8A 5E4IA 4P4KC 3DVIA 2ICEB 2P24B 5E8EA 4NRZB 3L5WB 4EUPA 3RWJA 4U1JA 5E0QA 5CJ5A 1GZPA 4ZAKD 4GW5A 3MUZ1 1YDPA 4HC1L 2NW2B 4OAWA 1GGBL 4LK4A 1KYOK 4C56A 3QG6A 2CDEA 3OX8B 3UX9B 3A6BL 3T3MF 4AEHL 1X5HA 4XWGH 4NQVA 5IB3B 4WGWB 1IFHH 3QUKA 5DVMA 1MCNA 1JZ6A 3QIWC 3KLHC 3CDCA 3WFZA 2ZSWB 4FQLH 4JM2B 5B3JE 4ESKA 4NM8L 3S97C 3VFMA 2HT4C 1JZ8A 4XGZB 2X4RA 4RBPH 5HI5C 5I18L 1ZANL 2CLZB 2IJ0C 1QFHA 4CMHC 4PRHA 2CPCA 2GHWB 3T0EA 5IB5B 4OCWL 5HYEA 3LKSB 1NC4D 3MOBL 3RWGA 4E42A 4MQTB 4MXQD 4R4FH 5KN5A 3O81A 1ETZA 2CK2A 1JGEA 1UYWH 4OZFG 1SM3H 3H7BB 1IM3A 2IAMB 4Y5VA 5D93B 4AT6B 3IKKA 2X9XA 4WFEE 5E1AA 2CKBH 3VXRD 4PRAA 2NY2D 1IAIL 2HJFA 1NLBL 1NCWL 4OF6A 3MRLB 2VNCA 4NQCA 2EE3A 2VO5A 4LSUH 3V8OA 4NN6C 3W2DH 3KPLB 4NP4H 1CDGA 3ZLQC 3QR2A 4UNTA 4PTTA 1PKQA 2J4WL 3DNKA 4PJEB 1IVLA 4YFDB 3UDWA 4KXZH 2V5MA 2DWEB 4KI1A 4OD1H 5C9JA 2QQNH 1WEJH 2Z31D 3MA9L 4OSUH 5D7SH 5J12B 3IFLH 4LCCA 4J1UA 4AG4H 4OZHE 3O3BA 1UKSA 3S34H 4H8WC 4MAYC 2OJZH 4DQOH 2P5EE 1KB5A 3DIFA 1OGAD 1RHFA 3QCTH 4AIZB 2YA1A 5JHDA 4M7JL 4R90H 4YBLC 4TVPL 1INQB 1YNKH 3WXVL 4HH9B 3IJHA 3HN3A 4L9LB 1B9ZA 5IBLD 3CXHK 1IKFL 2A73A 3FFCB 3MNZB 3U4EA 2B1AH 4OUUA 4JQIH 2CR3A 2ZNWA 4HG4J 3LRSA 3BP6A 3O2DL 3PWPB 5JNYB 3MLZL 2ESVB 2IQ9L 1EO8L 3SJVA 1CN4A 3T0BA 3D0LA 2YUWA 1JV5B 2CD0A 4M93B 4UTAH 4X6DA 3LQAH 15C8L 4TUJB 5AWNL 4JREC 3U7WL 1DL7H 2XNAA 2IADB 4DK6A 4JFQA 1IBGH 3EDKA 5C0NC 4PJBE 1TQCC 3ARFC 3OKEA 3D3VA 3G5XB 5INCA 1CDYA 2FATL 5I1AA 4PJGF 1PD6A 1I1AB 4HS6B 2WWKT 1PG7W 1BWMA 1FNFA 1ZGLM 1H8SA 2QSCL 2E9IA 3V4VL 5I16B 5D2NE 4K71C 4HC1H 5IOPB 2HKHL 2DOCA 4Z7VA 4Y4HD 1WAAA 2YPVH 4U1HA 3ELAT 4MNHB 4AEIL 4RFEB 4ZO6A 3O9WD 1AP2A 2QLVB 3A6BH 4RZCA 2CGRL 3MRQA 2BVQB 4AEHH 3GIZL 5K9QI 4S1QH 4U3CA 3KPRB 3JWOC 3DV4A 1XIWC 3BZFA 5FYLH 1ZLUH 2AEWA 4PV9A 4YZFF 5TGBA 2ICWA 5TH2A 2HT3C 4NM8H 4DKEL 5I18H 5D7LE 1ZANH 3B6SA 2L7UA 2R1XA 4MX7B 3FO1A 5D7IB 5DD1H 1AH1A 4PJFB 4I77H 5I8EA 1U2HA 1Y6NR 4U7KA 4AENA 4XB7A 3B83A 3MOBH 3CVHA 4RFNB 1VB9A 1R24B 4FXKA 3ARDD 2EDNA 3HE6A 3WLBB 3VU2A 4I4WB 3OF6A 1BJ1H 3RNKB 1G7HB 1UACL 3IJYA 5GGSY 3EO9L 2ZNXA 4Z7UA 4AIXA 2B5IC 4P9HH 3QBTB 2FL5B 3TO4D 1SYSB 3RDTA 5E6YA 2VRAA 1NLBH 1NCWH 4R0LA 3KHQA 4LKXA 4KK5C 5IFJB 2AERT 3FL7A 5ESQB 3R1GL 4Y89A 3T1FB 3FCTA 4M48H 1T2QL 5IW6A 1DVFB 2J4WH 2VAAA 4UUJB 2OP4H 5ALBL 1S7UB 1TJIL 1X5GA 2KZ1B 3MA9H 5K93A 1A7RL 5F88B 2E7MA 3TESA 3CIQA 4HAGA 1JGDA 4IRJC 2E9BA 5M7QA 2EDTA 2PN5A 2Q8AL 4M7JH 3L7FB 3VJ6A 4G6AC 5DWUL 1KJ2A 4TVPH 1JYNA 1AC0A 3WXVH 1AGEB 4KPHL 4QHUA 1RZKC 4Z5RA 2BOBA 2E7BA 3AY4C 3ARGA 4PY7A 4N1HB 3MLRL 1CFQA 2YMXL 4QHKI 4DFIA 1AKJA 1IKFH 4K94C 1HIML 3VI3E 4C54A 3SQOL 1RUML 2QHLA 4L8DB 3DO7B 1KEGL 1IGTA 3HNTL 3O2DH 4YDJB 4CDGC 3MLZH 2C1OA 2IQ9H 3T77B 3DVNB 3A67H 1Q9OB 2I27N 4I0KA 4K2UL 5ELIA 3UPAA 5HYQA 3GO1H 1QSFD 4NBZB 4O9HL 1VFAA 2ENSA 3D69B 3MV9B 3KPPA 15C8H 4MJ6A 5E6ID 5AWNH 3U7WH 4F15B 1AQDB 4EVNA 1Z0NA 3N50A 3EYFA 2OL3L 4OF8A 4N1EA 5I0ZA 2CSPA 4RGOL 4MVBD 1JK8B 1B0WA 1D6EB 2FATH 4KMTL 1EBPA 3M17A 4KMLB 5LVEA 3MBEA 1HOCB 1NANI 2R9HD 4S1RL 3GB7B 3LH2L 3MV8D 5DJ8B 4X6DF 3VGGA 5JA8B 2IPKB 4DEPC 5FYJE 2YWYA 1JPFB 4NSKB 2QSCH 5DFVC 1OP3K 5DJYB 4TYUA 4W81A 4WU7A 3WJJC 3QFJD 1X5YA 2EIZB 2JLLA 1OTTC 5CP3A 5FGBC 4ONGL 2Y7QA 3UTQB 4K7FA 2HKHH 2ZZUT 3LN9A 4IRSA 4Y1AD 5L2KA 1JN6B 2O61A 4DKAA 3DXAD 3SDCC 3OJVC 4HKJB 2J3SA 3N0PB 1YY9D 2CLVA 2F54A 4LRIC 1G7QA 3FO9A 1HH6A 5A2FA 1IQDA 3DMMB 4B50A 1FAIH 5EUOE 2UWEA 3QUXC 1BD2B 3MLUL 5JOPE 3WHXA 3HZVA 3INUL 4TQEL 4DKEH 2VDML 1KJ3L 1AR1C 2ZUSA 4K3EL 1T5WA 5EBMA 4FS0A 3FN3A 3KYMA 3H3PH 3HRZA 2NQCA 4Z7VF 3ROOB 1WAAF 3MGOA 1FCGA 3TZVB 3ESUF 5FA3B 4AH2B 4XC3H 3ARTA 5D1QA 1G9NL 5FAAA 4OCNC 3DURB 4H1LG 2JJWA 3UJTH 5SWQA 4NQEB 4PREB 5BOPA 4OV5B 1F3JB 3EO9H 4H5SA 2I60L 5F9OL 1IEAB 2C5DC 5DMIL 3C6LD 2PYFB 4U1GC 3H3BC 2WBKA 3UXFA 4J8RB 5F1NB 3U0TB 2H2SD 2P5WE 3SE4C 2EEBA 1YC7A 4WI2A 1JTOA 3R1GH 3SDXE 4ZS7L 4PJ8A 5FDWB 4U1KA 3JV6B 1T2QH 3E8UL 2UUDK 4L4TE 4HIHB 9CGTA 3CPLA 5ALBH 3QDGD 1TJIH 3C87A 4Z7UF 2KUTA 2FHFA 1A7RH 3H0TB 5DRXB 4IOFC 5IEHB 3HA0A 2V9RA 1OPGL 3PQYE 2BY3A 2Q8AH 1U36A 1ZS8B 3CFDB 5DWUH 5CP7A 3HE7D 3G6JB 2B20A 4UT6L 4KPHH 4G8FB 2DI8A 1KEMH 4JKWA 2EYSA 4JPVL 5TPWL 1PX3A 2DLTA 4K3GA 3MLRH 2YMXH 2AABL 1HIMH 1FO0A 2X41A 5ID0A 3JV4B 3S3JA 1S7WA 3SQOH 4LVHC 4W4OA 4FG6C 3KAAA 3NPZB 3P0VH 4XMLL 4U6VL 1ZTXL 3S5LG 1T2XA 4K2UH 3TYGL 2D7QA 4N0RA 4MQXD 5CJXA 1A7BA 3OR6B 1CFBA 4U7MA 1FDLL 3ET9F 2OTWB 4O9HH 1RZ7L 4JCLA 4GKOA 4OZFA 2Z8VC 4LGRB 2PW2A 3IDNA 4KZEL 4YBQD 3U1SH 2XG4A 1MRFL 2HJKA 2G2RB 1E4KC 1ZT1A 2PXYB 4Y5YC 4RGOH 4KY1L 2BRQA 2F19L 1ZLWH 1WJ3A 5DZOA 1I1FA 3CXDL 3MCKA 1KCVL 5I19L 4S1RH 5C0IB 3E6HB 4YHZH 3REVA 1I85C 2XACC 4JO1L 4X9HA 3V0VA 3PHOA 4U0RB 4L1HA 1KIPB 5EULV 4OIAA 1ZT4B 3R4DA 5I1LA 1YMMB 2AJZA 3NCCB 5C08A 2Z93A 1OAUL 5BW7C 4ONGH 5C8JB 1T89A 4L8SC 3C5JB 3MYJA 2HG5B 4F3FA 3LN4B 1JFQL 5IK3A 1GGIH 2OZ4H 4KKAC 1AO7A 2AJVL 5D1XA 2QHRL 2MHAB 4JM2D 2JIXB 1PZ5B 4I2XE 3IXTA 4CDHA 2GT9A 3MLUH 4G8IB 5EOTA 1ITBB 3HCVA 3NZ8B 4F37K 4TQEH 2VDMH 1KJ3H 3VFUA 3STLB 4DN4L 4YEEA 5BS0B 5C0AE 1IZJA 1IGYB 3BQUB 4YBHA 5HHXL 3S37X 3VXUA 2YD5A 3MRDA 2AXGB 2ERJB 1G9NH 3JXAA 2X4QB 3BPOB 4NUJA 1UEYA 4LVNC 2UWEF 3I3DA 1G7LA 2OXHA 1OQXA 5TDNB 1N5YL 4RGNB 3KPNB 3EYUH 4JFZL 3WFBL 3BVNB 1FYTB 1CG9A 4JB9L 2I60H 5F9OH 1D5XA 2DS4A 5DMIH 1ORQA 5JORA 1U3HD 2IANB 4ZUSB 2DQGL 4CRPA 2DQEH 4ZS7H 3JV5A 1IC1A 4HJ0C 1CR9H 3E8UH 3C09B 5CIPB 3QJHA 4I18B 1FYHB 3F6LA 2A83A 5AD0B 1OTUC 1D9KC 4AL8L 2Z4QA 4RDQF 1OPGH 5T3ZH 3KYAA 3LKPB 3SDDB 3VWJC 5GGRA 4KVNL 4UT6H 5D7JC 2BRRL 4JPVH 5TPWH 1MHHB 3FFCD 5DC0A 2K7PA 12E8L 2AABH 5CD3B 3SKOA 2VZUA 5DEZA 4GW4A 3TBTB 2XY2A 3PWPD 4TUOA 1RK0A 4KUZL 3BSZL 3SE9L 2UVEA 3GJFH 4QT5B 3SBWA 1T21B 1FV1B 1KJVB 1ZT7A 4F2MA 3HMXL 4CBPA 2Z92B 35C8L 1HQRB 3VA2C 1ZTXH 5C0GA 4KTDL 3TYGH 3O2VL 3QFDA 3UTTD 2ITCA 1FDLH 4XAKE 1GH7A 5FKPA 2OI9B 4IDJL 4DFHA 3P2TA 3HKFA 1RZ7H 4PY8I 1REIA 5DHYA 3PL6B 5DD3L 3BKMH 1LEIB 3QUZB 3VFRA 5F21B 2FD6H 2F19H 4X6CB 4JKLA 3PF2A 5A43C 5J0BA 4IRZH 4JLRB 1PQZA 1LO0L 3ILPA 1IC4L 2IQAA 4F9LA 1PKOA 4JO1H 4ONFH 3T65A 2ZWLT 4GAGL 3TJEL 1HZHL 4AJ0A 1YEDB 1MLCB 3KNBB 3ARZA 2YUXA 1XF3A 2PYEA 3RVXD 1JGVL 4LBEA 3RU8L 4M43L 4NC1C 1CLOL 3RWCB 2Q87A 1PW3A 5C2UB 5CEZE 2X6MA 4ENEC 5IB2A 3HMWL 4KWUA 1KTLA 5IMOA 4KTEL 3OHXB 1JFQH 3KPRD 3BD5A 3GMRA 2AJVH 1OQOA 1QLFB 2QHRH 4UIKL 3BDYL 3CLFL 4QHMB 3DO3A 3FT4A 3E6FA 1NDMB 4FMKA 4JDZA 3BKYL 5KJRL 2OQJB 4EOWL 4DN4H 1NGWB 1W8OA 3ES6B 1Q9LA 3LB6C 2X4TA 4C59B 4NNXA 5E2TL 2ADFL 5HHXH 2RHEA 3QPQC 3IDMB 4NQSA 3MROB 3RVTD 1NGZA 1EBAA 1I7TA 2A74A 1B0GA 5IWLC 2D0FA 1N5YH 1NFIB 2R1YB 1K6QL 4JFZH 1G6RB 3M1BA 3WFBH 1N3NA 4JB9H 1UG9A 1D7FA 4JRYB 3TYFB 3V6OE 1S7SB 5T1KB 4QXGL 4RAVA 2VXSL 4OUOA 5EDXA 4K8RH 2DQGH 3QQ3A 1I1YB 3CFBB 1RZGA 4N8VB 3ZL4L 2VLLA 1S7VB 1DVFD 4PJ9B 3LEVH 3OB0K 5EB9A 5EG6C 1Y0LB 4XMKL 4ALAL 3HI1A 5INDA 5DJXB 1F6AB 1A2YA 3HS0A 1J86A 4AL8H 2N4IA 4CNIB 3QDJE 4LFHG 4QRQA 3ZE2F 1AGBA 2MPAH 4OLUL 1ZE3C 3VXOA 2JCCB 4Y16B 1IGML 1KT2A 5HGAA 3MQIA 1LE9A 1CXEA 2BRRH 2OTUA 1MRDH 5FYJL 4TSCL 4OLVL 3LN5A 4QO1A 1YJDL 1A6ZB 4I3SH 4NJAL 3RWEA 2AXFB 4GG6B 4KUZH 4BQ8A 6FABL 2X7LA 4DJMA 5CCKH 3HMXH 3U36B 3OKKA 3QULB 35C8H 4U1LA 4KTDH 1NGQL 4P5KA 3O2VH 1KCLA 3DBXA 3GMOA 3MV9D 3ULUE 3T09A 5C9KA 4H1LA 4PP1D 2NY4B 2DIJA 4IDJH 3KR3L 1VESA 4M1DL 4RAUB 4LARL 5T1LA 5DD3H 3ZYIA 3L6FA 3S6CA 1U95A 3C5SA 3S98A 3MUHL 1LO0H 2UY6A 5B8CC 1IC4H 1F4HA 1XGYL 2ZUXA 4OZGA 2R2HA 2Q6WB 3O8XB 3MYZA 3F12B 1RK1A 2FX8H 2D0HA 4XCCL 3UO1L 4GAGH 3TJEH 1HZHH 2NY5L 5HGHA 1J05B 2XXCB 4RMUA 5HI3C 1T22A 3RWIA 5KSAA 1B4RA 5FA4A 4PJAA 1JGVH 2JJSC 3O6FA 3SE3C 1JTTA 2LVEA 1ZVSA 4GLRH 3RU8H 3QXDA 4M43H 5BRZB 1CLOH 4MAUL 2XFXA 5I73C 1YY8B 3L95B 3OZ9L 2NZIA 3WS6C 2X1QA 5E5RB 3UJJL 3ULVC 3HMWH 4KI5C 2GCYB 1AY1L 3U0PA 1N59B 5F9AC 3MLSL 1D5BA 4GXUN 5HSFA 3V4PL 4UIKH 3BDYH 1OW0A 3CLFH 3TPKA 1RQ5A 2Z8WC 4U3XA 4RNRB 2DL2A 2OYPA 3BKYH 5EBGA 1MELA 2V2WA 3C9NB 4QOKE 5GGTL 4EOWH 1CQKA 5MENE 3QSKB 3Q5TA 4GAJL 3TZVD 3OKNA 3ZDXF 1Q38A 5IW1A 1A1MB 1U8NB 3LEXB 4JFOA 5E2TH 2ADFH 4YJZL 4TSBL 5FEBA 5IHUL 3QJFB 4ORGA 2OZ4A 4UU9B 5EO0B 1FCCA 3T0AA 5EUKB 4CMHB 1NCCH 3P0GB 3L3OA 4MXWL 3L3HB 1K6QH 2NNAB 5I66B 1S7XB 2DQFB 3OAYK 3X12A 3CU7A 3VRJA 2DLFH 3VGAC 3DLQR 3QIUA 1IILE 5IHBA 2ZSVA 1QFPA 5FGSA 3BT2L 4NWUH 2VXSH 4XI5D 1CD9B 1OAZL 2DJSA 2NX5B 2HVJA 3ZL4H 3ARBD 3V5DB 4MD0B 3CZJA 1CLCA 3AFLA 1RZJC 5HHNB 4YGVA 4X4XA 1KLFA 3H8NA 5I1GL 5CD5D 4GG8B 1EJ6A 2HVKA 4OM1H 5E9DB 5MEPB 5KS9B 3O41A 3G5ZA 4IS6A 4F33B 3GDBA 3QWOB 4KHTL 1CK0H 5L6YH 1KELH 4K7PH 1ULVA 3ECBA 4OLUH 4HJGB 1SMOA 4MB4A 2H8PA 5D5MB 3O6ML 4YHKL 2LV4A 3NIDE 1BZ7A 3BYYA 2AV1A 2LFGA 3BD4A 5FYJH 4TSCH 4OLVH 2GY5A 5J9PB 4U49A 3UTZB 3WJLC 1YJDH 4NJAH 3O9WA 4JJHA 4YHLL 32C2A 6FABH 3VRIA 2Q76A 1C5BL 1TITA 2OS7A 5CZXC 4Y4KB 4S1DC 4RGMC 3SO5A 1RJYA 1NGQH 4L3EE 4HBQA 1IC5L 1JGLH 3GGWB 5J6GB 2D7MA 3KR3H 5T5FL 4M1DH 2K9UA 1H15B 5CZVL 4G5ZL 4QHLA 5K9QG 2XA8L 3TBYB 1J0KA 2O5XH 2VZVA 3NOIA 3FO2A 3U48A 4M1CD 3VFTB 4X83A 2YWZA 4POZD 1XGYH 2QJDA 1UXSA 1T66C 3ARDA 1K4DB 1TZHB 3IAQA 2YD7A 4X8JB 1AD9B 4XCCH 3QRFM 2BHYA 2NY5H 1P5UA 1YMMD 2AV7B 2WUBL 3RWFA 2R8SL 1R3IL 1CI5A 2ATPA 3BAEH 5IR1A 2FO4A 2H9GB 4P5TC 4LLYB 2R4SL 3BW9B 4ZUVA 1BFVL 4S1SL 1FIGL 3QG7L 4MAUH 1LQSR 3EO0B 3EYVA 1XR9B 5JIPA 3BPLC 4OZGF 1MNUL 1ZLVH 1AY1H 4YC2B 1H3TA 3LKOB 1MCWW 4UIMA 2JIXD 3MLSH 5DO2D 3CC5B 5E8NB 3V4PH 1MI5E 1ORSA 4TNVF 3MACH 3VMOA 4QHNB 1F2QA 4GRLB 2MCPL 3IB4A 4P2RE 1DBAL 5DJCB 5DK0B 4PJAF 5C09D 1LD9A 5GGTH 5T3XL 3RKDD 1UJ3B 4KV5E 2NTSP 4R3SA 5BS0D 5LGKA 3BZDA 4GAJH 5DUML 3VXRE 5GS1A 1RFDL 3BQUD 5F70A 3FQTB 5D4QA 1VKXB 3BIAX 5F9JB 4X6EA 2E7HA 5I8OL 3FQUA 4TSBH 5IHUH 1EFXA 1WCBA 1UZ6E 5LCVL 1NLDL 1NSNL 4ZOAA 5F7KC 4U2ZA 4RGND 4CADB 2FWOA 3GSUA 1AD0B 3IS1X 1FYTD 4LLWA 3OPZH 4KJYA 2W9DL 1Z3GL 5D6CB 4APQC 2IAND 1OGAE 2E8YA 4JFHD 3BT2H 3IU3B 1OAZH 5E6IA 5IHZA 4EEEA 2UY7A 2B5IB 1I3GH 3SKJH 3DUSA 5CBEA 1NL0L 1OL0A 1PJ9A 2CIKA 2EDQA 3JVGC 3VGEA 2AK1L 2Q8BH 1U8HA 3F7VB 4OZIA 4X9BA 1BAFL 4KHTH 3K2MC 3RDTC 2LVCA 3SDDD 2BSTA 4XNYL 4RCAA 4Y19B 1U91A 3O6MH 2QADC 4YHKH 2H2PC 3KPMB 4O51B 3L1OL 2NY0C 4IRJB 1J0JA 4NZDA 4IOIA 3HZKA 3TN0C 4KGLA 5HVWA 4YHLH 5H2BB 1IT9L 4RA3A 1C5BH 1XF2A 2EE9A 4OD3L 3SKMB 5CEZL 4CKVX 3RIAK 1J1OL 1JNHA 1I3VA 4E41B 5FM8A 3P4NB 3TVMC 2XPGA 4J6RH 4DGYL 3PL6D 1MH5A 3GI8L 4MD4A 3QUZD 5ISZB 4XH2B 4G5ZH 2V2TB 2XA8H 1T1XB 5LBSH 5CJ8A 1MF2L 2RB8A 1NKOA 1QBLL 5DQ9A 2CRIA 5ID1B 3GJEB 3EYSH 2R39A 3AU1B 2MKLC 4ZFOB 5I2IB 1V7NH 4PRDA 2P47B 1WT5C 1R5WB 2WUBH 3CX5J 1SVCP 3V6FA 3BMWA 4QTHB 3TEUA 4TNWF 1BQHB 2R4SH 3VFSA 3ZKXB 1BFVH 3L9RA 4S1SH 3PV6A 1FIGH 3QG7H 3G08B 1VFOA 1YPZE 2JE8A 4YUEL 2NY1C 4ZTPL 1MAML 3C5ZB 1LHZA 3BN9D 2Y6SC 1MNUH 4YDVB 3NIFF 4FQCL 5M95B 1T6VN 5J6HA 5CAYB 3LHPH 4XTRC 3MR9B 5B3JF 2MCPH 4FABL 5J4MA 3W9EB 3FZUD 2BOCB 1JPTL 5DUMH 4EQ3A 1QA9B 1RFDH 2L7JA 4PRNA 5MP6H 3VGBA 4LAJH 3DVGB 2A1WL 3ULSB 1INEH 2FJGA 5HHMB 2W65B 1MPAL 2F58H 4NYLA 3ARUA 5LCVH 1X4ZA 1NLDH 1NSNH 3QCUL 3LKNA 3MMEB 1M05B 3G5VA 1DSFH 4NOBA 2G60L 5IROA 1PSKL 4LLMB 2R1WA 1ZVHA 4V1DB 1NC2B 1N64L 4KUCD 4ONHA 4OCXH 1P6AB 5LG1A 4JRYD 4JFXA 5GGVY 5T1KD 2W9DH 1KG0A 1K8DA 1Z3GH 3U82B 3RVVD 3U6RB 3P9LA 1KJMB 4NN7B 1Q94A 5GRUL 1NCTA 4PJ9D 1B2WL 5C0BE 3ULUL 2Y4SA 2A0LD 1RIVH 2QSQA 3BXNB 4JANA 4GAFB 1LEKA 2FEDD 1V3MA 4UT9L 2E27L 3AB0C 4BFIA 4Z7QF 2AK1H 4D0BA 1BAFH 4KJQC 2J5LB 4QTIL 1I9JH 5EFIB 5E95B 3L5WA 4YPJA 4HEME 1QSFE 4QRSA 3QRGL 3RVUC 5IVXA 8CGTA 3IVKB 3JTTB 4HXAH 1HWHB 4XRCA 3L1OH 1VADB 5C86A 3OX8A 4UBDC 1LE5B 1E27B 3QO0A 5FGCB 1ES0B 4PJCB 4OZIF 1IT9H 3MODH 3D85B 4WHTB 4QCIA 2ARJB 2ZSWA 3NAAL 5CEZH 4OD3H 1QRNA 3MV8E 1P4LA 5DQJB 3VFOB 2NY4D 1J1OH 7FABL 4QRPE 2CLZA 5HPMA 2Y72A 1MCSA 2HRPL 4Y2DB 3BJ91 4MCZB 3EO1B 4DGYH 3QFJE 5D6DA 3X11B 4HCRL 3FFDB 4WJ5B 4F7CB 1R3LA 5DK2A 4IIQC 4UQ3B 3BP4B 2H32H 4I48B 1FGNL 1NAMB 4NPYB 3L5XL 1QBLH 4P2OB 4LSVH 2L4OA 4G80B 3O8XD 4Y2OA 4U1SB 3QUYA 4YHNB 4Y5YB 4ZNEE 4X4ME 5EUOA 4ZOEA 3BRGC 4JVUA 3MRLA 1JF1A 1CFNB 5GIRB 1MFDL 1U3HA 1K5NA 5BV7L 4JZOA 1A1OA 2BHZA 4YUEH 4ZTPH 4GKNB 1MAMH 3BEVB 2O5ZL 3ZHLA 3MBXL 4QRTB 3BPNC 1KTDB 1HQ4B 4N0FA 2Y5TB 3CH1B 1OF2B 3WLWC 5ICYA 2H6PA 4FABH 4KJPC 1HHGA 1JPTH 3QIWD 3KLHD 1N2RA 5JOFA 1T20A 2EE6A 2HT4D 3W39B 1CICC 2IPUK 5HI5D 4RMRA 3FFCA 1JNNL 2X5PA 3B9KB 4HK0B 4UQ2B 1MPAH 1ZLUK 1MCDA 1U3ZA 3Q2CA 3QCUH 5D1XC 2XZAH 5TF0A 4FQIL 1LK2B 1PSKH 2XKNB 2UYLB 1JV5A 4D9RE 1AHWA 4HV8A 1U41A 4GKZB 5HPOA 5L8KB 4JPWL 3KLSA 2XY1A 3I75B 3UTTA 4D0DA 1EAPA 1DE4B 3O4LB 1J88A 2NX5D 1NCBL 3PQYA 4LVOC 4PLNC 2IADA 1B2WH 3OAUL 5ESVA 4XX1E 3QWRA 3VXMB 1MCEA 5F9DC 3GRWA 3ULUH 1A9BA 3RUGF 1H5BC 2IFGA 2D3VA 3IETB 4M4RA 4LHJB 4GS7C 2E27H 1FGVH 5E9DD 4XP6H 3RZWA 3D39B 3VH8B 4OGZA 4HS6A 3T8XB 5FK9A 4J3XA 2BMKB 5FIEA 2V7NA 4EJ1C 1FL6B 2NY3C 4WWKB 2Z35A 1FG9C 2PCPA 1FFOA 4ZO7A 1X5XA 5KSBB 1KGCD 2F8XC 3QRGH 3RZCA 2VQ1A 1BX2B 3GBMH 4MAYD 3W0WE 5HVHC 5IOPA 4JFPA 2AEIT 3N1GC 1YN7A 4EDXB 3TA3A 3KPSD 4MNHA 4MMZC 3VI3F 3L3GA 3BHBA 1WBXA 1T0PB 1X7QB 5B38B 3KPRA 4Y4KD 3TBVB 3P30H 5D7JB 4HSQA 3DECA 3NAAH 1BVKB 3H9YA 3RVWD 5JLZB 2O5YL 3WE6B 1M6OA 3NPSB 3PHQA 1TXKA 3G5YA 2DQUL 5EORL 7FABH 5IVXF 2B39A 4AY0A 5FO7B 2HRPH 2Y5EA 2CDGA 3WKNA 4O2FB 4PGDB 3Q0HA 4PJFA 3PWJA 1WVZA 5MEOB 4HCRH 1O5DT 2VR4A 3IDIA 3P4OA 3WDHA 3NFNA 4UNUA 1K3IA 1YNTA 1FGNH 3ALPA 1AXSA 2FIKA 2YD8A 25C8L 1A7PL 4EN3B 5I75B 3P4LA 1JL8A 5C0ND 3ZKMC 1UKQA 2V9TA 4N0CD 4LGPB 1ZEAL 1A21A 3S4SB 4I2XA 2YPLE 4ODHL 4NNPL 2FYYB 2DN7A 4TTDC 5E7BA 4TRPL 1MFDH 4HUXB 3OAZH 4HGWA 4FFYL 4HHAA 5BV7H 4XBGB 5BVJA 4WENB 3IDXL 4LNRB 3MBXH 4UUJA 5IB1B 4N0YL 3PWNB 5ESAB 5DZNA 3RX8A 4GRLD 5EUOF 3ZSTA 3AS1A 3O0RL 1N8ZB 3PP3K 4S11A 2MQ0A 3DRTA 2EDEA 5DEGA 1A3QA 3K4AA 3GSWB 2HT3D 1PDKA 1FZMB 4BH8B 5IVZB 1OCWH 1JNNH 2W0KA 2F5BH 4PJEE 1WFOA 1XGPA 5F3BB 4ZFZB 3BPCB 3G9AB 2OMBA 5HHOB 4GOSA 4YXKL 1I8MB 5DLML 4YWGH 2M8XA 4CW1B 4KDTC 1F02I 4O4YL 1AFVH 1MFCH 4X98B 2YKLL 1V3LA 3DGCR 2F53E 4PRIB 4ZYKB 4WTZA 1RZ8B 4JPWH 1EO5A 1U8QB 4I8DA 4HH8A 4XPFL 3R06B 4NUGL 2ZOKA 3GMMA 1NCBH 2PW1B 4G9DA 3MRNB 2ZKHL 3OAUH 3SO3C 5DRZA 2HFTA 1A9EA 1JK8A 2BNQB 4WFGE 1A22B 5F1SA 4KK5D 3I6LD 5F8RC 2ESVE 4RIRB 5GRXG 5F1IB 1EX0A 1CDBA 4XVTH 4JCMA 1JP5A 3IFPB 5AYUL 1ZGLB 1LEGB 1KLGA 4O2CB 2DYPD 5T1MB 4Y19D 3B8YA 1W72A 3WKML 5J3HC 2IH1A 3K8KA 1ROWA 2JB5L 2EIZA 3PUCA 4IRJD 5DJAB 3UTQA 3F7YA 4CUCA 2NLJB 5IJKA 3GIVA 1JN6A 3L3DB 4XBEH 1F42A 4NO0B 3C8DA 2A6IA 4P5MA 4P3DB 2AKRB 1RZIA 4WI4A 4F8TA 5JW4M 1EXUA 3C8KA 4KK6C 1BQLL 2O5YH 4P9ML 4E41D 2DQUH 1QOKA 5EORH 4NKQB 4ZTOL 5FO9A 3HG1B 1WBYA 4HUUB 5B4MC 7CGTA 1BVZA 2RR3A 4JAMB 5ISZD 4DK3A 2EDXA 3LKRB 5FA3A 4G6JL 1JUFB 3RWHA 4XNQB 5C0DB 1C1EL 4WRLA 2EIDA 4KRPC 2BCKA 1I8KB 2XWJA 1KIQB 2EYRB 1UJTA 4F7PB 1A7PH 4GRMB 3ZE0E 4ZD3L 2ZUYA 3EDFA 4JGUA 4PREA 1P7QA 2FHCA 1CTOA 2ILLA 4OV5A 1IGJB 1ZEAH 3MRFB 3PGCA 1IEAA 1SHMA 1HXYB 4ODHH 4PJFF 4NNPH 1C7TA 1FG2B 1ACYL 1MCFA 2PYFA 5B8CB 3FOLB 5D7IE 4TRPH 4JO3L 3DSFL 4PJGB 1S7RA 4U4BA 5DJDB 4FFYH 4YR6A 1J0IA 5C0RL 1MUJA 3C5ZD 1VACB 3PGDB 4BM7A 5FDWA 3IDXH 3ARBA 5EZOL 4XNMB 3RRQA 1X6LA 2KZWA 2GJ6A 4N0YH 1G0XA 3H0TA 5I17B 3DROA 2PNDA 4XHJC 3MRMB 3ZT7A 3HPLA 2R15A 3T4AA 2W0FB 3B9VA 4PRPE 4RMQA 1Q1JL 2RCSL 3O6FC 3NN8A 4LCWE 1YQVL 4OFYA 3QQ9C 3V6OA 1HINH 3UTSE 1X5JA 3E1F1 5E8EB 5HHMD 2VL4A 4EUPB 4U1JB 1AR1D 4NRXB 1GZPB 2VABB 4GW5B 2D7OA 1YDPB 4KQ4H 5F1KC 4YXKH 4V1DD 1NC2D 5DLMH 5DQDL 2FLRT 1EUUA 2P8PA 4OAWB 5HDBE 1OOAA 3QG6B 2CXKA 1ZGLP 2CDEB 2VDKH 3CJJA 2YKLH 1UM6L 4JE4B 3WCYA 4NQVB 2OTWA 4ZOBA 3QUKB 5JQ6L 2HLAA 4NUGH 5DVLA 1FN4A 5GSRA 3VFMB 2HJLA 1GAFL 2ZKHH 2XWTA 2Q7YA 5GRWA 1F97A 1Y18B 4YQXL 4FMFA 3DI2B 4PRHB 2IFFH 5DFTA 4JFDB 3D1MC 3QNZA 1CFSA 1MCBA 3T0EB 3MRGA 3ZZ1A 3HB3C 1AI1H 3LMJL 4Q9QL 1S9VA 4OFDA 1XF1A 1H3VA 3RFZC 3RWGB 5AYUH 4E42B 4MYWB 3ZKNC 2HLFD 4QNPE 1ETZB 1JGEB 4GJTB 1G9NC 4F58L 1RY7B 1F58L 1IM3B 4Y5VB 2CJUL 5E1AB 4PRAB 2VN4A 2HJFB 4JY5L 2Z8SA 4F7MA 4NQCB 4NZRH 1PEWA 2MHAA 2JIXA 3MLXL 3MRRA 3FRUA 1BQLH 1MWAB 2R4RL 4BH7B 1HEZA 1PKQB 1JZ7A 2C1PA 5C9JB 4ZTOH 4Y2DD 4FG6D 3H6JA 5IM7A 5C09A 3DV6B 1AQKH 4J1UB 4S2SA 3O3BB 5C0CE 1MAJA 3BQUA 4G6JH 1KB5B 4RGMB 1X5FA 2LABA 2QTEA 1N6QL 1C1EH 2AXGA 3MC0A 4PPTA 4P2OD 2ZCLL 1ZOXA 1SVZA 5JOEA 3IJHB 4N0UE 1YC8A 4L5FL 4ZD3H 3C2AL 2QQQA 1VFMA 1BD2E 3Q48A 5J56B 2HH0L 1I8IA 2A73B 4A6YH 2XKUA 5BZDA 4F7TA 3U4EB 2VOTA 1J8HD 1X44A 4OUUB 2Y36L 5F3HA 5AZ2L 2BXYA 3BP6B 1ACYH 1FFNA 5FF6A 2IANA 2WINB 3SJVB 3D0LB 1NGPL 1NDGA 4JO3H 3QNYA 5DD0L 2D7TL 4EIZC 4X6DB 2UZIL 4HF5L 4KAQL 4WIQA 5EZOH 4H8WH 1Q8MA 2XNAB 4R9HA 5KTEL 4NQEE 2E8ZA 4JFQB 3K1DA 3IFNH 3QEQE 1RVFL 3D3VB 3HC3H 4KK8C 2X4PB 5DMGC 5INCB 5I1AB 4LCIH 3V7MA 1KYOJ 2RCSH 5MERA 5TE7L 3SDDA 4GFTB 1PG7X 1YQVH 4I0CC 4RWHA 3O6KH 5DURB 3VXQA 1RIHH 3ZE1F 4X7FC 1QNZL 3B9KD 5CBAA 1KC5L 3AM8C 3OSKA 1WTLA 2DQTL 5EBLB 3AXLB 1T21A 4PJ7B 5KZCD 5DQDH 4CU8A 1A6PA 4WFHE 4M7ZB 4Z7VB 4U1HB 4XNXH 1AP2B 1UM6H 4RZCB 4CVZA 4JDVA 3O4LD 5GS1C 3EGSA 5L8LB 1MIEL 2EO9A 3DV4B 3G6JE 5JQ6H 2I26N 2AK4E 4OIBA 4PV9B 4UMGA 2ICWB 5TH2B 3VXMD 5I1DA 1GAFH 3B2UC 3O3DA 2WBWB 2H45A 3B6SB 1U9KA 4APQB 1DEEA 2R1XB 1MRCL 2FB4H 4XAWL 3FO1B 2J6EA 4LLQA 1BOGA 4RQQA 5I8EB 2HT2C 5D1ZC 5CHNA 3L5IA 1CVRA 1YEIL 4AENB 3DSNA 3SEPA 1S7TA 3CNKA 4PJIE 2UZXB 4WWKD 4AZ8A 2QSVA 4HJ0D 4EQ2A 1YEDA 3CVHB 4IHOA 3GNML 5AZEH 3KNBA 3WNLA 2IGFL 4FXKB 3HE6B 1KCUL 2BY0A 4G7VL 5KOMC 2CDFA 3QI9C 4L3EA 4F58H 3FQNA 3EJZD 1OTUD 4KH2A 1D9KD 1F58H 3QUMA 1SBSH 3RDTB 1WIOA 4URTB 4HFUL 3LSOA 3VWJD 4R0LB 3OHXA 4K3HA 4LKXB 3LS4H 5D7JD 3FAXA 3MLXH 4K8RC 3FCTB 2R4RH 5IW6B 2P42B 3BDBA 2VAAB 1FSKC 4Z77A 4ZPTA 2OQJA 1J1PH 4XX1G 5L88L 4LKCA 3F7QA 3HR5B 1NGWA 1U3YA 2CKNA 1PLGL 3O4OB 2FBJL 1JGDB 3HAEB 3NZHH 4HKXA 1N6QH 1MFEL 4M8QA 3V0WL 4RRPG 3VJ6B 2ZCLH 4JQVA 4EN3D 4KQ3L 1FNEA 4QHUB 4DTGL 4L5FH 4Z5RB 2BOBB 3C2AH 2B4CL 3ARGB 4PY7B 2ZUQB 1FRGL 1CFQB 3TF7C 2HH0H 1AKJB 4K07A 2VLKE 1MI5A 2YXFA 1G9EA 1R3HB 5AZ2H 1DQQA 5FYKD 1IGTB 1P1ZB 4P2RA 4JQXA 5B3NA 3LPFA 1JCKA 1NGPH 3ABZA 5DD0H 2D7TH 5D2NC 2HP4A 5HYQB 2EE2A 1KV3A 2UZIH 4RMTA 4HF5H 2A2QT 3TH2T 5FHAL 4KAQH 3KPPB 4P46A 1J7VR 4MJ6B 4MNQA 3H3KA 3U4BL 2Z9TA 4EVNB 1XMWA 4IMKA 3EYFB 5KTEH 4RGNE 1IGFL 3W11D 1RVFH 2VDPH 3TPUA 4OLZH 3M17B 3MBEB 4Z7WA 1VHPA 3U30B 3CLEH 3PIQB 1YEGL 3DX9A 3ZDZE 2MSPA 1QNZH 2CK0L 3L3JA 2JJTA 5E24E 4IDLA 4WU7B 2VTFA 2VZTA 1MJ7L 4I9WE 2DQTH 4FXGA 2E7LA 3BGFB 2Y7QB 3U36A 4K7FB 4IRSB 4PRID 3T2NL 5KSVA