1OU5A

Crystal structure of human cca-adding enzyme
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
356
structure length
344
Chain Sequence
DKMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human CCA-adding Enzyme: Insights into Template-independent Polymerization
pubmed doi rcsb
molecule keywords tRNA CCA-adding enzyme
molecule tags Translation, transferase
source organism Homo sapiens
total genus 82
structure length 344
sequence length 356
chains with identical sequence B
ec nomenclature ec 2.7.7.72: CCA tRNA nucleotidyltransferase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
A PF12627 PolyA_pol_RNAbd Probable RNA and SrmB- binding site of polymerase A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 1ou5A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1ou5A01
3RJKA 8ICPA 8ICSA 4KLEA 8ICYA 4YN4A 4RWOA 3OUYA 3JPNA 4UBBA 1ZQFA 4Z6FA 4QZAA 5J2AA 4MFAA 5DB9A 4WC6A 4FHPA 4YD2A 5J2BA 4M0AA 3AQKA 1JMSA 4QZ9A 3B0XA 2I9GA 4I28A 4M5DA 4O9MA 4WC1A 3JPPA 4X4SA 5IILA 1WOTA 4EP7A 4LVSA 4UBCA 1VJ7A 4F5PA 5J0PA 4P2HA 4WC7A 8ICKA 4P4PA 2ID1A 5J2EA 3K75D 4KLUA 4DOBA 4NKUA 4WC4A 3OGUA 4XQ8A 3MGHA 2HHPA 4I2DA 5J2CA 3RJIA 4NXZA 3C2MA 9ICPA 4QZ8A 8ICNA 3ISDA 1UEVA 3UXNA 4PHDA 1ZQSA 5DDYA 1ZQBA 2ZHBA 4KLTA 3RJHA 2M2VA 5DB7A 4UD4A 4UB1A 1MQ3A 1BPZA 1RZTA 3UXOA 1ZQLA 1BPYA 4I2FA 4MFCA 3HIYA 3TFRA 7ICLA 3AU6A 4YMOA 1ZQJA 5J0OA 5J0QA 2DR7A 2FMPA 3RJEA 4WC3A 1TFYA 7ICSA 3JPRA 7ICRA 4KLQA 3AQNA 5BPCA 3HX0A 1ZQDA 3UQ0A 5BOLA 2VANA 5F2VO 4TUPA 7ICTA 4GXJA 4ATBB 1ZQPA 4R63A 2ZH1A 7ICFA 4UB3A 2DR8A 5HR9A 4KLMA 5HRDA 1ZJMA 1XSNA 4KLGA 3JZ0A 3C5FA 4WC2A 5IIKA 3UQ2A 4RQ7A 1ZQEA 1NOMA 1ZQHA 4FH3A 4NKTA 4O5KA 5HRGA 4I2GA 4MF2A 3V7LA 4AT9A 5D46A 5HRHA 4FHXA 5J2DA 8ICCA 4PGQA 5J2KA 9ICFA 3RH6A 4I29A 4O5CA 2FMQA 5CJ7A 4K4HA 1F5AA 1Q78A 2ZH3A 3UXPA 2NRKA 4RPXA 4GXIA 5IIIA 1UEUA 4KLHA 4I2IA 1R8CA 3H37A 4YCXA 4I2BA 5HRLA 4O5EA 7ICEA 5CWRA 4I2JA 4UAWA 4S3NA 4X4TA 3GDXA 5CP2A 5HHIA 4NM1A 2ZH8A 4RWPA 5CHGA 2GWSA 8ICFA 3TFSA 4YMMA 9ICGA 4Z6DA 1ZQOA 4QZHA 4QZCA 3HW8A 4R65A 5IIJA 3V72A 4Z6EA 5J2FA 1JAJA 4LZGA 2ZH2A 4WC0A 3WFRE 2PFOA 4E8FA 1BPEA 4UB2A 4KLLA 3MDCA 4WC5A 3ISBA 1ZQNA 3C2KA 1ZQAA 4X4VA 3RJJA 9ICJA 5HREA 4PGXA 3B0YA 1R8BA 8ICWA 4X4PA 9ICCA 3MDAA 4FHWA 1R8AA 1PX5A 5J0WA 2DR9A 3HJ1A 7ICPA 4F5QA 5IIMA 1BPBA 3MBYA 5J0YA 2FMSA 1MIYA 4X4QA 1HUOA 2BCSA 4TURA 3WFOA 5CR0A 4K4IA 4UB4A 4EBKA 9ICKA 5DECA 2BE3A 2RFFA 4TUQA 4DOAA 5DBCA 3OUYB 2DVIA 1OU5A 4UAZA 1JN3A 1ZJNA 8ICTA 2ZH7A 4LZDA 1V4AA 7ICJA 4NLZA 4KLSA 4QZBA 3H39A 4X5VA 4FO6A 4IG8A 4KLDA 7ICOA 5DBBA 5J29A 1KDHA 4X4UA 4KLOA 9ICTA 5J2JA 1BPDA 5D4BA 3PNCA 4WBZA 1ZQZA 4KLFA 5DB6A 2ZH4A 8ICUA 1NO5A 2ZH9A 4UAYA 3H38A 4IQVA 4GXKA 8ICJA 5DDMA 1ZQXA 2ZH5A 4X4OA 4Z6CA 8ICGA 5DEDA 4K4GA 2PBEA 5J0TA 8ICIA 5HRKA 4E80A 5DB8A 9ICBA 3HJ4A 2Q66A 2BPGA 4FHVA 4RT3A 8ICHA 2W9MA 3HWTA 3C18A 3ISCA 2IHMA 4R64A 5J2IA 4R66A 4NY8A 5EOZA 4XRHA 5J0SA 3OVAA 1ZQTA 1ZQQA 4IQWA 7ICMA 3C5GA 7ICHA 4RQ2A 4M04A 8ICAA 4QZEA 2ISPA 3PMLA 5DBAA 9ICUA 3C2LA 4RWNA 4UB5A 1ZQUA 3MGIA 4XUSA 7ICKA 2PXIA 1TFWA 9ICWA 5CB1A 9ICSA 1XSPA 2BCRA 1FA0A 9ICHA 4KLJA 2DRAA 4AT8A 4M9NA 5IIOA 1ZQKA 8ICXA 1UETA 4XA5A 2BCVA 3RH5A 4YD1A 3AUOA 9ICOA 8ICVA 4X0AA 1ZQMA 4PHPA 5HRBA 4I2CA 1YLQA 4M9GA 8ICOA 4AT9B 4I27A 3OV7A 2M2TA 2P66A 4RPYA 4M47A 3LK9A 1TV9A 3WFPA 2PFPA 2ZHAA 4PHEA 3NYBA 4ATBA 3UPQA 3H3AA 3JYYA 5HC9A 1MQ2A 2O1PA 4FH5A 8ICRA 2DR5A 5J0UA 2BCUA 5TZVA 2PFQA 1JQRA 4RT2A 4RQ4A 1KEJA 3WFSC 4QZIA 4TUSA 2M2WA 5IINA 4PH5A 4RQ3A 4PPXA 1MIWA 1ZQCA 8ICEA 9ICEA 1ZQWA 8ICBA 4PHAA 5J0RA 4RPZA 5BOMA 8ICLA 4KLIA 3RH4A 4RQ6A 4AT8B 4NM2A 3C66A 4RWQA 4NLKA 3JPQA 4E7XA 1BPXA 5HRIA 3WFQE 1MIVA 3OVSA 8ICMA 4AT7A 3RJGA 3AQLA 5HHHA 4FHYA 9ICMA 3AU2A 9ICRA 4RQ0A 4IQUA 4F5OA 4LT6A 4RQ5A 2O5AA 2ZH6A 7ICUA 1ZQGA 2BPFA 3JPOA 4QZFA 4JWNA 4DOCA 2PFNA 4RQ8A 4F5RA 3JPTA 8ICZA 4I2AA 4P4OA 4M9JA 4I2HA 2BCQA 9ICIA 9ICAA 1VFGA 2M2UA 4MF8A 5J2HA 1HUZA 3PMNA 7ICQA 2ISOA 4M9LA 1KNYA 3UPSA 1RPLA 4WCWA 9ICQA 5HRFA 7ICGA 3RJFA 4X4RA 5CA7A 9ICVA 9ICXA 3OVBA 8ICQA 4XQ7A 5DKWA 4JWMA 4MFFA 4X0BA 4QZGA 4M9HA 3V7KA 1Q79A 4WBYA 3AQMA 5J0XA 1ZQVA 9ICNA 4M2YA 9ICLA 3L9DA 1TVAA 4X4NA 4RQ1A 1XSLA 4I2EA 4AT7B 3JPSA 7ICIA 4P4MA 4F5NA 3LQCB 1ZQRA 4YMNA 7ICNA 1ZQYA 7ICVA 3V7JA 4DO9A 1R89A 2DRBA 4NLNA 4QZDA 4UD5A 1ZQIA 4IQTA 4EBJA 2BPCA 5J2GA 4PGYA 5D49A
chains in the Genus database with same CATH superfamily
3RJKA 8ICPA 8ICSA 4KLEA 4JLZA 8ICYA 4YN4A 4RWOA 3OUYA 3JPNA 4UBBA 1ZQFA 4Z6FA 4QZAA 5J2AA 4MFAA 5DB9A 4WC6A 4FHPA 4YD2A 5J2BA 4M0AA 3AQKA 1JMSA 4QZ9A 3B0XA 2I9GA 4I28A 4M5DA 4O9MA 4WC1A 3JPPA 4X4SA 5IILA 1WOTA 4EP7A 5CFTA 4LVSA 4UBCA 1VJ7A 4F5PA 5J0PA 4P2HA 4WC7A 8ICKA 4P4PA 2ID1A 5J2EA 3K75D 3K7DA 5D63A 4KLUA 4DOBA 4NKUA 4WC4A 3OGUA 4XQ8A 3MGHA 2HHPA 4I2DA 3CK6A 5J2CA 3RJIA 4NXZA 3C2MA 9ICPA 4QZ8A 8ICNA 3ISDA 1UEVA 3UXNA 4PHDA 1ZQSA 5DDYA 1ZQBA 2ZHBA 4KLTA 3RJHA 2M2VA 4N7RA 5DB7A 4UD4A 4UB1A 1MQ3A 1BPZA 1RZTA 3UXOA 1ZQLA 1BPYA 4I2FA 4MFCA 3HIYA 3TFRA 7ICLA 3AU6A 4YMOA 1ZQJA 5J0OA 5J0QA 2DR7A 2FMPA 3RJEA 4WC3A 1TFYA 7ICSA 3JPRA 7ICRA 4KLQA 3AQNA 5BPCA 3HX0A 1ZQDA 3UQ0A 5BOLA 2VANA 5F2VO 4TUPA 7ICTA 4GXJA 4ATBB 1ZQPA 4R63A 2ZH1A 7ICFA 4UB3A 2DR8A 5HR9A 4KLMA 4KM5A 5HRDA 2GA9D 1ZJMA 1XSNA 4WQKA 4KLGA 3JZ0A 3C5FA 4WC2A 5IIKA 3UQ2A 3MCRA 4KB6A 4LEZA 4RQ7A 1ZQEA 1NOMA 4NXTA 5CFUA 1ZQHA 4FH3A 4NKTA 4O5KA 5HRGA 4I2GA 4MF2A 3V7LA 4AT9A 5D46A 5HRHA 4FHXA 5J2DA 8ICCA 4PGQA 5J2KA 9ICFA 3RH6A 4LEWA 4I29A 4O5CA 2FMQA 5CJ7A 4K4HA 1F5AA 1Q78A 2ZH3A 3UXPA 4EV6A 2NRKA 4RPXA 4GXIA 5IIIA 1UEUA 4KLHA 4XJEA 4I2IA 1R8CA 3H37A 4YCXA 4I2BA 5HRLA 4O5EA 2FCLA 7ICEA 5CWRA 4I2JA 4JLXA 4UAWA 4S3NA 4X4TA 3GDXA 5CP2A 5HHIA 3PHZA 4NM1A 2ZH8A 4RWPA 5D61A 5CHGA 2GWSA 8ICFA 3ER8C 3TFSA 4YMMA 9ICGA 4Z6DA 1ZQOA 4QZHA 4QZCA 3HW8A 4R65A 5IIJA 3V72A 4Z6EA 5J2FA 1JAJA 4LZGA 2ZH2A 4WC0A 4O6AA 3WFRE 2PFOA 4E8FA 1BPEA 4UB2A 4KLLA 3MDCA 4WC5A 3ISBA 1ZQNA 3C2KA 1ZQAA 4X4VA 3RJJA 9ICJA 4WH5A 5HREA 4PGXA 3B0YA 1R8BA 8ICWA 4X4PA 9ICCA 3MDAA 4FHWA 1R8AA 1PX5A 5J0WA 2DR9A 3HJ1A 7ICPA 4F5QA 5CFSA 5D62A 5IIMA 1BPBA 3OWGA 3MBYA 5J0YA 2FMSA 1MIYA 4X4QA 1HUOA 2BCSA 4TURA 3WFOA 5CR0A 4K4IA 4UB4A 4EBKA 9ICKA 4K97A 4OAGA 5JTGA 5DECA 2BE3A 2RFFA 4TUQA 4DOAA 2B4VA 5DBCA 3OUYB 2DVIA 1OU5A 4UAZA 1JN3A 1ZJNA 8ICTA 2ZH7A 4O68A 4LZDA 1V4AA 5CHEA 7ICJA 4NLZA 4KLSA 4QZBA 3H39A 4X5VA 4FO6A 4IG8A 4KLDA 7ICOA 5DBBA 4K99A 5J29A 1KDHA 4X4UA 2EWRA 4KLOA 9ICTA 5J2JA 1BPDA 5D4BA 3PNCA 4MKPA 4I0UA 4WBZA 1ZQZA 4KLFA 5DB6A 2ZH4A 8ICUA 1NO5A 2ZH9A 4UAYA 3H38A 4IQVA 4GXKA 8ICJA 5DDMA 1ZQXA 4X4OA 2ZH5A 4Z6CA 8ICGA 5DEDA 4O69A 4K4GA 3NWIA 2PBEA 5J0TA 8ICIA 5HRKA 4E80A 5DB8A 9ICBA 3HJ4A 2Q66A 2BPGA 4FHVA 4RT3A 5B3QA 8ICHA 2W9MA 3HWTA 4FO1A 3C18A 3ISCA 2IHMA 4R64A 5J2IA 4R66A 4NY8A 1GPJA 5EOZA 4LEVA 4XRHA 5J0SA 4EGWA 3OVAA 1ZQTA 1ZQQA 4IQWA 4WOYA 7ICMA 3C5GA 7ICHA 4RQ2A 4M04A 8ICAA 4QZEA 2ISPA 3PMLA 5DBAA 4K8VA 9ICUA 3C2LA 4RWNA 4UB5A 1ZQUA 3MGIA 2HN1A 4XUSA 7ICKA 2PXIA 1TFWA 9ICWA 5CB1A 9ICSA 1XSPA 2BCRA 1FA0A 9ICHA 4KLJA 4HX0A 2DRAA 4AT8A 4M9NA 5IIOA 1ZQKA 8ICXA 1UETA 4XA5A 2BCVA 2B56A 3RH5A 4YD1A 3AUOA 9ICOA 8ICVA 4X0AA 1ZQMA 4NXXA 4LEYA 2IHOA 4PHPA 4NXUA 5HRBA 4I2CA 1YLQA 4M9GA 8ICOA 4AT9B 4I27A 3OV7A 2M2TA 2P66A 4RPYA 4M47A 3LK9A 2BBJA 1TV9A 3WFPA 4K98A 2PFPA 2ZHAA 4PHEA 2HN2A 3NYBA 4ATBA 3UPQA 4WQLA 3H3AA 3JCFA 3JYYA 5HC9A 1MQ2A 2O1PA 4FH5A 4EEBA 8ICRA 2DR5A 5J0UA 2BCUA 5TZVA 2PFQA 1JQRA 4RT2A 4RQ4A 1KEJA 3WFSC 3ER9B 4NXWA 4QZIA 4TUSA 3NVOA 2M2WA 5IINA 4PH5A 4RQ3A 4PPXA 1MIWA 1ZQCA 8ICEA 9ICEA 1ZQWA 3ERCC 8ICBA 4PHAA 5J0RA 4K9AA 4RPZA 5BOMA 8ICLA 4KLIA 3RH4A 4RQ6A 4AT8B 4NM2A 3C66A 4O67A 4RWQA 4NLKA 3JPQA 4E7XA 1BPXA 5HRIA 4K96A 3WFQE 1MIVA 3OVSA 8ICMA 4AT7A 3RJGA 3NKUA 3AQLA 5HHHA 4FHYA 9ICMA 3AU2A 2B51A 9ICRA 4RQ0A 4IQUA 4F5OA 4LT6A 4NXVA 4RQ5A 2O5AA 2ZH6A 7ICUA 1ZQGA 2BPFA 3JPOA 4QZFA 4JWNA 4DOCA 2PFNA 4RQ8A 4F5RA 3JPTA 8ICZA 4I2AA 4P4OA 4M9JA 4I2HA 2BCQA 9ICIA 9ICAA 1VFGA 2M2UA 4MF8A 5J2HA 1HUZA 3PMNA 7ICQA 2ISOA 4OAHA 4M9LA 1KNYA 3UPSA 1RPLA 4WCWA 9ICQA 5HRFA 7ICGA 3RJFA 4X4RA 5CA7A 9ICVA 9ICXA 3OVBA 8ICQA 4XQ7A 5DKWA 2IUBA 4JWMA 4EEDA 4MFFA 4X0BA 5B3PA 4QZGA 4M9HA 4OAFA 3V7KA 1Q79A 4WBYA 3AQMA 5J0XA 1ZQVA 9ICNA 4M2YA 9ICLA 3L9DA 1TVAA 4X4NA 4RQ1A 1XSLA 4I2EA 3EF2A 4AT7B 3JPSA 4P4MA 7ICIA 4F5NA 3LQCB 4K9BA 4YMNA 1ZQRA 1ZQYA 7ICNA 7ICVA 3V7JA 4DO9A 1R89A 2DRBA 4NLNA 4QZDA 4UD5A 1ZQIA 2BBHA 4IQTA 4EBJA 2BPCA 5J2GA 2GAFD 4OAIZ 4PGYA 5D49A
chains in the Genus database with same CATH topology
3RJKA 8ICPA 8ICSA 4KLEA 8ICYA 4YN4A 4RWOA 3OUYA 3JPNA 4UBBA 1ZQFA 4Z6FA 4QZAA 5J2AA 4MFAA 5DB9A 4WC6A 4FHPA 4YD2A 5J2BA 4M0AA 3AQKA 1JMSA 4QZ9A 3B0XA 2I9GA 4I28A 4M5DA 4O9MA 4WC1A 3JPPA 4X4SA 5IILA 1WOTA 4EP7A 4LVSA 4UBCA 1VJ7A 4F5PA 5J0PA 4P2HA 4WC7A 8ICKA 4P4PA 2ID1A 5J2EA 3K75D 4KLUA 4DOBA 4NKUA 4WC4A 3OGUA 4XQ8A 3MGHA 2HHPA 4I2DA 5J2CA 3RJIA 4NXZA 3C2MA 9ICPA 4QZ8A 8ICNA 3ISDA 1UEVA 3UXNA 4PHDA 1ZQSA 5DDYA 1ZQBA 2ZHBA 4KLTA 3RJHA 2M2VA 5DB7A 4UD4A 4UB1A 1MQ3A 1BPZA 1RZTA 3UXOA 1ZQLA 1BPYA 4I2FA 4MFCA 3HIYA 3TFRA 7ICLA 3AU6A 4YMOA 1ZQJA 5J0OA 5J0QA 2DR7A 2FMPA 3RJEA 4WC3A 1TFYA 7ICSA 3JPRA 7ICRA 4KLQA 3AQNA 5BPCA 3HX0A 1ZQDA 3UQ0A 5BOLA 2VANA 5F2VO 4TUPA 7ICTA 4GXJA 4ATBB 1ZQPA 4R63A 2ZH1A 7ICFA 4UB3A 2DR8A 5HR9A 4KLMA 5HRDA 1ZJMA 1XSNA 4KLGA 3JZ0A 3C5FA 4WC2A 5IIKA 3UQ2A 4RQ7A 1ZQEA 1NOMA 1ZQHA 4FH3A 4NKTA 4O5KA 5HRGA 4I2GA 4MF2A 3V7LA 4AT9A 5D46A 5HRHA 4FHXA 5J2DA 8ICCA 4PGQA 5J2KA 9ICFA 3RH6A 4I29A 4O5CA 2FMQA 5CJ7A 4K4HA 1F5AA 1Q78A 2ZH3A 3UXPA 2NRKA 4RPXA 4GXIA 5IIIA 1UEUA 4KLHA 4I2IA 1R8CA 3H37A 4YCXA 4I2BA 5HRLA 4O5EA 7ICEA 5CWRA 4I2JA 4UAWA 4S3NA 4X4TA 3GDXA 5CP2A 5HHIA 4NM1A 2ZH8A 4RWPA 5CHGA 2GWSA 8ICFA 3TFSA 4YMMA 9ICGA 4Z6DA 1ZQOA 4QZHA 4QZCA 3HW8A 4R65A 5IIJA 3V72A 4Z6EA 5J2FA 1JAJA 4LZGA 2ZH2A 4WC0A 3WFRE 2PFOA 4E8FA 1BPEA 4UB2A 4KLLA 3MDCA 4WC5A 3ISBA 1ZQNA 3C2KA 1ZQAA 4X4VA 3RJJA 9ICJA 5HREA 4PGXA 3B0YA 1R8BA 8ICWA 4X4PA 9ICCA 3MDAA 4FHWA 1R8AA 1PX5A 5J0WA 2DR9A 3HJ1A 7ICPA 4F5QA 5IIMA 1BPBA 3MBYA 5J0YA 2FMSA 1MIYA 4X4QA 1HUOA 2BCSA 4TURA 3WFOA 5CR0A 4K4IA 4UB4A 4EBKA 9ICKA 5DECA 2BE3A 2RFFA 4TUQA 4DOAA 5DBCA 3OUYB 2DVIA 1OU5A 4UAZA 1JN3A 1ZJNA 8ICTA 2ZH7A 4LZDA 1V4AA 7ICJA 4NLZA 4KLSA 4QZBA 3H39A 4X5VA 4FO6A 4IG8A 4KLDA 7ICOA 5DBBA 5J29A 1KDHA 4X4UA 4KLOA 9ICTA 5J2JA 1BPDA 5D4BA 3PNCA 4WBZA 1ZQZA 4KLFA 5DB6A 2ZH4A 8ICUA 1NO5A 2ZH9A 4UAYA 3H38A 4IQVA 4GXKA 8ICJA 5DDMA 1ZQXA 2ZH5A 4X4OA 4Z6CA 8ICGA 5DEDA 4K4GA 2PBEA 5J0TA 8ICIA 5HRKA 4E80A 5DB8A 9ICBA 3HJ4A 2Q66A 2BPGA 4FHVA 4RT3A 8ICHA 2W9MA 3HWTA 3C18A 3ISCA 2IHMA 4R64A 5J2IA 4R66A 4NY8A 5EOZA 4XRHA 5J0SA 3OVAA 1ZQTA 1ZQQA 4IQWA 7ICMA 3C5GA 7ICHA 4RQ2A 4M04A 8ICAA 4QZEA 2ISPA 3PMLA 5DBAA 9ICUA 3C2LA 4RWNA 4UB5A 1ZQUA 3MGIA 4XUSA 7ICKA 2PXIA 1TFWA 9ICWA 5CB1A 9ICSA 1XSPA 2BCRA 1FA0A 9ICHA 4KLJA 2DRAA 4AT8A 4M9NA 5IIOA 1ZQKA 8ICXA 1UETA 4XA5A 2BCVA 3RH5A 4YD1A 3AUOA 9ICOA 8ICVA 4X0AA 1ZQMA 4PHPA 5HRBA 4I2CA 1YLQA 4M9GA 8ICOA 4AT9B 4I27A 3OV7A 2M2TA 2P66A 4RPYA 4M47A 3LK9A 1TV9A 3WFPA 2PFPA 2ZHAA 4PHEA 3NYBA 4ATBA 3UPQA 3H3AA 3JYYA 5HC9A 1MQ2A 2O1PA 4FH5A 8ICRA 2DR5A 5J0UA 2BCUA 5TZVA 2PFQA 1JQRA 4RT2A 4RQ4A 1KEJA 3WFSC 4QZIA 4TUSA 2M2WA 5IINA 4PH5A 4RQ3A 4PPXA 1MIWA 1ZQCA 8ICEA 9ICEA 1ZQWA 8ICBA 4PHAA 5J0RA 4RPZA 5BOMA 8ICLA 4KLIA 3RH4A 4RQ6A 4AT8B 4NM2A 3C66A 4RWQA 4NLKA 3JPQA 4E7XA 1BPXA 5HRIA 3WFQE 1MIVA 3OVSA 8ICMA 4AT7A 3RJGA 3AQLA 5HHHA 4FHYA 9ICMA 3AU2A 9ICRA 4RQ0A 4IQUA 4F5OA 4LT6A 4RQ5A 2O5AA 2ZH6A 7ICUA 1ZQGA 2BPFA 3JPOA 4QZFA 4JWNA 4DOCA 2PFNA 4RQ8A 4F5RA 3JPTA 8ICZA 4I2AA 4P4OA 4M9JA 4I2HA 2BCQA 9ICIA 9ICAA 1VFGA 2M2UA 4MF8A 5J2HA 1HUZA 3PMNA 7ICQA 2ISOA 4M9LA 1KNYA 3UPSA 1RPLA 4WCWA 9ICQA 5HRFA 7ICGA 3RJFA 4X4RA 5CA7A 9ICVA 9ICXA 3OVBA 8ICQA 4XQ7A 5DKWA 4JWMA 4MFFA 4X0BA 4QZGA 4M9HA 3V7KA 1Q79A 4WBYA 3AQMA 5J0XA 1ZQVA 9ICNA 4M2YA 9ICLA 3L9DA 1TVAA 4X4NA 4RQ1A 1XSLA 4I2EA 4AT7B 3JPSA 7ICIA 4P4MA 4F5NA 3LQCB 1ZQRA 4YMNA 7ICNA 1ZQYA 7ICVA 3V7JA 4DO9A 1R89A 2DRBA 4NLNA 4QZDA 4UD5A 1ZQIA 4IQTA 4EBJA 2BPCA 5J2GA 4PGYA 5D49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJK A;  8ICP A;  8ICS A;  4KLE A;  8ICY A;  4YN4 A;  4RWO A;  3OUY A;  3JPN A;  4UBB A;  1ZQF A;  4Z6F A;  4QZA A;  5J2A A;  4MFA A;  5DB9 A;  4WC6 A;  4FHP A;  4YD2 A;  5J2B A;  4M0A A;  3AQK A;  1JMS A;  4QZ9 A;  3B0X A;  2I9G A;  4I28 A;  4M5D A;  4O9M A;  4WC1 A;  3JPP A;  4X4S A;  5IIL A;  1WOT A;  4EP7 A;  4LVS A;  4UBC A;  1VJ7 A;  4F5P A;  5J0P A;  4P2H A;  4WC7 A;  8ICK A;  4P4P A;  2ID1 A;  5J2E A;  3K75 D;  4KLU A;  4DOB A;  4NKU A;  4WC4 A;  3OGU A;  4XQ8 A;  3MGH A;  2HHP A;  4I2D A;  5J2C A;  3RJI A;  4NXZ A;  3C2M A;  9ICP A;  4QZ8 A;  8ICN A;  3ISD A;  1UEV A;  3UXN A;  4PHD A;  1ZQS A;  5DDY A;  1ZQB A;  2ZHB A;  4KLT A;  3RJH A;  2M2V A;  5DB7 A;  4UD4 A;  4UB1 A;  1MQ3 A;  1BPZ A;  1RZT A;  3UXO A;  1ZQL A;  1BPY A;  4I2F A;  4MFC A;  3HIY A;  3TFR A;  7ICL A;  3AU6 A;  4YMO A;  1ZQJ A;  5J0O A;  5J0Q A;  2DR7 A;  2FMP A;  3RJE A;  4WC3 A;  1TFY A;  7ICS A;  3JPR A;  7ICR A;  4KLQ A;  3AQN A;  5BPC A;  3HX0 A;  1ZQD A;  3UQ0 A;  5BOL A;  2VAN A;  5F2V O;  4TUP A;  7ICT A;  4GXJ A;  4ATB B;  1ZQP A;  4R63 A;  2ZH1 A;  7ICF A;  4UB3 A;  2DR8 A;  5HR9 A;  4KLM A;  5HRD A;  1ZJM A;  1XSN A;  4KLG A;  3JZ0 A;  3C5F A;  4WC2 A;  5IIK A;  3UQ2 A;  4RQ7 A;  1ZQE A;  1NOM A;  1ZQH A;  4FH3 A;  4NKT A;  4O5K A;  5HRG A;  4I2G A;  4MF2 A;  3V7L A;  4AT9 A;  5D46 A;  5HRH A;  4FHX A;  5J2D A;  8ICC A;  4PGQ A;  5J2K A;  9ICF A;  3RH6 A;  4I29 A;  4O5C A;  2FMQ A;  5CJ7 A;  4K4H A;  1F5A A;  1Q78 A;  2ZH3 A;  3UXP A;  2NRK A;  4RPX A;  4GXI A;  5III A;  1UEU A;  4KLH A;  4I2I A;  1R8C A;  3H37 A;  4YCX A;  4I2B A;  5HRL A;  4O5E A;  7ICE A;  5CWR A;  4I2J A;  4UAW A;  4S3N A;  4X4T A;  3GDX A;  5CP2 A;  5HHI A;  4NM1 A;  2ZH8 A;  4RWP A;  5CHG A;  2GWS A;  8ICF A;  3TFS A;  4YMM A;  9ICG A;  4Z6D A;  1ZQO A;  4QZH A;  4QZC A;  3HW8 A;  4R65 A;  5IIJ A;  3V72 A;  4Z6E A;  5J2F A;  1JAJ A;  4LZG A;  2ZH2 A;  4WC0 A;  3WFR E;  2PFO A;  4E8F A;  1BPE A;  4UB2 A;  4KLL A;  3MDC A;  4WC5 A;  3ISB A;  1ZQN A;  3C2K A;  1ZQA A;  4X4V A;  3RJJ A;  9ICJ A;  5HRE A;  4PGX A;  3B0Y A;  1R8B A;  8ICW A;  4X4P A;  9ICC A;  3MDA A;  4FHW A;  1R8A A;  1PX5 A;  5J0W A;  2DR9 A;  3HJ1 A;  7ICP A;  4F5Q A;  5IIM A;  1BPB A;  3MBY A;  5J0Y A;  2FMS A;  1MIY A;  4X4Q A;  1HUO A;  2BCS A;  4TUR A;  3WFO A;  5CR0 A;  4K4I A;  4UB4 A;  4EBK A;  9ICK A;  5DEC A;  2BE3 A;  2RFF A;  4TUQ A;  4DOA A;  5DBC A;  3OUY B;  2DVI A;  1OU5 A;  4UAZ A;  1JN3 A;  1ZJN A;  8ICT A;  2ZH7 A;  4LZD A;  1V4A A;  7ICJ A;  4NLZ A;  4KLS A;  4QZB A;  3H39 A;  4X5V A;  4FO6 A;  4IG8 A;  4KLD A;  7ICO A;  5DBB A;  5J29 A;  1KDH A;  4X4U A;  4KLO A;  9ICT A;  5J2J A;  1BPD A;  5D4B A;  3PNC A;  4WBZ A;  1ZQZ A;  4KLF A;  5DB6 A;  2ZH4 A;  8ICU A;  1NO5 A;  2ZH9 A;  4UAY A;  3H38 A;  4IQV A;  4GXK A;  8ICJ A;  5DDM A;  1ZQX A;  2ZH5 A;  4X4O A;  4Z6C A;  8ICG A;  5DED A;  4K4G A;  2PBE A;  5J0T A;  8ICI A;  5HRK A;  4E80 A;  5DB8 A;  9ICB A;  3HJ4 A;  2Q66 A;  2BPG A;  4FHV A;  4RT3 A;  8ICH A;  2W9M A;  3HWT A;  3C18 A;  3ISC A;  2IHM A;  4R64 A;  5J2I A;  4R66 A;  4NY8 A;  5EOZ A;  4XRH A;  5J0S A;  3OVA A;  1ZQT A;  1ZQQ A;  4IQW A;  7ICM A;  3C5G A;  7ICH A;  4RQ2 A;  4M04 A;  8ICA A;  4QZE A;  2ISP A;  3PML A;  5DBA A;  9ICU A;  3C2L A;  4RWN A;  4UB5 A;  1ZQU A;  3MGI A;  4XUS A;  7ICK A;  2PXI A;  1TFW A;  9ICW A;  5CB1 A;  9ICS A;  1XSP A;  2BCR A;  1FA0 A;  9ICH A;  4KLJ A;  2DRA A;  4AT8 A;  4M9N A;  5IIO A;  1ZQK A;  8ICX A;  1UET A;  4XA5 A;  2BCV A;  3RH5 A;  4YD1 A;  3AUO A;  9ICO A;  8ICV A;  4X0A A;  1ZQM A;  4PHP A;  5HRB A;  4I2C A;  1YLQ A;  4M9G A;  8ICO A;  4AT9 B;  4I27 A;  3OV7 A;  2M2T A;  2P66 A;  4RPY A;  4M47 A;  3LK9 A;  1TV9 A;  3WFP A;  2PFP A;  2ZHA A;  4PHE A;  3NYB A;  4ATB A;  3UPQ A;  3H3A A;  3JYY A;  5HC9 A;  1MQ2 A;  2O1P A;  4FH5 A;  8ICR A;  2DR5 A;  5J0U A;  2BCU A;  5TZV A;  2PFQ A;  1JQR A;  4RT2 A;  4RQ4 A;  1KEJ A;  3WFS C;  4QZI A;  4TUS A;  2M2W A;  5IIN A;  4PH5 A;  4RQ3 A;  4PPX A;  1MIW A;  1ZQC A;  8ICE A;  9ICE A;  1ZQW A;  8ICB A;  4PHA A;  5J0R A;  4RPZ A;  5BOM A;  8ICL A;  4KLI A;  3RH4 A;  4RQ6 A;  4AT8 B;  4NM2 A;  3C66 A;  4RWQ A;  4NLK A;  3JPQ A;  4E7X A;  1BPX A;  5HRI A;  3WFQ E;  1MIV A;  3OVS A;  8ICM A;  4AT7 A;  3RJG A;  3AQL A;  5HHH A;  4FHY A;  9ICM A;  3AU2 A;  9ICR A;  4RQ0 A;  4IQU A;  4F5O A;  4LT6 A;  4RQ5 A;  2O5A A;  2ZH6 A;  7ICU A;  1ZQG A;  2BPF A;  3JPO A;  4QZF A;  4JWN A;  4DOC A;  2PFN A;  4RQ8 A;  4F5R A;  3JPT A;  8ICZ A;  4I2A A;  4P4O A;  4M9J A;  4I2H A;  2BCQ A;  9ICI A;  9ICA A;  1VFG A;  2M2U A;  4MF8 A;  5J2H A;  1HUZ A;  3PMN A;  7ICQ A;  2ISO A;  4M9L A;  1KNY A;  3UPS A;  1RPL A;  4WCW A;  9ICQ A;  5HRF A;  7ICG A;  3RJF A;  4X4R A;  5CA7 A;  9ICV A;  9ICX A;  3OVB A;  8ICQ A;  4XQ7 A;  5DKW A;  4JWM A;  4MFF A;  4X0B A;  4QZG A;  4M9H A;  3V7K A;  1Q79 A;  4WBY A;  3AQM A;  5J0X A;  1ZQV A;  9ICN A;  4M2Y A;  9ICL A;  3L9D A;  1TVA A;  4X4N A;  4RQ1 A;  1XSL A;  4I2E A;  4AT7 B;  3JPS A;  7ICI A;  4P4M A;  4F5N A;  3LQC B;  1ZQR A;  4YMN A;  7ICN A;  1ZQY A;  7ICV A;  3V7J A;  4DO9 A;  1R89 A;  2DRB A;  4NLN A;  4QZD A;  4UD5 A;  1ZQI A;  4IQT A;  4EBJ A;  2BPC A;  5J2G A;  4PGY A;  5D49 A; 
#chains in the Genus database with same CATH topology
 3RJK A;  8ICP A;  8ICS A;  4KLE A;  4JLZ A;  8ICY A;  4YN4 A;  4RWO A;  3OUY A;  3JPN A;  4UBB A;  1ZQF A;  4Z6F A;  4QZA A;  5J2A A;  4MFA A;  5DB9 A;  4WC6 A;  4FHP A;  4YD2 A;  5J2B A;  4M0A A;  3AQK A;  1JMS A;  4QZ9 A;  3B0X A;  2I9G A;  4I28 A;  4M5D A;  4O9M A;  4WC1 A;  3JPP A;  4X4S A;  5IIL A;  1WOT A;  4EP7 A;  5CFT A;  4LVS A;  4UBC A;  1VJ7 A;  4F5P A;  5J0P A;  4P2H A;  4WC7 A;  8ICK A;  4P4P A;  2ID1 A;  5J2E A;  3K75 D;  3K7D A;  5D63 A;  4KLU A;  4DOB A;  4NKU A;  4WC4 A;  3OGU A;  4XQ8 A;  3MGH A;  2HHP A;  4I2D A;  3CK6 A;  5J2C A;  3RJI A;  4NXZ A;  3C2M A;  9ICP A;  4QZ8 A;  8ICN A;  3ISD A;  1UEV A;  3UXN A;  4PHD A;  1ZQS A;  5DDY A;  1ZQB A;  2ZHB A;  4KLT A;  3RJH A;  2M2V A;  4N7R A;  5DB7 A;  4UD4 A;  4UB1 A;  1MQ3 A;  1BPZ A;  1RZT A;  3UXO A;  1ZQL A;  1BPY A;  4I2F A;  4MFC A;  3HIY A;  3TFR A;  7ICL A;  3AU6 A;  4YMO A;  1ZQJ A;  5J0O A;  5J0Q A;  2DR7 A;  2FMP A;  3RJE A;  4WC3 A;  1TFY A;  7ICS A;  3JPR A;  7ICR A;  4KLQ A;  3AQN A;  5BPC A;  3HX0 A;  1ZQD A;  3UQ0 A;  5BOL A;  2VAN A;  5F2V O;  4TUP A;  7ICT A;  4GXJ A;  4ATB B;  1ZQP A;  4R63 A;  2ZH1 A;  7ICF A;  4UB3 A;  2DR8 A;  5HR9 A;  4KLM A;  4KM5 A;  5HRD A;  2GA9 D;  1ZJM A;  1XSN A;  4WQK A;  4KLG A;  3JZ0 A;  3C5F A;  4WC2 A;  5IIK A;  3UQ2 A;  3MCR A;  4KB6 A;  4LEZ A;  4RQ7 A;  1ZQE A;  1NOM A;  4NXT A;  5CFU A;  1ZQH A;  4FH3 A;  4NKT A;  4O5K A;  5HRG A;  4I2G A;  4MF2 A;  3V7L A;  4AT9 A;  5D46 A;  5HRH A;  4FHX A;  5J2D A;  8ICC A;  4PGQ A;  5J2K A;  9ICF A;  3RH6 A;  4LEW A;  4I29 A;  4O5C A;  2FMQ A;  5CJ7 A;  4K4H A;  1F5A A;  1Q78 A;  2ZH3 A;  3UXP A;  4EV6 A;  2NRK A;  4RPX A;  4GXI A;  5III A;  1UEU A;  4KLH A;  4XJE A;  4I2I A;  1R8C A;  3H37 A;  4YCX A;  4I2B A;  5HRL A;  4O5E A;  2FCL A;  7ICE A;  5CWR A;  4I2J A;  4JLX A;  4UAW A;  4S3N A;  4X4T A;  3GDX A;  5CP2 A;  5HHI A;  3PHZ A;  4NM1 A;  2ZH8 A;  4RWP A;  5D61 A;  5CHG A;  2GWS A;  8ICF A;  3ER8 C;  3TFS A;  4YMM A;  9ICG A;  4Z6D A;  1ZQO A;  4QZH A;  4QZC A;  3HW8 A;  4R65 A;  5IIJ A;  3V72 A;  4Z6E A;  5J2F A;  1JAJ A;  4LZG A;  2ZH2 A;  4WC0 A;  4O6A A;  3WFR E;  2PFO A;  4E8F A;  1BPE A;  4UB2 A;  4KLL A;  3MDC A;  4WC5 A;  3ISB A;  1ZQN A;  3C2K A;  1ZQA A;  4X4V A;  3RJJ A;  9ICJ A;  4WH5 A;  5HRE A;  4PGX A;  3B0Y A;  1R8B A;  8ICW A;  4X4P A;  9ICC A;  3MDA A;  4FHW A;  1R8A A;  1PX5 A;  5J0W A;  2DR9 A;  3HJ1 A;  7ICP A;  4F5Q A;  5CFS A;  5D62 A;  5IIM A;  1BPB A;  3OWG A;  3MBY A;  5J0Y A;  2FMS A;  1MIY A;  4X4Q A;  1HUO A;  2BCS A;  4TUR A;  3WFO A;  5CR0 A;  4K4I A;  4UB4 A;  4EBK A;  9ICK A;  4K97 A;  4OAG A;  5JTG A;  5DEC A;  2BE3 A;  2RFF A;  4TUQ A;  4DOA A;  2B4V A;  5DBC A;  3OUY B;  2DVI A;  1OU5 A;  4UAZ A;  1JN3 A;  1ZJN A;  8ICT A;  2ZH7 A;  4O68 A;  4LZD A;  1V4A A;  5CHE A;  7ICJ A;  4NLZ A;  4KLS A;  4QZB A;  3H39 A;  4X5V A;  4FO6 A;  4IG8 A;  4KLD A;  7ICO A;  5DBB A;  4K99 A;  5J29 A;  1KDH A;  4X4U A;  2EWR A;  4KLO A;  9ICT A;  5J2J A;  1BPD A;  5D4B A;  3PNC A;  4MKP A;  4I0U A;  4WBZ A;  1ZQZ A;  4KLF A;  5DB6 A;  2ZH4 A;  8ICU A;  1NO5 A;  2ZH9 A;  4UAY A;  3H38 A;  4IQV A;  4GXK A;  8ICJ A;  5DDM A;  1ZQX A;  4X4O A;  2ZH5 A;  4Z6C A;  8ICG A;  5DED A;  4O69 A;  4K4G A;  3NWI A;  2PBE A;  5J0T A;  8ICI A;  5HRK A;  4E80 A;  5DB8 A;  9ICB A;  3HJ4 A;  2Q66 A;  2BPG A;  4FHV A;  4RT3 A;  5B3Q A;  8ICH A;  2W9M A;  3HWT A;  4FO1 A;  3C18 A;  3ISC A;  2IHM A;  4R64 A;  5J2I A;  4R66 A;  4NY8 A;  1GPJ A;  5EOZ A;  4LEV A;  4XRH A;  5J0S A;  4EGW A;  3OVA A;  1ZQT A;  1ZQQ A;  4IQW A;  4WOY A;  7ICM A;  3C5G A;  7ICH A;  4RQ2 A;  4M04 A;  8ICA A;  4QZE A;  2ISP A;  3PML A;  5DBA A;  4K8V A;  9ICU A;  3C2L A;  4RWN A;  4UB5 A;  1ZQU A;  3MGI A;  2HN1 A;  4XUS A;  7ICK A;  2PXI A;  1TFW A;  9ICW A;  5CB1 A;  9ICS A;  1XSP A;  2BCR A;  1FA0 A;  9ICH A;  4KLJ A;  4HX0 A;  2DRA A;  4AT8 A;  4M9N A;  5IIO A;  1ZQK A;  8ICX A;  1UET A;  4XA5 A;  2BCV A;  2B56 A;  3RH5 A;  4YD1 A;  3AUO A;  9ICO A;  8ICV A;  4X0A A;  1ZQM A;  4NXX A;  4LEY A;  2IHO A;  4PHP A;  4NXU A;  5HRB A;  4I2C A;  1YLQ A;  4M9G A;  8ICO A;  4AT9 B;  4I27 A;  3OV7 A;  2M2T A;  2P66 A;  4RPY A;  4M47 A;  3LK9 A;  2BBJ A;  1TV9 A;  3WFP A;  4K98 A;  2PFP A;  2ZHA A;  4PHE A;  2HN2 A;  3NYB A;  4ATB A;  3UPQ A;  4WQL A;  3H3A A;  3JCF A;  3JYY A;  5HC9 A;  1MQ2 A;  2O1P A;  4FH5 A;  4EEB A;  8ICR A;  2DR5 A;  5J0U A;  2BCU A;  5TZV A;  2PFQ A;  1JQR A;  4RT2 A;  4RQ4 A;  1KEJ A;  3WFS C;  3ER9 B;  4NXW A;  4QZI A;  4TUS A;  3NVO A;  2M2W A;  5IIN A;  4PH5 A;  4RQ3 A;  4PPX A;  1MIW A;  1ZQC A;  8ICE A;  9ICE A;  1ZQW A;  3ERC C;  8ICB A;  4PHA A;  5J0R A;  4K9A A;  4RPZ A;  5BOM A;  8ICL A;  4KLI A;  3RH4 A;  4RQ6 A;  4AT8 B;  4NM2 A;  3C66 A;  4O67 A;  4RWQ A;  4NLK A;  3JPQ A;  4E7X A;  1BPX A;  5HRI A;  4K96 A;  3WFQ E;  1MIV A;  3OVS A;  8ICM A;  4AT7 A;  3RJG A;  3NKU A;  3AQL A;  5HHH A;  4FHY A;  9ICM A;  3AU2 A;  2B51 A;  9ICR A;  4RQ0 A;  4IQU A;  4F5O A;  4LT6 A;  4NXV A;  4RQ5 A;  2O5A A;  2ZH6 A;  7ICU A;  1ZQG A;  2BPF A;  3JPO A;  4QZF A;  4JWN A;  4DOC A;  2PFN A;  4RQ8 A;  4F5R A;  3JPT A;  8ICZ A;  4I2A A;  4P4O A;  4M9J A;  4I2H A;  2BCQ A;  9ICI A;  9ICA A;  1VFG A;  2M2U A;  4MF8 A;  5J2H A;  1HUZ A;  3PMN A;  7ICQ A;  2ISO A;  4OAH A;  4M9L A;  1KNY A;  3UPS A;  1RPL A;  4WCW A;  9ICQ A;  5HRF A;  7ICG A;  3RJF A;  4X4R A;  5CA7 A;  9ICV A;  9ICX A;  3OVB A;  8ICQ A;  4XQ7 A;  5DKW A;  2IUB A;  4JWM A;  4EED A;  4MFF A;  4X0B A;  5B3P A;  4QZG A;  4M9H A;  4OAF A;  3V7K A;  1Q79 A;  4WBY A;  3AQM A;  5J0X A;  1ZQV A;  9ICN A;  4M2Y A;  9ICL A;  3L9D A;  1TVA A;  4X4N A;  4RQ1 A;  1XSL A;  4I2E A;  3EF2 A;  4AT7 B;  3JPS A;  4P4M A;  7ICI A;  4F5N A;  3LQC B;  4K9B A;  4YMN A;  1ZQR A;  1ZQY A;  7ICN A;  7ICV A;  3V7J A;  4DO9 A;  1R89 A;  2DRB A;  4NLN A;  4QZD A;  4UD5 A;  1ZQI A;  2BBH A;  4IQT A;  4EBJ A;  2BPC A;  5J2G A;  2GAF D;  4OAI Z;  4PGY A;  5D49 A; 
#chains in the Genus database with same CATH homology
 3RJK A;  8ICP A;  8ICS A;  4KLE A;  8ICY A;  4YN4 A;  4RWO A;  3OUY A;  3JPN A;  4UBB A;  1ZQF A;  4Z6F A;  4QZA A;  5J2A A;  4MFA A;  5DB9 A;  4WC6 A;  4FHP A;  4YD2 A;  5J2B A;  4M0A A;  3AQK A;  1JMS A;  4QZ9 A;  3B0X A;  2I9G A;  4I28 A;  4M5D A;  4O9M A;  4WC1 A;  3JPP A;  4X4S A;  5IIL A;  1WOT A;  4EP7 A;  4LVS A;  4UBC A;  1VJ7 A;  4F5P A;  5J0P A;  4P2H A;  4WC7 A;  8ICK A;  4P4P A;  2ID1 A;  5J2E A;  3K75 D;  4KLU A;  4DOB A;  4NKU A;  4WC4 A;  3OGU A;  4XQ8 A;  3MGH A;  2HHP A;  4I2D A;  5J2C A;  3RJI A;  4NXZ A;  3C2M A;  9ICP A;  4QZ8 A;  8ICN A;  3ISD A;  1UEV A;  3UXN A;  4PHD A;  1ZQS A;  5DDY A;  1ZQB A;  2ZHB A;  4KLT A;  3RJH A;  2M2V A;  5DB7 A;  4UD4 A;  4UB1 A;  1MQ3 A;  1BPZ A;  1RZT A;  3UXO A;  1ZQL A;  1BPY A;  4I2F A;  4MFC A;  3HIY A;  3TFR A;  7ICL A;  3AU6 A;  4YMO A;  1ZQJ A;  5J0O A;  5J0Q A;  2DR7 A;  2FMP A;  3RJE A;  4WC3 A;  1TFY A;  7ICS A;  3JPR A;  7ICR A;  4KLQ A;  3AQN A;  5BPC A;  3HX0 A;  1ZQD A;  3UQ0 A;  5BOL A;  2VAN A;  5F2V O;  4TUP A;  7ICT A;  4GXJ A;  4ATB B;  1ZQP A;  4R63 A;  2ZH1 A;  7ICF A;  4UB3 A;  2DR8 A;  5HR9 A;  4KLM A;  5HRD A;  1ZJM A;  1XSN A;  4KLG A;  3JZ0 A;  3C5F A;  4WC2 A;  5IIK A;  3UQ2 A;  4RQ7 A;  1ZQE A;  1NOM A;  1ZQH A;  4FH3 A;  4NKT A;  4O5K A;  5HRG A;  4I2G A;  4MF2 A;  3V7L A;  4AT9 A;  5D46 A;  5HRH A;  4FHX A;  5J2D A;  8ICC A;  4PGQ A;  5J2K A;  9ICF A;  3RH6 A;  4I29 A;  4O5C A;  2FMQ A;  5CJ7 A;  4K4H A;  1F5A A;  1Q78 A;  2ZH3 A;  3UXP A;  2NRK A;  4RPX A;  4GXI A;  5III A;  1UEU A;  4KLH A;  4I2I A;  1R8C A;  3H37 A;  4YCX A;  4I2B A;  5HRL A;  4O5E A;  7ICE A;  5CWR A;  4I2J A;  4UAW A;  4S3N A;  4X4T A;  3GDX A;  5CP2 A;  5HHI A;  4NM1 A;  2ZH8 A;  4RWP A;  5CHG A;  2GWS A;  8ICF A;  3TFS A;  4YMM A;  9ICG A;  4Z6D A;  1ZQO A;  4QZH A;  4QZC A;  3HW8 A;  4R65 A;  5IIJ A;  3V72 A;  4Z6E A;  5J2F A;  1JAJ A;  4LZG A;  2ZH2 A;  4WC0 A;  3WFR E;  2PFO A;  4E8F A;  1BPE A;  4UB2 A;  4KLL A;  3MDC A;  4WC5 A;  3ISB A;  1ZQN A;  3C2K A;  1ZQA A;  4X4V A;  3RJJ A;  9ICJ A;  5HRE A;  4PGX A;  3B0Y A;  1R8B A;  8ICW A;  4X4P A;  9ICC A;  3MDA A;  4FHW A;  1R8A A;  1PX5 A;  5J0W A;  2DR9 A;  3HJ1 A;  7ICP A;  4F5Q A;  5IIM A;  1BPB A;  3MBY A;  5J0Y A;  2FMS A;  1MIY A;  4X4Q A;  1HUO A;  2BCS A;  4TUR A;  3WFO A;  5CR0 A;  4K4I A;  4UB4 A;  4EBK A;  9ICK A;  5DEC A;  2BE3 A;  2RFF A;  4TUQ A;  4DOA A;  5DBC A;  3OUY B;  2DVI A;  1OU5 A;  4UAZ A;  1JN3 A;  1ZJN A;  8ICT A;  2ZH7 A;  4LZD A;  1V4A A;  7ICJ A;  4NLZ A;  4KLS A;  4QZB A;  3H39 A;  4X5V A;  4FO6 A;  4IG8 A;  4KLD A;  7ICO A;  5DBB A;  5J29 A;  1KDH A;  4X4U A;  4KLO A;  9ICT A;  5J2J A;  1BPD A;  5D4B A;  3PNC A;  4WBZ A;  1ZQZ A;  4KLF A;  5DB6 A;  2ZH4 A;  8ICU A;  1NO5 A;  2ZH9 A;  4UAY A;  3H38 A;  4IQV A;  4GXK A;  8ICJ A;  5DDM A;  1ZQX A;  2ZH5 A;  4X4O A;  4Z6C A;  8ICG A;  5DED A;  4K4G A;  2PBE A;  5J0T A;  8ICI A;  5HRK A;  4E80 A;  5DB8 A;  9ICB A;  3HJ4 A;  2Q66 A;  2BPG A;  4FHV A;  4RT3 A;  8ICH A;  2W9M A;  3HWT A;  3C18 A;  3ISC A;  2IHM A;  4R64 A;  5J2I A;  4R66 A;  4NY8 A;  5EOZ A;  4XRH A;  5J0S A;  3OVA A;  1ZQT A;  1ZQQ A;  4IQW A;  7ICM A;  3C5G A;  7ICH A;  4RQ2 A;  4M04 A;  8ICA A;  4QZE A;  2ISP A;  3PML A;  5DBA A;  9ICU A;  3C2L A;  4RWN A;  4UB5 A;  1ZQU A;  3MGI A;  4XUS A;  7ICK A;  2PXI A;  1TFW A;  9ICW A;  5CB1 A;  9ICS A;  1XSP A;  2BCR A;  1FA0 A;  9ICH A;  4KLJ A;  2DRA A;  4AT8 A;  4M9N A;  5IIO A;  1ZQK A;  8ICX A;  1UET A;  4XA5 A;  2BCV A;  3RH5 A;  4YD1 A;  3AUO A;  9ICO A;  8ICV A;  4X0A A;  1ZQM A;  4PHP A;  5HRB A;  4I2C A;  1YLQ A;  4M9G A;  8ICO A;  4AT9 B;  4I27 A;  3OV7 A;  2M2T A;  2P66 A;  4RPY A;  4M47 A;  3LK9 A;  1TV9 A;  3WFP A;  2PFP A;  2ZHA A;  4PHE A;  3NYB A;  4ATB A;  3UPQ A;  3H3A A;  3JYY A;  5HC9 A;  1MQ2 A;  2O1P A;  4FH5 A;  8ICR A;  2DR5 A;  5J0U A;  2BCU A;  5TZV A;  2PFQ A;  1JQR A;  4RT2 A;  4RQ4 A;  1KEJ A;  3WFS C;  4QZI A;  4TUS A;  2M2W A;  5IIN A;  4PH5 A;  4RQ3 A;  4PPX A;  1MIW A;  1ZQC A;  8ICE A;  9ICE A;  1ZQW A;  8ICB A;  4PHA A;  5J0R A;  4RPZ A;  5BOM A;  8ICL A;  4KLI A;  3RH4 A;  4RQ6 A;  4AT8 B;  4NM2 A;  3C66 A;  4RWQ A;  4NLK A;  3JPQ A;  4E7X A;  1BPX A;  5HRI A;  3WFQ E;  1MIV A;  3OVS A;  8ICM A;  4AT7 A;  3RJG A;  3AQL A;  5HHH A;  4FHY A;  9ICM A;  3AU2 A;  9ICR A;  4RQ0 A;  4IQU A;  4F5O A;  4LT6 A;  4RQ5 A;  2O5A A;  2ZH6 A;  7ICU A;  1ZQG A;  2BPF A;  3JPO A;  4QZF A;  4JWN A;  4DOC A;  2PFN A;  4RQ8 A;  4F5R A;  3JPT A;  8ICZ A;  4I2A A;  4P4O A;  4M9J A;  4I2H A;  2BCQ A;  9ICI A;  9ICA A;  1VFG A;  2M2U A;  4MF8 A;  5J2H A;  1HUZ A;  3PMN A;  7ICQ A;  2ISO A;  4M9L A;  1KNY A;  3UPS A;  1RPL A;  4WCW A;  9ICQ A;  5HRF A;  7ICG A;  3RJF A;  4X4R A;  5CA7 A;  9ICV A;  9ICX A;  3OVB A;  8ICQ A;  4XQ7 A;  5DKW A;  4JWM A;  4MFF A;  4X0B A;  4QZG A;  4M9H A;  3V7K A;  1Q79 A;  4WBY A;  3AQM A;  5J0X A;  1ZQV A;  9ICN A;  4M2Y A;  9ICL A;  3L9D A;  1TVA A;  4X4N A;  4RQ1 A;  1XSL A;  4I2E A;  4AT7 B;  3JPS A;  7ICI A;  4P4M A;  4F5N A;  3LQC B;  1ZQR A;  4YMN A;  7ICN A;  1ZQY A;  7ICV A;  3V7J A;  4DO9 A;  1R89 A;  2DRB A;  4NLN A;  4QZD A;  4UD5 A;  1ZQI A;  4IQT A;  4EBJ A;  2BPC A;  5J2G A;  4PGY A;  5D49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...