1OU5A

Crystal structure of human cca-adding enzyme
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
356
structure length
344
Chain Sequence
DKMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA CCA-adding enzyme
publication title Crystal Structure of the Human CCA-adding Enzyme: Insights into Template-independent Polymerization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation, transferase
total genus 82
structure length 344
sequence length 356
chains with identical sequence B
ec nomenclature ec 2.7.7.72: CCA tRNA nucleotidyltransferase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
A PF12627 PolyA_pol_RNAbd Probable RNA and SrmB- binding site of polymerase A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 1ou5A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1ou5A01
2ZH4A 4Z6DA 8ICXA 2PBEA 4AT7B 3PNCA 4X5VA 1ZQVA 4WBZA 3JPNA 5BPCA 3RJKA 9ICUA 5HRDA 4QZIA 4F5NA 4KLTA 1UEUA 2M2VA 1ZQDA 5J2GA 5CHGA 4WC6A 2NRKA 4MF8A 3OUYA 2BPFA 1ZQLA 4NLZA 4O5KA 4TURA 3RH5A 1ZQFA 1ZQSA 8ICAA 5DEDA 3V7LA 5D4BA 3RH4A 1ZQKA 3PMLA 1JQRA 5HRGA 2BCRA 3UPQA 9ICAA 5D46A 4LZGA 3WFRE 4RWNA 9ICQA 1PX5A 5IINA 1HUOA 4I2AA 4F5OA 4ATBB 4UBCA 4XQ7A 4Z6CA 1ZQZA 4M9HA 5J0OA 3B0YA 4FHXA 4QZAA 4RQ7A 3ISCA 1ZQJA 4X4TA 1ZQUA 1WOTA 4UAWA 3PMNA 8ICCA 7ICFA 5J2JA 4F5RA 4DOAA 3HIYA 8ICGA 4QZEA 8ICSA 1YLQA 3OV7A 4TUSA 7ICKA 2BCVA 3JPOA 4RWOA 4LVSA 1UETA 4FHPA 4M9NA 8ICWA 2BPGA 3C2MA 1NOMA 1VJ7A 5J0QA 4NM2A 9ICPA 3UPSA 3RJEA 3AU2A 3WFQE 5J0PA 2Q66A 1ZQOA 4QZDA 1XSPA 9ICVA 4K4HA 1F5AA 9ICEA 4Z6EA 4MFCA 7ICVA 5D49A 1R8CA 2ZH9A 3AQMA 4M9JA 3OVBA 1RPLA 9ICKA 4UD5A 1ZQMA 4M0AA 5HC9A 4X4OA 4PGXA 3C2LA 1KNYA 2ISPA 1VFGA 7ICQA 1BPXA 3JZ0A 4NXZA 4RT3A 1R89A 4K4IA 5HRIA 2ZHAA 4KLEA 4KLSA 3NYBA 3L9DA 5F2VO 8ICUA 4QZGA 4XUSA 2VANA 1BPDA 4WC2A 4X4PA 3JPQA 8ICLA 2FMQA 1R8AA 3V7JA 5HRKA 2FMSA 4FHWA 1NO5A 3WFPA 3ISBA 8ICNA 7ICHA 4PGQA 1V4AA 1RZTA 2I9GA 2P66A 4M9LA 4I2JA 2M2TA 5J2KA 5CA7A 4KLJA 1MIYA 1XSLA 4R63A 4AT8A 3UXNA 2M2UA 5DBCA 9ICHA 1ZQAA 9ICLA 3HX0A 8ICHA 5DECA 1BPYA 4K4GA 5CWRA 8ICQA 2ZH6A 4X4QA 7ICIA 4DO9A 3C5GA 8ICKA 4GXJA 3OGUA 4RWPA 3MGIA 2DR8A 5IIMA 4NY8A 4F5PA 5IIJA 1ZJNA 4FH3A 1TFYA 3RJJA 4RQ2A 4KLOA 4PHEA 3JPSA 3H39A 7ICUA 4UD4A 2BCUA 4X4UA 3V7KA 1Q79A 3RJFA 8ICPA 4AT9A 4YMNA 4NKTA 4RPXA 3WFSC 4QZFA 4X4NA 4KLGA 2ID1A 4TUQA 4YMMA 5CB1A 1ZQPA 4WC5A 1MIVA 4AT7A 3GDXA 5IIKA 3AQNA 4WBYA 1R8BA 4DOCA 2GWSA 3JPRA 2W9MA 4KLMA 3C2KA 3H37A 3JPPA 4KLQA 3AU6A 4MFFA 2ZH3A 8ICYA 3UXOA 2PFQA 1ZQCA 3AQKA 1BPEA 4QZ9A 3OVSA 1ZQXA 4RPYA 4PHDA 5DDYA 7ICRA 3LK9A 5HHIA 7ICLA 4I2BA 4PGYA 4TUPA 8ICVA 3C18A 9ICXA 9ICSA 4I28A 3MBYA 5HRFA 2IHMA 4RPZA 5HRBA 7ICNA 4P4OA 4FHVA 5HHHA 3MGHA 4ATBA 5IIOA 4KLDA 9ICNA 5BOMA 3AQLA 4JWMA 4UB5A 4E7XA 4UB3A 4WC0A 3TFSA 8ICRA 2O5AA 4M2YA 4R64A 4X4SA 5HR9A 4NLKA 2ZH7A 3UXPA 4O9MA 4NM1A 2BE3A 4I2HA 4NLNA 3UQ0A 4AT8B 4MF2A 5DBAA 8ICIA 5J2HA 4KLUA 3MDAA 4FO6A 3WFOA 4KLIA 3RJIA 4UB2A 4PPXA 4EP7A 3K75D 4PHAA 1TVAA 5HRHA 2HHPA 5EOZA 3OUYB 8ICJA 4IQUA 4R65A 1Q78A 4WC3A 4F5QA 8ICEA 8ICFA 4P4PA 8ICMA 5DB9A 4P2HA 4UAYA 1JN3A 8ICZA 5J0XA 2O1PA 3H3AA 4QZHA 5J0WA 9ICFA 4YCXA 5DDMA 3V72A 2M2WA 3RJGA 4KLFA 1XSNA 5J0UA 1KEJA 5J2CA 2ZHBA 4EBJA 2PFOA 9ICJA 7ICOA 5J2FA 4UBBA 4AT9B 4UAZA 4DOBA 9ICMA 5CR0A 4IG8A 1ZQIA 7ICGA 5HREA 1MQ2A 4YMOA 4S3NA 4I2GA 5J0YA 4GXKA 9ICGA 5DB7A 1JMSA 2DRBA 9ICCA 4RQ6A 5DBBA 1MQ3A 4RT2A 4E80A 3RJHA 4MFAA 2DRAA 4M47A 5J0RA 3RH6A 1UEVA 4RQ8A 3H38A 2ISOA 5J2BA 4WCWA 1ZJMA 1ZQTA 5J2EA 1FA0A 1ZQQA 4XQ8A 4P4MA 2ZH1A 3TFRA 2BCSA 4I27A 3MDCA 4I29A 4FHYA 5DB8A 4RQ3A 4YD2A 4RQ1A 4X0AA 8ICOA 9ICIA 4X0BA 4NKUA 5IIIA 1OU5A 2PFNA 4X4VA 2DVIA 5HRLA 4RQ4A 7ICMA 3AUOA 1ZQNA 1TV9A 4M9GA 1KDHA 4Z6FA 7ICTA 4XA5A 3HJ1A 1MIWA 4EBKA 7ICPA 9ICWA 4KLHA 3HJ4A 3JPTA 5CJ7A 4XRHA 4O5EA 2DR5A 9ICOA 2RFFA 4UB1A 4M04A 8ICTA 5J2IA 5BOLA 3C5FA 1ZQHA 2ZH8A 4WC1A 4GXIA 3HW8A 1ZQRA 9ICRA 5J2DA 2BPCA 1ZQWA 4I2IA 1JAJA 4R66A 4QZ8A 1ZQGA 5J0SA 4LZDA 5DB6A 4YD1A 4RWQA 2PFPA 3OVAA 4WC7A 4RQ0A 4JWNA 5IILA 4I2EA 4IQVA 2ZH5A 4I2CA 4PH5A 1BPBA 1HUZA 4IQWA 5J0TA 3LQCB 5CP2A 3C66A 2DR9A 4QZCA 4UB4A 4O5CA 5J2AA 7ICSA 4E8FA 3HWTA 2ZH2A 7ICEA 4YN4A 4X4RA 1ZQBA 3JYYA 4FH5A 9ICTA 4RQ5A 4LT6A 2FMPA 5J29A 2BCQA 2DR7A 2PXIA 8ICBA 3ISDA 1ZQEA 1TFWA 5TZVA 4I2DA 4I2FA 1ZQYA 4M5DA 3UQ2A 7ICJA 1BPZA 4PHPA 3B0XA 4KLLA 4QZBA 9ICBA 4WC4A 4IQTA 5DKWA
chains in the Genus database with same CATH superfamily
2ZH4A 4Z6DA 8ICXA 2PBEA 4AT7B 3PNCA 4X5VA 1ZQVA 4WBZA 3JPNA 5BPCA 3RJKA 9ICUA 5HRDA 4QZIA 2GAFD 4F5NA 4KLTA 1UEUA 2M2VA 1ZQDA 5J2GA 5CHGA 4WC6A 2NRKA 4MF8A 3OUYA 2BPFA 1ZQLA 4NXTA 4NLZA 4O5KA 4NXXA 4TURA 3RH5A 1ZQFA 1ZQSA 8ICAA 5DEDA 3V7LA 5D4BA 3RH4A 1ZQKA 3PMLA 1JQRA 5HRGA 2BCRA 3UPQA 9ICAA 5D46A 4LZGA 3WFRE 4RWNA 9ICQA 4FO1A 1PX5A 5IINA 1HUOA 4I2AA 4F5OA 4ATBB 4UBCA 4XQ7A 4Z6CA 1ZQZA 4M9HA 5J0OA 3B0YA 4FHXA 4QZAA 4RQ7A 3ISCA 4K99A 1ZQJA 4X4TA 1ZQUA 1WOTA 4UAWA 3PMNA 8ICCA 7ICFA 5J2JA 4F5RA 4DOAA 3HIYA 8ICGA 4QZEA 8ICSA 1YLQA 3OV7A 4TUSA 7ICKA 2BCVA 3JPOA 4RWOA 4LVSA 1UETA 4FHPA 4M9NA 8ICWA 2BPGA 3C2MA 1NOMA 1VJ7A 5J0QA 4NM2A 9ICPA 3UPSA 3RJEA 3AU2A 3WFQE 5J0PA 2Q66A 1ZQOA 4QZDA 4K97A 1XSPA 9ICVA 4K4HA 4OAHA 1F5AA 9ICEA 4Z6EA 4MFCA 7ICVA 5D49A 1R8CA 2ZH9A 5CFUA 3AQMA 4M9JA 3OVBA 1RPLA 9ICKA 4UD5A 1ZQMA 4M0AA 5HC9A 4X4OA 4NXUA 4PGXA 5D61A 1KNYA 3C2LA 2ISPA 1VFGA 2B51A 7ICQA 1BPXA 3JZ0A 4NXZA 4RT3A 1R89A 4K4IA 5HRIA 2ZHAA 4KLEA 4KLSA 3NYBA 3L9DA 4O67A 5F2VO 8ICUA 4N7RA 4QZGA 4XUSA 5D63A 2VANA 1BPDA 2IHOA 4XJEA 4WC2A 4X4PA 3JPQA 8ICLA 2FMQA 1R8AA 3V7JA 5HRKA 2FMSA 4FHWA 1NO5A 3WFPA 3ISBA 8ICNA 7ICHA 4PGQA 5CFSA 1V4AA 1RZTA 2I9GA 2P66A 4M9LA 4I2JA 2M2TA 5J2KA 5CA7A 4KLJA 1MIYA 1XSLA 2HN1A 4R63A 4AT8A 3UXNA 2M2UA 5DBCA 9ICHA 1ZQAA 9ICLA 3HX0A 8ICHA 5DECA 1BPYA 4K4GA 5CWRA 8ICQA 2ZH6A 4X4QA 7ICIA 3ER9B 4DO9A 3C5GA 8ICKA 2GA9D 4GXJA 3OGUA 4RWPA 3MGIA 2DR8A 5IIMA 4NXVA 5D62A 4NY8A 4F5PA 5IIJA 5CHEA 1ZJNA 4FH3A 1TFYA 3RJJA 4RQ2A 4K96A 4KLOA 4PHEA 3JPSA 3H39A 7ICUA 4UD4A 2BCUA 4X4UA 3V7KA 1Q79A 3RJFA 8ICPA 4AT9A 4YMNA 3CK6A 4NKTA 4RPXA 3WFSC 4QZFA 4X4NA 4KLGA 4JLXA 2ID1A 4TUQA 4YMMA 5CB1A 1ZQPA 4WC5A 1MIVA 4AT7A 3GDXA 5IIKA 3AQNA 4WBYA 1R8BA 4DOCA 2GWSA 3JPRA 2W9MA 4O6AA 4KLMA 4LEYA 3C2KA 3H37A 3JPPA 4KLQA 3AU6A 4MFFA 2ZH3A 8ICYA 3UXOA 2PFQA 4K9BA 1ZQCA 4LEZA 3AQKA 1BPEA 4QZ9A 3OVSA 4O68A 1ZQXA 4RPYA 4PHDA 5DDYA 7ICRA 3LK9A 5HHIA 7ICLA 3JCFA 4I2BA 4PGYA 4TUPA 8ICVA 3C18A 9ICXA 9ICSA 4I28A 3MBYA 5HRFA 1GPJA 2IUBA 4MKPA 2IHMA 4RPZA 5HRBA 7ICNA 4P4OA 4FHVA 2HN2A 5HHHA 3MGHA 4OAFA 2FCLA 4ATBA 5IIOA 4KLDA 9ICNA 5BOMA 3AQLA 4K8VA 4WH5A 4JWMA 3ER8C 4UB5A 4E7XA 4KB6A 4UB3A 5CFTA 4WC0A 5JTGA 3TFSA 8ICRA 4O69A 2O5AA 4M2YA 4R64A 4X4SA 5HR9A 4NLKA 2ZH7A 3UXPA 4O9MA 4NM1A 2BE3A 4I2HA 4NLNA 3UQ0A 4AT8B 4MF2A 5DBAA 8ICIA 5J2HA 4KLUA 3MDAA 4FO6A 2EWRA 3WFOA 4KLIA 3RJIA 4UB2A 4PPXA 4EP7A 3K75D 4PHAA 1TVAA 2BBJA 3NKUA 2HHPA 5HRHA 5EOZA 3OUYB 8ICJA 4IQUA 4R65A 1Q78A 4WC3A 4F5QA 8ICEA 8ICFA 4P4PA 8ICMA 5DB9A 4P2HA 4UAYA 1JN3A 8ICZA 5J0XA 2O1PA 3H3AA 4QZHA 5J0WA 9ICFA 4YCXA 5DDMA 3V72A 2M2WA 2BBHA 3RJGA 4KLFA 1XSNA 5J0UA 3ERCC 1KEJA 5J2CA 2ZHBA 4EBJA 2PFOA 9ICJA 7ICOA 5J2FA 4AT9B 4UBBA 4UAZA 3K7DA 4DOBA 9ICMA 5CR0A 4IG8A 1ZQIA 7ICGA 5HREA 1MQ2A 4YMOA 4S3NA 4I2GA 5J0YA 4GXKA 9ICGA 5DB7A 1JMSA 4I0UA 2DRBA 9ICCA 4RQ6A 5DBBA 1MQ3A 4RT2A 4E80A 3RJHA 4LEWA 4MFAA 2DRAA 4M47A 5J0RA 4OAGA 3RH6A 1UEVA 5B3PA 4RQ8A 3H38A 2ISOA 5J2BA 4WCWA 1ZJMA 3EF2A 1ZQTA 5J2EA 1FA0A 1ZQQA 4XQ8A 4P4MA 2ZH1A 3TFRA 2BCSA 4I27A 3MDCA 4I29A 4K9AA 4FHYA 3PHZA 4EV6A 5DB8A 4RQ3A 4YD2A 4RQ1A 2B56A 3OWGA 4X0AA 8ICOA 9ICIA 4X0BA 3NVOA 4NKUA 5IIIA 1OU5A 2PFNA 4X4VA 2DVIA 5HRLA 4HX0A 4RQ4A 7ICMA 3AUOA 1ZQNA 1TV9A 4M9GA 1KDHA 4Z6FA 7ICTA 4XA5A 3HJ1A 1MIWA 3MCRA 4EBKA 7ICPA 9ICWA 4KLHA 3HJ4A 3JPTA 5CJ7A 4XRHA 4O5EA 2DR5A 9ICOA 2RFFA 4UB1A 4M04A 8ICTA 5J2IA 5BOLA 3C5FA 1ZQHA 2ZH8A 4WC1A 4GXIA 3HW8A 1ZQRA 9ICRA 5J2DA 2BPCA 1ZQWA 4I2IA 1JAJA 4R66A 4QZ8A 1ZQGA 5J0SA 4EGWA 4LZDA 5DB6A 4EEDA 4YD1A 4RWQA 2PFPA 3OVAA 4WC7A 2B4VA 4RQ0A 4JWNA 5IILA 4WQKA 4I2EA 4IQVA 4K98A 2ZH5A 4I2CA 4PH5A 1BPBA 4LEVA 1HUZA 4IQWA 5J0TA 3LQCB 5CP2A 3C66A 2DR9A 4JLZA 4QZCA 3NWIA 4UB4A 4O5CA 5J2AA 4WOYA 7ICSA 4E8FA 4OAIZ 3HWTA 2ZH2A 7ICEA 4YN4A 4X4RA 1ZQBA 3JYYA 4KM5A 4FH5A 9ICTA 4RQ5A 4LT6A 2FMPA 5J29A 2BCQA 2DR7A 2PXIA 8ICBA 4NXWA 3ISDA 1ZQEA 1TFWA 5TZVA 4I2DA 4I2FA 4WQLA 1ZQYA 4M5DA 4EEBA 3UQ2A 7ICJA 1BPZA 4PHPA 3B0XA 4KLLA 5B3QA 4QZBA 9ICBA 4WC4A 4IQTA 5DKWA
chains in the Genus database with same CATH topology
2ZH4A 4Z6DA 8ICXA 2PBEA 4AT7B 3PNCA 4X5VA 1ZQVA 4WBZA 3JPNA 5BPCA 3RJKA 9ICUA 5HRDA 4QZIA 4F5NA 4KLTA 1UEUA 2M2VA 1ZQDA 5J2GA 5CHGA 4WC6A 2NRKA 4MF8A 3OUYA 2BPFA 1ZQLA 4NLZA 4O5KA 4TURA 3RH5A 1ZQFA 1ZQSA 8ICAA 5DEDA 3V7LA 5D4BA 3RH4A 1ZQKA 3PMLA 1JQRA 5HRGA 2BCRA 3UPQA 9ICAA 5D46A 4LZGA 3WFRE 4RWNA 9ICQA 1PX5A 5IINA 1HUOA 4I2AA 4F5OA 4ATBB 4UBCA 4XQ7A 4Z6CA 1ZQZA 4M9HA 5J0OA 3B0YA 4FHXA 4QZAA 4RQ7A 3ISCA 1ZQJA 4X4TA 1ZQUA 1WOTA 4UAWA 3PMNA 8ICCA 7ICFA 5J2JA 4F5RA 4DOAA 3HIYA 8ICGA 4QZEA 8ICSA 1YLQA 3OV7A 4TUSA 7ICKA 2BCVA 3JPOA 4RWOA 4LVSA 1UETA 4FHPA 4M9NA 8ICWA 2BPGA 3C2MA 1NOMA 1VJ7A 5J0QA 4NM2A 9ICPA 3UPSA 3RJEA 3AU2A 3WFQE 5J0PA 2Q66A 1ZQOA 4QZDA 1XSPA 9ICVA 4K4HA 1F5AA 9ICEA 4Z6EA 4MFCA 7ICVA 5D49A 1R8CA 2ZH9A 3AQMA 4M9JA 3OVBA 1RPLA 9ICKA 4UD5A 1ZQMA 4M0AA 5HC9A 4X4OA 4PGXA 3C2LA 1KNYA 2ISPA 1VFGA 7ICQA 1BPXA 3JZ0A 4NXZA 4RT3A 1R89A 4K4IA 5HRIA 2ZHAA 4KLEA 4KLSA 3NYBA 3L9DA 5F2VO 8ICUA 4QZGA 4XUSA 2VANA 1BPDA 4WC2A 4X4PA 3JPQA 8ICLA 2FMQA 1R8AA 3V7JA 5HRKA 2FMSA 4FHWA 1NO5A 3WFPA 3ISBA 8ICNA 7ICHA 4PGQA 1V4AA 1RZTA 2I9GA 2P66A 4M9LA 4I2JA 2M2TA 5J2KA 5CA7A 4KLJA 1MIYA 1XSLA 4R63A 4AT8A 3UXNA 2M2UA 5DBCA 9ICHA 1ZQAA 9ICLA 3HX0A 8ICHA 5DECA 1BPYA 4K4GA 5CWRA 8ICQA 2ZH6A 4X4QA 7ICIA 4DO9A 3C5GA 8ICKA 4GXJA 3OGUA 4RWPA 3MGIA 2DR8A 5IIMA 4NY8A 4F5PA 5IIJA 1ZJNA 4FH3A 1TFYA 3RJJA 4RQ2A 4KLOA 4PHEA 3JPSA 3H39A 7ICUA 4UD4A 2BCUA 4X4UA 3V7KA 1Q79A 3RJFA 8ICPA 4AT9A 4YMNA 4NKTA 4RPXA 3WFSC 4QZFA 4X4NA 4KLGA 2ID1A 4TUQA 4YMMA 5CB1A 1ZQPA 4WC5A 1MIVA 4AT7A 3GDXA 5IIKA 3AQNA 4WBYA 1R8BA 4DOCA 2GWSA 3JPRA 2W9MA 4KLMA 3C2KA 3H37A 3JPPA 4KLQA 3AU6A 4MFFA 2ZH3A 8ICYA 3UXOA 2PFQA 1ZQCA 3AQKA 1BPEA 4QZ9A 3OVSA 1ZQXA 4RPYA 4PHDA 5DDYA 7ICRA 3LK9A 5HHIA 7ICLA 4I2BA 4PGYA 4TUPA 8ICVA 3C18A 9ICXA 9ICSA 4I28A 3MBYA 5HRFA 2IHMA 4RPZA 5HRBA 7ICNA 4P4OA 4FHVA 5HHHA 3MGHA 4ATBA 5IIOA 4KLDA 9ICNA 5BOMA 3AQLA 4JWMA 4UB5A 4E7XA 4UB3A 4WC0A 3TFSA 8ICRA 2O5AA 4M2YA 4R64A 4X4SA 5HR9A 4NLKA 2ZH7A 3UXPA 4O9MA 4NM1A 2BE3A 4I2HA 4NLNA 3UQ0A 4AT8B 4MF2A 5DBAA 8ICIA 5J2HA 4KLUA 3MDAA 4FO6A 3WFOA 4KLIA 3RJIA 4UB2A 4PPXA 4EP7A 3K75D 4PHAA 1TVAA 5HRHA 2HHPA 5EOZA 3OUYB 8ICJA 4IQUA 4R65A 1Q78A 4WC3A 4F5QA 8ICEA 8ICFA 4P4PA 8ICMA 5DB9A 4P2HA 4UAYA 1JN3A 8ICZA 5J0XA 2O1PA 3H3AA 4QZHA 5J0WA 9ICFA 4YCXA 5DDMA 3V72A 2M2WA 3RJGA 4KLFA 1XSNA 5J0UA 1KEJA 5J2CA 2ZHBA 4EBJA 2PFOA 9ICJA 7ICOA 5J2FA 4UBBA 4AT9B 4UAZA 4DOBA 9ICMA 5CR0A 4IG8A 1ZQIA 7ICGA 5HREA 1MQ2A 4YMOA 4S3NA 4I2GA 5J0YA 4GXKA 9ICGA 5DB7A 1JMSA 2DRBA 9ICCA 4RQ6A 5DBBA 1MQ3A 4RT2A 4E80A 3RJHA 4MFAA 2DRAA 4M47A 5J0RA 3RH6A 1UEVA 4RQ8A 3H38A 2ISOA 5J2BA 4WCWA 1ZJMA 1ZQTA 5J2EA 1FA0A 1ZQQA 4XQ8A 4P4MA 2ZH1A 3TFRA 2BCSA 4I27A 3MDCA 4I29A 4FHYA 5DB8A 4RQ3A 4YD2A 4RQ1A 4X0AA 8ICOA 9ICIA 4X0BA 4NKUA 5IIIA 1OU5A 2PFNA 4X4VA 2DVIA 5HRLA 4RQ4A 7ICMA 3AUOA 1ZQNA 1TV9A 4M9GA 1KDHA 4Z6FA 7ICTA 4XA5A 3HJ1A 1MIWA 4EBKA 7ICPA 9ICWA 4KLHA 3HJ4A 3JPTA 5CJ7A 4XRHA 4O5EA 2DR5A 9ICOA 2RFFA 4UB1A 4M04A 8ICTA 5J2IA 5BOLA 3C5FA 1ZQHA 2ZH8A 4WC1A 4GXIA 3HW8A 1ZQRA 9ICRA 5J2DA 2BPCA 1ZQWA 4I2IA 1JAJA 4R66A 4QZ8A 1ZQGA 5J0SA 4LZDA 5DB6A 4YD1A 4RWQA 2PFPA 3OVAA 4WC7A 4RQ0A 4JWNA 5IILA 4I2EA 4IQVA 2ZH5A 4I2CA 4PH5A 1BPBA 1HUZA 4IQWA 5J0TA 3LQCB 5CP2A 3C66A 2DR9A 4QZCA 4UB4A 4O5CA 5J2AA 7ICSA 4E8FA 3HWTA 2ZH2A 7ICEA 4YN4A 4X4RA 1ZQBA 3JYYA 4FH5A 9ICTA 4RQ5A 4LT6A 2FMPA 5J29A 2BCQA 2DR7A 2PXIA 8ICBA 3ISDA 1ZQEA 1TFWA 5TZVA 4I2DA 4I2FA 1ZQYA 4M5DA 3UQ2A 7ICJA 1BPZA 4PHPA 3B0XA 4KLLA 4QZBA 9ICBA 4WC4A 4IQTA 5DKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZH4 A;  4Z6D A;  8ICX A;  2PBE A;  4AT7 B;  3PNC A;  4X5V A;  1ZQV A;  4WBZ A;  3JPN A;  5BPC A;  3RJK A;  9ICU A;  5HRD A;  4QZI A;  4F5N A;  4KLT A;  1UEU A;  2M2V A;  1ZQD A;  5J2G A;  5CHG A;  4WC6 A;  2NRK A;  4MF8 A;  3OUY A;  2BPF A;  1ZQL A;  4NLZ A;  4O5K A;  4TUR A;  3RH5 A;  1ZQF A;  1ZQS A;  8ICA A;  5DED A;  3V7L A;  5D4B A;  3RH4 A;  1ZQK A;  3PML A;  1JQR A;  5HRG A;  2BCR A;  3UPQ A;  9ICA A;  5D46 A;  4LZG A;  3WFR E;  4RWN A;  9ICQ A;  1PX5 A;  5IIN A;  1HUO A;  4I2A A;  4F5O A;  4ATB B;  4UBC A;  4XQ7 A;  4Z6C A;  1ZQZ A;  4M9H A;  5J0O A;  3B0Y A;  4FHX A;  4QZA A;  4RQ7 A;  3ISC A;  1ZQJ A;  4X4T A;  1ZQU A;  1WOT A;  4UAW A;  3PMN A;  8ICC A;  7ICF A;  5J2J A;  4F5R A;  4DOA A;  3HIY A;  8ICG A;  4QZE A;  8ICS A;  1YLQ A;  3OV7 A;  4TUS A;  7ICK A;  2BCV A;  3JPO A;  4RWO A;  4LVS A;  1UET A;  4FHP A;  4M9N A;  8ICW A;  2BPG A;  3C2M A;  1NOM A;  1VJ7 A;  5J0Q A;  4NM2 A;  9ICP A;  3UPS A;  3RJE A;  3AU2 A;  3WFQ E;  5J0P A;  2Q66 A;  1ZQO A;  4QZD A;  1XSP A;  9ICV A;  4K4H A;  1F5A A;  9ICE A;  4Z6E A;  4MFC A;  7ICV A;  5D49 A;  1R8C A;  2ZH9 A;  3AQM A;  4M9J A;  3OVB A;  1RPL A;  9ICK A;  4UD5 A;  1ZQM A;  4M0A A;  5HC9 A;  4X4O A;  4PGX A;  3C2L A;  1KNY A;  2ISP A;  1VFG A;  7ICQ A;  1BPX A;  3JZ0 A;  4NXZ A;  4RT3 A;  1R89 A;  4K4I A;  5HRI A;  2ZHA A;  4KLE A;  4KLS A;  3NYB A;  3L9D A;  5F2V O;  8ICU A;  4QZG A;  4XUS A;  2VAN A;  1BPD A;  4WC2 A;  4X4P A;  3JPQ A;  8ICL A;  2FMQ A;  1R8A A;  3V7J A;  5HRK A;  2FMS A;  4FHW A;  1NO5 A;  3WFP A;  3ISB A;  8ICN A;  7ICH A;  4PGQ A;  1V4A A;  1RZT A;  2I9G A;  2P66 A;  4M9L A;  4I2J A;  2M2T A;  5J2K A;  5CA7 A;  4KLJ A;  1MIY A;  1XSL A;  4R63 A;  4AT8 A;  3UXN A;  2M2U A;  5DBC A;  9ICH A;  1ZQA A;  9ICL A;  3HX0 A;  8ICH A;  5DEC A;  1BPY A;  4K4G A;  5CWR A;  8ICQ A;  2ZH6 A;  4X4Q A;  7ICI A;  4DO9 A;  3C5G A;  8ICK A;  4GXJ A;  3OGU A;  4RWP A;  3MGI A;  2DR8 A;  5IIM A;  4NY8 A;  4F5P A;  5IIJ A;  1ZJN A;  4FH3 A;  1TFY A;  3RJJ A;  4RQ2 A;  4KLO A;  4PHE A;  3JPS A;  3H39 A;  7ICU A;  4UD4 A;  2BCU A;  4X4U A;  3V7K A;  1Q79 A;  3RJF A;  8ICP A;  4AT9 A;  4YMN A;  4NKT A;  4RPX A;  3WFS C;  4QZF A;  4X4N A;  4KLG A;  2ID1 A;  4TUQ A;  4YMM A;  5CB1 A;  1ZQP A;  4WC5 A;  1MIV A;  4AT7 A;  3GDX A;  5IIK A;  3AQN A;  4WBY A;  1R8B A;  4DOC A;  2GWS A;  3JPR A;  2W9M A;  4KLM A;  3C2K A;  3H37 A;  3JPP A;  4KLQ A;  3AU6 A;  4MFF A;  2ZH3 A;  8ICY A;  3UXO A;  2PFQ A;  1ZQC A;  3AQK A;  1BPE A;  4QZ9 A;  3OVS A;  1ZQX A;  4RPY A;  4PHD A;  5DDY A;  7ICR A;  3LK9 A;  5HHI A;  7ICL A;  4I2B A;  4PGY A;  4TUP A;  8ICV A;  3C18 A;  9ICX A;  9ICS A;  4I28 A;  3MBY A;  5HRF A;  2IHM A;  4RPZ A;  5HRB A;  7ICN A;  4P4O A;  4FHV A;  5HHH A;  3MGH A;  4ATB A;  5IIO A;  4KLD A;  9ICN A;  5BOM A;  3AQL A;  4JWM A;  4UB5 A;  4E7X A;  4UB3 A;  4WC0 A;  3TFS A;  8ICR A;  2O5A A;  4M2Y A;  4R64 A;  4X4S A;  5HR9 A;  4NLK A;  2ZH7 A;  3UXP A;  4O9M A;  4NM1 A;  2BE3 A;  4I2H A;  4NLN A;  3UQ0 A;  4AT8 B;  4MF2 A;  5DBA A;  8ICI A;  5J2H A;  4KLU A;  3MDA A;  4FO6 A;  3WFO A;  4KLI A;  3RJI A;  4UB2 A;  4PPX A;  4EP7 A;  3K75 D;  4PHA A;  1TVA A;  5HRH A;  2HHP A;  5EOZ A;  3OUY B;  8ICJ A;  4IQU A;  4R65 A;  1Q78 A;  4WC3 A;  4F5Q A;  8ICE A;  8ICF A;  4P4P A;  8ICM A;  5DB9 A;  4P2H A;  4UAY A;  1JN3 A;  8ICZ A;  5J0X A;  2O1P A;  3H3A A;  4QZH A;  5J0W A;  9ICF A;  4YCX A;  5DDM A;  3V72 A;  2M2W A;  3RJG A;  4KLF A;  1XSN A;  5J0U A;  1KEJ A;  5J2C A;  2ZHB A;  4EBJ A;  2PFO A;  9ICJ A;  7ICO A;  5J2F A;  4UBB A;  4AT9 B;  4UAZ A;  4DOB A;  9ICM A;  5CR0 A;  4IG8 A;  1ZQI A;  7ICG A;  5HRE A;  1MQ2 A;  4YMO A;  4S3N A;  4I2G A;  5J0Y A;  4GXK A;  9ICG A;  5DB7 A;  1JMS A;  2DRB A;  9ICC A;  4RQ6 A;  5DBB A;  1MQ3 A;  4RT2 A;  4E80 A;  3RJH A;  4MFA A;  2DRA A;  4M47 A;  5J0R A;  3RH6 A;  1UEV A;  4RQ8 A;  3H38 A;  2ISO A;  5J2B A;  4WCW A;  1ZJM A;  1ZQT A;  5J2E A;  1FA0 A;  1ZQQ A;  4XQ8 A;  4P4M A;  2ZH1 A;  3TFR A;  2BCS A;  4I27 A;  3MDC A;  4I29 A;  4FHY A;  5DB8 A;  4RQ3 A;  4YD2 A;  4RQ1 A;  4X0A A;  8ICO A;  9ICI A;  4X0B A;  4NKU A;  5III A;  1OU5 A;  2PFN A;  4X4V A;  2DVI A;  5HRL A;  4RQ4 A;  7ICM A;  3AUO A;  1ZQN A;  1TV9 A;  4M9G A;  1KDH A;  4Z6F A;  7ICT A;  4XA5 A;  3HJ1 A;  1MIW A;  4EBK A;  7ICP A;  9ICW A;  4KLH A;  3HJ4 A;  3JPT A;  5CJ7 A;  4XRH A;  4O5E A;  2DR5 A;  9ICO A;  2RFF A;  4UB1 A;  4M04 A;  8ICT A;  5J2I A;  5BOL A;  3C5F A;  1ZQH A;  2ZH8 A;  4WC1 A;  4GXI A;  3HW8 A;  1ZQR A;  9ICR A;  5J2D A;  2BPC A;  1ZQW A;  4I2I A;  1JAJ A;  4R66 A;  4QZ8 A;  1ZQG A;  5J0S A;  4LZD A;  5DB6 A;  4YD1 A;  4RWQ A;  2PFP A;  3OVA A;  4WC7 A;  4RQ0 A;  4JWN A;  5IIL A;  4I2E A;  4IQV A;  2ZH5 A;  4I2C A;  4PH5 A;  1BPB A;  1HUZ A;  4IQW A;  5J0T A;  3LQC B;  5CP2 A;  3C66 A;  2DR9 A;  4QZC A;  4UB4 A;  4O5C A;  5J2A A;  7ICS A;  4E8F A;  3HWT A;  2ZH2 A;  7ICE A;  4YN4 A;  4X4R A;  1ZQB A;  3JYY A;  4FH5 A;  9ICT A;  4RQ5 A;  4LT6 A;  2FMP A;  5J29 A;  2BCQ A;  2DR7 A;  2PXI A;  8ICB A;  3ISD A;  1ZQE A;  1TFW A;  5TZV A;  4I2D A;  4I2F A;  1ZQY A;  4M5D A;  3UQ2 A;  7ICJ A;  1BPZ A;  4PHP A;  3B0X A;  4KLL A;  4QZB A;  9ICB A;  4WC4 A;  4IQT A;  5DKW A; 
#chains in the Genus database with same CATH topology
 2ZH4 A;  4Z6D A;  8ICX A;  2PBE A;  4AT7 B;  3PNC A;  4X5V A;  1ZQV A;  4WBZ A;  3JPN A;  5BPC A;  3RJK A;  9ICU A;  5HRD A;  4QZI A;  2GAF D;  4F5N A;  4KLT A;  1UEU A;  2M2V A;  1ZQD A;  5J2G A;  5CHG A;  4WC6 A;  2NRK A;  4MF8 A;  3OUY A;  2BPF A;  1ZQL A;  4NXT A;  4NLZ A;  4O5K A;  4NXX A;  4TUR A;  3RH5 A;  1ZQF A;  1ZQS A;  8ICA A;  5DED A;  3V7L A;  5D4B A;  3RH4 A;  1ZQK A;  3PML A;  1JQR A;  5HRG A;  2BCR A;  3UPQ A;  9ICA A;  5D46 A;  4LZG A;  3WFR E;  4RWN A;  9ICQ A;  4FO1 A;  1PX5 A;  5IIN A;  1HUO A;  4I2A A;  4F5O A;  4ATB B;  4UBC A;  4XQ7 A;  4Z6C A;  1ZQZ A;  4M9H A;  5J0O A;  3B0Y A;  4FHX A;  4QZA A;  4RQ7 A;  3ISC A;  4K99 A;  1ZQJ A;  4X4T A;  1ZQU A;  1WOT A;  4UAW A;  3PMN A;  8ICC A;  7ICF A;  5J2J A;  4F5R A;  4DOA A;  3HIY A;  8ICG A;  4QZE A;  8ICS A;  1YLQ A;  3OV7 A;  4TUS A;  7ICK A;  2BCV A;  3JPO A;  4RWO A;  4LVS A;  1UET A;  4FHP A;  4M9N A;  8ICW A;  2BPG A;  3C2M A;  1NOM A;  1VJ7 A;  5J0Q A;  4NM2 A;  9ICP A;  3UPS A;  3RJE A;  3AU2 A;  3WFQ E;  5J0P A;  2Q66 A;  1ZQO A;  4QZD A;  4K97 A;  1XSP A;  9ICV A;  4K4H A;  4OAH A;  1F5A A;  9ICE A;  4Z6E A;  4MFC A;  7ICV A;  5D49 A;  1R8C A;  2ZH9 A;  5CFU A;  3AQM A;  4M9J A;  3OVB A;  1RPL A;  9ICK A;  4UD5 A;  1ZQM A;  4M0A A;  5HC9 A;  4X4O A;  4NXU A;  4PGX A;  5D61 A;  1KNY A;  3C2L A;  2ISP A;  1VFG A;  2B51 A;  7ICQ A;  1BPX A;  3JZ0 A;  4NXZ A;  4RT3 A;  1R89 A;  4K4I A;  5HRI A;  2ZHA A;  4KLE A;  4KLS A;  3NYB A;  3L9D A;  4O67 A;  5F2V O;  8ICU A;  4N7R A;  4QZG A;  4XUS A;  5D63 A;  2VAN A;  1BPD A;  2IHO A;  4XJE A;  4WC2 A;  4X4P A;  3JPQ A;  8ICL A;  2FMQ A;  1R8A A;  3V7J A;  5HRK A;  2FMS A;  4FHW A;  1NO5 A;  3WFP A;  3ISB A;  8ICN A;  7ICH A;  4PGQ A;  5CFS A;  1V4A A;  1RZT A;  2I9G A;  2P66 A;  4M9L A;  4I2J A;  2M2T A;  5J2K A;  5CA7 A;  4KLJ A;  1MIY A;  1XSL A;  2HN1 A;  4R63 A;  4AT8 A;  3UXN A;  2M2U A;  5DBC A;  9ICH A;  1ZQA A;  9ICL A;  3HX0 A;  8ICH A;  5DEC A;  1BPY A;  4K4G A;  5CWR A;  8ICQ A;  2ZH6 A;  4X4Q A;  7ICI A;  3ER9 B;  4DO9 A;  3C5G A;  8ICK A;  2GA9 D;  4GXJ A;  3OGU A;  4RWP A;  3MGI A;  2DR8 A;  5IIM A;  4NXV A;  5D62 A;  4NY8 A;  4F5P A;  5IIJ A;  5CHE A;  1ZJN A;  4FH3 A;  1TFY A;  3RJJ A;  4RQ2 A;  4K96 A;  4KLO A;  4PHE A;  3JPS A;  3H39 A;  7ICU A;  4UD4 A;  2BCU A;  4X4U A;  3V7K A;  1Q79 A;  3RJF A;  8ICP A;  4AT9 A;  4YMN A;  3CK6 A;  4NKT A;  4RPX A;  3WFS C;  4QZF A;  4X4N A;  4KLG A;  4JLX A;  2ID1 A;  4TUQ A;  4YMM A;  5CB1 A;  1ZQP A;  4WC5 A;  1MIV A;  4AT7 A;  3GDX A;  5IIK A;  3AQN A;  4WBY A;  1R8B A;  4DOC A;  2GWS A;  3JPR A;  2W9M A;  4O6A A;  4KLM A;  4LEY A;  3C2K A;  3H37 A;  3JPP A;  4KLQ A;  3AU6 A;  4MFF A;  2ZH3 A;  8ICY A;  3UXO A;  2PFQ A;  4K9B A;  1ZQC A;  4LEZ A;  3AQK A;  1BPE A;  4QZ9 A;  3OVS A;  4O68 A;  1ZQX A;  4RPY A;  4PHD A;  5DDY A;  7ICR A;  3LK9 A;  5HHI A;  7ICL A;  3JCF A;  4I2B A;  4PGY A;  4TUP A;  8ICV A;  3C18 A;  9ICX A;  9ICS A;  4I28 A;  3MBY A;  5HRF A;  1GPJ A;  2IUB A;  4MKP A;  2IHM A;  4RPZ A;  5HRB A;  7ICN A;  4P4O A;  4FHV A;  2HN2 A;  5HHH A;  3MGH A;  4OAF A;  2FCL A;  4ATB A;  5IIO A;  4KLD A;  9ICN A;  5BOM A;  3AQL A;  4K8V A;  4WH5 A;  4JWM A;  3ER8 C;  4UB5 A;  4E7X A;  4KB6 A;  4UB3 A;  5CFT A;  4WC0 A;  5JTG A;  3TFS A;  8ICR A;  4O69 A;  2O5A A;  4M2Y A;  4R64 A;  4X4S A;  5HR9 A;  4NLK A;  2ZH7 A;  3UXP A;  4O9M A;  4NM1 A;  2BE3 A;  4I2H A;  4NLN A;  3UQ0 A;  4AT8 B;  4MF2 A;  5DBA A;  8ICI A;  5J2H A;  4KLU A;  3MDA A;  4FO6 A;  2EWR A;  3WFO A;  4KLI A;  3RJI A;  4UB2 A;  4PPX A;  4EP7 A;  3K75 D;  4PHA A;  1TVA A;  2BBJ A;  3NKU A;  2HHP A;  5HRH A;  5EOZ A;  3OUY B;  8ICJ A;  4IQU A;  4R65 A;  1Q78 A;  4WC3 A;  4F5Q A;  8ICE A;  8ICF A;  4P4P A;  8ICM A;  5DB9 A;  4P2H A;  4UAY A;  1JN3 A;  8ICZ A;  5J0X A;  2O1P A;  3H3A A;  4QZH A;  5J0W A;  9ICF A;  4YCX A;  5DDM A;  3V72 A;  2M2W A;  2BBH A;  3RJG A;  4KLF A;  1XSN A;  5J0U A;  3ERC C;  1KEJ A;  5J2C A;  2ZHB A;  4EBJ A;  2PFO A;  9ICJ A;  7ICO A;  5J2F A;  4AT9 B;  4UBB A;  4UAZ A;  3K7D A;  4DOB A;  9ICM A;  5CR0 A;  4IG8 A;  1ZQI A;  7ICG A;  5HRE A;  1MQ2 A;  4YMO A;  4S3N A;  4I2G A;  5J0Y A;  4GXK A;  9ICG A;  5DB7 A;  1JMS A;  4I0U A;  2DRB A;  9ICC A;  4RQ6 A;  5DBB A;  1MQ3 A;  4RT2 A;  4E80 A;  3RJH A;  4LEW A;  4MFA A;  2DRA A;  4M47 A;  5J0R A;  4OAG A;  3RH6 A;  1UEV A;  5B3P A;  4RQ8 A;  3H38 A;  2ISO A;  5J2B A;  4WCW A;  1ZJM A;  3EF2 A;  1ZQT A;  5J2E A;  1FA0 A;  1ZQQ A;  4XQ8 A;  4P4M A;  2ZH1 A;  3TFR A;  2BCS A;  4I27 A;  3MDC A;  4I29 A;  4K9A A;  4FHY A;  3PHZ A;  4EV6 A;  5DB8 A;  4RQ3 A;  4YD2 A;  4RQ1 A;  2B56 A;  3OWG A;  4X0A A;  8ICO A;  9ICI A;  4X0B A;  3NVO A;  4NKU A;  5III A;  1OU5 A;  2PFN A;  4X4V A;  2DVI A;  5HRL A;  4HX0 A;  4RQ4 A;  7ICM A;  3AUO A;  1ZQN A;  1TV9 A;  4M9G A;  1KDH A;  4Z6F A;  7ICT A;  4XA5 A;  3HJ1 A;  1MIW A;  3MCR A;  4EBK A;  7ICP A;  9ICW A;  4KLH A;  3HJ4 A;  3JPT A;  5CJ7 A;  4XRH A;  4O5E A;  2DR5 A;  9ICO A;  2RFF A;  4UB1 A;  4M04 A;  8ICT A;  5J2I A;  5BOL A;  3C5F A;  1ZQH A;  2ZH8 A;  4WC1 A;  4GXI A;  3HW8 A;  1ZQR A;  9ICR A;  5J2D A;  2BPC A;  1ZQW A;  4I2I A;  1JAJ A;  4R66 A;  4QZ8 A;  1ZQG A;  5J0S A;  4EGW A;  4LZD A;  5DB6 A;  4EED A;  4YD1 A;  4RWQ A;  2PFP A;  3OVA A;  4WC7 A;  2B4V A;  4RQ0 A;  4JWN A;  5IIL A;  4WQK A;  4I2E A;  4IQV A;  4K98 A;  2ZH5 A;  4I2C A;  4PH5 A;  1BPB A;  4LEV A;  1HUZ A;  4IQW A;  5J0T A;  3LQC B;  5CP2 A;  3C66 A;  2DR9 A;  4JLZ A;  4QZC A;  3NWI A;  4UB4 A;  4O5C A;  5J2A A;  4WOY A;  7ICS A;  4E8F A;  4OAI Z;  3HWT A;  2ZH2 A;  7ICE A;  4YN4 A;  4X4R A;  1ZQB A;  3JYY A;  4KM5 A;  4FH5 A;  9ICT A;  4RQ5 A;  4LT6 A;  2FMP A;  5J29 A;  2BCQ A;  2DR7 A;  2PXI A;  8ICB A;  4NXW A;  3ISD A;  1ZQE A;  1TFW A;  5TZV A;  4I2D A;  4I2F A;  4WQL A;  1ZQY A;  4M5D A;  4EEB A;  3UQ2 A;  7ICJ A;  1BPZ A;  4PHP A;  3B0X A;  4KLL A;  5B3Q A;  4QZB A;  9ICB A;  4WC4 A;  4IQT A;  5DKW A; 
#chains in the Genus database with same CATH homology
 2ZH4 A;  4Z6D A;  8ICX A;  2PBE A;  4AT7 B;  3PNC A;  4X5V A;  1ZQV A;  4WBZ A;  3JPN A;  5BPC A;  3RJK A;  9ICU A;  5HRD A;  4QZI A;  4F5N A;  4KLT A;  1UEU A;  2M2V A;  1ZQD A;  5J2G A;  5CHG A;  4WC6 A;  2NRK A;  4MF8 A;  3OUY A;  2BPF A;  1ZQL A;  4NLZ A;  4O5K A;  4TUR A;  3RH5 A;  1ZQF A;  1ZQS A;  8ICA A;  5DED A;  3V7L A;  5D4B A;  3RH4 A;  1ZQK A;  3PML A;  1JQR A;  5HRG A;  2BCR A;  3UPQ A;  9ICA A;  5D46 A;  4LZG A;  3WFR E;  4RWN A;  9ICQ A;  1PX5 A;  5IIN A;  1HUO A;  4I2A A;  4F5O A;  4ATB B;  4UBC A;  4XQ7 A;  4Z6C A;  1ZQZ A;  4M9H A;  5J0O A;  3B0Y A;  4FHX A;  4QZA A;  4RQ7 A;  3ISC A;  1ZQJ A;  4X4T A;  1ZQU A;  1WOT A;  4UAW A;  3PMN A;  8ICC A;  7ICF A;  5J2J A;  4F5R A;  4DOA A;  3HIY A;  8ICG A;  4QZE A;  8ICS A;  1YLQ A;  3OV7 A;  4TUS A;  7ICK A;  2BCV A;  3JPO A;  4RWO A;  4LVS A;  1UET A;  4FHP A;  4M9N A;  8ICW A;  2BPG A;  3C2M A;  1NOM A;  1VJ7 A;  5J0Q A;  4NM2 A;  9ICP A;  3UPS A;  3RJE A;  3AU2 A;  3WFQ E;  5J0P A;  2Q66 A;  1ZQO A;  4QZD A;  1XSP A;  9ICV A;  4K4H A;  1F5A A;  9ICE A;  4Z6E A;  4MFC A;  7ICV A;  5D49 A;  1R8C A;  2ZH9 A;  3AQM A;  4M9J A;  3OVB A;  1RPL A;  9ICK A;  4UD5 A;  1ZQM A;  4M0A A;  5HC9 A;  4X4O A;  4PGX A;  3C2L A;  1KNY A;  2ISP A;  1VFG A;  7ICQ A;  1BPX A;  3JZ0 A;  4NXZ A;  4RT3 A;  1R89 A;  4K4I A;  5HRI A;  2ZHA A;  4KLE A;  4KLS A;  3NYB A;  3L9D A;  5F2V O;  8ICU A;  4QZG A;  4XUS A;  2VAN A;  1BPD A;  4WC2 A;  4X4P A;  3JPQ A;  8ICL A;  2FMQ A;  1R8A A;  3V7J A;  5HRK A;  2FMS A;  4FHW A;  1NO5 A;  3WFP A;  3ISB A;  8ICN A;  7ICH A;  4PGQ A;  1V4A A;  1RZT A;  2I9G A;  2P66 A;  4M9L A;  4I2J A;  2M2T A;  5J2K A;  5CA7 A;  4KLJ A;  1MIY A;  1XSL A;  4R63 A;  4AT8 A;  3UXN A;  2M2U A;  5DBC A;  9ICH A;  1ZQA A;  9ICL A;  3HX0 A;  8ICH A;  5DEC A;  1BPY A;  4K4G A;  5CWR A;  8ICQ A;  2ZH6 A;  4X4Q A;  7ICI A;  4DO9 A;  3C5G A;  8ICK A;  4GXJ A;  3OGU A;  4RWP A;  3MGI A;  2DR8 A;  5IIM A;  4NY8 A;  4F5P A;  5IIJ A;  1ZJN A;  4FH3 A;  1TFY A;  3RJJ A;  4RQ2 A;  4KLO A;  4PHE A;  3JPS A;  3H39 A;  7ICU A;  4UD4 A;  2BCU A;  4X4U A;  3V7K A;  1Q79 A;  3RJF A;  8ICP A;  4AT9 A;  4YMN A;  4NKT A;  4RPX A;  3WFS C;  4QZF A;  4X4N A;  4KLG A;  2ID1 A;  4TUQ A;  4YMM A;  5CB1 A;  1ZQP A;  4WC5 A;  1MIV A;  4AT7 A;  3GDX A;  5IIK A;  3AQN A;  4WBY A;  1R8B A;  4DOC A;  2GWS A;  3JPR A;  2W9M A;  4KLM A;  3C2K A;  3H37 A;  3JPP A;  4KLQ A;  3AU6 A;  4MFF A;  2ZH3 A;  8ICY A;  3UXO A;  2PFQ A;  1ZQC A;  3AQK A;  1BPE A;  4QZ9 A;  3OVS A;  1ZQX A;  4RPY A;  4PHD A;  5DDY A;  7ICR A;  3LK9 A;  5HHI A;  7ICL A;  4I2B A;  4PGY A;  4TUP A;  8ICV A;  3C18 A;  9ICX A;  9ICS A;  4I28 A;  3MBY A;  5HRF A;  2IHM A;  4RPZ A;  5HRB A;  7ICN A;  4P4O A;  4FHV A;  5HHH A;  3MGH A;  4ATB A;  5IIO A;  4KLD A;  9ICN A;  5BOM A;  3AQL A;  4JWM A;  4UB5 A;  4E7X A;  4UB3 A;  4WC0 A;  3TFS A;  8ICR A;  2O5A A;  4M2Y A;  4R64 A;  4X4S A;  5HR9 A;  4NLK A;  2ZH7 A;  3UXP A;  4O9M A;  4NM1 A;  2BE3 A;  4I2H A;  4NLN A;  3UQ0 A;  4AT8 B;  4MF2 A;  5DBA A;  8ICI A;  5J2H A;  4KLU A;  3MDA A;  4FO6 A;  3WFO A;  4KLI A;  3RJI A;  4UB2 A;  4PPX A;  4EP7 A;  3K75 D;  4PHA A;  1TVA A;  5HRH A;  2HHP A;  5EOZ A;  3OUY B;  8ICJ A;  4IQU A;  4R65 A;  1Q78 A;  4WC3 A;  4F5Q A;  8ICE A;  8ICF A;  4P4P A;  8ICM A;  5DB9 A;  4P2H A;  4UAY A;  1JN3 A;  8ICZ A;  5J0X A;  2O1P A;  3H3A A;  4QZH A;  5J0W A;  9ICF A;  4YCX A;  5DDM A;  3V72 A;  2M2W A;  3RJG A;  4KLF A;  1XSN A;  5J0U A;  1KEJ A;  5J2C A;  2ZHB A;  4EBJ A;  2PFO A;  9ICJ A;  7ICO A;  5J2F A;  4UBB A;  4AT9 B;  4UAZ A;  4DOB A;  9ICM A;  5CR0 A;  4IG8 A;  1ZQI A;  7ICG A;  5HRE A;  1MQ2 A;  4YMO A;  4S3N A;  4I2G A;  5J0Y A;  4GXK A;  9ICG A;  5DB7 A;  1JMS A;  2DRB A;  9ICC A;  4RQ6 A;  5DBB A;  1MQ3 A;  4RT2 A;  4E80 A;  3RJH A;  4MFA A;  2DRA A;  4M47 A;  5J0R A;  3RH6 A;  1UEV A;  4RQ8 A;  3H38 A;  2ISO A;  5J2B A;  4WCW A;  1ZJM A;  1ZQT A;  5J2E A;  1FA0 A;  1ZQQ A;  4XQ8 A;  4P4M A;  2ZH1 A;  3TFR A;  2BCS A;  4I27 A;  3MDC A;  4I29 A;  4FHY A;  5DB8 A;  4RQ3 A;  4YD2 A;  4RQ1 A;  4X0A A;  8ICO A;  9ICI A;  4X0B A;  4NKU A;  5III A;  1OU5 A;  2PFN A;  4X4V A;  2DVI A;  5HRL A;  4RQ4 A;  7ICM A;  3AUO A;  1ZQN A;  1TV9 A;  4M9G A;  1KDH A;  4Z6F A;  7ICT A;  4XA5 A;  3HJ1 A;  1MIW A;  4EBK A;  7ICP A;  9ICW A;  4KLH A;  3HJ4 A;  3JPT A;  5CJ7 A;  4XRH A;  4O5E A;  2DR5 A;  9ICO A;  2RFF A;  4UB1 A;  4M04 A;  8ICT A;  5J2I A;  5BOL A;  3C5F A;  1ZQH A;  2ZH8 A;  4WC1 A;  4GXI A;  3HW8 A;  1ZQR A;  9ICR A;  5J2D A;  2BPC A;  1ZQW A;  4I2I A;  1JAJ A;  4R66 A;  4QZ8 A;  1ZQG A;  5J0S A;  4LZD A;  5DB6 A;  4YD1 A;  4RWQ A;  2PFP A;  3OVA A;  4WC7 A;  4RQ0 A;  4JWN A;  5IIL A;  4I2E A;  4IQV A;  2ZH5 A;  4I2C A;  4PH5 A;  1BPB A;  1HUZ A;  4IQW A;  5J0T A;  3LQC B;  5CP2 A;  3C66 A;  2DR9 A;  4QZC A;  4UB4 A;  4O5C A;  5J2A A;  7ICS A;  4E8F A;  3HWT A;  2ZH2 A;  7ICE A;  4YN4 A;  4X4R A;  1ZQB A;  3JYY A;  4FH5 A;  9ICT A;  4RQ5 A;  4LT6 A;  2FMP A;  5J29 A;  2BCQ A;  2DR7 A;  2PXI A;  8ICB A;  3ISD A;  1ZQE A;  1TFW A;  5TZV A;  4I2D A;  4I2F A;  1ZQY A;  4M5D A;  3UQ2 A;  7ICJ A;  1BPZ A;  4PHP A;  3B0X A;  4KLL A;  4QZB A;  9ICB A;  4WC4 A;  4IQT A;  5DKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...