1OUNA

Crystal structure of nuclear transport factor 2 (ntf2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title The 1.6 angstroms resolution crystal structure of nuclear transport factor 2 (NTF2).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ounA00
3VGNA 3DUKA 5G2GA 3GZYB 4H3UA 1QMAA 2RCDA 4WWUC 4R9KA 3EHCA 3FLJA 1VZZA 4HM7B 3NM2A 3NV0A 4RZMA 5DRVA 3OWUA 4FCJA 4LMIA 4HM5B 5CK6A 1ULIB 3T8NA 3KSPA 4K1UA 1U5OA 1Z1SA 4XBXA 3LYGA 2GEYA 4J9AA 4K1VA 1QJGA 4L8PA 5AIGA 5AI1A 1IDPA 2Z76A 1Q40A 3S5CA 2QGUA 3GZXB 6STDA 4LEHA 1STDA 4MJDA 1EA2A 3EBYA 7STDA 4FCMA 4L8OA 3STDA 5CF2A 3H51A 1BUQA 5D83A 4HKVB 2HMLB 1JKGA 3SEDA 5JPPA 4HM0B 1GY6A 4STDA 3NBRA 3FSDA 1O7MB 5STDA 2INXA 3ER7A 3FZWA 3F14A 3WMDA 2YFLB 4I4KA 1DMQA 1OUNA 3B4OA 3DM8A 3A76A 2GBXB 3FGYA 4HM3B 5KP4A 3E99A 2BMOB 5IEOA 3Q90A 5IG0A 5KP3A 3RGRA 4HM6B 4IIAA 4HM8B 2CKFB 1JN5A 1OGXA 1NDOB 4XBTA 5CLKA 4WYKB 1OHSA 3CNMA 2K54A 3BLZA 2RFRA 3EQQB 3F7SA 5BVBA 1TP6A 3GWRA 5IG5A 2HMJB 2I9WA 3MG2A 3RGAA 1WQLB 3IPTA 4J8TA 4XM4A 3F7XA 3F9SA 3JUMA 3H3HA 3NUVA 5DREA 4U13A 4R9LA 3MG3A 3K7CA 2HMKB 3VSYA 2B1XB 1ASKA 3B8LA 4WP5A 2HMOB 3GRDA 3G8ZA 3G16A 2B24B 4CDLA 1W6YA 3MSOA 3FF2A 2A15A 5AIFA 5EVHA 3SOYA 1JB5A 2GEXA 3MHEA 3I0YA 4KVHA 2RGQA 1C7HA 3SOAA 5CF1A 1W01A 4OVMA 4R1KA 3UJMA 2PZVA 5TGNA 5AEWB 3OXAA 2JQ5A 2YFIB 1AR0A 1DMNA 3KKGA 5IENA 3OV4A 2BMQB 3B4PA 4X2HA 1OHPA 2CHCA 1JKGB 1OPYA 2STDA 1SJWA 5JPUA 2F86B 2QIYA 1ULJB 1GS3A 4HM1B 2YFJB 1O7GB 2W2CA 5IEPA 2Z7AA 4HZBB 3DZLA 3HX8A 3GZBA 4OUQA 5IG3A 4HM2B 3BB9A 5FW5A 4XB5A 1OF5B 5AIIA 3T8UA 5D82A 5BXQA 3MKIA 1K41A 1OCVA 2HMMB 1ZO2A 1GY7A 2HMNB 3G0KA 3M8CA 5IERA 1Q42A 1JB2A 3NHXA 1W00A 3K0ZA 3NV0B 1OHOA 1O7HB 3OWSA 2XSOB 1ZX2A 3DXOA 3F8HA 2F98A 4GB5A 4Q53A 3HZPA 2XSHB 5HGRA 3EX9A 2XRXB 4HM4B 3EN8A 2IMJA 3CNXA 5AIHA 4XBYA 1UUWB 3F8XA 1UUVB 4HJLB 2F99A 3LZAA 3EC9A 1E97A 1OGZA 3ROBA 1Q40B 3FKAA 4N3VA 3JUPA 5AEUB 1O7NB 4LGQA 1NWWA 2GBWB 1DMMA 2XR8B 5IG4A 3OWYA 1CQSA 4HVNA 5CXOA 3JUNA 1EG9B 3B7CA 1NU3A 3MG1A 2Z77A 3EBTA 3EF8A 3HK4A 5D81A 1TUHA 5IF6A 1O7PB 3FF0A 1GY5A 3KE7A 4PEJA 3ECFA 3KZTA 4L7KA 4XDVA 3EJVA 1E3RA 1A2KA 3EN1B 2UX0A 1W02A 2BNGA 4WYKA 1S5AA 3JUQA 5KP1A 3D9RA 3FH1A 2BMRB 1OH0A 2R4IA 3F40A 1HKXA 1E3VA 1O7WB 3DMCA 4XDWA 2GXFA 3OX9A 4X2OA 3MYTA 4ORLA 1ISKA 3JUOA 2OWPA 3GZRA 3CPOA 1JB4A 1OF5A 3CU3A 1JN5B 3UNLA 4HZ9B 1GYBA 3NXJA 8CHOA
chains in the Genus database with same CATH superfamily
1JBSA 3VGNA 1BRIA 2WO0A 3DUKA 3SYUA 5G2GA 3GZYB 4H3UA 1QMAA 2RCDA 4WWUC 1VQ73 4TX4A 4R9KA 3EHCA 1JJ22 1GSPA 3FLJA 1VZZA 3SLUA 2J8XB 1Q814 1UDII 1RRHA 2CX1A 2OCTA 4KT3B 1RNTA 4NHFA 4HM7B 1TJDA 2MC8A 3URPA 5AYRB 1HU9A 3DGNA 3NM2A 1N9JA 2GU3A 4FMBA 3NV0A 4RZMA 2AADA 5DRVA 3A5EA 3OWUA 4FCZA 4FCJA 5M1AA 1NB3I 2CFDA 4LMIA 1Q824 2UUGC 4HM5B 1BRGA 1YJ93 1A67A 4BTYA 2P05A 5CK6A 2L1SA 1ULIB 1I2GA 2BU4A 4FMCA 3T8NA 3LTBA 2O3OA 3KSED 3KSPA 3GAXA 1X1UA 2W04A 4N6LA 1TRQA 1FGRA 1EKMA 1FGTA 1TIJA 1I0XA 1RGCA 4K1UA 1U5OA 3SX1A 5BIRA 1I3IA 1JNQA 1Z1SA 2CC3A 4WFOA 4XBXA 3LYGA 1RLSA 5EEOA 2HOHA 2GEYA 4J9AA 4K1VA 3WOFB 1QJGA 3J7Yd 1BSCA 1W6GA 3N8BA 1YVSA 4L8PA 5AIGA 5AI1A 5JBSA 1IDPA 1YHQ3 3ALAA 2Z76A 1Q40A 3S5CA 3CPW2 4EXRA 2QGUA 3GZXB 6STDA 5IW9A 2H0HA 1KD14 4LEHA 2RSXA 1STDA 1M904 2ML5A 3T0UA 1GOVA 3CCU3 2W9PA 1J2BA 4MJDA 1EA2A 4RNYA 1NB5I 1VQL3 1DETA 2F56A 3EBYA 4KZ1A 2CX0A 5M18A 7STDA 4FCMA 3LXUX 4L8OA 1BSDA 3PCRA 3STDA 3X41A 1Q7HA 3CCQ3 3NX0A 5CF2A 3FCSB 3H51A 1CEWI 1US1A 2ZA4A 1BANA 4NPBA 1BUQA 3NQZA 2V1LA 5D83A 2QA43 1BVIA 4N6TA 1B2UA 4HKVB 4GSPA 6RNTA 2HMLB 2CIUA 1GD3A 1RGHA 3IMAB 1JKGA 1UCKA 3OW22 2C4BA 2CW9A 3SEDA 4O8SA 5JPPA 3AMOB 3LT9A 8RNTA 2Z6BA 4HM0B 1GY6A 2OTL3 2QEX3 2W0QA 4ILFA 4STDA 3NBRA 4MMXB 1YI23 3FSDA 1VQ83 1IV9A 1O7MB 2FGTA 3X3ZA 3LTCA 1B2XA 2JDIH 3CMA3 1B2ZA 5STDA 2INXA 3G4S3 1YVBI 1VQO3 1IQYA 2WOHA 2XEPA 3ER7A 1BNGA 2BT3A 3O8YA 5ELJA 3FZWA 2P09A 2ZHXB 3F14A 3WMDA 1MOLA 2C10A 2YFLB 3FG3A 2W6JH 4I4KA 1ZGXA 1ZS7A 1KWIA 1N5HA 2LYXA 4GHOA 3LOYA 1RHLA 1DMQA 1A2PA 1OUNA 2W03A 3BIRA 3B4OA 1Q9EA 2Y73A 2KXGA 1SIHA 3DM8A 3CCV3 1QVG2 1M9GA 1MGWA 3A76A 2GBXB 1Q864 1R4CA 3FGYA 4EV5A 1FUTA 3N9HA 1IVXA 3ZG5A 4HM3B 1IYYA 3HIIA 5KP4A 4AKZA 1N9EA 1RN7A 3E99A 2BMOB 3PZWA 4BTWA 1T5YA 5IEOA 3Q90A 2KF5A 3D3LA 5IG0A 5KP3A 4KFFA 4HM6B 3RGRA 3G713 4IIAA 4O3VA 4HM8B 2CKFB 1JN5A 1OGXA 2F4YA 1NDOB 3L0RA 4XBTA 1BNRA 5CLKA 4WYKB 2KF3A 1OHSA 3CNMA 3MWZA 4RNTA 1YGEA 1FZUA 2ZL8A 4H61A 3U1WA 2CK3H 2K54A 1GMPA 3DGLA 2KF4A 3DGYA 1BOXA 3CCS3 1BSEA 2FNQA 2XGNA 1W5ZA 1AV4A 1K28A 2RFRA 1MWUA 3BLZA 3EQQB 1GOYA 3F7SA 3FG1A 1FYSA 3WOEB 5BVBA 6GSPA 1R4YA 1JBTA 4FMAA 1TP6A 4K61A 1MNLA 1T2HA 1MGRA 3AGOA 3GWRA 4EBGA 1IK3A 2SBLA 3G6E3 2OOVC 4EC6A 5IG5A 1BRJA 1WMPA 2W56B 2IUJA 3NBBA 4BIRA 2HMJB 1SPUA 2I9WA 3MG2A 3RGAA 1MWSA 1WQLB 3D5IA 1LOVA 3DH2A 1JBRA 3ZG0A 1BNSA 1JZDA 2XFSA 1MWRA 2GU1A 2YX9A 4HYZA 3IPTA 4OK0A 2XH9A 4J8TA 3WR2A 4XM4A 1N8R4 1RGKA 3F7XA 3F9SA 1QALA 1G96A 3JUMA 4CJNA 3H3HA 3NUVA 1LVNA 1MWTA 4U13A 5DREA 5RNTA 1KQS2 4R9LA 2WGOA 1NO3A 1YJW3 4LSOA 4AKYA 3MG3A 1VQM3 1NNVA 2OTJ3 2CH9A 3K7CA 1LXEA 1I0VA 2HMKB 1PU4A 2H0GA 2P0MA 3VSYA 1LQMB 2B1XB 1B21A 2H0IA 1ASKA 1N5PA 3B8LA 4WP5A 2HMOB 3GRDA 3BNBA 3G8ZA 3G16A 1PFPA 3SXXA 4LZIA 4O2HA 4KFDA 2B24B 3QK9A 1BRSA 4N6V0 4CDLA 3FG4A 2KRTA 1GMRA 1W6YA 3MSOA 4N6UA 3FF2A 3S28A 1K734 2A15A 2D42A 1PY3A 1DVCA 4N6MA 2F5WA 3CC23 2O9UX 3BU4A 9RNTA 5I97A 5AIFA 5EVHA 3SOYA 1I70A 1JB5A 2K0MA 2GEXA 2KCDA 3DGMA 3MHEA 3SVAA 3V99A 3CCM3 3I563 1Y4KA 3I0YA 1SARA 4KVHA 1BNEA 1B2SA 3Q1CA 1AVKA 3AMOA 1STFI 1AY7A 1C7HA 2RGQA 3SOAA 5CF1A 5LC7A 1W01A 4OVMA 3N54B 4R1KA 4MMYB 3UB1A 3UJMA 2PZVA 2RNTA 3K63A 3BNEA 5TGNA 1TRPA 2OOVA 5HOHA 5AEWB 1IQXA 3EE1A 3LMLA 1JZOA 3CD63 3AHWA 1KC84 4HAAA 1BRHA 3OXAA 1WNHA 2JQ5A 2YFIB 4G1MB 3WA3A 1AR0A 1DMNA 4EW5A 3KKGA 1FA3A 5IENA 1A2VA 3OV4A 2BMQB 3HIGA 1EEJA 1M1K4 3B4PA 1F8NA 4X2HA 1OHPA 1G02A 1IT7A 1BSAA 1RGAA 1SQWA 2CHCA 4RBNA 1RTUA 3PCSA 1JKGB 4O02B 1GD4A 1LOWA 3K9MC 1CYUA 3Q2PA 1I2FA 1OPYA 1RMSA 2STDA 1I3FA 2LQVA 1RJOA 1SJWA 4ZM8A 5JPUA 1I2EA 2E2VA 2F86B 2QIYA 2KF6A 4N6NB 5GSPA 1ULJB 2Y74A 3DGOA 1RN4A 1GS3A 1UCIA 4HM1B 3WHOA 5BU4A 1D6UA 3KIIA 3IJEB 3CC73 1HYFA 3X3XA 3X3YA 1QAKA 2R41A 1AQZA 2YFJB 3PS8A 1U8CB 5G1KA 1RCKA 4K90B 5EQLA 3TDGA 1CH0A 2UGIA 3AHSA 4BL2A 1O7GB 1GOUA 5G1LA 1IVVA 3EB8A 1YNVX 2W2CA 2CFLA 1W4NA 1TU5A 2W9QA 1RDSA 1YIJ3 1UGHI 5IEPA 1S723 4BTXA 1VQN3 5M19A 2Z7AA 2GSPA 4EV2A 3D79A 4HZBB 7GSPA 3KFQC 1RGFA 1V58A 1DVDA 3DZLA 1D6ZA 3HX8A 2W56A 3GZBA 1V74A 4LYLB 4OUQA 3RNTA 1K9M4 4NREA 5IG3A 1VQ53 4HM2B 4HBRA 1UI7A 2CG1A 3BB9A 4FR9A 5FW5A 4XB5A 1LNHA 4MMZB 1OF5B 3LT8A 5AIIA 3U97A 1NJI4 1W7CA 5AYSC 1KSIA 3T8UA 1FUWA 3GSPA 1BRNL 3WA2X 1B27A 2RBIA 5D82A 3LTDA 1I8VA 3S67A 5BXQA 3MKIA 1DYUA 3NQYA 3KN4A 1A90A 1RSNA 1B3SA 1K41A 2PNCA 1OCVA 2IA7A 3WDGB 2HMMB 1VQ43 1ZO2A 1T3BA 1FGOA 1C54A 3S29A 1GY7A 1YGWA 3CCR3 1GMQA 2XGLA 4WHAA 2HMNB 1BNFA 3G0KA 3M8CA 5IERA 1IV7A 1M1XB 1Q42A 2BHMA 3CCJ3 3BNDA 1AVLA 1WMNA 2IY2A 1JB2A 3NHXA 2D1WA 1IT8A 1BRKA 1W00A 3K0ZA 3NV0B 1W2B2 1OHOA 1LNIA 2Q07A 1O7HB 1G0TA 1UI8A 4HOHA 3MPHA 3OWSA 2CG0A 2CFGA 2XSOB 1BIRA 2P38A 1BUJA 2CFWA 1ZX2A 1RRLA 1X1WA 2AAEA 3DXOA 3BNCA 3F8HA 2F98A 1EUIC 4GB5A 4FMDA 4Q53A 3HZPA 1JRQA 2XSHB 5HGRA 2OQEC 4BL3A 2MF7A 1BSBA 3D4AA 3EX9A 4IT7A 2XF3A 4MEIA 1T2IA 3DY5A 1UCJA 2XRXB 1UCLA 4HM4B 4N6OB 4KFEA 4CPKA 1Q7Y4 1RCLA 3CC43 3NBJA 1HZ1A 2IMJA 3CNXA 3EN8A 3CCE3 1QVF2 5AIHA 4XBYA 3CXC2 1FW7A 1UUWB 2K3DA 3F8XA 1VQP3 1UUVB 1VQK3 2FXTA 1WTHA 4JRFA 4HJLB 3D5GA 1PYLA 1X1YA 2F99A 3LZAA 2M7OA 3EC9A 1RGEA 1E97A 3UL6A 3ZFZA 1LQGC 1OGZA 1Q40B 3FKAA 3Q3FA 4N3VA 2CWVA 3ROBA 3X42A 3JUPA 1D6YA 5AEUB 5ELUA 1LOYA 1SIIA 1UW1A 1O7NB 1RGGA 2L4VA 3PYJA 4LGQA 1NWWA 1RN1A 3LTAA 2GBWB 2CWUA 1VQ63 3V92A 1DMMA 2CWTA 4R4KA 2XR8B 5IG4A 3PGBA 3OWYA 1CQSA 1ROVA 4HVNA 5CXOA 2WGQA 2BIRA 3JUNA 1EG9B 3B7CA 7RNTA 2ML6A 1NU3A 3MG1A 1L5GB 2Z77A 5A0OB 3EBTA 1DE3A 3EF8A 3KCHA 1BU4A 3HK4A 3PXMA 5LC6A 1UGIA 2KAAA 4RNZA 4QWTA 3NM7A 5D81A 1TUHA 1TFOA 3QRDA 5IF6A 1VQ93 4J5KA 2E2UA 1O7PB 1JV2B 3FF0A 2IUKA 4GL6A 1GY5A 3KE7A 4IPBA 3ECFA 4PEJA 3KZTA 4CCVA 4L7KA 1UUGB 3K5TA 2P0XA 1LRAA 4XDVA 3EJVA 4R80A 1YJN3 1K8A4 1E3RA 1A2KA 1FUSA 2CFKA 3EN1B 2SARA 1CYVA 2XFTA 2UX0A 4AEQA 1IU7A 1W02A 1B20A 1W6CA 2BNGA 2IYJA 4WYKA 1S5AA 3JUQA 5KP1A 3HOHA 1BNJA 3LH4A 3D9RA 4J5GA 1B2MA 3FH1A 1IQ8A 1BNIA 1OACA 3RDEA 4JF8A 3VF1A 2BMRB 1OH0A 2R4IA 1BGSA 2ZDJA 2WOFA 2E2TA 3F40A 1FGQA 1HKXA 2C11A 1V57A 2OQEA 4BU4A 1E3VA 1O7WB 1WMOA 3WODG 3X40A 4DKIA 1RNBA 3DMCA 4XDWA 1YIT3 3UL5A 2GXFA 3OX9A 4X2OA 3MYTA 4ORLA 3AGNA 1ISKA 3JVCA 3JUOA 1FGMA 1W2ZA 1IVUA 3HI7A 2OWPA 1RKYA 2BO9B 3GZRA 3CPOA 4EYCA 1EQKA 1JB4A 1OF5A 1QAFA 3CU3A 1ROAA 1TTOA 1JN5B 1LOXA 4HZ9B 4I5QA 3UNLA 1VQQA 1GYBA 1N8QA 1RGLA 1TFKA 1IVWA 1X1XA 2F5MA 1BAOA 3CCL3 3NXJA 3S27A 5FGOA 3V98A 8CHOA 3CME3 3I553
chains in the Genus database with same CATH topology
3VGNA 2WO0A 3DUKA 5G2GA 3GZYB 4H3UA 1QMAA 2RCDA 4WWUC 1VQ73 4TX4A 4R9KA 3EHCA 1JJ22 3FLJA 1VZZA 3SLUA 1Q814 1RRHA 2OCTA 4NHFA 4HM7B 2MC8A 5AYRB 1HU9A 3DGNA 3NM2A 1N9JA 2GU3A 4FMBA 3NV0A 4RZMA 5DRVA 3OWUA 4FCZA 4FCJA 1NB3I 2CFDA 4LMIA 1Q824 4HM5B 1YJ93 1A67A 4BTYA 2P05A 5CK6A 1ULIB 4FMCA 3T8NA 3LTBA 2O3OA 3KSED 3KSPA 3GAXA 2W04A 4N6LA 1FGRA 1EKMA 1FGTA 1TIJA 3SX1A 4K1UA 1U5OA 1JNQA 1Z1SA 2CC3A 4WFOA 4XBXA 3LYGA 5EEOA 2GEYA 4J9AA 4K1VA 3WOFB 1QJGA 3J7Yd 1W6GA 3N8BA 4L8PA 5AIGA 5AI1A 5JBSA 1IDPA 1YHQ3 3ALAA 2Z76A 1Q40A 3S5CA 3CPW2 4EXRA 2QGUA 3GZXB 6STDA 5IW9A 1KD14 4LEHA 2RSXA 1STDA 1M904 2ML5A 3T0UA 3CCU3 2W9PA 1J2BA 4MJDA 1EA2A 4RNYA 1NB5I 1VQL3 4KZ1A 3EBYA 7STDA 4FCMA 3LXUX 4L8OA 3PCRA 3STDA 3X41A 3CCQ3 3NX0A 5CF2A 3FCSB 3H51A 1CEWI 1US1A 1BUQA 3NQZA 2V1LA 5D83A 2QA43 4N6TA 4HKVB 2HMLB 2CIUA 1GD3A 3IMAB 3OW22 1JKGA 2CW9A 3SEDA 4O8SA 5JPPA 3AMOB 3LT9A 2OTL3 2Z6BA 4HM0B 1GY6A 2QEX3 2W0QA 4STDA 3NBRA 4MMXB 1YI23 3FSDA 1VQ83 1IV9A 1O7MB 2FGTA 3X3ZA 3LTCA 2JDIH 3CMA3 5STDA 2INXA 3G4S3 1YVBI 1VQO3 1IQYA 2XEPA 2WOHA 3ER7A 3O8YA 2BT3A 5ELJA 3FZWA 2P09A 3F14A 3WMDA 1MOLA 2C10A 2YFLB 3FG3A 2W6JH 4I4KA 1KWIA 1N5HA 2LYXA 3LOYA 1DMQA 1OUNA 2W03A 3B4OA 2Y73A 2KXGA 1SIHA 3DM8A 3CCV3 1QVG2 1M9GA 3A76A 2GBXB 1Q864 1R4CA 3FGYA 4EV5A 3N9HA 1IVXA 4HM3B 3HIIA 5KP4A 4AKZA 1N9EA 1RN7A 3E99A 2BMOB 3PZWA 4BTWA 1T5YA 5IEOA 3Q90A 3D3LA 5IG0A 5KP3A 4KFFA 4HM6B 3RGRA 3G713 4IIAA 4O3VA 4HM8B 2CKFB 1JN5A 1OGXA 1NDOB 3L0RA 4XBTA 5CLKA 4WYKB 1OHSA 3CNMA 3MWZA 1YGEA 2ZL8A 4H61A 3U1WA 2CK3H 2K54A 3DGLA 3CCS3 2FNQA 2XGNA 1W5ZA 1AV4A 1K28A 2RFRA 3BLZA 3EQQB 3F7SA 3FG1A 3WOEB 5BVBA 4FMAA 1TP6A 4K61A 1MNLA 3GWRA 4EBGA 1IK3A 2SBLA 3G6E3 2OOVC 4EC6A 5IG5A 1WMPA 2W56B 2IUJA 3NBBA 2HMJB 1SPUA 2I9WA 3MG2A 3RGAA 1WQLB 2XFSA 2GU1A 2YX9A 4HYZA 3IPTA 4OK0A 2XH9A 4J8TA 4XM4A 1N8R4 3F7XA 3F9SA 1QALA 1G96A 3JUMA 3H3HA 3NUVA 1LVNA 5DREA 4U13A 1KQS2 4R9LA 2WGOA 1NO3A 1YJW3 4LSOA 4AKYA 3MG3A 1VQM3 2OTJ3 2CH9A 3K7CA 1LXEA 2HMKB 1PU4A 2P0MA 3VSYA 2B1XB 1ASKA 1N5PA 3B8LA 4WP5A 2HMOB 3GRDA 3BNBA 3G8ZA 3G16A 1PFPA 3SXXA 4LZIA 4O2HA 4KFDA 2B24B 3QK9A 4N6V0 4CDLA 3FG4A 2KRTA 1W6YA 3MSOA 4N6UA 3FF2A 3S28A 1K734 2A15A 2D42A 1DVCA 4N6MA 3CC23 2O9UX 5I97A 5AIFA 5EVHA 3SOYA 2K0MA 1JB5A 2GEXA 2KCDA 3DGMA 3MHEA 3SVAA 3V99A 3CCM3 3I563 1Y4KA 3I0YA 4KVHA 3Q1CA 3AMOA 1AVKA 1STFI 2RGQA 1C7HA 3SOAA 5CF1A 5LC7A 1W01A 4OVMA 3N54B 4R1KA 4MMYB 3UB1A 3UJMA 2PZVA 3K63A 3BNEA 5TGNA 2OOVA 5AEWB 1IQXA 3EE1A 3LMLA 3CD63 1KC84 3OXAA 1WNHA 2JQ5A 2YFIB 4G1MB 3WA3A 1AR0A 1DMNA 3KKGA 1FA3A 5IENA 1A2VA 3OV4A 2BMQB 3HIGA 1M1K4 3B4PA 1F8NA 4X2HA 1OHPA 1IT7A 1SQWA 2CHCA 4RBNA 3PCSA 1JKGB 4O02B 1GD4A 3K9MC 1CYUA 3Q2PA 1OPYA 2STDA 2LQVA 1RJOA 1SJWA 4ZM8A 5JPUA 2E2VA 2F86B 2QIYA 4N6NB 1ULJB 2Y74A 3DGOA 1GS3A 4HM1B 1D6UA 3KIIA 3IJEB 3CC73 3X3XA 3X3YA 1QAKA 2YFJB 3PS8A 1U8CB 3TDGA 4K90B 5EQLA 1O7GB 1IVVA 3EB8A 2W2CA 2CFLA 1W4NA 1TU5A 2W9QA 1YIJ3 5IEPA 1S723 4BTXA 1VQN3 2Z7AA 4EV2A 4HZBB 3KFQC 1DVDA 3DZLA 1D6ZA 3HX8A 2W56A 3GZBA 1V74A 4OUQA 1K9M4 4NREA 5IG3A 1VQ53 4HM2B 4HBRA 1UI7A 2CG1A 3BB9A 4FR9A 5FW5A 4XB5A 1LNHA 4MMZB 1OF5B 3LT8A 5AIIA 3U97A 1NJI4 1W7CA 5AYSC 1KSIA 3T8UA 1FUWA 3WA2X 5D82A 3LTDA 3S67A 5BXQA 3MKIA 1DYUA 3NQYA 3KN4A 1A90A 1K41A 2PNCA 1OCVA 2IA7A 3WDGB 2HMMB 1VQ43 1ZO2A 1FGOA 3S29A 1GY7A 3CCR3 2XGLA 4WHAA 2HMNB 3G0KA 3M8CA 5IERA 1IV7A 1M1XB 1Q42A 2BHMA 3CCJ3 3BNDA 1AVLA 1WMNA 1JB2A 3NHXA 2D1WA 1IT8A 1W00A 3K0ZA 3NV0B 1W2B2 1OHOA 2Q07A 1O7HB 1UI8A 3MPHA 3OWSA 2CG0A 2CFGA 2XSOB 2P38A 2CFWA 1ZX2A 1RRLA 3DXOA 3BNCA 3F8HA 2F98A 4GB5A 4FMDA 4Q53A 3HZPA 1JRQA 2XSHB 5HGRA 2OQEC 2MF7A 3EX9A 4IT7A 2XF3A 4MEIA 3DY5A 4N6OB 2XRXB 4HM4B 3CC43 4KFEA 1Q7Y4 3NBJA 3EN8A 2IMJA 3CNXA 3CCE3 1QVF2 5AIHA 4XBYA 3CXC2 1UUWB 3F8XA 1VQP3 1UUVB 1VQK3 2FXTA 1WTHA 4JRFA 4HJLB 2F99A 3LZAA 2M7OA 3EC9A 1E97A 3UL6A 1OGZA 3ROBA 1Q40B 3FKAA 4N3VA 3X42A 2CWVA 3JUPA 1D6YA 5AEUB 5ELUA 1SIIA 1UW1A 1O7NB 2L4VA 3PYJA 4LGQA 1NWWA 3LTAA 2GBWB 2CWUA 1VQ63 3V92A 1DMMA 2CWTA 4R4KA 2XR8B 5IG4A 3PGBA 3OWYA 1CQSA 1ROVA 4HVNA 5CXOA 2WGQA 3JUNA 1EG9B 3B7CA 2ML6A 1NU3A 3MG1A 1L5GB 2Z77A 5A0OB 3EBTA 3EF8A 3HK4A 3PXMA 5LC6A 4RNZA 4QWTA 3NM7A 5D81A 1TUHA 1TFOA 3QRDA 5IF6A 1VQ93 2E2UA 1O7PB 1JV2B 3FF0A 2IUKA 4GL6A 1GY5A 3KE7A 4IPBA 3ECFA 4PEJA 3KZTA 4CCVA 4L7KA 3K5TA 2P0XA 4XDVA 3EJVA 4R80A 1YJN3 1K8A4 1E3RA 1A2KA 3EN1B 2CFKA 1CYVA 2XFTA 2UX0A 4AEQA 1IU7A 1W02A 1W6CA 2BNGA 4WYKA 1S5AA 3JUQA 5KP1A 3LH4A 3D9RA 3FH1A 1IQ8A 1OACA 3RDEA 4JF8A 3VF1A 2BMRB 1OH0A 2R4IA 2ZDJA 2WOFA 2E2TA 3F40A 1FGQA 1HKXA 2C11A 2OQEA 1E3VA 1O7WB 1WMOA 3WODG 3X40A 3DMCA 4XDWA 1YIT3 3UL5A 2GXFA 3OX9A 4X2OA 3MYTA 4ORLA 1ISKA 3JVCA 3JUOA 1FGMA 1W2ZA 1IVUA 3HI7A 2OWPA 1RKYA 2BO9B 3GZRA 3CPOA 4EYCA 1EQKA 1JB4A 1OF5A 1QAFA 3CU3A 1ROAA 1JN5B 1LOXA 4HZ9B 3UNLA 1GYBA 1N8QA 1TFKA 1IVWA 3CCL3 3NXJA 3S27A 5FGOA 3V98A 8CHOA 3CME3 3I553
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGN A;  3DUK A;  5G2G A;  3GZY B;  4H3U A;  1QMA A;  2RCD A;  4WWU C;  4R9K A;  3EHC A;  3FLJ A;  1VZZ A;  4HM7 B;  3NM2 A;  3NV0 A;  4RZM A;  5DRV A;  3OWU A;  4FCJ A;  4LMI A;  4HM5 B;  5CK6 A;  1ULI B;  3T8N A;  3KSP A;  4K1U A;  1U5O A;  1Z1S A;  4XBX A;  3LYG A;  2GEY A;  4J9A A;  4K1V A;  1QJG A;  4L8P A;  5AIG A;  5AI1 A;  1IDP A;  2Z76 A;  1Q40 A;  3S5C A;  2QGU A;  3GZX B;  6STD A;  4LEH A;  1STD A;  4MJD A;  1EA2 A;  3EBY A;  7STD A;  4FCM A;  4L8O A;  3STD A;  5CF2 A;  3H51 A;  1BUQ A;  5D83 A;  4HKV B;  2HML B;  1JKG A;  3SED A;  5JPP A;  4HM0 B;  1GY6 A;  4STD A;  3NBR A;  3FSD A;  1O7M B;  5STD A;  2INX A;  3ER7 A;  3FZW A;  3F14 A;  3WMD A;  2YFL B;  4I4K A;  1DMQ A;  1OUN A;  3B4O A;  3DM8 A;  3A76 A;  2GBX B;  3FGY A;  4HM3 B;  5KP4 A;  3E99 A;  2BMO B;  5IEO A;  3Q90 A;  5IG0 A;  5KP3 A;  3RGR A;  4HM6 B;  4IIA A;  4HM8 B;  2CKF B;  1JN5 A;  1OGX A;  1NDO B;  4XBT A;  5CLK A;  4WYK B;  1OHS A;  3CNM A;  2K54 A;  3BLZ A;  2RFR A;  3EQQ B;  3F7S A;  5BVB A;  1TP6 A;  3GWR A;  5IG5 A;  2HMJ B;  2I9W A;  3MG2 A;  3RGA A;  1WQL B;  3IPT A;  4J8T A;  4XM4 A;  3F7X A;  3F9S A;  3JUM A;  3H3H A;  3NUV A;  5DRE A;  4U13 A;  4R9L A;  3MG3 A;  3K7C A;  2HMK B;  3VSY A;  2B1X B;  1ASK A;  3B8L A;  4WP5 A;  2HMO B;  3GRD A;  3G8Z A;  3G16 A;  2B24 B;  4CDL A;  1W6Y A;  3MSO A;  3FF2 A;  2A15 A;  5AIF A;  5EVH A;  3SOY A;  1JB5 A;  2GEX A;  3MHE A;  3I0Y A;  4KVH A;  2RGQ A;  1C7H A;  3SOA A;  5CF1 A;  1W01 A;  4OVM A;  4R1K A;  3UJM A;  2PZV A;  5TGN A;  5AEW B;  3OXA A;  2JQ5 A;  2YFI B;  1AR0 A;  1DMN A;  3KKG A;  5IEN A;  3OV4 A;  2BMQ B;  3B4P A;  4X2H A;  1OHP A;  2CHC A;  1JKG B;  1OPY A;  2STD A;  1SJW A;  5JPU A;  2F86 B;  2QIY A;  1ULJ B;  1GS3 A;  4HM1 B;  2YFJ B;  1O7G B;  2W2C A;  5IEP A;  2Z7A A;  4HZB B;  3DZL A;  3HX8 A;  3GZB A;  4OUQ A;  5IG3 A;  4HM2 B;  3BB9 A;  5FW5 A;  4XB5 A;  1OF5 B;  5AII A;  3T8U A;  5D82 A;  5BXQ A;  3MKI A;  1K41 A;  1OCV A;  2HMM B;  1ZO2 A;  1GY7 A;  2HMN B;  3G0K A;  3M8C A;  5IER A;  1Q42 A;  1JB2 A;  3NHX A;  1W00 A;  3K0Z A;  3NV0 B;  1OHO A;  1O7H B;  3OWS A;  2XSO B;  1ZX2 A;  3DXO A;  3F8H A;  2F98 A;  4GB5 A;  4Q53 A;  3HZP A;  2XSH B;  5HGR A;  3EX9 A;  2XRX B;  4HM4 B;  3EN8 A;  2IMJ A;  3CNX A;  5AIH A;  4XBY A;  1UUW B;  3F8X A;  1UUV B;  4HJL B;  2F99 A;  3LZA A;  3EC9 A;  1E97 A;  1OGZ A;  3ROB A;  1Q40 B;  3FKA A;  4N3V A;  3JUP A;  5AEU B;  1O7N B;  4LGQ A;  1NWW A;  2GBW B;  1DMM A;  2XR8 B;  5IG4 A;  3OWY A;  1CQS A;  4HVN A;  5CXO A;  3JUN A;  1EG9 B;  3B7C A;  1NU3 A;  3MG1 A;  2Z77 A;  3EBT A;  3EF8 A;  3HK4 A;  5D81 A;  1TUH A;  5IF6 A;  1O7P B;  3FF0 A;  1GY5 A;  3KE7 A;  4PEJ A;  3ECF A;  3KZT A;  4L7K A;  4XDV A;  3EJV A;  1E3R A;  1A2K A;  3EN1 B;  2UX0 A;  1W02 A;  2BNG A;  4WYK A;  1S5A A;  3JUQ A;  5KP1 A;  3D9R A;  3FH1 A;  2BMR B;  1OH0 A;  2R4I A;  3F40 A;  1HKX A;  1E3V A;  1O7W B;  3DMC A;  4XDW A;  2GXF A;  3OX9 A;  4X2O A;  3MYT A;  4ORL A;  1ISK A;  3JUO A;  2OWP A;  3GZR A;  3CPO A;  1JB4 A;  1OF5 A;  3CU3 A;  1JN5 B;  3UNL A;  4HZ9 B;  1GYB A;  3NXJ A;  8CHO A; 
#chains in the Genus database with same CATH topology
 1JBS A;  3VGN A;  1BRI A;  2WO0 A;  3DUK A;  3SYU A;  5G2G A;  3GZY B;  4H3U A;  1QMA A;  2RCD A;  4WWU C;  1VQ7 3;  4TX4 A;  4R9K A;  3EHC A;  1JJ2 2;  1GSP A;  3FLJ A;  1VZZ A;  3SLU A;  2J8X B;  1Q81 4;  1UDI I;  1RRH A;  2CX1 A;  2OCT A;  4KT3 B;  1RNT A;  4NHF A;  4HM7 B;  1TJD A;  2MC8 A;  3URP A;  5AYR B;  1HU9 A;  3DGN A;  3NM2 A;  1N9J A;  2GU3 A;  4FMB A;  3NV0 A;  4RZM A;  2AAD A;  5DRV A;  3A5E A;  3OWU A;  4FCZ A;  4FCJ A;  5M1A A;  1NB3 I;  2CFD A;  4LMI A;  1Q82 4;  2UUG C;  4HM5 B;  1BRG A;  1YJ9 3;  1A67 A;  4BTY A;  2P05 A;  5CK6 A;  2L1S A;  1ULI B;  1I2G A;  2BU4 A;  4FMC A;  3T8N A;  3LTB A;  2O3O A;  3KSE D;  3KSP A;  3GAX A;  1X1U A;  2W04 A;  4N6L A;  1TRQ A;  1FGR A;  1EKM A;  1FGT A;  1TIJ A;  1I0X A;  1RGC A;  4K1U A;  1U5O A;  3SX1 A;  5BIR A;  1I3I A;  1JNQ A;  1Z1S A;  2CC3 A;  4WFO A;  4XBX A;  3LYG A;  1RLS A;  5EEO A;  2HOH A;  2GEY A;  4J9A A;  4K1V A;  3WOF B;  1QJG A;  3J7Y d;  1BSC A;  1W6G A;  3N8B A;  1YVS A;  4L8P A;  5AIG A;  5AI1 A;  5JBS A;  1IDP A;  1YHQ 3;  3ALA A;  2Z76 A;  1Q40 A;  3S5C A;  3CPW 2;  4EXR A;  2QGU A;  3GZX B;  6STD A;  5IW9 A;  2H0H A;  1KD1 4;  4LEH A;  2RSX A;  1STD A;  1M90 4;  2ML5 A;  3T0U A;  1GOV A;  3CCU 3;  2W9P A;  1J2B A;  4MJD A;  1EA2 A;  4RNY A;  1NB5 I;  1VQL 3;  1DET A;  2F56 A;  3EBY A;  4KZ1 A;  2CX0 A;  5M18 A;  7STD A;  4FCM A;  3LXU X;  4L8O A;  1BSD A;  3PCR A;  3STD A;  3X41 A;  1Q7H A;  3CCQ 3;  3NX0 A;  5CF2 A;  3FCS B;  3H51 A;  1CEW I;  1US1 A;  2ZA4 A;  1BAN A;  4NPB A;  1BUQ A;  3NQZ A;  2V1L A;  5D83 A;  2QA4 3;  1BVI A;  4N6T A;  1B2U A;  4HKV B;  4GSP A;  6RNT A;  2HML B;  2CIU A;  1GD3 A;  1RGH A;  3IMA B;  1JKG A;  1UCK A;  3OW2 2;  2C4B A;  2CW9 A;  3SED A;  4O8S A;  5JPP A;  3AMO B;  3LT9 A;  8RNT A;  2Z6B A;  4HM0 B;  1GY6 A;  2OTL 3;  2QEX 3;  2W0Q A;  4ILF A;  4STD A;  3NBR A;  4MMX B;  1YI2 3;  3FSD A;  1VQ8 3;  1IV9 A;  1O7M B;  2FGT A;  3X3Z A;  3LTC A;  1B2X A;  2JDI H;  3CMA 3;  1B2Z A;  5STD A;  2INX A;  3G4S 3;  1YVB I;  1VQO 3;  1IQY A;  2WOH A;  2XEP A;  3ER7 A;  1BNG A;  2BT3 A;  3O8Y A;  5ELJ A;  3FZW A;  2P09 A;  2ZHX B;  3F14 A;  3WMD A;  1MOL A;  2C10 A;  2YFL B;  3FG3 A;  2W6J H;  4I4K A;  1ZGX A;  1ZS7 A;  1KWI A;  1N5H A;  2LYX A;  4GHO A;  3LOY A;  1RHL A;  1DMQ A;  1A2P A;  1OUN A;  2W03 A;  3BIR A;  3B4O A;  1Q9E A;  2Y73 A;  2KXG A;  1SIH A;  3DM8 A;  3CCV 3;  1QVG 2;  1M9G A;  1MGW A;  3A76 A;  2GBX B;  1Q86 4;  1R4C A;  3FGY A;  4EV5 A;  1FUT A;  3N9H A;  1IVX A;  3ZG5 A;  4HM3 B;  1IYY A;  3HII A;  5KP4 A;  4AKZ A;  1N9E A;  1RN7 A;  3E99 A;  2BMO B;  3PZW A;  4BTW A;  1T5Y A;  5IEO A;  3Q90 A;  2KF5 A;  3D3L A;  5IG0 A;  5KP3 A;  4KFF A;  4HM6 B;  3RGR A;  3G71 3;  4IIA A;  4O3V A;  4HM8 B;  2CKF B;  1JN5 A;  1OGX A;  2F4Y A;  1NDO B;  3L0R A;  4XBT A;  1BNR A;  5CLK A;  4WYK B;  2KF3 A;  1OHS A;  3CNM A;  3MWZ A;  4RNT A;  1YGE A;  1FZU A;  2ZL8 A;  4H61 A;  3U1W A;  2CK3 H;  2K54 A;  1GMP A;  3DGL A;  2KF4 A;  3DGY A;  1BOX A;  3CCS 3;  1BSE A;  2FNQ A;  2XGN A;  1W5Z A;  1AV4 A;  1K28 A;  2RFR A;  1MWU A;  3BLZ A;  3EQQ B;  1GOY A;  3F7S A;  3FG1 A;  1FYS A;  3WOE B;  5BVB A;  6GSP A;  1R4Y A;  1JBT A;  4FMA A;  1TP6 A;  4K61 A;  1MNL A;  1T2H A;  1MGR A;  3AGO A;  3GWR A;  4EBG A;  1IK3 A;  2SBL A;  3G6E 3;  2OOV C;  4EC6 A;  5IG5 A;  1BRJ A;  1WMP A;  2W56 B;  2IUJ A;  3NBB A;  4BIR A;  2HMJ B;  1SPU A;  2I9W A;  3MG2 A;  3RGA A;  1MWS A;  1WQL B;  3D5I A;  1LOV A;  3DH2 A;  1JBR A;  3ZG0 A;  1BNS A;  1JZD A;  2XFS A;  1MWR A;  2GU1 A;  2YX9 A;  4HYZ A;  3IPT A;  4OK0 A;  2XH9 A;  4J8T A;  3WR2 A;  4XM4 A;  1N8R 4;  1RGK A;  3F7X A;  3F9S A;  1QAL A;  1G96 A;  3JUM A;  4CJN A;  3H3H A;  3NUV A;  1LVN A;  1MWT A;  4U13 A;  5DRE A;  5RNT A;  1KQS 2;  4R9L A;  2WGO A;  1NO3 A;  1YJW 3;  4LSO A;  4AKY A;  3MG3 A;  1VQM 3;  1NNV A;  2OTJ 3;  2CH9 A;  3K7C A;  1LXE A;  1I0V A;  2HMK B;  1PU4 A;  2H0G A;  2P0M A;  3VSY A;  1LQM B;  2B1X B;  1B21 A;  2H0I A;  1ASK A;  1N5P A;  3B8L A;  4WP5 A;  2HMO B;  3GRD A;  3BNB A;  3G8Z A;  3G16 A;  1PFP A;  3SXX A;  4LZI A;  4O2H A;  4KFD A;  2B24 B;  3QK9 A;  1BRS A;  4N6V 0;  4CDL A;  3FG4 A;  2KRT A;  1GMR A;  1W6Y A;  3MSO A;  4N6U A;  3FF2 A;  3S28 A;  1K73 4;  2A15 A;  2D42 A;  1PY3 A;  1DVC A;  4N6M A;  2F5W A;  3CC2 3;  2O9U X;  3BU4 A;  9RNT A;  5I97 A;  5AIF A;  5EVH A;  3SOY A;  1I70 A;  1JB5 A;  2K0M A;  2GEX A;  2KCD A;  3DGM A;  3MHE A;  3SVA A;  3V99 A;  3CCM 3;  3I56 3;  1Y4K A;  3I0Y A;  1SAR A;  4KVH A;  1BNE A;  1B2S A;  3Q1C A;  1AVK A;  3AMO A;  1STF I;  1AY7 A;  1C7H A;  2RGQ A;  3SOA A;  5CF1 A;  5LC7 A;  1W01 A;  4OVM A;  3N54 B;  4R1K A;  4MMY B;  3UB1 A;  3UJM A;  2PZV A;  2RNT A;  3K63 A;  3BNE A;  5TGN A;  1TRP A;  2OOV A;  5HOH A;  5AEW B;  1IQX A;  3EE1 A;  3LML A;  1JZO A;  3CD6 3;  3AHW A;  1KC8 4;  4HAA A;  1BRH A;  3OXA A;  1WNH A;  2JQ5 A;  2YFI B;  4G1M B;  3WA3 A;  1AR0 A;  1DMN A;  4EW5 A;  3KKG A;  1FA3 A;  5IEN A;  1A2V A;  3OV4 A;  2BMQ B;  3HIG A;  1EEJ A;  1M1K 4;  3B4P A;  1F8N A;  4X2H A;  1OHP A;  1G02 A;  1IT7 A;  1BSA A;  1RGA A;  1SQW A;  2CHC A;  4RBN A;  1RTU A;  3PCS A;  1JKG B;  4O02 B;  1GD4 A;  1LOW A;  3K9M C;  1CYU A;  3Q2P A;  1I2F A;  1OPY A;  1RMS A;  2STD A;  1I3F A;  2LQV A;  1RJO A;  1SJW A;  4ZM8 A;  5JPU A;  1I2E A;  2E2V A;  2F86 B;  2QIY A;  2KF6 A;  4N6N B;  5GSP A;  1ULJ B;  2Y74 A;  3DGO A;  1RN4 A;  1GS3 A;  1UCI A;  4HM1 B;  3WHO A;  5BU4 A;  1D6U A;  3KII A;  3IJE B;  3CC7 3;  1HYF A;  3X3X A;  3X3Y A;  1QAK A;  2R41 A;  1AQZ A;  2YFJ B;  3PS8 A;  1U8C B;  5G1K A;  1RCK A;  4K90 B;  5EQL A;  3TDG A;  1CH0 A;  2UGI A;  3AHS A;  4BL2 A;  1O7G B;  1GOU A;  5G1L A;  1IVV A;  3EB8 A;  1YNV X;  2W2C A;  2CFL A;  1W4N A;  1TU5 A;  2W9Q A;  1RDS A;  1YIJ 3;  1UGH I;  5IEP A;  1S72 3;  4BTX A;  1VQN 3;  5M19 A;  2Z7A A;  2GSP A;  4EV2 A;  3D79 A;  4HZB B;  7GSP A;  3KFQ C;  1RGF A;  1V58 A;  1DVD A;  3DZL A;  1D6Z A;  3HX8 A;  2W56 A;  3GZB A;  1V74 A;  4LYL B;  4OUQ A;  3RNT A;  1K9M 4;  4NRE A;  5IG3 A;  1VQ5 3;  4HM2 B;  4HBR A;  1UI7 A;  2CG1 A;  3BB9 A;  4FR9 A;  5FW5 A;  4XB5 A;  1LNH A;  4MMZ B;  1OF5 B;  3LT8 A;  5AII A;  3U97 A;  1NJI 4;  1W7C A;  5AYS C;  1KSI A;  3T8U A;  1FUW A;  3GSP A;  1BRN L;  3WA2 X;  1B27 A;  2RBI A;  5D82 A;  3LTD A;  1I8V A;  3S67 A;  5BXQ A;  3MKI A;  1DYU A;  3NQY A;  3KN4 A;  1A90 A;  1RSN A;  1B3S A;  1K41 A;  2PNC A;  1OCV A;  2IA7 A;  3WDG B;  2HMM B;  1VQ4 3;  1ZO2 A;  1T3B A;  1FGO A;  1C54 A;  3S29 A;  1GY7 A;  1YGW A;  3CCR 3;  1GMQ A;  2XGL A;  4WHA A;  2HMN B;  1BNF A;  3G0K A;  3M8C A;  5IER A;  1IV7 A;  1M1X B;  1Q42 A;  2BHM A;  3CCJ 3;  3BND A;  1AVL A;  1WMN A;  2IY2 A;  1JB2 A;  3NHX A;  2D1W A;  1IT8 A;  1BRK A;  1W00 A;  3K0Z A;  3NV0 B;  1W2B 2;  1OHO A;  1LNI A;  2Q07 A;  1O7H B;  1G0T A;  1UI8 A;  4HOH A;  3MPH A;  3OWS A;  2CG0 A;  2CFG A;  2XSO B;  1BIR A;  2P38 A;  1BUJ A;  2CFW A;  1ZX2 A;  1RRL A;  1X1W A;  2AAE A;  3DXO A;  3BNC A;  3F8H A;  2F98 A;  1EUI C;  4GB5 A;  4FMD A;  4Q53 A;  3HZP A;  1JRQ A;  2XSH B;  5HGR A;  2OQE C;  4BL3 A;  2MF7 A;  1BSB A;  3D4A A;  3EX9 A;  4IT7 A;  2XF3 A;  4MEI A;  1T2I A;  3DY5 A;  1UCJ A;  2XRX B;  1UCL A;  4HM4 B;  4N6O B;  4KFE A;  4CPK A;  1Q7Y 4;  1RCL A;  3CC4 3;  3NBJ A;  1HZ1 A;  2IMJ A;  3CNX A;  3EN8 A;  3CCE 3;  1QVF 2;  5AIH A;  4XBY A;  3CXC 2;  1FW7 A;  1UUW B;  2K3D A;  3F8X A;  1VQP 3;  1UUV B;  1VQK 3;  2FXT A;  1WTH A;  4JRF A;  4HJL B;  3D5G A;  1PYL A;  1X1Y A;  2F99 A;  3LZA A;  2M7O A;  3EC9 A;  1RGE A;  1E97 A;  3UL6 A;  3ZFZ A;  1LQG C;  1OGZ A;  1Q40 B;  3FKA A;  3Q3F A;  4N3V A;  2CWV A;  3ROB A;  3X42 A;  3JUP A;  1D6Y A;  5AEU B;  5ELU A;  1LOY A;  1SII A;  1UW1 A;  1O7N B;  1RGG A;  2L4V A;  3PYJ A;  4LGQ A;  1NWW A;  1RN1 A;  3LTA A;  2GBW B;  2CWU A;  1VQ6 3;  3V92 A;  1DMM A;  2CWT A;  4R4K A;  2XR8 B;  5IG4 A;  3PGB A;  3OWY A;  1CQS A;  1ROV A;  4HVN A;  5CXO A;  2WGQ A;  2BIR A;  3JUN A;  1EG9 B;  3B7C A;  7RNT A;  2ML6 A;  1NU3 A;  3MG1 A;  1L5G B;  2Z77 A;  5A0O B;  3EBT A;  1DE3 A;  3EF8 A;  3KCH A;  1BU4 A;  3HK4 A;  3PXM A;  5LC6 A;  1UGI A;  2KAA A;  4RNZ A;  4QWT A;  3NM7 A;  5D81 A;  1TUH A;  1TFO A;  3QRD A;  5IF6 A;  1VQ9 3;  4J5K A;  2E2U A;  1O7P B;  1JV2 B;  3FF0 A;  2IUK A;  4GL6 A;  1GY5 A;  3KE7 A;  4IPB A;  3ECF A;  4PEJ A;  3KZT A;  4CCV A;  4L7K A;  1UUG B;  3K5T A;  2P0X A;  1LRA A;  4XDV A;  3EJV A;  4R80 A;  1YJN 3;  1K8A 4;  1E3R A;  1A2K A;  1FUS A;  2CFK A;  3EN1 B;  2SAR A;  1CYV A;  2XFT A;  2UX0 A;  4AEQ A;  1IU7 A;  1W02 A;  1B20 A;  1W6C A;  2BNG A;  2IYJ A;  4WYK A;  1S5A A;  3JUQ A;  5KP1 A;  3HOH A;  1BNJ A;  3LH4 A;  3D9R A;  4J5G A;  1B2M A;  3FH1 A;  1IQ8 A;  1BNI A;  1OAC A;  3RDE A;  4JF8 A;  3VF1 A;  2BMR B;  1OH0 A;  2R4I A;  1BGS A;  2ZDJ A;  2WOF A;  2E2T A;  3F40 A;  1FGQ A;  1HKX A;  2C11 A;  1V57 A;  2OQE A;  4BU4 A;  1E3V A;  1O7W B;  1WMO A;  3WOD G;  3X40 A;  4DKI A;  1RNB A;  3DMC A;  4XDW A;  1YIT 3;  3UL5 A;  2GXF A;  3OX9 A;  4X2O A;  3MYT A;  4ORL A;  3AGN A;  1ISK A;  3JVC A;  3JUO A;  1FGM A;  1W2Z A;  1IVU A;  3HI7 A;  2OWP A;  1RKY A;  2BO9 B;  3GZR A;  3CPO A;  4EYC A;  1EQK A;  1JB4 A;  1OF5 A;  1QAF A;  3CU3 A;  1ROA A;  1TTO A;  1JN5 B;  1LOX A;  4HZ9 B;  4I5Q A;  3UNL A;  1VQQ A;  1GYB A;  1N8Q A;  1RGL A;  1TFK A;  1IVW A;  1X1X A;  2F5M A;  1BAO A;  3CCL 3;  3NXJ A;  3S27 A;  5FGO A;  3V98 A;  8CHO A;  3CME 3;  3I55 3; 
#chains in the Genus database with same CATH homology
 3VGN A;  2WO0 A;  3DUK A;  5G2G A;  3GZY B;  4H3U A;  1QMA A;  2RCD A;  4WWU C;  1VQ7 3;  4TX4 A;  4R9K A;  3EHC A;  1JJ2 2;  3FLJ A;  1VZZ A;  3SLU A;  1Q81 4;  1RRH A;  2OCT A;  4NHF A;  4HM7 B;  2MC8 A;  5AYR B;  1HU9 A;  3DGN A;  3NM2 A;  1N9J A;  2GU3 A;  4FMB A;  3NV0 A;  4RZM A;  5DRV A;  3OWU A;  4FCZ A;  4FCJ A;  1NB3 I;  2CFD A;  4LMI A;  1Q82 4;  4HM5 B;  1YJ9 3;  1A67 A;  4BTY A;  2P05 A;  5CK6 A;  1ULI B;  4FMC A;  3T8N A;  3LTB A;  2O3O A;  3KSE D;  3KSP A;  3GAX A;  2W04 A;  4N6L A;  1FGR A;  1EKM A;  1FGT A;  1TIJ A;  3SX1 A;  4K1U A;  1U5O A;  1JNQ A;  1Z1S A;  2CC3 A;  4WFO A;  4XBX A;  3LYG A;  5EEO A;  2GEY A;  4J9A A;  4K1V A;  3WOF B;  1QJG A;  3J7Y d;  1W6G A;  3N8B A;  4L8P A;  5AIG A;  5AI1 A;  5JBS A;  1IDP A;  1YHQ 3;  3ALA A;  2Z76 A;  1Q40 A;  3S5C A;  3CPW 2;  4EXR A;  2QGU A;  3GZX B;  6STD A;  5IW9 A;  1KD1 4;  4LEH A;  2RSX A;  1STD A;  1M90 4;  2ML5 A;  3T0U A;  3CCU 3;  2W9P A;  1J2B A;  4MJD A;  1EA2 A;  4RNY A;  1NB5 I;  1VQL 3;  4KZ1 A;  3EBY A;  7STD A;  4FCM A;  3LXU X;  4L8O A;  3PCR A;  3STD A;  3X41 A;  3CCQ 3;  3NX0 A;  5CF2 A;  3FCS B;  3H51 A;  1CEW I;  1US1 A;  1BUQ A;  3NQZ A;  2V1L A;  5D83 A;  2QA4 3;  4N6T A;  4HKV B;  2HML B;  2CIU A;  1GD3 A;  3IMA B;  3OW2 2;  1JKG A;  2CW9 A;  3SED A;  4O8S A;  5JPP A;  3AMO B;  3LT9 A;  2OTL 3;  2Z6B A;  4HM0 B;  1GY6 A;  2QEX 3;  2W0Q A;  4STD A;  3NBR A;  4MMX B;  1YI2 3;  3FSD A;  1VQ8 3;  1IV9 A;  1O7M B;  2FGT A;  3X3Z A;  3LTC A;  2JDI H;  3CMA 3;  5STD A;  2INX A;  3G4S 3;  1YVB I;  1VQO 3;  1IQY A;  2XEP A;  2WOH A;  3ER7 A;  3O8Y A;  2BT3 A;  5ELJ A;  3FZW A;  2P09 A;  3F14 A;  3WMD A;  1MOL A;  2C10 A;  2YFL B;  3FG3 A;  2W6J H;  4I4K A;  1KWI A;  1N5H A;  2LYX A;  3LOY A;  1DMQ A;  1OUN A;  2W03 A;  3B4O A;  2Y73 A;  2KXG A;  1SIH A;  3DM8 A;  3CCV 3;  1QVG 2;  1M9G A;  3A76 A;  2GBX B;  1Q86 4;  1R4C A;  3FGY A;  4EV5 A;  3N9H A;  1IVX A;  4HM3 B;  3HII A;  5KP4 A;  4AKZ A;  1N9E A;  1RN7 A;  3E99 A;  2BMO B;  3PZW A;  4BTW A;  1T5Y A;  5IEO A;  3Q90 A;  3D3L A;  5IG0 A;  5KP3 A;  4KFF A;  4HM6 B;  3RGR A;  3G71 3;  4IIA A;  4O3V A;  4HM8 B;  2CKF B;  1JN5 A;  1OGX A;  1NDO B;  3L0R A;  4XBT A;  5CLK A;  4WYK B;  1OHS A;  3CNM A;  3MWZ A;  1YGE A;  2ZL8 A;  4H61 A;  3U1W A;  2CK3 H;  2K54 A;  3DGL A;  3CCS 3;  2FNQ A;  2XGN A;  1W5Z A;  1AV4 A;  1K28 A;  2RFR A;  3BLZ A;  3EQQ B;  3F7S A;  3FG1 A;  3WOE B;  5BVB A;  4FMA A;  1TP6 A;  4K61 A;  1MNL A;  3GWR A;  4EBG A;  1IK3 A;  2SBL A;  3G6E 3;  2OOV C;  4EC6 A;  5IG5 A;  1WMP A;  2W56 B;  2IUJ A;  3NBB A;  2HMJ B;  1SPU A;  2I9W A;  3MG2 A;  3RGA A;  1WQL B;  2XFS A;  2GU1 A;  2YX9 A;  4HYZ A;  3IPT A;  4OK0 A;  2XH9 A;  4J8T A;  4XM4 A;  1N8R 4;  3F7X A;  3F9S A;  1QAL A;  1G96 A;  3JUM A;  3H3H A;  3NUV A;  1LVN A;  5DRE A;  4U13 A;  1KQS 2;  4R9L A;  2WGO A;  1NO3 A;  1YJW 3;  4LSO A;  4AKY A;  3MG3 A;  1VQM 3;  2OTJ 3;  2CH9 A;  3K7C A;  1LXE A;  2HMK B;  1PU4 A;  2P0M A;  3VSY A;  2B1X B;  1ASK A;  1N5P A;  3B8L A;  4WP5 A;  2HMO B;  3GRD A;  3BNB A;  3G8Z A;  3G16 A;  1PFP A;  3SXX A;  4LZI A;  4O2H A;  4KFD A;  2B24 B;  3QK9 A;  4N6V 0;  4CDL A;  3FG4 A;  2KRT A;  1W6Y A;  3MSO A;  4N6U A;  3FF2 A;  3S28 A;  1K73 4;  2A15 A;  2D42 A;  1DVC A;  4N6M A;  3CC2 3;  2O9U X;  5I97 A;  5AIF A;  5EVH A;  3SOY A;  2K0M A;  1JB5 A;  2GEX A;  2KCD A;  3DGM A;  3MHE A;  3SVA A;  3V99 A;  3CCM 3;  3I56 3;  1Y4K A;  3I0Y A;  4KVH A;  3Q1C A;  3AMO A;  1AVK A;  1STF I;  2RGQ A;  1C7H A;  3SOA A;  5CF1 A;  5LC7 A;  1W01 A;  4OVM A;  3N54 B;  4R1K A;  4MMY B;  3UB1 A;  3UJM A;  2PZV A;  3K63 A;  3BNE A;  5TGN A;  2OOV A;  5AEW B;  1IQX A;  3EE1 A;  3LML A;  3CD6 3;  1KC8 4;  3OXA A;  1WNH A;  2JQ5 A;  2YFI B;  4G1M B;  3WA3 A;  1AR0 A;  1DMN A;  3KKG A;  1FA3 A;  5IEN A;  1A2V A;  3OV4 A;  2BMQ B;  3HIG A;  1M1K 4;  3B4P A;  1F8N A;  4X2H A;  1OHP A;  1IT7 A;  1SQW A;  2CHC A;  4RBN A;  3PCS A;  1JKG B;  4O02 B;  1GD4 A;  3K9M C;  1CYU A;  3Q2P A;  1OPY A;  2STD A;  2LQV A;  1RJO A;  1SJW A;  4ZM8 A;  5JPU A;  2E2V A;  2F86 B;  2QIY A;  4N6N B;  1ULJ B;  2Y74 A;  3DGO A;  1GS3 A;  4HM1 B;  1D6U A;  3KII A;  3IJE B;  3CC7 3;  3X3X A;  3X3Y A;  1QAK A;  2YFJ B;  3PS8 A;  1U8C B;  3TDG A;  4K90 B;  5EQL A;  1O7G B;  1IVV A;  3EB8 A;  2W2C A;  2CFL A;  1W4N A;  1TU5 A;  2W9Q A;  1YIJ 3;  5IEP A;  1S72 3;  4BTX A;  1VQN 3;  2Z7A A;  4EV2 A;  4HZB B;  3KFQ C;  1DVD A;  3DZL A;  1D6Z A;  3HX8 A;  2W56 A;  3GZB A;  1V74 A;  4OUQ A;  1K9M 4;  4NRE A;  5IG3 A;  1VQ5 3;  4HM2 B;  4HBR A;  1UI7 A;  2CG1 A;  3BB9 A;  4FR9 A;  5FW5 A;  4XB5 A;  1LNH A;  4MMZ B;  1OF5 B;  3LT8 A;  5AII A;  3U97 A;  1NJI 4;  1W7C A;  5AYS C;  1KSI A;  3T8U A;  1FUW A;  3WA2 X;  5D82 A;  3LTD A;  3S67 A;  5BXQ A;  3MKI A;  1DYU A;  3NQY A;  3KN4 A;  1A90 A;  1K41 A;  2PNC A;  1OCV A;  2IA7 A;  3WDG B;  2HMM B;  1VQ4 3;  1ZO2 A;  1FGO A;  3S29 A;  1GY7 A;  3CCR 3;  2XGL A;  4WHA A;  2HMN B;  3G0K A;  3M8C A;  5IER A;  1IV7 A;  1M1X B;  1Q42 A;  2BHM A;  3CCJ 3;  3BND A;  1AVL A;  1WMN A;  1JB2 A;  3NHX A;  2D1W A;  1IT8 A;  1W00 A;  3K0Z A;  3NV0 B;  1W2B 2;  1OHO A;  2Q07 A;  1O7H B;  1UI8 A;  3MPH A;  3OWS A;  2CG0 A;  2CFG A;  2XSO B;  2P38 A;  2CFW A;  1ZX2 A;  1RRL A;  3DXO A;  3BNC A;  3F8H A;  2F98 A;  4GB5 A;  4FMD A;  4Q53 A;  3HZP A;  1JRQ A;  2XSH B;  5HGR A;  2OQE C;  2MF7 A;  3EX9 A;  4IT7 A;  2XF3 A;  4MEI A;  3DY5 A;  4N6O B;  2XRX B;  4HM4 B;  3CC4 3;  4KFE A;  1Q7Y 4;  3NBJ A;  3EN8 A;  2IMJ A;  3CNX A;  3CCE 3;  1QVF 2;  5AIH A;  4XBY A;  3CXC 2;  1UUW B;  3F8X A;  1VQP 3;  1UUV B;  1VQK 3;  2FXT A;  1WTH A;  4JRF A;  4HJL B;  2F99 A;  3LZA A;  2M7O A;  3EC9 A;  1E97 A;  3UL6 A;  1OGZ A;  3ROB A;  1Q40 B;  3FKA A;  4N3V A;  3X42 A;  2CWV A;  3JUP A;  1D6Y A;  5AEU B;  5ELU A;  1SII A;  1UW1 A;  1O7N B;  2L4V A;  3PYJ A;  4LGQ A;  1NWW A;  3LTA A;  2GBW B;  2CWU A;  1VQ6 3;  3V92 A;  1DMM A;  2CWT A;  4R4K A;  2XR8 B;  5IG4 A;  3PGB A;  3OWY A;  1CQS A;  1ROV A;  4HVN A;  5CXO A;  2WGQ A;  3JUN A;  1EG9 B;  3B7C A;  2ML6 A;  1NU3 A;  3MG1 A;  1L5G B;  2Z77 A;  5A0O B;  3EBT A;  3EF8 A;  3HK4 A;  3PXM A;  5LC6 A;  4RNZ A;  4QWT A;  3NM7 A;  5D81 A;  1TUH A;  1TFO A;  3QRD A;  5IF6 A;  1VQ9 3;  2E2U A;  1O7P B;  1JV2 B;  3FF0 A;  2IUK A;  4GL6 A;  1GY5 A;  3KE7 A;  4IPB A;  3ECF A;  4PEJ A;  3KZT A;  4CCV A;  4L7K A;  3K5T A;  2P0X A;  4XDV A;  3EJV A;  4R80 A;  1YJN 3;  1K8A 4;  1E3R A;  1A2K A;  3EN1 B;  2CFK A;  1CYV A;  2XFT A;  2UX0 A;  4AEQ A;  1IU7 A;  1W02 A;  1W6C A;  2BNG A;  4WYK A;  1S5A A;  3JUQ A;  5KP1 A;  3LH4 A;  3D9R A;  3FH1 A;  1IQ8 A;  1OAC A;  3RDE A;  4JF8 A;  3VF1 A;  2BMR B;  1OH0 A;  2R4I A;  2ZDJ A;  2WOF A;  2E2T A;  3F40 A;  1FGQ A;  1HKX A;  2C11 A;  2OQE A;  1E3V A;  1O7W B;  1WMO A;  3WOD G;  3X40 A;  3DMC A;  4XDW A;  1YIT 3;  3UL5 A;  2GXF A;  3OX9 A;  4X2O A;  3MYT A;  4ORL A;  1ISK A;  3JVC A;  3JUO A;  1FGM A;  1W2Z A;  1IVU A;  3HI7 A;  2OWP A;  1RKY A;  2BO9 B;  3GZR A;  3CPO A;  4EYC A;  1EQK A;  1JB4 A;  1OF5 A;  1QAF A;  3CU3 A;  1ROA A;  1JN5 B;  1LOX A;  4HZ9 B;  3UNL A;  1GYB A;  1N8Q A;  1TFK A;  1IVW A;  3CCL 3;  3NXJ A;  3S27 A;  5FGO A;  3V98 A;  8CHO A;  3CME 3;  3I55 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...