1OUNA

Crystal structure of nuclear transport factor 2 (ntf2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
molecule tags Transport
source organism Rattus norvegicus
publication title The 1.6 angstroms resolution crystal structure of nuclear transport factor 2 (NTF2).
pubmed doi rcsb
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ounA00
1OHSA 2K54A 3NUVA 1NDOB 3FF2A 1CQSA 2Z76A 4HM6B 5AEUB 1JN5A 1ZX2A 3H51A 3CNXA 4HM3B 3EN8A 4HM8B 4WYKB 2IMJA 3FKAA 3LYGA 5IEPA 1AR0A 1Q42A 1W02A 3K0ZA 2W2CA 3DM8A 3FSDA 5IG0A 3ROBA 2YFIB 3BB9A 1BUQA 3B7CA 4CDLA 2GEYA 2HMJB 2HMLB 3KSPA 3SOYA 3H3HA 4XBXA 1EG9B 4KVHA 4HM7B 4HM2B 4R9KA 5KP4A 3M8CA 3HX8A 3K7CA 3OX9A 3JUMA 4K1VA 4OUQA 5DREA 3F7XA 2XSOB 5BVBA 5CXOA 1E97A 5G2GA 4N3VA 3DZLA 5CK6A 3A76A 4L8OA 1W00A 5AIFA 4R9LA 5D82A 2B1XB 1GY7A 2HMOB 3LZAA 3G0KA 3CU3A 5IERA 3MKIA 1JKGB 3STDA 3B4OA 4STDA 2BMQB 1OPYA 3SEDA 3EQQB 1SJWA 5TGNA 3T8UA 3FZWA 1OF5A 1K41A 3NHXA 1OHOA 3F9SA 3NXJA 5D81A 1OGZA 3NM2A 3EBYA 3GZRA 4XBYA 5IG5A 1W01A 1Q40B 2UX0A 2GBXB 5AIIA 5D83A 3GWRA 3MSOA 1JN5B 1DMMA 8CHOA 1JB5A 2PZVA 3F8HA 4WYKA 3OV4A 3JUNA 3OWYA 5JPUA 1EA2A 3DXOA 5CF2A 5BXQA 5IG3A 3F40A 2YFLB 1ULIB 4X2HA 4J8TA 2QIYA 1A2KA 1TUHA 2RGQA 1DMQA 2BNGA 3OXAA 3CPOA 5AI1A 5CLKA 3HK4A 2F98A 3CNMA 3JUPA 4PEJA 3UNLA 3JUQA 1QJGA 1ISKA 3SOAA 1HKXA 1E3RA 1NWWA 1TP6A 1ULJB 2XSHB 1O7HB 3NV0B 3OWUA 4GB5A 2CHCA 2Z77A 3FLJA 5IG4A 1GY5A 4L7KA 4XM4A 1Z1SA 3JUOA 4FCJA 1JKGA 3KE7A 1ASKA 3EF8A 1U5OA 3E99A 5IEOA 1JB4A 3MHEA 3GRDA 2Z7AA 3B4PA 3OWSA 2YFJB 4IIAA 4X2OA 3RGAA 1OF5B 2XR8B 2HMKB 3GZXB 2XRXB 3EBTA 3HZPA 2RCDA 1O7PB 1DMNA 2R4IA 3IPTA 3NBRA 4HVNA 4ORLA 4U13A 3KKGA 4HM1B 4HM5B 1Q40A 3Q90A 5CF1A 3DMCA 5HGRA 1O7GB 1GS3A 3G16A 3MG2A 3EC9A 2GBWB 3MYTA 4H3UA 4WP5A 1W6YA 1VZZA 5FW5A 5KP1A 2OWPA 3WMDA 1IDPA 1WQLB 4HM4B 4K1UA 4OVMA 4XDVA 5STDA 1UUVB 3F14A 3FGYA 3ECFA 4LEHA 5AIGA 5AIHA 3GZYB 1O7NB 2JQ5A 3I0YA 4XBTA 3FF0A 4XDWA 1OHPA 4LGQA 1C7HA 3F8XA 1JB2A 3EJVA 5KP3A 1OCVA 3VSYA 1O7MB 1NU3A 4HZ9B 5AEWB 6STDA 2I9WA 3NV0A 4XB5A 5DRVA 3MG1A 2BMOB 4LMIA 5JPPA 5EVHA 4L8PA 4RZMA 7STDA 5IF6A 3MG3A 2GEXA 1E3VA 1QMAA 4HJLB 3B8LA 3RGRA 3UJMA 3F7SA 3S5CA 1GY6A 3VGNA 4J9AA 2INXA 1OGXA 3D9RA 1S5AA 2F86B 3EHCA 3ER7A 3G8ZA 1OH0A 1OUNA 1O7WB 1UUWB 2HMNB 3BLZA 3GZBA 3DUKA 2A15A 1STDA 2STDA 4R1KA 2QGUA 5IENA 1ZO2A 4FCMA 4WWUC 3T8NA 2F99A 2BMRB 4HM0B 4HZBB 4I4KA 4Q53A 2GXFA 2HMMB 1GYBA 3FH1A 3EN1B 3EX9A 2CKFB 2B24B 4MJDA 4HKVB 2RFRA 3KZTA
chains in the Genus database with same CATH superfamily
1OHSA 2K54A 1NB5I 1CQSA 1Q7Y4 6RNTA 3CCR3 4WYKB 2KF6A 3FKAA 1A2PA 1W02A 3K0ZA 1B21A 3DM8A 3ROBA 3UL6A 1YJ93 1BUQA 1ROVA 3BB9A 3B7CA 2GEYA 1LXEA 2IUKA 3Q1CA 2HMLB 1A2VA 1MGRA 3CD63 1TJDA 4HM2B 4R9KA 2ZDJA 3N8BA 3HX8A 3PYJA 1N8R4 1X1YA 2FXTA 2XSOB 3QRDA 5G2GA 5CK6A 1RGCA 1W4NA 3D4AA 3WOFB 3D5GA 5D82A 4R9LA 3LZAA 2QEX3 4BTXA 3GAXA 1TTOA 3B4OA 2ZHXB 1T3BA 2BMQB 3CC23 4O02B 3KIIA 1FUTA 3BU4A 4LSOA 3SLUA 5IG5A 2W6JH 1YNVX 3EBYA 5AYRB 5LC6A 3FG4A 2D1WA 1BRSA 1DMMA 5AYSC 3I553 4KFDA 1IV7A 4WYKA 3JUNA 1EA2A 3DXOA 4MMXB 1BNGA 4J5KA 2YFLB 3PZWA 4J8TA 4X2HA 1LVNA 5IW9A 4FMAA 2WGQA 2BNGA 1DE3A 1IT7A 1CH0A 2CFDA 3RNTA 3HIIA 3HK4A 4EBGA 1W2B2 3HI7A 1EEJA 2F98A 3AGOA 4PEJA 3TDGA 3JUQA 4WFOA 1W5ZA 1Q9EA 4LYLB 4RNYA 2W03A 1VQ83 4GB5A 2XGNA 3T0UA 2CHCA 3X40A 3G6E3 1I2FA 5G1LA 1UUGB 3FCSB 1SARA 1VQ63 3JUOA 2W9PA 1VQO3 2KF4A 1LOWA 5IEOA 1RRLA 2IA7A 2XFTA 2Z7AA 4RBNA 3CXC2 2YFJB 1B2SA 4X2OA 3T8UA 3CPW2 4WWUC 3EE1A 1G0TA 3NM7A 1O7PB 1DMNA 2RNTA 3NBRA 2OCTA 9RNTA 2P38A 1BNJA 4HYZA 4AKZA 3KKGA 4EV5A 4HM5B 1I3FA 1PU4A 1RNTA 1T2IA 3G16A 1T2HA 3HOHA 4N6V0 3X3ZA 1V74A 2GBWB 1ZGXA 2J8XB 1TRPA 1W6YA 1VZZA 2BT3A 2D42A 3Q3FA 5FW5A 3U97A 2OWPA 1GOUA 2WOHA 1W6CA 1SIIA 2CG0A 3LT9A 1UUVB 5AIHA 3ECFA 4QWTA 5AIGA 2CG1A 1BNRA 1JRQA 1SIHA 1JNQA 1I2GA 1C7HA 4HZ9B 2I9WA 4BU4A 4XB5A 1IVUA 3WR2A 1VQL3 4O8SA 1WMPA 5JPPA 4IPBA 3KCHA 2CH9A 1K8A4 2OOVA 1TRQA 1BANA 1QMAA 4BL2A 1NJI4 1IYYA 1EUIC 4LZIA 1UDII 3AHWA 1S723 1GY6A 1IQXA 4JF8A 1AVLA 3VGNA 2F86B 3EHCA 2BIRA 2C10A 1FGOA 3G8ZA 1QAKA 4BL3A 3BNEA 3IMAB 1UUWB 3GZBA 3U1WA 3X41A 3FG3A 1ZO2A 1YIT3 2CFLA 3MPHA 5G1KA 2F99A 2BO9B 4Q53A 1K734 3CC43 2P09A 1F8NA 4EW5A 3EN1B 2B24B 4WHAA 4HKVB 5M19A 4H61A 3CC73 2W04A 3FF2A 3D5IA 1BNFA 1ROAA 2Z76A 5AEUB 1JN5A 3ALAA 2KXGA 1JJ22 3LYGA 1Q42A 1NB3I 2FGTA 3FSDA 3CCU3 2YFIB 1LOXA 2MF7A 1RMSA 4KFFA 4CDLA 4CJNA 1BNEA 2HMJB 1LOVA 1N5HA 3H3HA 4KVHA 5M18A 2BHMA 1VQ93 2PNCA 1BOXA 4GHOA 4HAAA 5KP4A 3OX9A 5DREA 3DGNA 3F7XA 3DGOA 1WNHA 4FMCA 5CXOA 3SVAA 2Z6BA 4L8OA 3X3YA 1K9M4 1CEWI 5FGOA 1DVDA 1GY7A 7GSPA 1Q864 2HMOB 3NBBA 3G0KA 3CU3A 1BIRA 5IERA 1Q814 1JKGB 2LYXA 4STDA 1B2UA 3EQQB 1OF5A 4N6OB 1G96A 1UGIA 1OGZA 4GL6A 4XBYA 1RLSA 1Q40B 3LT8A 4K61A 4RNTA 3CCJ3 5JBSA 3K5TA 3MSOA 1JN5B 1FUWA 2F5WA 1RHLA 2KAAA 3OV4A 2GU3A 1FZUA 1YGEA 3F40A 1BRIA 1UCJA 1RGFA 1ULIB 2RGQA 1A2KA 3OXAA 1BRKA 1JZDA 3URPA 5CLKA 2KCDA 3WHOA 4GSPA 2QA43 3UNLA 1ISKA 5EQLA 1N8QA 2W56A 1MWRA 1FUSA 3X42A 5RNTA 2XEPA 2Z77A 4L7KA 2K0MA 4XM4A 1VQ53 3L0RA 2CW9A 1JKGA 1UGHI 3KE7A 3QK9A 2E2UA 2KF5A 1B2ZA 1GMPA 1YJN3 3NQZA 2CX0A 2Q07A 5CF1A 1A67A 4OK0A 1R4YA 3S67A 1OF5B 3IJEB 3EBTA 3BIRA 3HZPA 3UB1A 4ORLA 4U13A 5BXQA 1HYFA 4N6LA 2P0MA 1BAOA 1Q40A 1RNBA 1B20A 5HGRA 1BNSA 1GS3A 2V1LA 1UI8A 3EC9A 3MG2A 3MYTA 5KP1A 1HU9A 2CK3H 1IQ8A 3CCE3 2R41A 2CFWA 4HM4B 1BSBA 1X1UA 2C11A 1AVKA 3GZYB 2W0QA 2JQ5A 1VQN3 4XBTA 2SBLA 4XDWA 3LMLA 2RSXA 3VSYA 5KP3A 3F8XA 1JB2A 2AADA 3EJVA 2W56B 1YI23 2IUJA 3SYUA 1FGMA 8RNTA 3MG1A 1WMOA 1M1K4 3MG3A 1TFOA 1E3VA 1GSPA 1YGWA 1RGGA 2XFSA 3B8LA 3F7SA 3FG1A 3WA3A 1B3SA 2INXA 1OGXA 3D9RA 1AV4A 1S5AA 3WDGB 1BUJA 3DH2A 4BTWA 1O7WB 1UCLA 3NX0A 1BGSA 1FYSA 2CIUA 3DUKA 1STDA 1IQYA 2Y73A 5IENA 3T8NA 4FCMA 1B2MA 1WTHA 2BMRB 4HM0B 5BIRA 1VQK3 1I3IA 2GXFA 2HMMB 1GYBA 3RDEA 3PGBA 3G713 4FR9A 1GD4A 2RFRA 3LTDA 3NUVA 1NDOB 3S28A 2H0IA 3CCQ3 1RN4A 4HM6B 1QVG2 1YIJ3 3H51A 1QVF2 2UGIA 1RGLA 1TIJA 1AR0A 4EV2A 3V98A 1UCIA 3K63A 1M9GA 1VQ43 1MWTA 2ML6A 3KSPA 3AHSA 4XBXA 4HM7B 1W6GA 3JUMA 4OUQA 5BU4A 1E97A 2C4BA 4N3VA 1BVIA 3A76A 5AIFA 1V57A 3DGYA 2B1XB 1AQZA 1GMRA 3MKIA 1RRHA 3STDA 3KSED 1MWSA 3SEDA 1N5PA 5TGNA 1D6UA 2O9UX 3NXJA 2E2TA 1K28A 1C54A 1B27A 1W01A 2UX0A 4TX4A 2GBXB 5EEOA 3WODG 5AIIA 5D83A 3UL5A 1LOYA 3GWRA 1L5GB 1U8CB 3LOYA 4O2HA 1JB5A 3OWYA 1US1A 4AEQA 1RGKA 5CF2A 1JBRA 1I0VA 4FCZA 1AY7A 1I70A 1KWIA 1YVSA 2QIYA 1BSAA 1DMQA 3PXMA 3CPOA 1X1WA 3HIGA 4CCVA 1BSDA 1V58A 3BNDA 1LQGC 3CNMA 3JUPA 1MNLA 1QJGA 1VQP3 3SOAA 1E3RA 1NWWA 1ULJB 3NV0B 2CWTA 3OWUA 5LC7A 2M7OA 5M1AA 3ZG0A 1N9EA 4BIRA 5IG4A 3EB8A 1D6YA 3ZG5A 4KZ1A 4FCJA 3EF8A 1U5OA 1JB4A 3GRDA 3OWSA 4IIAA 4MMZB 3RGAA 2XR8B 4J9AA 3GZXB 2XRXB 4MEIA 3CCM3 2P0XA 2RCDA 3IPTA 2R4IA 4HVNA 1YHQ3 4HM1B 3J7Yd 1SPUA 1LQMB 3Q90A 3DMCA 2ZA4A 1M1XB 1MOLA 1IVVA 3KFQC 1BSEA 1OACA 1CYUA 4N6MA 1M904 1IDPA 1N9JA 1WQLB 4MMYB 4R80A 1BSCA 5STDA 3F14A 1BU4A 3FGYA 1D6ZA 1O7NB 1A90A 3FF0A 3ZFZA 4NPBA 6STDA 1KD14 2P05A 1O7MB 1NU3A 5AEWB 1VQM3 3NV0A 1RN7A 3LTBA 5I97A 1RTUA 2GU1A 3BNBA 1RCLA 2WGOA 4LMIA 5EVHA 1DETA 3LH4A 2FNQA 3WA2X 1YVBI 7STDA 5IF6A 4HJLB 3RGRA 1X1XA 3AMOA 3CME3 3SXXA 1STFI 1IU7A 2OQEC 1Q824 1OH0A 2XGLA 1KC84 4R4KA 2AAEA 3BLZA 2OTL3 1HZ1A 4R1KA 2QGUA 2YX9A 2CWVA 1I0XA 4I4KA 1KSIA 1IV9A 1QALA 4JRFA 4FMBA 3SX1A 2OTJ3 2F4YA 1Q7HA 1GOYA 1PY3A 3V92A 1T5YA 3KZTA 3CCL3 2ZL8A 4BTYA 2H0GA 4O3VA 1JBSA 3D3LA 2HOHA 1B2XA 3K9MC 1ZX2A 3A5EA 2CFKA 1YJW3 2E2VA 3CNXA 3NQYA 3EN8A 4HM3B 4HM8B 2IMJA 3JVCA 5HOHA 4G1MB 5IEPA 1RKYA 1BNIA 3LTAA 1DYUA 2W2CA 2ML5A 5IG0A 4K90B 4NHFA 4EXRA 3SOYA 2CX1A 2GSPA 1EG9B 3GSPA 1UI7A 1GD3A 3DGLA 3K7CA 3M8CA 2SARA 1CYVA 1RCKA 4K1VA 5BVBA 3CCV3 3AMOB 1LNIA 4CPKA 1GMQA 3DZLA 3CMA3 2Y74A 1NNVA 1W00A 4EC6A 3Q2PA 1DVCA 4N6TA 3O8YA 4J5GA 1JZOA 1RDSA 1OPYA 1RSNA 1SJWA 1RGEA 3FZWA 3LXUX 1K41A 1EQKA 3NHXA 4HOHA 1Y4KA 1OHOA 2WO0A 1W7CA 3F9SA 5D81A 3NM2A 3PCSA 3GZRA 2F5MA 1VQQA 1UW1A 3X3XA 1FA3A 2L1SA 2F56A 3AGNA 1MGWA 1FGTA 8CHOA 2PZVA 3F8HA 3G4S3 5JPUA 2CC3A 1IK3A 2OQEA 5IG3A 4HBRA 2BU4A 1TUHA 1PYLA 1SQWA 3PS8A 3WOEB 5AI1A 4KT3B 4ILFA 1KQS2 5GSPA 3S29A 1HKXA 1JV2B 2LQVA 1TP6A 2XSHB 1O7HB 3OW22 1EKMA 3FLJA 3BNCA 1GY5A 2RBIA 1I2EA 1Z1SA 1BRHA 3MWZA 6GSPA 3DGMA 2MC8A 1ASKA 4EYCA 3E99A 1W2ZA 3MHEA 3B4PA 4IT7A 1UCKA 1QAFA 1RN1A 2HMKB 1IVWA 2O3OA 3CCS3 3NBJA 4NREA 1NO3A 1G02A 4ZM8A 1MWUA 1PFPA 3DY5A 1FW7A 1O7GB 3S27A 2CWUA 4H3UA 4WP5A 4N6NB 4FMDA 3WMDA 1VQ73 1JBTA 1TFKA 1I8VA 1FGQA 2JDIH 1IT8A 4K1UA 2UUGC 4OVMA 4XDVA 4DKIA 2XH9A 2IYJA 4LEHA 2KF3A 1WMNA 1GOVA 5ELUA 1RGHA 3I0YA 1J2BA 1OHPA 4LGQA 3I563 1OCVA 1BRJA 3N54B 2L4VA 1LRAA 1R4CA 1IVXA 5DRVA 3D79A 1TU5A 2BMOB 3N9HA 1RJOA 1RGAA 2OOVC 1BRGA 4L8PA 4RZMA 2GEXA 2W9QA 4AKYA 1ZS7A 2XF3A 3LTCA 3UJMA 3S5CA 2WOFA 5A0OB 3ER7A 3V99A 4I5QA 1OUNA 3VF1A 1BRNL 2H0HA 2HMNB 4RNZA 2A15A 2STDA 3KN4A 7RNTA 1FGRA 4HZBB 2CFGA 3PCRA 3FH1A 2K3DA 4KFEA 2IY2A 2KRTA 3EX9A 4N6UA 5ELJA 2CKFB 4MJDA 1LNHA
chains in the Genus database with same CATH topology
1OHSA 2K54A 1NB5I 1CQSA 1Q7Y4 3CCR3 4WYKB 3FKAA 1W02A 3K0ZA 3UL6A 3DM8A 3ROBA 1YJ93 1BUQA 1ROVA 3BB9A 3B7CA 2GEYA 1LXEA 2IUKA 3Q1CA 2HMLB 1A2VA 3CD63 4HM2B 4R9KA 2ZDJA 3N8BA 3HX8A 3PYJA 1N8R4 2FXTA 2XSOB 3QRDA 5G2GA 5CK6A 1W4NA 3WOFB 5D82A 4R9LA 3LZAA 2QEX3 4BTXA 3GAXA 3B4OA 3CC23 2BMQB 4O02B 3KIIA 4LSOA 3SLUA 5IG5A 2W6JH 3EBYA 5AYRB 5LC6A 3FG4A 2D1WA 1DMMA 5AYSC 3I553 4KFDA 1IV7A 4WYKA 3JUNA 1EA2A 3DXOA 4MMXB 2YFLB 3PZWA 4J8TA 4X2HA 1LVNA 5IW9A 4FMAA 2WGQA 2BNGA 1IT7A 2CFDA 4EBGA 1W2B2 3HIIA 3HK4A 3HI7A 2F98A 4PEJA 3TDGA 3JUQA 4WFOA 1W5ZA 4RNYA 2W03A 1VQ83 4GB5A 2XGNA 3T0UA 2CHCA 3X40A 3G6E3 3FCSB 1VQ63 3JUOA 2W9PA 1VQO3 5IEOA 1RRLA 2IA7A 2XFTA 2Z7AA 4RBNA 3CXC2 2YFJB 4X2OA 3T8UA 3CPW2 4WWUC 3EE1A 3NM7A 1O7PB 1DMNA 3NBRA 2OCTA 2P38A 4HYZA 4AKZA 3KKGA 4EV5A 4HM5B 1PU4A 3G16A 4N6V0 3X3ZA 1V74A 2GBWB 3U97A 1W6YA 1VZZA 2BT3A 2D42A 5FW5A 2OWPA 2WOHA 1W6CA 1SIIA 2CG0A 3LT9A 1UUVB 5AIHA 3ECFA 4QWTA 5AIGA 2CG1A 1JRQA 1SIHA 1JNQA 1C7HA 4HZ9B 2I9WA 4XB5A 1IVUA 1VQL3 4O8SA 1WMPA 5JPPA 4IPBA 2CH9A 1K8A4 2OOVA 1QMAA 1NJI4 4LZIA 1S723 1GY6A 1IQXA 4JF8A 1AVLA 3VGNA 3EHCA 2F86B 2C10A 3G8ZA 1FGOA 1QAKA 3BNEA 3IMAB 1UUWB 3GZBA 3U1WA 3X41A 3FG3A 1ZO2A 1YIT3 2CFLA 3MPHA 1K734 2F99A 2BO9B 4Q53A 3CC43 2P09A 1F8NA 3EN1B 2B24B 4WHAA 4HKVB 4H61A 3CC73 2W04A 3FF2A 1ROAA 2Z76A 5AEUB 1JN5A 3ALAA 2KXGA 1JJ22 3LYGA 1Q42A 1NB3I 2FGTA 3FSDA 3CCU3 2YFIB 1LOXA 2MF7A 4KFFA 4CDLA 2HMJB 1N5HA 3H3HA 4KVHA 2BHMA 1VQ93 2PNCA 5KP4A 3OX9A 5DREA 3DGNA 3F7XA 3DGOA 1WNHA 4FMCA 5CXOA 3SVAA 2Z6BA 4L8OA 3X3YA 1K9M4 1CEWI 5FGOA 1DVDA 1GY7A 1Q864 2HMOB 3NBBA 3G0KA 3CU3A 5IERA 1Q814 1JKGB 2LYXA 4STDA 3EQQB 1OF5A 4N6OB 1G96A 1OGZA 4GL6A 4XBYA 1Q40B 3LT8A 4K61A 3CCJ3 5JBSA 3K5TA 3MSOA 1JN5B 1FUWA 3OV4A 2GU3A 1YGEA 3F40A 1ULIB 2RGQA 1A2KA 3OXAA 2CKFB 5CLKA 2KCDA 2QA43 3UNLA 1ISKA 5EQLA 1N8QA 2W56A 3X42A 2XEPA 2Z77A 4L7KA 2K0MA 4XM4A 1VQ53 3L0RA 2CW9A 1JKGA 3KE7A 3QK9A 2E2UA 1YJN3 3NQZA 2Q07A 5CF1A 1A67A 4OK0A 3S67A 1OF5B 3IJEB 3EBTA 3HZPA 3UB1A 4ORLA 4U13A 5BXQA 4N6LA 2P0MA 1Q40A 5HGRA 1GS3A 2V1LA 1UI8A 3EC9A 3MG2A 3MYTA 5KP1A 1HU9A 2CK3H 1IQ8A 3CCE3 4HM4B 2CFWA 2C11A 1AVKA 3GZYB 2W0QA 2JQ5A 1VQN3 4XBTA 2SBLA 4XDWA 3LMLA 2RSXA 3VSYA 5KP3A 3F8XA 1JB2A 3EJVA 1YI23 2W56B 2IUJA 1FGMA 3MG1A 1WMOA 1M1K4 3MG3A 1TFOA 1E3VA 2XFSA 3B8LA 3F7SA 3FG1A 3WA3A 2INXA 1OGXA 3D9RA 1AV4A 1S5AA 3WDGB 4BTWA 1O7WB 3NX0A 2CIUA 1STDA 1IQYA 2Y73A 5IENA 3T8NA 4FCMA 1WTHA 2BMRB 4HM0B 1VQK3 2GXFA 2HMMB 1GYBA 3RDEA 3PGBA 3G713 4FR9A 1GD4A 2RFRA 3LTDA 3NUVA 1NDOB 3S28A 3CCQ3 4HM6B 1QVG2 1YIJ3 3H51A 1QVF2 1TIJA 1AR0A 4EV2A 3V98A 3K63A 1M9GA 1VQ43 2ML6A 3KSPA 4XBXA 4HM7B 1W6GA 3JUMA 4OUQA 1E97A 4N3VA 3A76A 5AIFA 2B1XB 3MKIA 1RRHA 3STDA 3KSED 3SEDA 1N5PA 5TGNA 1D6UA 2O9UX 3NXJA 2E2TA 1K28A 1W01A 2UX0A 4TX4A 2GBXB 5EEOA 3WODG 5AIIA 5D83A 3UL5A 3GWRA 1L5GB 1U8CB 3LOYA 4O2HA 1JB5A 3OWYA 1US1A 4AEQA 5CF2A 4FCZA 1KWIA 2QIYA 1DMQA 3PXMA 3CPOA 3HIGA 4CCVA 3BNDA 3CNMA 3JUPA 1MNLA 1QJGA 1VQP3 3SOAA 1E3RA 1NWWA 1ULJB 3NV0B 2CWTA 3OWUA 5LC7A 2M7OA 1N9EA 5IG4A 3EB8A 1D6YA 4KZ1A 4FCJA 3EF8A 1U5OA 1JB4A 3GRDA 3OWSA 4IIAA 4MMZB 3RGAA 2XR8B 4J9AA 3GZXB 2XRXB 4MEIA 3CCM3 2P0XA 2RCDA 3IPTA 2R4IA 4HVNA 1YHQ3 4HM1B 3J7Yd 1SPUA 3Q90A 3DMCA 1M1XB 1MOLA 1IVVA 3KFQC 1OACA 1CYUA 4N6MA 1M904 1IDPA 1N9JA 1WQLB 4MMYB 4R80A 5STDA 3F14A 3FGYA 1D6ZA 1O7NB 1A90A 3FF0A 6STDA 1KD14 2P05A 1O7MB 1NU3A 5AEWB 1VQM3 3NV0A 1RN7A 3LTBA 5I97A 2GU1A 3BNBA 2WGOA 4LMIA 5EVHA 3LH4A 2FNQA 3WA2X 1YVBI 7STDA 5IF6A 4HJLB 3RGRA 3AMOA 3CME3 3SXXA 1STFI 1IU7A 2OQEC 1Q824 1OH0A 2XGLA 1KC84 4R4KA 3BLZA 2OTL3 4R1KA 2QGUA 2YX9A 2CWVA 4I4KA 1KSIA 1IV9A 1QALA 4JRFA 4FMBA 3SX1A 2OTJ3 3V92A 1T5YA 3KZTA 3CCL3 2ZL8A 4BTYA 4O3VA 3D3LA 3K9MC 1ZX2A 2CFKA 1YJW3 2E2VA 3CNXA 3NQYA 3EN8A 4HM3B 4HM8B 2IMJA 3JVCA 1RKYA 4G1MB 5IEPA 3LTAA 1DYUA 2W2CA 2ML5A 5IG0A 4K90B 4NHFA 4EXRA 3SOYA 1EG9B 1UI7A 1GD3A 3DGLA 3K7CA 3M8CA 5BVBA 1CYVA 4K1VA 3CCV3 3AMOB 3DZLA 3CMA3 2Y74A 1W00A 4EC6A 3Q2PA 1DVCA 4N6TA 3O8YA 1OPYA 1SJWA 3FZWA 3LXUX 1K41A 1EQKA 3NHXA 1Y4KA 1OHOA 2WO0A 1W7CA 3F9SA 5D81A 3NM2A 3PCSA 3GZRA 1FA3A 3X3XA 1UW1A 1FGTA 8CHOA 2PZVA 3F8HA 3G4S3 5JPUA 2CC3A 1IK3A 2OQEA 5IG3A 4HBRA 1TUHA 1SQWA 3PS8A 3WOEB 5AI1A 1KQS2 3S29A 1HKXA 1JV2B 2LQVA 1TP6A 2XSHB 1O7HB 3OW22 1EKMA 3FLJA 3BNCA 1GY5A 1Z1SA 3MWZA 3DGMA 2MC8A 1ASKA 4EYCA 3E99A 1W2ZA 3MHEA 3B4PA 4IT7A 1QAFA 2HMKB 1IVWA 2O3OA 3CCS3 3NBJA 4NREA 1NO3A 4ZM8A 1PFPA 3DY5A 1O7GB 3S27A 2CWUA 4H3UA 4WP5A 4N6NB 4FMDA 3WMDA 1VQ73 1TFKA 1FGQA 2JDIH 1IT8A 4K1UA 4OVMA 4XDVA 2XH9A 4LEHA 5ELUA 1WMNA 1J2BA 3I0YA 1OHPA 4LGQA 3I563 1OCVA 3N54B 2L4VA 1R4CA 1IVXA 5DRVA 1TU5A 2BMOB 3N9HA 1RJOA 2OOVC 4L8PA 4RZMA 2GEXA 2W9QA 4AKYA 2XF3A 3LTCA 3UJMA 3S5CA 2WOFA 5A0OB 3ER7A 3V99A 1OUNA 3VF1A 2HMNB 4RNZA 2A15A 2STDA 3KN4A 1FGRA 4HZBB 2CFGA 3PCRA 3FH1A 4KFEA 2KRTA 3EX9A 4N6UA 5ELJA 3DUKA 4MJDA 1LNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHS A;  2K54 A;  3NUV A;  1NDO B;  3FF2 A;  1CQS A;  2Z76 A;  4HM6 B;  5AEU B;  1JN5 A;  1ZX2 A;  3H51 A;  3CNX A;  4HM3 B;  3EN8 A;  4HM8 B;  4WYK B;  2IMJ A;  3FKA A;  3LYG A;  5IEP A;  1AR0 A;  1Q42 A;  1W02 A;  3K0Z A;  2W2C A;  3DM8 A;  3FSD A;  5IG0 A;  3ROB A;  2YFI B;  3BB9 A;  1BUQ A;  3B7C A;  4CDL A;  2GEY A;  2HMJ B;  2HML B;  3KSP A;  3SOY A;  3H3H A;  4XBX A;  1EG9 B;  4KVH A;  4HM7 B;  4HM2 B;  4R9K A;  5KP4 A;  3M8C A;  3HX8 A;  3K7C A;  3OX9 A;  3JUM A;  4K1V A;  4OUQ A;  5DRE A;  3F7X A;  2XSO B;  5BVB A;  5CXO A;  1E97 A;  5G2G A;  4N3V A;  3DZL A;  5CK6 A;  3A76 A;  4L8O A;  1W00 A;  5AIF A;  4R9L A;  5D82 A;  2B1X B;  1GY7 A;  2HMO B;  3LZA A;  3G0K A;  3CU3 A;  5IER A;  3MKI A;  1JKG B;  3STD A;  3B4O A;  4STD A;  2BMQ B;  1OPY A;  3SED A;  3EQQ B;  1SJW A;  5TGN A;  3T8U A;  3FZW A;  1OF5 A;  1K41 A;  3NHX A;  1OHO A;  3F9S A;  3NXJ A;  5D81 A;  1OGZ A;  3NM2 A;  3EBY A;  3GZR A;  4XBY A;  5IG5 A;  1W01 A;  1Q40 B;  2UX0 A;  2GBX B;  5AII A;  5D83 A;  3GWR A;  3MSO A;  1JN5 B;  1DMM A;  8CHO A;  1JB5 A;  2PZV A;  3F8H A;  4WYK A;  3OV4 A;  3JUN A;  3OWY A;  5JPU A;  1EA2 A;  3DXO A;  5CF2 A;  5BXQ A;  5IG3 A;  3F40 A;  2YFL B;  1ULI B;  4X2H A;  4J8T A;  2QIY A;  1A2K A;  1TUH A;  2RGQ A;  1DMQ A;  2BNG A;  3OXA A;  3CPO A;  5AI1 A;  5CLK A;  3HK4 A;  2F98 A;  3CNM A;  3JUP A;  4PEJ A;  3UNL A;  3JUQ A;  1QJG A;  1ISK A;  3SOA A;  1HKX A;  1E3R A;  1NWW A;  1TP6 A;  1ULJ B;  2XSH B;  1O7H B;  3NV0 B;  3OWU A;  4GB5 A;  2CHC A;  2Z77 A;  3FLJ A;  5IG4 A;  1GY5 A;  4L7K A;  4XM4 A;  1Z1S A;  3JUO A;  4FCJ A;  1JKG A;  3KE7 A;  1ASK A;  3EF8 A;  1U5O A;  3E99 A;  5IEO A;  1JB4 A;  3MHE A;  3GRD A;  2Z7A A;  3B4P A;  3OWS A;  2YFJ B;  4IIA A;  4X2O A;  3RGA A;  1OF5 B;  2XR8 B;  2HMK B;  3GZX B;  2XRX B;  3EBT A;  3HZP A;  2RCD A;  1O7P B;  1DMN A;  2R4I A;  3IPT A;  3NBR A;  4HVN A;  4ORL A;  4U13 A;  3KKG A;  4HM1 B;  4HM5 B;  1Q40 A;  3Q90 A;  5CF1 A;  3DMC A;  5HGR A;  1O7G B;  1GS3 A;  3G16 A;  3MG2 A;  3EC9 A;  2GBW B;  3MYT A;  4H3U A;  4WP5 A;  1W6Y A;  1VZZ A;  5FW5 A;  5KP1 A;  2OWP A;  3WMD A;  1IDP A;  1WQL B;  4HM4 B;  4K1U A;  4OVM A;  4XDV A;  5STD A;  1UUV B;  3F14 A;  3FGY A;  3ECF A;  4LEH A;  5AIG A;  5AIH A;  3GZY B;  1O7N B;  2JQ5 A;  3I0Y A;  4XBT A;  3FF0 A;  4XDW A;  1OHP A;  4LGQ A;  1C7H A;  3F8X A;  1JB2 A;  3EJV A;  5KP3 A;  1OCV A;  3VSY A;  1O7M B;  1NU3 A;  4HZ9 B;  5AEW B;  6STD A;  2I9W A;  3NV0 A;  4XB5 A;  5DRV A;  3MG1 A;  2BMO B;  4LMI A;  5JPP A;  5EVH A;  4L8P A;  4RZM A;  7STD A;  5IF6 A;  3MG3 A;  2GEX A;  1E3V A;  1QMA A;  4HJL B;  3B8L A;  3RGR A;  3UJM A;  3F7S A;  3S5C A;  1GY6 A;  3VGN A;  4J9A A;  2INX A;  1OGX A;  3D9R A;  1S5A A;  2F86 B;  3EHC A;  3ER7 A;  3G8Z A;  1OH0 A;  1OUN A;  1O7W B;  1UUW B;  2HMN B;  3BLZ A;  3GZB A;  3DUK A;  2A15 A;  1STD A;  2STD A;  4R1K A;  2QGU A;  5IEN A;  1ZO2 A;  4FCM A;  4WWU C;  3T8N A;  2F99 A;  2BMR B;  4HM0 B;  4HZB B;  4I4K A;  4Q53 A;  2GXF A;  2HMM B;  1GYB A;  3FH1 A;  3EN1 B;  3EX9 A;  2CKF B;  2B24 B;  4MJD A;  4HKV B;  2RFR A;  3KZT A; 
#chains in the Genus database with same CATH topology
 1OHS A;  2K54 A;  1NB5 I;  1CQS A;  1Q7Y 4;  6RNT A;  3CCR 3;  4WYK B;  2KF6 A;  3FKA A;  1A2P A;  1W02 A;  3K0Z A;  1B21 A;  3DM8 A;  3ROB A;  3UL6 A;  1YJ9 3;  1BUQ A;  1ROV A;  3BB9 A;  3B7C A;  2GEY A;  1LXE A;  2IUK A;  3Q1C A;  2HML B;  1A2V A;  1MGR A;  3CD6 3;  1TJD A;  4HM2 B;  4R9K A;  2ZDJ A;  3N8B A;  3HX8 A;  3PYJ A;  1N8R 4;  1X1Y A;  2FXT A;  2XSO B;  3QRD A;  5G2G A;  5CK6 A;  1RGC A;  1W4N A;  3D4A A;  3WOF B;  3D5G A;  5D82 A;  4R9L A;  3LZA A;  2QEX 3;  4BTX A;  3GAX A;  1TTO A;  3B4O A;  2ZHX B;  1T3B A;  2BMQ B;  3CC2 3;  4O02 B;  3KII A;  1FUT A;  3BU4 A;  4LSO A;  3SLU A;  5IG5 A;  2W6J H;  1YNV X;  3EBY A;  5AYR B;  5LC6 A;  3FG4 A;  2D1W A;  1BRS A;  1DMM A;  5AYS C;  3I55 3;  4KFD A;  1IV7 A;  4WYK A;  3JUN A;  1EA2 A;  3DXO A;  4MMX B;  1BNG A;  4J5K A;  2YFL B;  3PZW A;  4J8T A;  4X2H A;  1LVN A;  5IW9 A;  4FMA A;  2WGQ A;  2BNG A;  1DE3 A;  1IT7 A;  1CH0 A;  2CFD A;  3RNT A;  3HII A;  3HK4 A;  4EBG A;  1W2B 2;  3HI7 A;  1EEJ A;  2F98 A;  3AGO A;  4PEJ A;  3TDG A;  3JUQ A;  4WFO A;  1W5Z A;  1Q9E A;  4LYL B;  4RNY A;  2W03 A;  1VQ8 3;  4GB5 A;  2XGN A;  3T0U A;  2CHC A;  3X40 A;  3G6E 3;  1I2F A;  5G1L A;  1UUG B;  3FCS B;  1SAR A;  1VQ6 3;  3JUO A;  2W9P A;  1VQO 3;  2KF4 A;  1LOW A;  5IEO A;  1RRL A;  2IA7 A;  2XFT A;  2Z7A A;  4RBN A;  3CXC 2;  2YFJ B;  1B2S A;  4X2O A;  3T8U A;  3CPW 2;  4WWU C;  3EE1 A;  1G0T A;  3NM7 A;  1O7P B;  1DMN A;  2RNT A;  3NBR A;  2OCT A;  9RNT A;  2P38 A;  1BNJ A;  4HYZ A;  4AKZ A;  3KKG A;  4EV5 A;  4HM5 B;  1I3F A;  1PU4 A;  1RNT A;  1T2I A;  3G16 A;  1T2H A;  3HOH A;  4N6V 0;  3X3Z A;  1V74 A;  2GBW B;  1ZGX A;  2J8X B;  1TRP A;  1W6Y A;  1VZZ A;  2BT3 A;  2D42 A;  3Q3F A;  5FW5 A;  3U97 A;  2OWP A;  1GOU A;  2WOH A;  1W6C A;  1SII A;  2CG0 A;  3LT9 A;  1UUV B;  5AIH A;  3ECF A;  4QWT A;  5AIG A;  2CG1 A;  1BNR A;  1JRQ A;  1SIH A;  1JNQ A;  1I2G A;  1C7H A;  4HZ9 B;  2I9W A;  4BU4 A;  4XB5 A;  1IVU A;  3WR2 A;  1VQL 3;  4O8S A;  1WMP A;  5JPP A;  4IPB A;  3KCH A;  2CH9 A;  1K8A 4;  2OOV A;  1TRQ A;  1BAN A;  1QMA A;  4BL2 A;  1NJI 4;  1IYY A;  1EUI C;  4LZI A;  1UDI I;  3AHW A;  1S72 3;  1GY6 A;  1IQX A;  4JF8 A;  1AVL A;  3VGN A;  2F86 B;  3EHC A;  2BIR A;  2C10 A;  1FGO A;  3G8Z A;  1QAK A;  4BL3 A;  3BNE A;  3IMA B;  1UUW B;  3GZB A;  3U1W A;  3X41 A;  3FG3 A;  1ZO2 A;  1YIT 3;  2CFL A;  3MPH A;  5G1K A;  2F99 A;  2BO9 B;  4Q53 A;  1K73 4;  3CC4 3;  2P09 A;  1F8N A;  4EW5 A;  3EN1 B;  2B24 B;  4WHA A;  4HKV B;  5M19 A;  4H61 A;  3CC7 3;  2W04 A;  3FF2 A;  3D5I A;  1BNF A;  1ROA A;  2Z76 A;  5AEU B;  1JN5 A;  3ALA A;  2KXG A;  1JJ2 2;  3LYG A;  1Q42 A;  1NB3 I;  2FGT A;  3FSD A;  3CCU 3;  2YFI B;  1LOX A;  2MF7 A;  1RMS A;  4KFF A;  4CDL A;  4CJN A;  1BNE A;  2HMJ B;  1LOV A;  1N5H A;  3H3H A;  4KVH A;  5M18 A;  2BHM A;  1VQ9 3;  2PNC A;  1BOX A;  4GHO A;  4HAA A;  5KP4 A;  3OX9 A;  5DRE A;  3DGN A;  3F7X A;  3DGO A;  1WNH A;  4FMC A;  5CXO A;  3SVA A;  2Z6B A;  4L8O A;  3X3Y A;  1K9M 4;  1CEW I;  5FGO A;  1DVD A;  1GY7 A;  7GSP A;  1Q86 4;  2HMO B;  3NBB A;  3G0K A;  3CU3 A;  1BIR A;  5IER A;  1Q81 4;  1JKG B;  2LYX A;  4STD A;  1B2U A;  3EQQ B;  1OF5 A;  4N6O B;  1G96 A;  1UGI A;  1OGZ A;  4GL6 A;  4XBY A;  1RLS A;  1Q40 B;  3LT8 A;  4K61 A;  4RNT A;  3CCJ 3;  5JBS A;  3K5T A;  3MSO A;  1JN5 B;  1FUW A;  2F5W A;  1RHL A;  2KAA A;  3OV4 A;  2GU3 A;  1FZU A;  1YGE A;  3F40 A;  1BRI A;  1UCJ A;  1RGF A;  1ULI B;  2RGQ A;  1A2K A;  3OXA A;  1BRK A;  1JZD A;  3URP A;  5CLK A;  2KCD A;  3WHO A;  4GSP A;  2QA4 3;  3UNL A;  1ISK A;  5EQL A;  1N8Q A;  2W56 A;  1MWR A;  1FUS A;  3X42 A;  5RNT A;  2XEP A;  2Z77 A;  4L7K A;  2K0M A;  4XM4 A;  1VQ5 3;  3L0R A;  2CW9 A;  1JKG A;  1UGH I;  3KE7 A;  3QK9 A;  2E2U A;  2KF5 A;  1B2Z A;  1GMP A;  1YJN 3;  3NQZ A;  2CX0 A;  2Q07 A;  5CF1 A;  1A67 A;  4OK0 A;  1R4Y A;  3S67 A;  1OF5 B;  3IJE B;  3EBT A;  3BIR A;  3HZP A;  3UB1 A;  4ORL A;  4U13 A;  5BXQ A;  1HYF A;  4N6L A;  2P0M A;  1BAO A;  1Q40 A;  1RNB A;  1B20 A;  5HGR A;  1BNS A;  1GS3 A;  2V1L A;  1UI8 A;  3EC9 A;  3MG2 A;  3MYT A;  5KP1 A;  1HU9 A;  2CK3 H;  1IQ8 A;  3CCE 3;  2R41 A;  2CFW A;  4HM4 B;  1BSB A;  1X1U A;  2C11 A;  1AVK A;  3GZY B;  2W0Q A;  2JQ5 A;  1VQN 3;  4XBT A;  2SBL A;  4XDW A;  3LML A;  2RSX A;  3VSY A;  5KP3 A;  3F8X A;  1JB2 A;  2AAD A;  3EJV A;  2W56 B;  1YI2 3;  2IUJ A;  3SYU A;  1FGM A;  8RNT A;  3MG1 A;  1WMO A;  1M1K 4;  3MG3 A;  1TFO A;  1E3V A;  1GSP A;  1YGW A;  1RGG A;  2XFS A;  3B8L A;  3F7S A;  3FG1 A;  3WA3 A;  1B3S A;  2INX A;  1OGX A;  3D9R A;  1AV4 A;  1S5A A;  3WDG B;  1BUJ A;  3DH2 A;  4BTW A;  1O7W B;  1UCL A;  3NX0 A;  1BGS A;  1FYS A;  2CIU A;  3DUK A;  1STD A;  1IQY A;  2Y73 A;  5IEN A;  3T8N A;  4FCM A;  1B2M A;  1WTH A;  2BMR B;  4HM0 B;  5BIR A;  1VQK 3;  1I3I A;  2GXF A;  2HMM B;  1GYB A;  3RDE A;  3PGB A;  3G71 3;  4FR9 A;  1GD4 A;  2RFR A;  3LTD A;  3NUV A;  1NDO B;  3S28 A;  2H0I A;  3CCQ 3;  1RN4 A;  4HM6 B;  1QVG 2;  1YIJ 3;  3H51 A;  1QVF 2;  2UGI A;  1RGL A;  1TIJ A;  1AR0 A;  4EV2 A;  3V98 A;  1UCI A;  3K63 A;  1M9G A;  1VQ4 3;  1MWT A;  2ML6 A;  3KSP A;  3AHS A;  4XBX A;  4HM7 B;  1W6G A;  3JUM A;  4OUQ A;  5BU4 A;  1E97 A;  2C4B A;  4N3V A;  1BVI A;  3A76 A;  5AIF A;  1V57 A;  3DGY A;  2B1X B;  1AQZ A;  1GMR A;  3MKI A;  1RRH A;  3STD A;  3KSE D;  1MWS A;  3SED A;  1N5P A;  5TGN A;  1D6U A;  2O9U X;  3NXJ A;  2E2T A;  1K28 A;  1C54 A;  1B27 A;  1W01 A;  2UX0 A;  4TX4 A;  2GBX B;  5EEO A;  3WOD G;  5AII A;  5D83 A;  3UL5 A;  1LOY A;  3GWR A;  1L5G B;  1U8C B;  3LOY A;  4O2H A;  1JB5 A;  3OWY A;  1US1 A;  4AEQ A;  1RGK A;  5CF2 A;  1JBR A;  1I0V A;  4FCZ A;  1AY7 A;  1I70 A;  1KWI A;  1YVS A;  2QIY A;  1BSA A;  1DMQ A;  3PXM A;  3CPO A;  1X1W A;  3HIG A;  4CCV A;  1BSD A;  1V58 A;  3BND A;  1LQG C;  3CNM A;  3JUP A;  1MNL A;  1QJG A;  1VQP 3;  3SOA A;  1E3R A;  1NWW A;  1ULJ B;  3NV0 B;  2CWT A;  3OWU A;  5LC7 A;  2M7O A;  5M1A A;  3ZG0 A;  1N9E A;  4BIR A;  5IG4 A;  3EB8 A;  1D6Y A;  3ZG5 A;  4KZ1 A;  4FCJ A;  3EF8 A;  1U5O A;  1JB4 A;  3GRD A;  3OWS A;  4IIA A;  4MMZ B;  3RGA A;  2XR8 B;  4J9A A;  3GZX B;  2XRX B;  4MEI A;  3CCM 3;  2P0X A;  2RCD A;  3IPT A;  2R4I A;  4HVN A;  1YHQ 3;  4HM1 B;  3J7Y d;  1SPU A;  1LQM B;  3Q90 A;  3DMC A;  2ZA4 A;  1M1X B;  1MOL A;  1IVV A;  3KFQ C;  1BSE A;  1OAC A;  1CYU A;  4N6M A;  1M90 4;  1IDP A;  1N9J A;  1WQL B;  4MMY B;  4R80 A;  1BSC A;  5STD A;  3F14 A;  1BU4 A;  3FGY A;  1D6Z A;  1O7N B;  1A90 A;  3FF0 A;  3ZFZ A;  4NPB A;  6STD A;  1KD1 4;  2P05 A;  1O7M B;  1NU3 A;  5AEW B;  1VQM 3;  3NV0 A;  1RN7 A;  3LTB A;  5I97 A;  1RTU A;  2GU1 A;  3BNB A;  1RCL A;  2WGO A;  4LMI A;  5EVH A;  1DET A;  3LH4 A;  2FNQ A;  3WA2 X;  1YVB I;  7STD A;  5IF6 A;  4HJL B;  3RGR A;  1X1X A;  3AMO A;  3CME 3;  3SXX A;  1STF I;  1IU7 A;  2OQE C;  1Q82 4;  1OH0 A;  2XGL A;  1KC8 4;  4R4K A;  2AAE A;  3BLZ A;  2OTL 3;  1HZ1 A;  4R1K A;  2QGU A;  2YX9 A;  2CWV A;  1I0X A;  4I4K A;  1KSI A;  1IV9 A;  1QAL A;  4JRF A;  4FMB A;  3SX1 A;  2OTJ 3;  2F4Y A;  1Q7H A;  1GOY A;  1PY3 A;  3V92 A;  1T5Y A;  3KZT A;  3CCL 3;  2ZL8 A;  4BTY A;  2H0G A;  4O3V A;  1JBS A;  3D3L A;  2HOH A;  1B2X A;  3K9M C;  1ZX2 A;  3A5E A;  2CFK A;  1YJW 3;  2E2V A;  3CNX A;  3NQY A;  3EN8 A;  4HM3 B;  4HM8 B;  2IMJ A;  3JVC A;  5HOH A;  4G1M B;  5IEP A;  1RKY A;  1BNI A;  3LTA A;  1DYU A;  2W2C A;  2ML5 A;  5IG0 A;  4K90 B;  4NHF A;  4EXR A;  3SOY A;  2CX1 A;  2GSP A;  1EG9 B;  3GSP A;  1UI7 A;  1GD3 A;  3DGL A;  3K7C A;  3M8C A;  2SAR A;  1CYV A;  1RCK A;  4K1V A;  5BVB A;  3CCV 3;  3AMO B;  1LNI A;  4CPK A;  1GMQ A;  3DZL A;  3CMA 3;  2Y74 A;  1NNV A;  1W00 A;  4EC6 A;  3Q2P A;  1DVC A;  4N6T A;  3O8Y A;  4J5G A;  1JZO A;  1RDS A;  1OPY A;  1RSN A;  1SJW A;  1RGE A;  3FZW A;  3LXU X;  1K41 A;  1EQK A;  3NHX A;  4HOH A;  1Y4K A;  1OHO A;  2WO0 A;  1W7C A;  3F9S A;  5D81 A;  3NM2 A;  3PCS A;  3GZR A;  2F5M A;  1VQQ A;  1UW1 A;  3X3X A;  1FA3 A;  2L1S A;  2F56 A;  3AGN A;  1MGW A;  1FGT A;  8CHO A;  2PZV A;  3F8H A;  3G4S 3;  5JPU A;  2CC3 A;  1IK3 A;  2OQE A;  5IG3 A;  4HBR A;  2BU4 A;  1TUH A;  1PYL A;  1SQW A;  3PS8 A;  3WOE B;  5AI1 A;  4KT3 B;  4ILF A;  1KQS 2;  5GSP A;  3S29 A;  1HKX A;  1JV2 B;  2LQV A;  1TP6 A;  2XSH B;  1O7H B;  3OW2 2;  1EKM A;  3FLJ A;  3BNC A;  1GY5 A;  2RBI A;  1I2E A;  1Z1S A;  1BRH A;  3MWZ A;  6GSP A;  3DGM A;  2MC8 A;  1ASK A;  4EYC A;  3E99 A;  1W2Z A;  3MHE A;  3B4P A;  4IT7 A;  1UCK A;  1QAF A;  1RN1 A;  2HMK B;  1IVW A;  2O3O A;  3CCS 3;  3NBJ A;  4NRE A;  1NO3 A;  1G02 A;  4ZM8 A;  1MWU A;  1PFP A;  3DY5 A;  1FW7 A;  1O7G B;  3S27 A;  2CWU A;  4H3U A;  4WP5 A;  4N6N B;  4FMD A;  3WMD A;  1VQ7 3;  1JBT A;  1TFK A;  1I8V A;  1FGQ A;  2JDI H;  1IT8 A;  4K1U A;  2UUG C;  4OVM A;  4XDV A;  4DKI A;  2XH9 A;  2IYJ A;  4LEH A;  2KF3 A;  1WMN A;  1GOV A;  5ELU A;  1RGH A;  3I0Y A;  1J2B A;  1OHP A;  4LGQ A;  3I56 3;  1OCV A;  1BRJ A;  3N54 B;  2L4V A;  1LRA A;  1R4C A;  1IVX A;  5DRV A;  3D79 A;  1TU5 A;  2BMO B;  3N9H A;  1RJO A;  1RGA A;  2OOV C;  1BRG A;  4L8P A;  4RZM A;  2GEX A;  2W9Q A;  4AKY A;  1ZS7 A;  2XF3 A;  3LTC A;  3UJM A;  3S5C A;  2WOF A;  5A0O B;  3ER7 A;  3V99 A;  4I5Q A;  1OUN A;  3VF1 A;  1BRN L;  2H0H A;  2HMN B;  4RNZ A;  2A15 A;  2STD A;  3KN4 A;  7RNT A;  1FGR A;  4HZB B;  2CFG A;  3PCR A;  3FH1 A;  2K3D A;  4KFE A;  2IY2 A;  2KRT A;  3EX9 A;  4N6U A;  5ELJ A;  2CKF B;  4MJD A;  1LNH A; 
#chains in the Genus database with same CATH homology
 1OHS A;  2K54 A;  1NB5 I;  1CQS A;  1Q7Y 4;  3CCR 3;  4WYK B;  3FKA A;  1W02 A;  3K0Z A;  3UL6 A;  3DM8 A;  3ROB A;  1YJ9 3;  1BUQ A;  1ROV A;  3BB9 A;  3B7C A;  2GEY A;  1LXE A;  2IUK A;  3Q1C A;  2HML B;  1A2V A;  3CD6 3;  4HM2 B;  4R9K A;  2ZDJ A;  3N8B A;  3HX8 A;  3PYJ A;  1N8R 4;  2FXT A;  2XSO B;  3QRD A;  5G2G A;  5CK6 A;  1W4N A;  3WOF B;  5D82 A;  4R9L A;  3LZA A;  2QEX 3;  4BTX A;  3GAX A;  3B4O A;  3CC2 3;  2BMQ B;  4O02 B;  3KII A;  4LSO A;  3SLU A;  5IG5 A;  2W6J H;  3EBY A;  5AYR B;  5LC6 A;  3FG4 A;  2D1W A;  1DMM A;  5AYS C;  3I55 3;  4KFD A;  1IV7 A;  4WYK A;  3JUN A;  1EA2 A;  3DXO A;  4MMX B;  2YFL B;  3PZW A;  4J8T A;  4X2H A;  1LVN A;  5IW9 A;  4FMA A;  2WGQ A;  2BNG A;  1IT7 A;  2CFD A;  4EBG A;  1W2B 2;  3HII A;  3HK4 A;  3HI7 A;  2F98 A;  4PEJ A;  3TDG A;  3JUQ A;  4WFO A;  1W5Z A;  4RNY A;  2W03 A;  1VQ8 3;  4GB5 A;  2XGN A;  3T0U A;  2CHC A;  3X40 A;  3G6E 3;  3FCS B;  1VQ6 3;  3JUO A;  2W9P A;  1VQO 3;  5IEO A;  1RRL A;  2IA7 A;  2XFT A;  2Z7A A;  4RBN A;  3CXC 2;  2YFJ B;  4X2O A;  3T8U A;  3CPW 2;  4WWU C;  3EE1 A;  3NM7 A;  1O7P B;  1DMN A;  3NBR A;  2OCT A;  2P38 A;  4HYZ A;  4AKZ A;  3KKG A;  4EV5 A;  4HM5 B;  1PU4 A;  3G16 A;  4N6V 0;  3X3Z A;  1V74 A;  2GBW B;  3U97 A;  1W6Y A;  1VZZ A;  2BT3 A;  2D42 A;  5FW5 A;  2OWP A;  2WOH A;  1W6C A;  1SII A;  2CG0 A;  3LT9 A;  1UUV B;  5AIH A;  3ECF A;  4QWT A;  5AIG A;  2CG1 A;  1JRQ A;  1SIH A;  1JNQ A;  1C7H A;  4HZ9 B;  2I9W A;  4XB5 A;  1IVU A;  1VQL 3;  4O8S A;  1WMP A;  5JPP A;  4IPB A;  2CH9 A;  1K8A 4;  2OOV A;  1QMA A;  1NJI 4;  4LZI A;  1S72 3;  1GY6 A;  1IQX A;  4JF8 A;  1AVL A;  3VGN A;  3EHC A;  2F86 B;  2C10 A;  3G8Z A;  1FGO A;  1QAK A;  3BNE A;  3IMA B;  1UUW B;  3GZB A;  3U1W A;  3X41 A;  3FG3 A;  1ZO2 A;  1YIT 3;  2CFL A;  3MPH A;  1K73 4;  2F99 A;  2BO9 B;  4Q53 A;  3CC4 3;  2P09 A;  1F8N A;  3EN1 B;  2B24 B;  4WHA A;  4HKV B;  4H61 A;  3CC7 3;  2W04 A;  3FF2 A;  1ROA A;  2Z76 A;  5AEU B;  1JN5 A;  3ALA A;  2KXG A;  1JJ2 2;  3LYG A;  1Q42 A;  1NB3 I;  2FGT A;  3FSD A;  3CCU 3;  2YFI B;  1LOX A;  2MF7 A;  4KFF A;  4CDL A;  2HMJ B;  1N5H A;  3H3H A;  4KVH A;  2BHM A;  1VQ9 3;  2PNC A;  5KP4 A;  3OX9 A;  5DRE A;  3DGN A;  3F7X A;  3DGO A;  1WNH A;  4FMC A;  5CXO A;  3SVA A;  2Z6B A;  4L8O A;  3X3Y A;  1K9M 4;  1CEW I;  5FGO A;  1DVD A;  1GY7 A;  1Q86 4;  2HMO B;  3NBB A;  3G0K A;  3CU3 A;  5IER A;  1Q81 4;  1JKG B;  2LYX A;  4STD A;  3EQQ B;  1OF5 A;  4N6O B;  1G96 A;  1OGZ A;  4GL6 A;  4XBY A;  1Q40 B;  3LT8 A;  4K61 A;  3CCJ 3;  5JBS A;  3K5T A;  3MSO A;  1JN5 B;  1FUW A;  3OV4 A;  2GU3 A;  1YGE A;  3F40 A;  1ULI B;  2RGQ A;  1A2K A;  3OXA A;  2CKF B;  5CLK A;  2KCD A;  2QA4 3;  3UNL A;  1ISK A;  5EQL A;  1N8Q A;  2W56 A;  3X42 A;  2XEP A;  2Z77 A;  4L7K A;  2K0M A;  4XM4 A;  1VQ5 3;  3L0R A;  2CW9 A;  1JKG A;  3KE7 A;  3QK9 A;  2E2U A;  1YJN 3;  3NQZ A;  2Q07 A;  5CF1 A;  1A67 A;  4OK0 A;  3S67 A;  1OF5 B;  3IJE B;  3EBT A;  3HZP A;  3UB1 A;  4ORL A;  4U13 A;  5BXQ A;  4N6L A;  2P0M A;  1Q40 A;  5HGR A;  1GS3 A;  2V1L A;  1UI8 A;  3EC9 A;  3MG2 A;  3MYT A;  5KP1 A;  1HU9 A;  2CK3 H;  1IQ8 A;  3CCE 3;  4HM4 B;  2CFW A;  2C11 A;  1AVK A;  3GZY B;  2W0Q A;  2JQ5 A;  1VQN 3;  4XBT A;  2SBL A;  4XDW A;  3LML A;  2RSX A;  3VSY A;  5KP3 A;  3F8X A;  1JB2 A;  3EJV A;  1YI2 3;  2W56 B;  2IUJ A;  1FGM A;  3MG1 A;  1WMO A;  1M1K 4;  3MG3 A;  1TFO A;  1E3V A;  2XFS A;  3B8L A;  3F7S A;  3FG1 A;  3WA3 A;  2INX A;  1OGX A;  3D9R A;  1AV4 A;  1S5A A;  3WDG B;  4BTW A;  1O7W B;  3NX0 A;  2CIU A;  1STD A;  1IQY A;  2Y73 A;  5IEN A;  3T8N A;  4FCM A;  1WTH A;  2BMR B;  4HM0 B;  1VQK 3;  2GXF A;  2HMM B;  1GYB A;  3RDE A;  3PGB A;  3G71 3;  4FR9 A;  1GD4 A;  2RFR A;  3LTD A;  3NUV A;  1NDO B;  3S28 A;  3CCQ 3;  4HM6 B;  1QVG 2;  1YIJ 3;  3H51 A;  1QVF 2;  1TIJ A;  1AR0 A;  4EV2 A;  3V98 A;  3K63 A;  1M9G A;  1VQ4 3;  2ML6 A;  3KSP A;  4XBX A;  4HM7 B;  1W6G A;  3JUM A;  4OUQ A;  1E97 A;  4N3V A;  3A76 A;  5AIF A;  2B1X B;  3MKI A;  1RRH A;  3STD A;  3KSE D;  3SED A;  1N5P A;  5TGN A;  1D6U A;  2O9U X;  3NXJ A;  2E2T A;  1K28 A;  1W01 A;  2UX0 A;  4TX4 A;  2GBX B;  5EEO A;  3WOD G;  5AII A;  5D83 A;  3UL5 A;  3GWR A;  1L5G B;  1U8C B;  3LOY A;  4O2H A;  1JB5 A;  3OWY A;  1US1 A;  4AEQ A;  5CF2 A;  4FCZ A;  1KWI A;  2QIY A;  1DMQ A;  3PXM A;  3CPO A;  3HIG A;  4CCV A;  3BND A;  3CNM A;  3JUP A;  1MNL A;  1QJG A;  1VQP 3;  3SOA A;  1E3R A;  1NWW A;  1ULJ B;  3NV0 B;  2CWT A;  3OWU A;  5LC7 A;  2M7O A;  1N9E A;  5IG4 A;  3EB8 A;  1D6Y A;  4KZ1 A;  4FCJ A;  3EF8 A;  1U5O A;  1JB4 A;  3GRD A;  3OWS A;  4IIA A;  4MMZ B;  3RGA A;  2XR8 B;  4J9A A;  3GZX B;  2XRX B;  4MEI A;  3CCM 3;  2P0X A;  2RCD A;  3IPT A;  2R4I A;  4HVN A;  1YHQ 3;  4HM1 B;  3J7Y d;  1SPU A;  3Q90 A;  3DMC A;  1M1X B;  1MOL A;  1IVV A;  3KFQ C;  1OAC A;  1CYU A;  4N6M A;  1M90 4;  1IDP A;  1N9J A;  1WQL B;  4MMY B;  4R80 A;  5STD A;  3F14 A;  3FGY A;  1D6Z A;  1O7N B;  1A90 A;  3FF0 A;  6STD A;  1KD1 4;  2P05 A;  1O7M B;  1NU3 A;  5AEW B;  1VQM 3;  3NV0 A;  1RN7 A;  3LTB A;  5I97 A;  2GU1 A;  3BNB A;  2WGO A;  4LMI A;  5EVH A;  3LH4 A;  2FNQ A;  3WA2 X;  1YVB I;  7STD A;  5IF6 A;  4HJL B;  3RGR A;  3AMO A;  3CME 3;  3SXX A;  1STF I;  1IU7 A;  2OQE C;  1Q82 4;  1OH0 A;  2XGL A;  1KC8 4;  4R4K A;  3BLZ A;  2OTL 3;  4R1K A;  2QGU A;  2YX9 A;  2CWV A;  4I4K A;  1KSI A;  1IV9 A;  1QAL A;  4JRF A;  4FMB A;  3SX1 A;  2OTJ 3;  3V92 A;  1T5Y A;  3KZT A;  3CCL 3;  2ZL8 A;  4BTY A;  4O3V A;  3D3L A;  3K9M C;  1ZX2 A;  2CFK A;  1YJW 3;  2E2V A;  3CNX A;  3NQY A;  3EN8 A;  4HM3 B;  4HM8 B;  2IMJ A;  3JVC A;  1RKY A;  4G1M B;  5IEP A;  3LTA A;  1DYU A;  2W2C A;  2ML5 A;  5IG0 A;  4K90 B;  4NHF A;  4EXR A;  3SOY A;  1EG9 B;  1UI7 A;  1GD3 A;  3DGL A;  3K7C A;  3M8C A;  5BVB A;  1CYV A;  4K1V A;  3CCV 3;  3AMO B;  3DZL A;  3CMA 3;  2Y74 A;  1W00 A;  4EC6 A;  3Q2P A;  1DVC A;  4N6T A;  3O8Y A;  1OPY A;  1SJW A;  3FZW A;  3LXU X;  1K41 A;  1EQK A;  3NHX A;  1Y4K A;  1OHO A;  2WO0 A;  1W7C A;  3F9S A;  5D81 A;  3NM2 A;  3PCS A;  3GZR A;  1FA3 A;  3X3X A;  1UW1 A;  1FGT A;  8CHO A;  2PZV A;  3F8H A;  3G4S 3;  5JPU A;  2CC3 A;  1IK3 A;  2OQE A;  5IG3 A;  4HBR A;  1TUH A;  1SQW A;  3PS8 A;  3WOE B;  5AI1 A;  1KQS 2;  3S29 A;  1HKX A;  1JV2 B;  2LQV A;  1TP6 A;  2XSH B;  1O7H B;  3OW2 2;  1EKM A;  3FLJ A;  3BNC A;  1GY5 A;  1Z1S A;  3MWZ A;  3DGM A;  2MC8 A;  1ASK A;  4EYC A;  3E99 A;  1W2Z A;  3MHE A;  3B4P A;  4IT7 A;  1QAF A;  2HMK B;  1IVW A;  2O3O A;  3CCS 3;  3NBJ A;  4NRE A;  1NO3 A;  4ZM8 A;  1PFP A;  3DY5 A;  1O7G B;  3S27 A;  2CWU A;  4H3U A;  4WP5 A;  4N6N B;  4FMD A;  3WMD A;  1VQ7 3;  1TFK A;  1FGQ A;  2JDI H;  1IT8 A;  4K1U A;  4OVM A;  4XDV A;  2XH9 A;  4LEH A;  5ELU A;  1WMN A;  1J2B A;  3I0Y A;  1OHP A;  4LGQ A;  3I56 3;  1OCV A;  3N54 B;  2L4V A;  1R4C A;  1IVX A;  5DRV A;  1TU5 A;  2BMO B;  3N9H A;  1RJO A;  2OOV C;  4L8P A;  4RZM A;  2GEX A;  2W9Q A;  4AKY A;  2XF3 A;  3LTC A;  3UJM A;  3S5C A;  2WOF A;  5A0O B;  3ER7 A;  3V99 A;  1OUN A;  3VF1 A;  2HMN B;  4RNZ A;  2A15 A;  2STD A;  3KN4 A;  1FGR A;  4HZB B;  2CFG A;  3PCR A;  3FH1 A;  4KFE A;  2KRT A;  3EX9 A;  4N6U A;  5ELJ A;  3DUK A;  4MJD A;  1LNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...