1OUNA

Crystal structure of nuclear transport factor 2 (ntf2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title The 1.6 angstroms resolution crystal structure of nuclear transport factor 2 (NTF2).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ounA00
3H3HA 1W00A 4HM5B 1Q40B 4WYKB 3EQQB 3ECFA 4HZBB 3EN8A 1U5OA 1S5AA 3B4OA 5BXQA 1NU3A 1EG9B 4HVNA 1OH0A 3B7CA 2YFLB 4XDWA 2BMQB 1ASKA 3OXAA 2GEXA 4H3UA 5AIFA 2HMJB 3FGYA 3MG3A 3CPOA 3FLJA 3VSYA 4R1KA 3F9SA 3MSOA 3F14A 5KP4A 3F7SA 2JQ5A 4XBYA 2F98A 1TP6A 3EF8A 4HKVB 4HM2B 4Q53A 5AIGA 1W6YA 3S5CA 5IF6A 2YFIB 5IG4A 2GBXB 1DMMA 1OHSA 1JB4A 2GXFA 3KE7A 2Z7AA 5KP1A 4XBTA 1OPYA 2XSHB 5AEWB 2HMOB 3B8LA 1OF5A 3FKAA 1CQSA 2B24B 3RGAA 1JB5A 1TUHA 4LEHA 2IMJA 1O7PB 3CU3A 3A76A 4L7KA 3DXOA 3UJMA 4K1VA 4HM0B 5D82A 1QMAA 5AEUB 4KVHA 3EN1B 3SOAA 3NV0A 4K1UA 5D81A 3LZAA 1OCVA 3NXJA 2PZVA 5CXOA 4HJLB 1ULJB 4OUQA 3STDA 3LYGA 1GY5A 5CF1A 2QGUA 3EJVA 1GYBA 4IIAA 4R9KA 3HX8A 6STDA 3BLZA 3FF2A 5IG0A 1NDOB 3EHCA 2YFJB 3UNLA 5D83A 2R4IA 3NM2A 1E3VA 3JUOA 2XR8B 4WWUC 1VZZA 2STDA 4HM8B 3OWYA 4FCJA 2QIYA 4XDVA 3VGNA 5AIHA 4XM4A 1Q40A 4MJDA 4WYKA 2INXA 2F86B 4HM7B 1A2KA 1Z1SA 2A15A 3G8ZA 3MYTA 1GY6A 3KSPA 4L8OA 3Q90A 1ISKA 3HK4A 2HMMB 2RFRA 3EC9A 5FW5A 5DRVA 1UUWB 5DREA 5EVHA 1QJGA 1ZX2A 1O7NB 3NHXA 3NV0B 3MG1A 5IENA 7STDA 3DMCA 4LGQA 1JKGB 5HGRA 4J8TA 3GZBA 1W01A 1O7GB 5AI1A 2RGQA 1JB2A 3G0KA 3GWRA 2BMOB 3H51A 3KKGA 2XRXB 5G2GA 2HMLB 3OV4A 5CLKA 5IEOA 2F99A 3DM8A 2BMRB 4LMIA 3T8NA 5BVBA 1E3RA 3CNXA 1STDA 3T8UA 4GB5A 1GY7A 3IPTA 1ULIB 2B1XB 4FCMA 3FSDA 3JUPA 4OVMA 3OWSA 4HM4B 2W2CA 8CHOA 1WQLB 4R9LA 3GZRA 4X2HA 3JUQA 3K7CA 1OGZA 1IDPA 3SEDA 2RCDA 2Z76A 2BNGA 3F40A 1JN5A 1GS3A 1DMNA 1EA2A 4N3VA 1O7WB 2K54A 2Z77A 5CF2A 1C7HA 4XBXA 3EBTA 1O7HB 5TGNA 3KZTA 1O7MB 4HM6B 2UX0A 4PEJA 2OWPA 5AIIA 4I4KA 4HM3B 3EBYA 3GZYB 1OF5B 4X2OA 2XSOB 4XB5A 3MHEA 5JPUA 1ZO2A 2HMKB 1NWWA 3M8CA 2CKFB 1OGXA 3SOYA 3NUVA 5IEPA 1UUVB 1W02A 4U13A 3F7XA 5IG3A 3CNMA 1Q42A 3FF0A 1OHPA 3B4PA 1DMQA 4STDA 5CK6A 3WMDA 1OHOA 1SJWA 4HM1B 4RZMA 5IERA 3JUNA 2GEYA 3OWUA 3K0ZA 2CHCA 3FZWA 3RGRA 1E97A 3G16A 3ER7A 3DZLA 3DUKA 5IG5A 3MG2A 1JN5B 3I0YA 5JPPA 3F8HA 3D9RA 3JUMA 1BUQA 3ROBA 1HKXA 3NBRA 3BB9A 1OUNA 5KP3A 1K41A 4CDLA 4L8PA 3F8XA 4WP5A 4ORLA 3MKIA 3OX9A 3E99A 4J9AA 3FH1A 3GRDA 2HMNB 2GBWB 4HZ9B 3GZXB 5STDA 1AR0A 3EX9A 1JKGA 2I9WA 3HZPA
chains in the Genus database with same CATH superfamily
3H3HA 1W00A 1LOYA 3PS8A 5A0OB 1NB5I 4HM5B 1Q40B 4WYKB 1BSEA 3EQQB 3WOFB 4N6UA 3ECFA 1K28A 1VQM3 2K0MA 3Q3FA 4FMBA 4HZBB 1FYSA 4K61A 3DGMA 4MEIA 4RNZA 3EN8A 1YIT3 2P0MA 3CC43 1U5OA 4EV5A 3V92A 1S5AA 3B4OA 4GSPA 5BXQA 3VF1A 1NU3A 1GSPA 4IT7A 1VQ63 1ZGXA 1DVCA 1IYYA 1BRSA 1EG9B 3AMOA 1OH0A 3B7CA 1TFKA 2YFLB 4HVNA 2WGOA 4XDWA 8RNTA 2QEX3 2R41A 1W6GA 4OK0A 4R4KA 2BMQB 4RNYA 1MWRA 3D3LA 3HIGA 1IVWA 3SVAA 1ASKA 3OXAA 4IPBA 1NJI4 1YJN3 2GEXA 4H3UA 5AIFA 1IV9A 1I2GA 4TX4A 1VQ93 2HMJB 3FGYA 3MG3A 1RGFA 3CPOA 3FLJA 1FGOA 3SXXA 3VSYA 4AKYA 1BOXA 4BTWA 1RGGA 2W56A 4N6OB 1BSAA 1F8NA 4R1KA 3CXC2 1GMRA 1W2B2 1JZOA 3D5IA 1B2ZA 3RNTA 3F9SA 2E2VA 3MSOA 3F14A 3TDGA 1X1WA 5KP4A 3CPW2 3F7SA 2BO9B 2JQ5A 4XBYA 1WMPA 2F98A 1TP6A 3EF8A 1N5PA 1RN7A 1STFI 1JV2B 2HOHA 2O3OA 4HKVB 4HM2B 4Q53A 5AIGA 1BRNL 1RNBA 1W6YA 3S5CA 2AADA 3NBBA 5IF6A 1BRGA 2YFIB 2GU3A 4CJNA 2GBXB 5IG4A 3LTDA 3CC73 5IW9A 1DMMA 1B3SA 1B21A 3AGNA 3S27A 1OHSA 1DETA 5ELUA 1B2XA 1WMOA 1G02A 1JB4A 1W4NA 2GXFA 3QK9A 1CH0A 3KE7A 4FMCA 2OTL3 2CWUA 2Z7AA 3X3XA 1Y4KA 5KP1A 5RNTA 4XBTA 1YGEA 4EXRA 1OPYA 2XSHB 5AEWB 1VQL3 1SIHA 2UGIA 3FG4A 4K90B 2HMOB 2IYJA 1A90A 1EEJA 3JVCA 4NPBA 3DGLA 3B8LA 3MPHA 1ROAA 1HYFA 1OF5A 3FKAA 1CQSA 1LXEA 4AEQA 2XFSA 2B24B 1RDSA 3NX0A 1N8R4 1GMQA 1JB5A 1RGLA 1TUHA 3HI7A 4LEHA 5LC7A 1LRAA 2IMJA 3RGAA 1A67A 3FG3A 1LOVA 3LT8A 1O7PB 4N6MA 1RGHA 3CU3A 4KFFA 1QALA 3A76A 3FG1A 4L7KA 1UCKA 4MMXB 2RSXA 3DXOA 2CC3A 2C11A 4EW5A 3UJMA 1EKMA 1B27A 1TRQA 4HM0B 4K1VA 1QMAA 3DGOA 5D82A 5AEUB 1KSIA 1G96A 1TTOA 1X1XA 3Q1CA 4KVHA 2CG1A 1UGIA 1KWIA 4J5KA 1R4CA 1VQK3 2LYXA 3EN1B 3SOAA 2Z6BA 4BTYA 3NV0A 4O3VA 2WOHA 1IVVA 3X41A 1U8CB 1JJ22 2GSPA 1IQXA 3BNDA 4BL3A 5BIRA 1DVDA 1IV7A 1BNFA 2E2TA 4K1UA 3T0UA 1PYLA 5D81A 1I0VA 1PU4A 1FW7A 3S28A 2WGQA 3WR2A 3BIRA 3LZAA 1OCVA 3NXJA 2PZVA 2JDIH 2IA7A 2BU4A 5EEOA 3G6E3 1MOLA 1BUJA 2SARA 2CH9A 1N8QA 5CXOA 4HJLB 1IK3A 1VQP3 3MWZA 1ULJB 3LTCA 3AGOA 3HOHA 4OUQA 3CCU3 3STDA 1S723 3LYGA 1IQ8A 2ZL8A 3PXMA 1BNEA 1GY5A 3ZFZA 5CF1A 2CG0A 1GD3A 2PNCA 1CYUA 2KF5A 1LOXA 1VQ73 2BT3A 1KQS2 3CD63 3Q2PA 5M18A 2CIUA 3OW22 3WA3A 1RGEA 4HOHA 3URPA 4FR9A 1G0TA 4RNTA 1I70A 2QGUA 4I5QA 5GSPA 3EJVA 1GYBA 4IIAA 3G4S3 1K734 1C54A 2L1SA 4R9KA 3HX8A 1X1YA 5AYSC 3N9HA 6STDA 3BLZA 3FF2A 5IG0A 2CFLA 1BU4A 1AY7A 1NDOB 1GOYA 1UDII 3EHCA 2YFJB 3U97A 4LYLB 1IQYA 3UNLA 1X1UA 5D83A 2R4IA 3GAXA 1BNIA 3NM2A 4RBNA 1E3VA 2OQEC 1IT7A 2OCTA 3JUOA 2XR8B 4WWUC 1VZZA 2STDA 4HM8B 3OWYA 1GOVA 1MGWA 2SBLA 1FGRA 3D5GA 2MF7A 4FCJA 1SIIA 2OTJ3 2QIYA 4XDVA 1TFOA 1D6ZA 5LC6A 3VGNA 4AKZA 3SX1A 1I3FA 2CFKA 4HYZA 5AIHA 1AV4A 1M1K4 3NQYA 3X3ZA 1SQWA 2GU1A 1TU5A 1MWTA 1I0XA 3LXUX 4FCZA 5AYRB 1QAKA 4XM4A 1Q40A 4MJDA 4WYKA 3WHOA 2INXA 2F86B 3L0RA 3KCHA 3IJEB 4HM7B 5G1KA 3UL6A 1YHQ3 1YGWA 1MGRA 1SARA 1UI8A 1I2FA 1A2KA 1Z1SA 5I97A 3KFQC 2A15A 3WOEB 3G8ZA 3MYTA 1Q824 1YJ93 1GY6A 1GD4A 3KSPA 4L8OA 4EYCA 3I563 1M9GA 3Q90A 1ISKA 1DE3A 3HK4A 2HMMB 2RFRA 4FMAA 2ML5A 3EC9A 5FW5A 5DRVA 1RLSA 1UUWB 2KAAA 5DREA 2D42A 1QJGA 2Y73A 1ZX2A 3GSPA 1GMPA 5EVHA 2IUJA 1O7NB 3NHXA 4DKIA 3NV0B 3PYJA 3MG1A 1MWUA 3PZWA 4HAAA 4BU4A 5IENA 1VQ43 1FUSA 1VQN3 2YX9A 4BTXA 7STDA 1CYVA 1WNHA 3DMCA 4LGQA 1JKGB 2K3DA 5HGRA 1RCLA 4J8TA 1UGHI 2W03A 3GZBA 3LMLA 1V74A 2Q07A 1W01A 3CCR3 3CCS3 1UI7A 1O7GB 3DGNA 5AI1A 4EV2A 2IUKA 2ML6A 2RGQA 1JB2A 3G0KA 3GWRA 3D79A 2BMOB 3J7Yd 1PFPA 3LTAA 2C4BA 2KRTA 3H51A 3KKGA 2XRXB 4JF8A 5G2GA 1M904 3KSED 6RNTA 2BIRA 2HMLB 3OV4A 5CLKA 2F56A 2OOVC 3AHSA 4KFDA 1D6UA 1LNHA 1T3BA 2F99A 2RBIA 5IEOA 4EBGA 3CMA3 3DM8A 1JNQA 2F4YA 1VQ53 2BMRB 1BGSA 2WOFA 4LMIA 3T8NA 4J5GA 5BVBA 1W6CA 1E3RA 2H0GA 3CNXA 4KT3B 1STDA 1RTUA 1W5ZA 2LQVA 3T8UA 1V58A 2W04A 3ALAA 3PGBA 3AMOB 4GB5A 3A5EA 1GY7A 2CFGA 4BL2A 1JBTA 3X42A 3WDGB 3S67A 1FUTA 3IPTA 1DYUA 1SPUA 5M1AA 1ULIB 2B1XB 4FCMA 4LZIA 2OQEA 1UW1A 1RRLA 3FSDA 3JUPA 3PCSA 2KCDA 4N6LA 4OVMA 2XEPA 3OWSA 4NREA 4HM4B 4O8SA 3BNCA 4GHOA 2W2CA 2H0HA 3I553 2V1LA 8CHOA 1RRHA 2E2UA 1IVUA 3ZG5A 2P38A 1WQLB 4R9LA 1W7CA 3X3YA 2P09A 3GZRA 3PCRA 4O2HA 1GOUA 3V99A 2CX1A 3N54B 2W56B 3JUQA 1IT8A 2FXTA 1OGZA 3K7CA 4X2HA 1IDPA 4O02B 3UL5A 1B20A 3SEDA 2CWVA 2RCDA 2Z76A 3EE1A 1I8VA 3CCL3 2ZHXB 2BNGA 5BU4A 1Q864 1FGQA 1RGKA 3X40A 1UCIA 4ILFA 1B2SA 1VQ83 1RN4A 3F40A 2D1WA 1JN5A 1GS3A 1LQMB 1BNJA 3G713 1DMNA 5FGOA 1EA2A 3CCQ3 2QA43 3HIIA 3LOYA 1BSCA 1W2ZA 2CW9A 4JRFA 1RKYA 3SYUA 1Q7Y4 4N3VA 1TRPA 3S29A 1O7WB 1JBRA 1Q814 2K54A 2Z77A 1WMNA 5CF2A 1C7HA 2H0IA 2F5WA 6GSPA 4XBXA 2W9PA 1R4YA 3EBTA 1O7HB 3NBJA 3CCM3 3CCE3 4G1MB 3K63A 3BU4A 3QRDA 5TGNA 1QVG2 1QVF2 1I3IA 4LSOA 4ZM8A 3KZTA 1YI23 1Q9EA 4CPKA 2CK3H 1NNVA 5G1LA 4CCVA 1B2UA 1O7MB 1EQKA 2IY2A 4N6NB 9RNTA 2FGTA 3DGYA 4EC6A 1T5YA 1LQGC 2AAEA 1MNLA 1AVKA 3KN4A 4HM6B 3O8YA 2W9QA 1T2IA 2UX0A 2XFTA 3EB8A 2OWPA 4N6V0 4NHFA 4PEJA 3ZG0A 4BIRA 3BNEA 5AIIA 1UUGB 4I4KA 4HM3B 1YNVX 3EBYA 3GZYB 3U1WA 1BRKA 3WA2X 1VQO3 1OF5B 1IVXA 1FGMA 1LOWA 2O9UX 2XSOB 3LTBA 4X2OA 1FA3A 4H61A 4XB5A 1TJDA 3LH4A 2ZDJA 3MHEA 1M1XB 2OOVA 3WODG 1N9EA 3SLUA 1CEWI 1BRIA 4KZ1A 5JPUA 1ZO2A 2HMKB 2XH9A 1KC84 1NWWA 1K9M4 3UB1A 1HU9A 1RMSA 1BRJA 2XGLA 3M8CA 2MC8A 5HOHA 2CKFB 1OGXA 3SOYA 3NUVA 5IEPA 2J8XB 1UUVB 1RNTA 1OACA 1BNRA 1ROVA 1W02A 4U13A 3CCV3 3F7XA 1RSNA 2WO0A 1T2HA 2XF3A 3DY5A 2F5MA 3CNMA 5IG3A 1AVLA 2C10A 1RGAA 1Q42A 3CCJ3 3FF0A 1OHPA 3NQZA 3B4PA 3KIIA 1L5GB 2KXGA 1DMQA 4STDA 3DH2A 2CX0A 5CK6A 3WMDA 4R80A 7GSPA 1KD14 1NO3A 1OHOA 1US1A 1SJWA 4HM1B 1BANA 4RZMA 5IERA 3JUNA 4HBRA 2KF4A 2GEYA 2KF3A 1D6YA 1RHLA 3OWUA 2UUGC 1I2EA 3K0ZA 1QAFA 2CHCA 1BVIA 2P05A 5EQLA 1B2MA 3FZWA 1J2BA 2W0QA 1TIJA 1MWSA 2FNQA 3RGRA 1E97A 1V57A 3G16A 3ER7A 1YJW3 4MMZB 2CFWA 2CWTA 1RJOA 2M7OA 3DZLA 4FMDA 1BNSA 1IU7A 1N5HA 3DUKA 5IG5A 3MG2A 3RDEA 1JN5B 3I0YA 4QWTA 1A2PA 2KF6A 5JBSA 1NB3I 3D4AA 5JPPA 1ZS7A 1JRQA 3F8HA 1RN1A 3D9RA 3JUMA 2P0XA 1BUQA 3ROBA 1HKXA 3NBRA 4WFOA 1UCJA 2ZA4A 1Q7HA 1BSDA 1LVNA 1LNIA 3BB9A 1RGCA 3K5TA 1BSBA 1UCLA 1OUNA 5KP3A 1K41A 4CDLA 1K8A4 4L8PA 1PY3A 3F8XA 4WP5A 1RCKA 4N6TA 4ORLA 2Y74A 3MKIA 1YVBI 1A2VA 3K9MC 2L4VA 1JBSA 3OX9A 1BAOA 1N9JA 1VQQA 3NM7A 3CME3 3E99A 4KFEA 2XGNA 2BHMA 2W6JH 1WTHA 3FH1A 3LT9A 4J9AA 7RNTA 3GRDA 1EUIC 3V98A 2HMNB 5ELJA 3AHWA 3N8BA 2GBWB 1BIRA 4HZ9B 4WHAA 1BNGA 1JZDA 1YIJ3 4GL6A 3GZXB 5M19A 1AQZA 1BRHA 3CC23 5STDA 1FGTA 1YVSA 2RNTA 1AR0A 3BNBA 3EX9A 3IMAB 1FUWA 1JKGA 1FZUA 2I9WA 3FCSB 4MMYB 3HZPA 1HZ1A 2CFDA
chains in the Genus database with same CATH topology
3H3HA 1W00A 3PS8A 5A0OB 1NB5I 4HM5B 1Q40B 4WYKB 3EQQB 3WOFB 4N6UA 3ECFA 1K28A 1VQM3 2K0MA 4FMBA 4HZBB 4K61A 3DGMA 4MEIA 4RNZA 3EN8A 1YIT3 2P0MA 3CC43 1U5OA 4EV5A 3V92A 1S5AA 3B4OA 5BXQA 3VF1A 1NU3A 4IT7A 1VQ63 1DVCA 1EG9B 3AMOA 1OH0A 3B7CA 1TFKA 2YFLB 4HVNA 2WGOA 4XDWA 2QEX3 1W6GA 4OK0A 4R4KA 2BMQB 4RNYA 3D3LA 3HIGA 1IVWA 3SVAA 1ASKA 3OXAA 4IPBA 1NJI4 1YJN3 2GEXA 4H3UA 5AIFA 1IV9A 1VQ93 4TX4A 2HMJB 3FGYA 3MG3A 3CPOA 3FLJA 1FGOA 3SXXA 3VSYA 4AKYA 4BTWA 4N6OB 2W56A 4R1KA 1F8NA 3CXC2 1W2B2 3F9SA 2E2VA 3MSOA 3F14A 3TDGA 5KP4A 3CPW2 3F7SA 2BO9B 2JQ5A 4XBYA 1WMPA 2F98A 1TP6A 3EF8A 1N5PA 1RN7A 1STFI 1JV2B 2O3OA 4HKVB 4HM2B 4Q53A 5AIGA 1W6YA 3S5CA 3NBBA 5IF6A 2YFIB 2GU3A 5IG4A 2GBXB 3LTDA 3CC73 5IW9A 1DMMA 3S27A 1OHSA 5ELUA 1WMOA 1JB4A 1W4NA 2GXFA 3QK9A 3KE7A 4FMCA 2OTL3 2CWUA 2Z7AA 3X3XA 1Y4KA 5KP1A 4XBTA 1YGEA 4EXRA 1OPYA 2XSHB 5AEWB 1VQL3 1SIHA 3FG4A 4K90B 2HMOB 1A90A 3JVCA 3DGLA 3B8LA 3MPHA 1ROAA 1OF5A 3FKAA 1CQSA 1LXEA 4AEQA 2XFSA 2B24B 3NX0A 1N8R4 3RGAA 1JB5A 1TUHA 3HI7A 4LEHA 5LC7A 2IMJA 1A67A 3FG3A 3LT8A 1O7PB 4N6MA 3CU3A 4KFFA 1QALA 3A76A 3FG1A 4L7KA 4MMXB 2RSXA 3DXOA 2CC3A 2C11A 3UJMA 1EKMA 4K1VA 4HM0B 5D82A 1QMAA 3DGOA 5AEUB 1KSIA 1G96A 3Q1CA 4KVHA 2CG1A 1KWIA 1R4CA 1VQK3 2LYXA 3EN1B 3SOAA 2Z6BA 4BTYA 3NV0A 4O3VA 2WOHA 1IVVA 3X41A 1U8CB 1JJ22 1IQXA 3BNDA 1DVDA 1IV7A 2E2TA 4K1UA 3T0UA 5D81A 1PU4A 3S28A 2WGQA 3LZAA 1OCVA 3NXJA 2PZVA 2JDIH 2IA7A 5EEOA 3G6E3 1MOLA 2CH9A 1N8QA 5CXOA 4HJLB 1IK3A 1VQP3 3MWZA 1ULJB 3LTCA 4OUQA 1S723 3CCU3 3STDA 3LYGA 1IQ8A 2ZL8A 3PXMA 1GY5A 5CF1A 2CG0A 1GD3A 2PNCA 1CYUA 1KQS2 1LOXA 1VQ73 2BT3A 3CD63 3Q2PA 2CIUA 3OW22 3WA3A 4FR9A 2QGUA 3EJVA 1GYBA 4IIAA 3G4S3 4R9KA 3HX8A 5AYSC 3N9HA 6STDA 3BLZA 3FF2A 5IG0A 2CFLA 1NDOB 3EHCA 2YFJB 3U97A 1IQYA 3UNLA 5D83A 2R4IA 3GAXA 3NM2A 4RBNA 1E3VA 2OQEC 1IT7A 2OCTA 3JUOA 2XR8B 4WWUC 1VZZA 2STDA 4HM8B 3OWYA 2SBLA 1FGRA 2MF7A 4FCJA 1SIIA 2OTJ3 2QIYA 4XDVA 1TFOA 1D6ZA 5LC6A 3VGNA 4AKZA 3SX1A 2CFKA 4HYZA 5AIHA 1AV4A 1M1K4 3NQYA 3X3ZA 1SQWA 2GU1A 1TU5A 3LXUX 4FCZA 5AYRB 1QAKA 4XM4A 1Q40A 4MJDA 4WYKA 2INXA 2F86B 3L0RA 1YHQ3 3IJEB 4HM7B 3UL6A 1UI8A 1A2KA 1Z1SA 5I97A 3KFQC 2A15A 3WOEB 3G8ZA 3MYTA 1Q824 1YJ93 1GY6A 1GD4A 3KSPA 4L8OA 4EYCA 3I563 1M9GA 3Q90A 1ISKA 3HK4A 2HMMB 2RFRA 4FMAA 2ML5A 3EC9A 5FW5A 5DRVA 1UUWB 5DREA 2D42A 1QJGA 2Y73A 1ZX2A 5EVHA 2IUJA 1O7NB 3NHXA 3NV0B 3PYJA 3MG1A 3PZWA 5IENA 1VQ43 1VQN3 2YX9A 4BTXA 7STDA 1CYVA 1WNHA 3DMCA 4LGQA 1JKGB 1K734 5HGRA 4J8TA 3GZBA 2W03A 3LMLA 1V74A 2Q07A 1W01A 3CCR3 3CCS3 1UI7A 1O7GB 3DGNA 5AI1A 4EV2A 2IUKA 2ML6A 2RGQA 1JB2A 3G0KA 3GWRA 2BMOB 3J7Yd 1PFPA 3LTAA 2KRTA 3H51A 3KKGA 1M904 2XRXB 4JF8A 5G2GA 3KSED 2HMLB 3OV4A 5CLKA 2OOVC 4KFDA 5IEOA 4EBGA 1D6UA 1LNHA 3CMA3 2F99A 3DM8A 1JNQA 1VQ53 2BMRB 2WOFA 4LMIA 3T8NA 5BVBA 1W6CA 1E3RA 3CNXA 1STDA 1W5ZA 2LQVA 3T8UA 3ALAA 2W04A 3PGBA 3AMOB 4GB5A 1GY7A 2CFGA 3X42A 3WDGB 3S67A 3IPTA 1DYUA 1SPUA 1ULIB 2B1XB 4FCMA 4LZIA 2OQEA 1UW1A 1RRLA 3FSDA 3JUPA 3PCSA 2KCDA 4N6LA 4OVMA 2XEPA 3OWSA 4NREA 4HM4B 4O8SA 3BNCA 3I553 2W2CA 2V1LA 8CHOA 1RRHA 2E2UA 1IVUA 2P38A 1WQLB 4R9LA 1W7CA 3X3YA 2P09A 3GZRA 3PCRA 4O2HA 3V99A 3N54B 2W56B 3JUQA 1IT8A 2FXTA 1OGZA 3K7CA 4X2HA 1IDPA 4O02B 3UL5A 3SEDA 2CWVA 2RCDA 2Z76A 3EE1A 3CCL3 2BNGA 1Q864 1FGQA 3X40A 1VQ83 3F40A 2D1WA 1JN5A 1GS3A 3G713 1DMNA 5FGOA 1EA2A 3CCQ3 2QA43 3HIIA 3LOYA 1W2ZA 2CW9A 4JRFA 1RKYA 1Q7Y4 4N3VA 3S29A 1O7WB 1Q814 2K54A 2Z77A 1WMNA 5CF2A 1C7HA 4XBXA 2W9PA 3EBTA 1O7HB 3NBJA 3CCM3 3CCE3 4G1MB 3K63A 5TGNA 3QRDA 1QVG2 1QVF2 4LSOA 4ZM8A 3KZTA 1YI23 2CK3H 4CCVA 1EQKA 1O7MB 4N6NB 2FGTA 4EC6A 1T5YA 1AVKA 1MNLA 3KN4A 4HM6B 3O8YA 2W9QA 3EB8A 2UX0A 2XFTA 4PEJA 2OWPA 4N6V0 4NHFA 1J2BA 3BNEA 5AIIA 4I4KA 4HM3B 3EBYA 3GZYB 3U1WA 3WA2X 1VQO3 1OF5B 1IVXA 1FGMA 2O9UX 2XSOB 3LTBA 4X2OA 1FA3A 4H61A 4XB5A 3LH4A 2ZDJA 3MHEA 1M1XB 2OOVA 3WODG 1N9EA 3SLUA 1CEWI 5JPUA 4KZ1A 1KC84 1ZO2A 2HMKB 2XH9A 1K9M4 1NWWA 3UB1A 1HU9A 3M8CA 2XGLA 2MC8A 2CKFB 1OGXA 3SOYA 3NUVA 5IEPA 1UUVB 1OACA 1ROVA 1W02A 4U13A 3CCV3 3F7XA 2WO0A 2XF3A 3DY5A 5IG3A 3CNMA 1AVLA 2C10A 1Q42A 3CCJ3 3FF0A 1OHPA 3NQZA 3B4PA 3KIIA 1L5GB 2KXGA 1DMQA 4STDA 5CK6A 3WMDA 4R80A 1KD14 1NO3A 1OHOA 1US1A 1SJWA 4HM1B 4RZMA 5IERA 3JUNA 4HBRA 2GEYA 1D6YA 3OWUA 3K0ZA 1QAFA 2CHCA 2P05A 5EQLA 3FZWA 2W0QA 1TIJA 2FNQA 3RGRA 1E97A 3G16A 3ER7A 1YJW3 4MMZB 2CFWA 2CWTA 1RJOA 2M7OA 3DZLA 4FMDA 1IU7A 1N5HA 3DUKA 5IG5A 3MG2A 3RDEA 1JN5B 3I0YA 4QWTA 5JBSA 1NB3I 5JPPA 1JRQA 3F8HA 3D9RA 3JUMA 2P0XA 1BUQA 3ROBA 1HKXA 3NBRA 4WFOA 1LVNA 3BB9A 3K5TA 1OUNA 1K8A4 5KP3A 1K41A 4CDLA 4L8PA 3F8XA 4WP5A 4N6TA 4ORLA 2Y74A 3MKIA 1YVBI 1A2VA 3K9MC 2L4VA 3OX9A 1N9JA 3NM7A 3CME3 3E99A 4KFEA 2XGNA 2BHMA 2W6JH 1WTHA 3FH1A 3LT9A 4J9AA 3GRDA 3V98A 2HMNB 5ELJA 3N8BA 2GBWB 4HZ9B 4WHAA 1YIJ3 4GL6A 3GZXB 3CC23 5STDA 1FGTA 3BNBA 1FUWA 1AR0A 3EX9A 3IMAB 1JKGA 2I9WA 3FCSB 4MMYB 3HZPA 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3H A;  1W00 A;  4HM5 B;  1Q40 B;  4WYK B;  3EQQ B;  3ECF A;  4HZB B;  3EN8 A;  1U5O A;  1S5A A;  3B4O A;  5BXQ A;  1NU3 A;  1EG9 B;  4HVN A;  1OH0 A;  3B7C A;  2YFL B;  4XDW A;  2BMQ B;  1ASK A;  3OXA A;  2GEX A;  4H3U A;  5AIF A;  2HMJ B;  3FGY A;  3MG3 A;  3CPO A;  3FLJ A;  3VSY A;  4R1K A;  3F9S A;  3MSO A;  3F14 A;  5KP4 A;  3F7S A;  2JQ5 A;  4XBY A;  2F98 A;  1TP6 A;  3EF8 A;  4HKV B;  4HM2 B;  4Q53 A;  5AIG A;  1W6Y A;  3S5C A;  5IF6 A;  2YFI B;  5IG4 A;  2GBX B;  1DMM A;  1OHS A;  1JB4 A;  2GXF A;  3KE7 A;  2Z7A A;  5KP1 A;  4XBT A;  1OPY A;  2XSH B;  5AEW B;  2HMO B;  3B8L A;  1OF5 A;  3FKA A;  1CQS A;  2B24 B;  3RGA A;  1JB5 A;  1TUH A;  4LEH A;  2IMJ A;  1O7P B;  3CU3 A;  3A76 A;  4L7K A;  3DXO A;  3UJM A;  4K1V A;  4HM0 B;  5D82 A;  1QMA A;  5AEU B;  4KVH A;  3EN1 B;  3SOA A;  3NV0 A;  4K1U A;  5D81 A;  3LZA A;  1OCV A;  3NXJ A;  2PZV A;  5CXO A;  4HJL B;  1ULJ B;  4OUQ A;  3STD A;  3LYG A;  1GY5 A;  5CF1 A;  2QGU A;  3EJV A;  1GYB A;  4IIA A;  4R9K A;  3HX8 A;  6STD A;  3BLZ A;  3FF2 A;  5IG0 A;  1NDO B;  3EHC A;  2YFJ B;  3UNL A;  5D83 A;  2R4I A;  3NM2 A;  1E3V A;  3JUO A;  2XR8 B;  4WWU C;  1VZZ A;  2STD A;  4HM8 B;  3OWY A;  4FCJ A;  2QIY A;  4XDV A;  3VGN A;  5AIH A;  4XM4 A;  1Q40 A;  4MJD A;  4WYK A;  2INX A;  2F86 B;  4HM7 B;  1A2K A;  1Z1S A;  2A15 A;  3G8Z A;  3MYT A;  1GY6 A;  3KSP A;  4L8O A;  3Q90 A;  1ISK A;  3HK4 A;  2HMM B;  2RFR A;  3EC9 A;  5FW5 A;  5DRV A;  1UUW B;  5DRE A;  5EVH A;  1QJG A;  1ZX2 A;  1O7N B;  3NHX A;  3NV0 B;  3MG1 A;  5IEN A;  7STD A;  3DMC A;  4LGQ A;  1JKG B;  5HGR A;  4J8T A;  3GZB A;  1W01 A;  1O7G B;  5AI1 A;  2RGQ A;  1JB2 A;  3G0K A;  3GWR A;  2BMO B;  3H51 A;  3KKG A;  2XRX B;  5G2G A;  2HML B;  3OV4 A;  5CLK A;  5IEO A;  2F99 A;  3DM8 A;  2BMR B;  4LMI A;  3T8N A;  5BVB A;  1E3R A;  3CNX A;  1STD A;  3T8U A;  4GB5 A;  1GY7 A;  3IPT A;  1ULI B;  2B1X B;  4FCM A;  3FSD A;  3JUP A;  4OVM A;  3OWS A;  4HM4 B;  2W2C A;  8CHO A;  1WQL B;  4R9L A;  3GZR A;  4X2H A;  3JUQ A;  3K7C A;  1OGZ A;  1IDP A;  3SED A;  2RCD A;  2Z76 A;  2BNG A;  3F40 A;  1JN5 A;  1GS3 A;  1DMN A;  1EA2 A;  4N3V A;  1O7W B;  2K54 A;  2Z77 A;  5CF2 A;  1C7H A;  4XBX A;  3EBT A;  1O7H B;  5TGN A;  3KZT A;  1O7M B;  4HM6 B;  2UX0 A;  4PEJ A;  2OWP A;  5AII A;  4I4K A;  4HM3 B;  3EBY A;  3GZY B;  1OF5 B;  4X2O A;  2XSO B;  4XB5 A;  3MHE A;  5JPU A;  1ZO2 A;  2HMK B;  1NWW A;  3M8C A;  2CKF B;  1OGX A;  3SOY A;  3NUV A;  5IEP A;  1UUV B;  1W02 A;  4U13 A;  3F7X A;  5IG3 A;  3CNM A;  1Q42 A;  3FF0 A;  1OHP A;  3B4P A;  1DMQ A;  4STD A;  5CK6 A;  3WMD A;  1OHO A;  1SJW A;  4HM1 B;  4RZM A;  5IER A;  3JUN A;  2GEY A;  3OWU A;  3K0Z A;  2CHC A;  3FZW A;  3RGR A;  1E97 A;  3G16 A;  3ER7 A;  3DZL A;  3DUK A;  5IG5 A;  3MG2 A;  1JN5 B;  3I0Y A;  5JPP A;  3F8H A;  3D9R A;  3JUM A;  1BUQ A;  3ROB A;  1HKX A;  3NBR A;  3BB9 A;  1OUN A;  5KP3 A;  1K41 A;  4CDL A;  4L8P A;  3F8X A;  4WP5 A;  4ORL A;  3MKI A;  3OX9 A;  3E99 A;  4J9A A;  3FH1 A;  3GRD A;  2HMN B;  2GBW B;  4HZ9 B;  3GZX B;  5STD A;  1AR0 A;  3EX9 A;  1JKG A;  2I9W A;  3HZP A; 
#chains in the Genus database with same CATH topology
 3H3H A;  1W00 A;  1LOY A;  3PS8 A;  5A0O B;  1NB5 I;  4HM5 B;  1Q40 B;  4WYK B;  1BSE A;  3EQQ B;  3WOF B;  4N6U A;  3ECF A;  1K28 A;  1VQM 3;  2K0M A;  3Q3F A;  4FMB A;  4HZB B;  1FYS A;  4K61 A;  3DGM A;  4MEI A;  4RNZ A;  3EN8 A;  1YIT 3;  2P0M A;  3CC4 3;  1U5O A;  4EV5 A;  3V92 A;  1S5A A;  3B4O A;  4GSP A;  5BXQ A;  3VF1 A;  1NU3 A;  1GSP A;  4IT7 A;  1VQ6 3;  1ZGX A;  1DVC A;  1IYY A;  1BRS A;  1EG9 B;  3AMO A;  1OH0 A;  3B7C A;  1TFK A;  2YFL B;  4HVN A;  2WGO A;  4XDW A;  8RNT A;  2QEX 3;  2R41 A;  1W6G A;  4OK0 A;  4R4K A;  2BMQ B;  4RNY A;  1MWR A;  3D3L A;  3HIG A;  1IVW A;  3SVA A;  1ASK A;  3OXA A;  4IPB A;  1NJI 4;  1YJN 3;  2GEX A;  4H3U A;  5AIF A;  1IV9 A;  1I2G A;  4TX4 A;  1VQ9 3;  2HMJ B;  3FGY A;  3MG3 A;  1RGF A;  3CPO A;  3FLJ A;  1FGO A;  3SXX A;  3VSY A;  4AKY A;  1BOX A;  4BTW A;  1RGG A;  2W56 A;  4N6O B;  1BSA A;  1F8N A;  4R1K A;  3CXC 2;  1GMR A;  1W2B 2;  1JZO A;  3D5I A;  1B2Z A;  3RNT A;  3F9S A;  2E2V A;  3MSO A;  3F14 A;  3TDG A;  1X1W A;  5KP4 A;  3CPW 2;  3F7S A;  2BO9 B;  2JQ5 A;  4XBY A;  1WMP A;  2F98 A;  1TP6 A;  3EF8 A;  1N5P A;  1RN7 A;  1STF I;  1JV2 B;  2HOH A;  2O3O A;  4HKV B;  4HM2 B;  4Q53 A;  5AIG A;  1BRN L;  1RNB A;  1W6Y A;  3S5C A;  2AAD A;  3NBB A;  5IF6 A;  1BRG A;  2YFI B;  2GU3 A;  4CJN A;  2GBX B;  5IG4 A;  3LTD A;  3CC7 3;  5IW9 A;  1DMM A;  1B3S A;  1B21 A;  3AGN A;  3S27 A;  1OHS A;  1DET A;  5ELU A;  1B2X A;  1WMO A;  1G02 A;  1JB4 A;  1W4N A;  2GXF A;  3QK9 A;  1CH0 A;  3KE7 A;  4FMC A;  2OTL 3;  2CWU A;  2Z7A A;  3X3X A;  1Y4K A;  5KP1 A;  5RNT A;  4XBT A;  1YGE A;  4EXR A;  1OPY A;  2XSH B;  5AEW B;  1VQL 3;  1SIH A;  2UGI A;  3FG4 A;  4K90 B;  2HMO B;  2IYJ A;  1A90 A;  1EEJ A;  3JVC A;  4NPB A;  3DGL A;  3B8L A;  3MPH A;  1ROA A;  1HYF A;  1OF5 A;  3FKA A;  1CQS A;  1LXE A;  4AEQ A;  2XFS A;  2B24 B;  1RDS A;  3NX0 A;  1N8R 4;  1GMQ A;  1JB5 A;  1RGL A;  1TUH A;  3HI7 A;  4LEH A;  5LC7 A;  1LRA A;  2IMJ A;  3RGA A;  1A67 A;  3FG3 A;  1LOV A;  3LT8 A;  1O7P B;  4N6M A;  1RGH A;  3CU3 A;  4KFF A;  1QAL A;  3A76 A;  3FG1 A;  4L7K A;  1UCK A;  4MMX B;  2RSX A;  3DXO A;  2CC3 A;  2C11 A;  4EW5 A;  3UJM A;  1EKM A;  1B27 A;  1TRQ A;  4HM0 B;  4K1V A;  1QMA A;  3DGO A;  5D82 A;  5AEU B;  1KSI A;  1G96 A;  1TTO A;  1X1X A;  3Q1C A;  4KVH A;  2CG1 A;  1UGI A;  1KWI A;  4J5K A;  1R4C A;  1VQK 3;  2LYX A;  3EN1 B;  3SOA A;  2Z6B A;  4BTY A;  3NV0 A;  4O3V A;  2WOH A;  1IVV A;  3X41 A;  1U8C B;  1JJ2 2;  2GSP A;  1IQX A;  3BND A;  4BL3 A;  5BIR A;  1DVD A;  1IV7 A;  1BNF A;  2E2T A;  4K1U A;  3T0U A;  1PYL A;  5D81 A;  1I0V A;  1PU4 A;  1FW7 A;  3S28 A;  2WGQ A;  3WR2 A;  3BIR A;  3LZA A;  1OCV A;  3NXJ A;  2PZV A;  2JDI H;  2IA7 A;  2BU4 A;  5EEO A;  3G6E 3;  1MOL A;  1BUJ A;  2SAR A;  2CH9 A;  1N8Q A;  5CXO A;  4HJL B;  1IK3 A;  1VQP 3;  3MWZ A;  1ULJ B;  3LTC A;  3AGO A;  3HOH A;  4OUQ A;  3CCU 3;  3STD A;  1S72 3;  3LYG A;  1IQ8 A;  2ZL8 A;  3PXM A;  1BNE A;  1GY5 A;  3ZFZ A;  5CF1 A;  2CG0 A;  1GD3 A;  2PNC A;  1CYU A;  2KF5 A;  1LOX A;  1VQ7 3;  2BT3 A;  1KQS 2;  3CD6 3;  3Q2P A;  5M18 A;  2CIU A;  3OW2 2;  3WA3 A;  1RGE A;  4HOH A;  3URP A;  4FR9 A;  1G0T A;  4RNT A;  1I70 A;  2QGU A;  4I5Q A;  5GSP A;  3EJV A;  1GYB A;  4IIA A;  3G4S 3;  1K73 4;  1C54 A;  2L1S A;  4R9K A;  3HX8 A;  1X1Y A;  5AYS C;  3N9H A;  6STD A;  3BLZ A;  3FF2 A;  5IG0 A;  2CFL A;  1BU4 A;  1AY7 A;  1NDO B;  1GOY A;  1UDI I;  3EHC A;  2YFJ B;  3U97 A;  4LYL B;  1IQY A;  3UNL A;  1X1U A;  5D83 A;  2R4I A;  3GAX A;  1BNI A;  3NM2 A;  4RBN A;  1E3V A;  2OQE C;  1IT7 A;  2OCT A;  3JUO A;  2XR8 B;  4WWU C;  1VZZ A;  2STD A;  4HM8 B;  3OWY A;  1GOV A;  1MGW A;  2SBL A;  1FGR A;  3D5G A;  2MF7 A;  4FCJ A;  1SII A;  2OTJ 3;  2QIY A;  4XDV A;  1TFO A;  1D6Z A;  5LC6 A;  3VGN A;  4AKZ A;  3SX1 A;  1I3F A;  2CFK A;  4HYZ A;  5AIH A;  1AV4 A;  1M1K 4;  3NQY A;  3X3Z A;  1SQW A;  2GU1 A;  1TU5 A;  1MWT A;  1I0X A;  3LXU X;  4FCZ A;  5AYR B;  1QAK A;  4XM4 A;  1Q40 A;  4MJD A;  4WYK A;  3WHO A;  2INX A;  2F86 B;  3L0R A;  3KCH A;  3IJE B;  4HM7 B;  5G1K A;  3UL6 A;  1YHQ 3;  1YGW A;  1MGR A;  1SAR A;  1UI8 A;  1I2F A;  1A2K A;  1Z1S A;  5I97 A;  3KFQ C;  2A15 A;  3WOE B;  3G8Z A;  3MYT A;  1Q82 4;  1YJ9 3;  1GY6 A;  1GD4 A;  3KSP A;  4L8O A;  4EYC A;  3I56 3;  1M9G A;  3Q90 A;  1ISK A;  1DE3 A;  3HK4 A;  2HMM B;  2RFR A;  4FMA A;  2ML5 A;  3EC9 A;  5FW5 A;  5DRV A;  1RLS A;  1UUW B;  2KAA A;  5DRE A;  2D42 A;  1QJG A;  2Y73 A;  1ZX2 A;  3GSP A;  1GMP A;  5EVH A;  2IUJ A;  1O7N B;  3NHX A;  4DKI A;  3NV0 B;  3PYJ A;  3MG1 A;  1MWU A;  3PZW A;  4HAA A;  4BU4 A;  5IEN A;  1VQ4 3;  1FUS A;  1VQN 3;  2YX9 A;  4BTX A;  7STD A;  1CYV A;  1WNH A;  3DMC A;  4LGQ A;  1JKG B;  2K3D A;  5HGR A;  1RCL A;  4J8T A;  1UGH I;  2W03 A;  3GZB A;  3LML A;  1V74 A;  2Q07 A;  1W01 A;  3CCR 3;  3CCS 3;  1UI7 A;  1O7G B;  3DGN A;  5AI1 A;  4EV2 A;  2IUK A;  2ML6 A;  2RGQ A;  1JB2 A;  3G0K A;  3GWR A;  3D79 A;  2BMO B;  3J7Y d;  1PFP A;  3LTA A;  2C4B A;  2KRT A;  3H51 A;  3KKG A;  2XRX B;  4JF8 A;  5G2G A;  1M90 4;  3KSE D;  6RNT A;  2BIR A;  2HML B;  3OV4 A;  5CLK A;  2F56 A;  2OOV C;  3AHS A;  4KFD A;  1D6U A;  1LNH A;  1T3B A;  2F99 A;  2RBI A;  5IEO A;  4EBG A;  3CMA 3;  3DM8 A;  1JNQ A;  2F4Y A;  1VQ5 3;  2BMR B;  1BGS A;  2WOF A;  4LMI A;  3T8N A;  4J5G A;  5BVB A;  1W6C A;  1E3R A;  2H0G A;  3CNX A;  4KT3 B;  1STD A;  1RTU A;  1W5Z A;  2LQV A;  3T8U A;  1V58 A;  2W04 A;  3ALA A;  3PGB A;  3AMO B;  4GB5 A;  3A5E A;  1GY7 A;  2CFG A;  4BL2 A;  1JBT A;  3X42 A;  3WDG B;  3S67 A;  1FUT A;  3IPT A;  1DYU A;  1SPU A;  5M1A A;  1ULI B;  2B1X B;  4FCM A;  4LZI A;  2OQE A;  1UW1 A;  1RRL A;  3FSD A;  3JUP A;  3PCS A;  2KCD A;  4N6L A;  4OVM A;  2XEP A;  3OWS A;  4NRE A;  4HM4 B;  4O8S A;  3BNC A;  4GHO A;  2W2C A;  2H0H A;  3I55 3;  2V1L A;  8CHO A;  1RRH A;  2E2U A;  1IVU A;  3ZG5 A;  2P38 A;  1WQL B;  4R9L A;  1W7C A;  3X3Y A;  2P09 A;  3GZR A;  3PCR A;  4O2H A;  1GOU A;  3V99 A;  2CX1 A;  3N54 B;  2W56 B;  3JUQ A;  1IT8 A;  2FXT A;  1OGZ A;  3K7C A;  4X2H A;  1IDP A;  4O02 B;  3UL5 A;  1B20 A;  3SED A;  2CWV A;  2RCD A;  2Z76 A;  3EE1 A;  1I8V A;  3CCL 3;  2ZHX B;  2BNG A;  5BU4 A;  1Q86 4;  1FGQ A;  1RGK A;  3X40 A;  1UCI A;  4ILF A;  1B2S A;  1VQ8 3;  1RN4 A;  3F40 A;  2D1W A;  1JN5 A;  1GS3 A;  1LQM B;  1BNJ A;  3G71 3;  1DMN A;  5FGO A;  1EA2 A;  3CCQ 3;  2QA4 3;  3HII A;  3LOY A;  1BSC A;  1W2Z A;  2CW9 A;  4JRF A;  1RKY A;  3SYU A;  1Q7Y 4;  4N3V A;  1TRP A;  3S29 A;  1O7W B;  1JBR A;  1Q81 4;  2K54 A;  2Z77 A;  1WMN A;  5CF2 A;  1C7H A;  2H0I A;  2F5W A;  6GSP A;  4XBX A;  2W9P A;  1R4Y A;  3EBT A;  1O7H B;  3NBJ A;  3CCM 3;  3CCE 3;  4G1M B;  3K63 A;  3BU4 A;  3QRD A;  5TGN A;  1QVG 2;  1QVF 2;  1I3I A;  4LSO A;  4ZM8 A;  3KZT A;  1YI2 3;  1Q9E A;  4CPK A;  2CK3 H;  1NNV A;  5G1L A;  4CCV A;  1B2U A;  1O7M B;  1EQK A;  2IY2 A;  4N6N B;  9RNT A;  2FGT A;  3DGY A;  4EC6 A;  1T5Y A;  1LQG C;  2AAE A;  1MNL A;  1AVK A;  3KN4 A;  4HM6 B;  3O8Y A;  2W9Q A;  1T2I A;  2UX0 A;  2XFT A;  3EB8 A;  2OWP A;  4N6V 0;  4NHF A;  4PEJ A;  3ZG0 A;  4BIR A;  3BNE A;  5AII A;  1UUG B;  4I4K A;  4HM3 B;  1YNV X;  3EBY A;  3GZY B;  3U1W A;  1BRK A;  3WA2 X;  1VQO 3;  1OF5 B;  1IVX A;  1FGM A;  1LOW A;  2O9U X;  2XSO B;  3LTB A;  4X2O A;  1FA3 A;  4H61 A;  4XB5 A;  1TJD A;  3LH4 A;  2ZDJ A;  3MHE A;  1M1X B;  2OOV A;  3WOD G;  1N9E A;  3SLU A;  1CEW I;  1BRI A;  4KZ1 A;  5JPU A;  1ZO2 A;  2HMK B;  2XH9 A;  1KC8 4;  1NWW A;  1K9M 4;  3UB1 A;  1HU9 A;  1RMS A;  1BRJ A;  2XGL A;  3M8C A;  2MC8 A;  5HOH A;  2CKF B;  1OGX A;  3SOY A;  3NUV A;  5IEP A;  2J8X B;  1UUV B;  1RNT A;  1OAC A;  1BNR A;  1ROV A;  1W02 A;  4U13 A;  3CCV 3;  3F7X A;  1RSN A;  2WO0 A;  1T2H A;  2XF3 A;  3DY5 A;  2F5M A;  3CNM A;  5IG3 A;  1AVL A;  2C10 A;  1RGA A;  1Q42 A;  3CCJ 3;  3FF0 A;  1OHP A;  3NQZ A;  3B4P A;  3KII A;  1L5G B;  2KXG A;  1DMQ A;  4STD A;  3DH2 A;  2CX0 A;  5CK6 A;  3WMD A;  4R80 A;  7GSP A;  1KD1 4;  1NO3 A;  1OHO A;  1US1 A;  1SJW A;  4HM1 B;  1BAN A;  4RZM A;  5IER A;  3JUN A;  4HBR A;  2KF4 A;  2GEY A;  2KF3 A;  1D6Y A;  1RHL A;  3OWU A;  2UUG C;  1I2E A;  3K0Z A;  1QAF A;  2CHC A;  1BVI A;  2P05 A;  5EQL A;  1B2M A;  3FZW A;  1J2B A;  2W0Q A;  1TIJ A;  1MWS A;  2FNQ A;  3RGR A;  1E97 A;  1V57 A;  3G16 A;  3ER7 A;  1YJW 3;  4MMZ B;  2CFW A;  2CWT A;  1RJO A;  2M7O A;  3DZL A;  4FMD A;  1BNS A;  1IU7 A;  1N5H A;  3DUK A;  5IG5 A;  3MG2 A;  3RDE A;  1JN5 B;  3I0Y A;  4QWT A;  1A2P A;  2KF6 A;  5JBS A;  1NB3 I;  3D4A A;  5JPP A;  1ZS7 A;  1JRQ A;  3F8H A;  1RN1 A;  3D9R A;  3JUM A;  2P0X A;  1BUQ A;  3ROB A;  1HKX A;  3NBR A;  4WFO A;  1UCJ A;  2ZA4 A;  1Q7H A;  1BSD A;  1LVN A;  1LNI A;  3BB9 A;  1RGC A;  3K5T A;  1BSB A;  1UCL A;  1OUN A;  5KP3 A;  1K41 A;  4CDL A;  1K8A 4;  4L8P A;  1PY3 A;  3F8X A;  4WP5 A;  1RCK A;  4N6T A;  4ORL A;  2Y74 A;  3MKI A;  1YVB I;  1A2V A;  3K9M C;  2L4V A;  1JBS A;  3OX9 A;  1BAO A;  1N9J A;  1VQQ A;  3NM7 A;  3CME 3;  3E99 A;  4KFE A;  2XGN A;  2BHM A;  2W6J H;  1WTH A;  3FH1 A;  3LT9 A;  4J9A A;  7RNT A;  3GRD A;  1EUI C;  3V98 A;  2HMN B;  5ELJ A;  3AHW A;  3N8B A;  2GBW B;  1BIR A;  4HZ9 B;  4WHA A;  1BNG A;  1JZD A;  1YIJ 3;  4GL6 A;  3GZX B;  5M19 A;  1AQZ A;  1BRH A;  3CC2 3;  5STD A;  1FGT A;  1YVS A;  2RNT A;  1AR0 A;  3BNB A;  3EX9 A;  3IMA B;  1FUW A;  1JKG A;  1FZU A;  2I9W A;  3FCS B;  4MMY B;  3HZP A;  1HZ1 A;  2CFD A; 
#chains in the Genus database with same CATH homology
 3H3H A;  1W00 A;  3PS8 A;  5A0O B;  1NB5 I;  4HM5 B;  1Q40 B;  4WYK B;  3EQQ B;  3WOF B;  4N6U A;  3ECF A;  1K28 A;  1VQM 3;  2K0M A;  4FMB A;  4HZB B;  4K61 A;  3DGM A;  4MEI A;  4RNZ A;  3EN8 A;  1YIT 3;  2P0M A;  3CC4 3;  1U5O A;  4EV5 A;  3V92 A;  1S5A A;  3B4O A;  5BXQ A;  3VF1 A;  1NU3 A;  4IT7 A;  1VQ6 3;  1DVC A;  1EG9 B;  3AMO A;  1OH0 A;  3B7C A;  1TFK A;  2YFL B;  4HVN A;  2WGO A;  4XDW A;  2QEX 3;  1W6G A;  4OK0 A;  4R4K A;  2BMQ B;  4RNY A;  3D3L A;  3HIG A;  1IVW A;  3SVA A;  1ASK A;  3OXA A;  4IPB A;  1NJI 4;  1YJN 3;  2GEX A;  4H3U A;  5AIF A;  1IV9 A;  1VQ9 3;  4TX4 A;  2HMJ B;  3FGY A;  3MG3 A;  3CPO A;  3FLJ A;  1FGO A;  3SXX A;  3VSY A;  4AKY A;  4BTW A;  4N6O B;  2W56 A;  4R1K A;  1F8N A;  3CXC 2;  1W2B 2;  3F9S A;  2E2V A;  3MSO A;  3F14 A;  3TDG A;  5KP4 A;  3CPW 2;  3F7S A;  2BO9 B;  2JQ5 A;  4XBY A;  1WMP A;  2F98 A;  1TP6 A;  3EF8 A;  1N5P A;  1RN7 A;  1STF I;  1JV2 B;  2O3O A;  4HKV B;  4HM2 B;  4Q53 A;  5AIG A;  1W6Y A;  3S5C A;  3NBB A;  5IF6 A;  2YFI B;  2GU3 A;  5IG4 A;  2GBX B;  3LTD A;  3CC7 3;  5IW9 A;  1DMM A;  3S27 A;  1OHS A;  5ELU A;  1WMO A;  1JB4 A;  1W4N A;  2GXF A;  3QK9 A;  3KE7 A;  4FMC A;  2OTL 3;  2CWU A;  2Z7A A;  3X3X A;  1Y4K A;  5KP1 A;  4XBT A;  1YGE A;  4EXR A;  1OPY A;  2XSH B;  5AEW B;  1VQL 3;  1SIH A;  3FG4 A;  4K90 B;  2HMO B;  1A90 A;  3JVC A;  3DGL A;  3B8L A;  3MPH A;  1ROA A;  1OF5 A;  3FKA A;  1CQS A;  1LXE A;  4AEQ A;  2XFS A;  2B24 B;  3NX0 A;  1N8R 4;  3RGA A;  1JB5 A;  1TUH A;  3HI7 A;  4LEH A;  5LC7 A;  2IMJ A;  1A67 A;  3FG3 A;  3LT8 A;  1O7P B;  4N6M A;  3CU3 A;  4KFF A;  1QAL A;  3A76 A;  3FG1 A;  4L7K A;  4MMX B;  2RSX A;  3DXO A;  2CC3 A;  2C11 A;  3UJM A;  1EKM A;  4K1V A;  4HM0 B;  5D82 A;  1QMA A;  3DGO A;  5AEU B;  1KSI A;  1G96 A;  3Q1C A;  4KVH A;  2CG1 A;  1KWI A;  1R4C A;  1VQK 3;  2LYX A;  3EN1 B;  3SOA A;  2Z6B A;  4BTY A;  3NV0 A;  4O3V A;  2WOH A;  1IVV A;  3X41 A;  1U8C B;  1JJ2 2;  1IQX A;  3BND A;  1DVD A;  1IV7 A;  2E2T A;  4K1U A;  3T0U A;  5D81 A;  1PU4 A;  3S28 A;  2WGQ A;  3LZA A;  1OCV A;  3NXJ A;  2PZV A;  2JDI H;  2IA7 A;  5EEO A;  3G6E 3;  1MOL A;  2CH9 A;  1N8Q A;  5CXO A;  4HJL B;  1IK3 A;  1VQP 3;  3MWZ A;  1ULJ B;  3LTC A;  4OUQ A;  1S72 3;  3CCU 3;  3STD A;  3LYG A;  1IQ8 A;  2ZL8 A;  3PXM A;  1GY5 A;  5CF1 A;  2CG0 A;  1GD3 A;  2PNC A;  1CYU A;  1KQS 2;  1LOX A;  1VQ7 3;  2BT3 A;  3CD6 3;  3Q2P A;  2CIU A;  3OW2 2;  3WA3 A;  4FR9 A;  2QGU A;  3EJV A;  1GYB A;  4IIA A;  3G4S 3;  4R9K A;  3HX8 A;  5AYS C;  3N9H A;  6STD A;  3BLZ A;  3FF2 A;  5IG0 A;  2CFL A;  1NDO B;  3EHC A;  2YFJ B;  3U97 A;  1IQY A;  3UNL A;  5D83 A;  2R4I A;  3GAX A;  3NM2 A;  4RBN A;  1E3V A;  2OQE C;  1IT7 A;  2OCT A;  3JUO A;  2XR8 B;  4WWU C;  1VZZ A;  2STD A;  4HM8 B;  3OWY A;  2SBL A;  1FGR A;  2MF7 A;  4FCJ A;  1SII A;  2OTJ 3;  2QIY A;  4XDV A;  1TFO A;  1D6Z A;  5LC6 A;  3VGN A;  4AKZ A;  3SX1 A;  2CFK A;  4HYZ A;  5AIH A;  1AV4 A;  1M1K 4;  3NQY A;  3X3Z A;  1SQW A;  2GU1 A;  1TU5 A;  3LXU X;  4FCZ A;  5AYR B;  1QAK A;  4XM4 A;  1Q40 A;  4MJD A;  4WYK A;  2INX A;  2F86 B;  3L0R A;  1YHQ 3;  3IJE B;  4HM7 B;  3UL6 A;  1UI8 A;  1A2K A;  1Z1S A;  5I97 A;  3KFQ C;  2A15 A;  3WOE B;  3G8Z A;  3MYT A;  1Q82 4;  1YJ9 3;  1GY6 A;  1GD4 A;  3KSP A;  4L8O A;  4EYC A;  3I56 3;  1M9G A;  3Q90 A;  1ISK A;  3HK4 A;  2HMM B;  2RFR A;  4FMA A;  2ML5 A;  3EC9 A;  5FW5 A;  5DRV A;  1UUW B;  5DRE A;  2D42 A;  1QJG A;  2Y73 A;  1ZX2 A;  5EVH A;  2IUJ A;  1O7N B;  3NHX A;  3NV0 B;  3PYJ A;  3MG1 A;  3PZW A;  5IEN A;  1VQ4 3;  1VQN 3;  2YX9 A;  4BTX A;  7STD A;  1CYV A;  1WNH A;  3DMC A;  4LGQ A;  1JKG B;  1K73 4;  5HGR A;  4J8T A;  3GZB A;  2W03 A;  3LML A;  1V74 A;  2Q07 A;  1W01 A;  3CCR 3;  3CCS 3;  1UI7 A;  1O7G B;  3DGN A;  5AI1 A;  4EV2 A;  2IUK A;  2ML6 A;  2RGQ A;  1JB2 A;  3G0K A;  3GWR A;  2BMO B;  3J7Y d;  1PFP A;  3LTA A;  2KRT A;  3H51 A;  3KKG A;  1M90 4;  2XRX B;  4JF8 A;  5G2G A;  3KSE D;  2HML B;  3OV4 A;  5CLK A;  2OOV C;  4KFD A;  5IEO A;  4EBG A;  1D6U A;  1LNH A;  3CMA 3;  2F99 A;  3DM8 A;  1JNQ A;  1VQ5 3;  2BMR B;  2WOF A;  4LMI A;  3T8N A;  5BVB A;  1W6C A;  1E3R A;  3CNX A;  1STD A;  1W5Z A;  2LQV A;  3T8U A;  3ALA A;  2W04 A;  3PGB A;  3AMO B;  4GB5 A;  1GY7 A;  2CFG A;  3X42 A;  3WDG B;  3S67 A;  3IPT A;  1DYU A;  1SPU A;  1ULI B;  2B1X B;  4FCM A;  4LZI A;  2OQE A;  1UW1 A;  1RRL A;  3FSD A;  3JUP A;  3PCS A;  2KCD A;  4N6L A;  4OVM A;  2XEP A;  3OWS A;  4NRE A;  4HM4 B;  4O8S A;  3BNC A;  3I55 3;  2W2C A;  2V1L A;  8CHO A;  1RRH A;  2E2U A;  1IVU A;  2P38 A;  1WQL B;  4R9L A;  1W7C A;  3X3Y A;  2P09 A;  3GZR A;  3PCR A;  4O2H A;  3V99 A;  3N54 B;  2W56 B;  3JUQ A;  1IT8 A;  2FXT A;  1OGZ A;  3K7C A;  4X2H A;  1IDP A;  4O02 B;  3UL5 A;  3SED A;  2CWV A;  2RCD A;  2Z76 A;  3EE1 A;  3CCL 3;  2BNG A;  1Q86 4;  1FGQ A;  3X40 A;  1VQ8 3;  3F40 A;  2D1W A;  1JN5 A;  1GS3 A;  3G71 3;  1DMN A;  5FGO A;  1EA2 A;  3CCQ 3;  2QA4 3;  3HII A;  3LOY A;  1W2Z A;  2CW9 A;  4JRF A;  1RKY A;  1Q7Y 4;  4N3V A;  3S29 A;  1O7W B;  1Q81 4;  2K54 A;  2Z77 A;  1WMN A;  5CF2 A;  1C7H A;  4XBX A;  2W9P A;  3EBT A;  1O7H B;  3NBJ A;  3CCM 3;  3CCE 3;  4G1M B;  3K63 A;  5TGN A;  3QRD A;  1QVG 2;  1QVF 2;  4LSO A;  4ZM8 A;  3KZT A;  1YI2 3;  2CK3 H;  4CCV A;  1EQK A;  1O7M B;  4N6N B;  2FGT A;  4EC6 A;  1T5Y A;  1AVK A;  1MNL A;  3KN4 A;  4HM6 B;  3O8Y A;  2W9Q A;  3EB8 A;  2UX0 A;  2XFT A;  4PEJ A;  2OWP A;  4N6V 0;  4NHF A;  1J2B A;  3BNE A;  5AII A;  4I4K A;  4HM3 B;  3EBY A;  3GZY B;  3U1W A;  3WA2 X;  1VQO 3;  1OF5 B;  1IVX A;  1FGM A;  2O9U X;  2XSO B;  3LTB A;  4X2O A;  1FA3 A;  4H61 A;  4XB5 A;  3LH4 A;  2ZDJ A;  3MHE A;  1M1X B;  2OOV A;  3WOD G;  1N9E A;  3SLU A;  1CEW I;  5JPU A;  4KZ1 A;  1KC8 4;  1ZO2 A;  2HMK B;  2XH9 A;  1K9M 4;  1NWW A;  3UB1 A;  1HU9 A;  3M8C A;  2XGL A;  2MC8 A;  2CKF B;  1OGX A;  3SOY A;  3NUV A;  5IEP A;  1UUV B;  1OAC A;  1ROV A;  1W02 A;  4U13 A;  3CCV 3;  3F7X A;  2WO0 A;  2XF3 A;  3DY5 A;  5IG3 A;  3CNM A;  1AVL A;  2C10 A;  1Q42 A;  3CCJ 3;  3FF0 A;  1OHP A;  3NQZ A;  3B4P A;  3KII A;  1L5G B;  2KXG A;  1DMQ A;  4STD A;  5CK6 A;  3WMD A;  4R80 A;  1KD1 4;  1NO3 A;  1OHO A;  1US1 A;  1SJW A;  4HM1 B;  4RZM A;  5IER A;  3JUN A;  4HBR A;  2GEY A;  1D6Y A;  3OWU A;  3K0Z A;  1QAF A;  2CHC A;  2P05 A;  5EQL A;  3FZW A;  2W0Q A;  1TIJ A;  2FNQ A;  3RGR A;  1E97 A;  3G16 A;  3ER7 A;  1YJW 3;  4MMZ B;  2CFW A;  2CWT A;  1RJO A;  2M7O A;  3DZL A;  4FMD A;  1IU7 A;  1N5H A;  3DUK A;  5IG5 A;  3MG2 A;  3RDE A;  1JN5 B;  3I0Y A;  4QWT A;  5JBS A;  1NB3 I;  5JPP A;  1JRQ A;  3F8H A;  3D9R A;  3JUM A;  2P0X A;  1BUQ A;  3ROB A;  1HKX A;  3NBR A;  4WFO A;  1LVN A;  3BB9 A;  3K5T A;  1OUN A;  1K8A 4;  5KP3 A;  1K41 A;  4CDL A;  4L8P A;  3F8X A;  4WP5 A;  4N6T A;  4ORL A;  2Y74 A;  3MKI A;  1YVB I;  1A2V A;  3K9M C;  2L4V A;  3OX9 A;  1N9J A;  3NM7 A;  3CME 3;  3E99 A;  4KFE A;  2XGN A;  2BHM A;  2W6J H;  1WTH A;  3FH1 A;  3LT9 A;  4J9A A;  3GRD A;  3V98 A;  2HMN B;  5ELJ A;  3N8B A;  2GBW B;  4HZ9 B;  4WHA A;  1YIJ 3;  4GL6 A;  3GZX B;  3CC2 3;  5STD A;  1FGT A;  3BNB A;  1FUW A;  1AR0 A;  3EX9 A;  3IMA B;  1JKG A;  2I9W A;  3FCS B;  4MMY B;  3HZP A;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...