1OUNA

Crystal structure of nuclear transport factor 2 (ntf2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.6 angstroms resolution crystal structure of nuclear transport factor 2 (NTF2).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
molecule keywords NUCLEAR TRANSPORT FACTOR 2
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ounA00
4GB5A 4R9KA 3NXJA 1ZX2A 4RZMA 1W01A 4X2OA 4XB5A 4XDWA 5AEWB 4HM4B 3SOYA 1OHPA 3B8LA 4HM5B 4X2HA 4CDLA 4LEHA 2GXFA 1O7PB 2OWPA 1UUVB 3CNXA 1AR0A 3CPOA 1JN5B 1OF5A 2BMQB 3FKAA 3H51A 4L7KA 1GY7A 3JUQA 3EHCA 4J9AA 2CHCA 1Q40B 1U5OA 2HMLB 3EN8A 4HM6B 3JUOA 5AIIA 4LMIA 5AEUB 3OXAA 3FF2A 5D83A 3GZXB 3T8NA 3SOAA 2K54A 3FLJA 4XDVA 4L8OA 2GEYA 2HMJB 1QMAA 3MG3A 5CXOA 3BLZA 3EF8A 3HZPA 1STDA 3DUKA 3UJMA 5EVHA 3CNMA 2XSHB 1TUHA 3JUMA 3DXOA 5HGRA 5CF2A 3DMCA 1OCVA 2XRXB 3MG1A 3MKIA 1OUNA 4WP5A 3WMDA 1JB4A 3JUPA 5CK6A 3DM8A 3NM2A 3CU3A 1Z1SA 4I4KA 5AIGA 2BMRB 3D9RA 3SEDA 5BXQA 2UX0A 1W02A 3FF0A 2IMJA 3NHXA 4HZ9B 5IG0A 1Q40A 4H3UA 3OWUA 1O7MB 1GY5A 6STDA 2YFLB 3NUVA 3G16A 1JB2A 1O7GB 1O7WB 1C7HA 1UUWB 4WYKB 5DREA 5IEOA 1K41A 2GBWB 2YFJB 2Z77A 2INXA 1EG9B 1OHSA 1DMQA 3OX9A 3LYGA 3FGYA 2B1XB 5BVBA 5AIHA 1JB5A 4Q53A 1Q42A 5TGNA 3F14A 1OGZA 3KE7A 4HJLB 1EA2A 1O7HB 3ECFA 3T8UA 4HM8B 3GZRA 4WYKA 4XM4A 4FCJA 5CLKA 2HMOB 3EBYA 3K0ZA 2RGQA 3STDA 3NV0A 1ISKA 1O7NB 2HMMB 3LZAA 3IPTA 2R4IA 3VGNA 5KP1A 5JPPA 1NU3A 2GEXA 3MHEA 5G2GA 3EC9A 4L8PA 3B4PA 3E99A 1GY6A 4HZBB 3F40A 4WWUC 5IENA 4OUQA 1JKGB 2HMNB 3EN1B 2F86B 2Z7AA 1HKXA 3GZBA 1VZZA 3KKGA 3GRDA 5STDA 3S5CA 2HMKB 4KVHA 4MJDA 1ULJB 2STDA 3K7CA 2QGUA 3G8ZA 1ZO2A 4XBXA 3F9SA 4HM3B 5AIFA 5FW5A 1IDPA 5KP3A 3OWSA 3VSYA 2Z76A 2PZVA 2A15A 5IERA 3B4OA 5IG5A 5IG4A 3NBRA 1TP6A 2BNGA 3FZWA 1BUQA 1OGXA 2YFIB 1JN5A 1OF5B 1E3RA 3M8CA 4HKVB 4U13A 1NWWA 3ER7A 5D82A 3A76A 2BMOB 5CF1A 4HM2B 4HVNA 2JQ5A 3FH1A 3KSPA 1NDOB 2RCDA 3OV4A 1A2KA 4STDA 3EBTA 2F99A 1OHOA 3EJVA 3MSOA 3F7SA 4J8TA 2XSOB 1SJWA 4K1VA 3UNLA 3F7XA 2RFRA 4HM1B 4PEJA 3EX9A 3ROBA 5JPUA 2CKFB 2W2CA 3GZYB 4N3VA 4ORLA 2B24B 3KZTA 3RGAA 1JKGA 3GWRA 3H3HA 4HM0B 3F8XA 1CQSA 3HK4A 4XBTA 5IEPA 5KP4A 4LGQA 4R9LA 2GBXB 3RGRA 3BB9A 4XBYA 1DMMA 3FSDA 3HX8A 4HM7B 1GS3A 2I9WA 3G0KA 7STDA 1GYBA 1S5AA 3EQQB 3I0YA 5DRVA 5IG3A 5IF6A 3NV0B 3F8HA 1ASKA 5AI1A 4K1UA 1OH0A 3OWYA 3DZLA 1ULIB 1E97A 4R1KA 3B7CA 8CHOA 3MYTA 3Q90A 1OPYA 3JUNA 3MG2A 4IIAA 4FCMA 1DMNA 1WQLB 5D81A 1E3VA 4OVMA 1QJGA 1W00A 1W6YA 2QIYA 2F98A 2XR8B
chains in the Genus database with same CATH superfamily
3FCSB 1IT7A 1ZX2A 2QA43 1LXEA 5AYRB 3J7Yd 1LRAA 1IV7A 1B2MA 3BIRA 3KSED 1RMSA 4CDLA 4LEHA 1O7PB 4EV5A 1UUVB 3CNXA 1DVDA 3DGNA 1RGCA 1PU4A 2M7OA 4AEQA 1QVG2 2CHCA 2HMLB 3CCQ3 1B2ZA 5AEUB 1RLSA 3GZXB 4AKYA 1YGWA 2AADA 1T5YA 1QMAA 3BNBA 2C4BA 1GMPA 3BLZA 1PFPA 3K5TA 3DUKA 2CX1A 3CNMA 4GHOA 1RN7A 1RGEA 4AKZA 2CG1A 4N6NB 1OUNA 4EBGA 3JUPA 1D6ZA 1MWUA 1R4YA 1UUGB 1DVCA 4NPBA 1BAOA 1TFKA 2F5WA 2OTJ3 1FUWA 1Z1SA 4I4KA 1NO3A 3D9RA 4N6OB 1VQK3 3NX0A 6RNTA 3OWUA 1O7MB 2W56A 3RDEA 2YFLB 3NUVA 4RNTA 1JB2A 4NHFA 2W9QA 4R4KA 1IQYA 5DREA 3OW22 2ZL8A 1BGSA 1DETA 4N6UA 1C54A 2GSPA 3SX1A 1OHSA 3ZG0A 3OX9A 3FGYA 2H0IA 3PXMA 1J2BA 1UI7A 5AIHA 1RGFA 3Q1CA 4HJLB 3ZG5A 1W6GA 1BUJA 2O9UX 1ROVA 4FCJA 3STDA 1KC84 1N9EA 1MGRA 3K0ZA 1ISKA 1SARA 4FR9A 2HMMB 1AQZA 3LXUX 3IPTA 3V99A 3VGNA 4DKIA 2CFLA 4LYLB 1UGIA 3CME3 1GY6A 2P0XA 4HAAA 4K90B 1T3BA 3EN1B 2HOHA 2OOVA 1IQ8A 1HKXA 1NB3I 3GZBA 3SXXA 3ZFZA 4N6LA 3D4AA 3PZWA 3S5CA 1BSCA 5ELUA 1OACA 2CFKA 1B2UA 1BNGA 2E2VA 2STDA 1ZO2A 3F9SA 4HM3B 1I8VA 5RNTA 2UUGC 8RNTA 4CCVA 3AMOB 1FGMA 2XH9A 5EQLA 1L5GB 1X1XA 3NQZA 2KCDA 1NWWA 3LTBA 1AY7A 2BT3A 4FMDA 1B2XA 3N8BA 3CCS3 1A2KA 1F8NA 1OHOA 2P0MA 2KF6A 4J8TA 3ROBA 3WHOA 3I553 4HBRA 2WGQA 2PNCA 2CWUA 3GZYB 2IUJA 4N3VA 4ORLA 3I563 1UCJA 1NB5I 2IUKA 3DGOA 2Z6BA 4XBTA 4R9LA 1I2EA 1ROAA 3PS8A 3BB9A 4O8SA 4XBYA 2XF3A 2BIRA 2L4VA 1M1K4 2KF5A 4HM7B 1R4CA 2OCTA 3CC73 1S5AA 5DRVA 3EQQB 1FUTA 4RBNA 4LSOA 2K0MA 4K1UA 3OWYA 4ZM8A 3DZLA 1ULIB 1RCLA 3URPA 3LTCA 8CHOA 2CK3H 3S28A 1N9JA 5D81A 4FCMA 4KT3B 1TU5A 3KIIA 1KD14 4GL6A 2OTL3 2QIYA 3BU4A 3BNEA 3QK9A 3WOEB 2CWVA 4RZMA 1WNHA 5AEWB 3B8LA 5HOHA 2GXFA 2WGOA 2OWPA 1AR0A 1OF5A 4L7KA 1GOVA 3S67A 1YVSA 1GY7A 3JUQA 4J9AA 4BL3A 2XEPA 1T2HA 3EN8A 3LOYA 3CPW2 3FF2A 5D83A 3T8NA 1IT8A 1TFOA 4LZIA 4L8OA 3SVAA 3MG3A 1VQO3 3LT9A 1NNVA 5EVHA 5HGRA 1TUHA 3V98A 5CF2A 1UCKA 3WMDA 1RRLA 1K734 2RSXA 3N9HA 5EEOA 1RGLA 1FYSA 3HI7A 3NM2A 1LQGC 4TX4A 1NJI4 3SEDA 5BXQA 1W02A 1KWIA 5IG0A 4EC6A 2FXTA 4H3UA 1GD4A 3BNDA 2OQEA 3S29A 1RHLA 1JZOA 1RRHA 2GU1A 3G16A 1O7GB 1O7WB 1C7HA 2OQEC 3PYJA 4WYKB 5IEOA 1K41A 2YFJB 2CX0A 1VQ93 1YJN3 2INXA 7GSPA 1YGEA 3CC23 1D6YA 3LH4A 5BVBA 1JB5A 3GAXA 1Q42A 2AAEA 3F14A 1WMOA 1OGZA 3K9MC 1EA2A 1I2FA 1TRQA 3D5GA 3CMA3 1BSEA 2IYJA 3AGNA 3EBYA 1I70A 2RGQA 3X3XA 2XFTA 1O7NB 1FW7A 5KP1A 1IYYA 2GEXA 5A0OB 1Y4KA 5M19A 3EC9A 1TIJA 3B4PA 1VQL3 1UCIA 2WOFA 2MC8A 1VQ53 3F40A 3HIIA 2YX9A 1SIIA 1RGKA 2IA7A 2HMNB 2SARA 4N6V0 2F86B 2Z7AA 3LMLA 4JRFA 3UB1A 3L0RA 4MMYB 5LC7A 1LOWA 1PYLA 2HMKB 4R80A 3X42A 1T2IA 3WA2X 1EQKA 4XBXA 5FW5A 4FCZA 3VSYA 3OWSA 2Z76A 1W5ZA 2A15A 4OK0A 3B4OA 3SLUA 4EXRA 5IG4A 3NBRA 2BNGA 3BNCA 1BUQA 2YFIB 5ELJA 1FZUA 1E3RA 3M8CA 4QWTA 1RGGA 4HYZA 5D82A 1VQM3 3A76A 3AMOA 2D42A 2JQ5A 1BRHA 3KSPA 4BTXA 2RCDA 3X40A 1CH0A 3EBTA 3MSOA 3EJVA 4K1VA 1B20A 1SJWA 2V1LA 1MNLA 1Q9EA 2ZHXB 2Q07A 3EX9A 2R41A 1BSDA 2CKFB 5AYSC 3WODG 1M904 3GWRA 1Q814 1ZS7A 3CCM3 5IEPA 1G02A 2W6JH 1ZGXA 3A5EA 3D3LA 2Y74A 3AHSA 1DMMA 1B21A 1W4NA 3PCRA 4O02B 1GS3A 4MEIA 1RN1A 1U8CB 1AVKA 3DGLA 3G4S3 3DY5A 4RNYA 3Q90A 1OPYA 4IIAA 1VQP3 1Q824 1V74A 1WQLB 3KN4A 5G1KA 3PGBA 4GB5A 1VQ73 3NXJA 1CEWI 2CIUA 1K8A4 1IK3A 2GU3A 4X2OA 4XDWA 1UDII 2KRTA 4HM4B 3SOYA 1MWSA 4HM5B 4J5GA 1X1YA 1WMNA 3MWZA 3S27A 1JRQA 1LVNA 1JN5B 2BMQB 1N8R4 1IVUA 3H51A 1BRSA 5IG5A 3EHCA 1U5OA 2JDIH 5BU4A 4KFFA 4HM6B 7RNTA 3WOFB 1CYUA 1BRJA 1RTUA 3OXAA 1RNTA 1I3IA 1Q864 4FMAA 4XDVA 1GOUA 2GEYA 2HMJB 5CXOA 1QJGA 1M9GA 1RSNA 1SIHA 2IY2A 2KF3A 1STDA 5M18A 5M1AA 3T0UA 2XSHB 3K63A 1KSIA 3DXOA 4ILFA 1JJ22 3DMCA 1A2PA 2KF4A 2XRXB 3MG1A 4WP5A 1JB4A 3RNTA 1CYVA 4BL2A 3CCV3 2P09A 2CWTA 4BU4A 3SYUA 3FF0A 4K61A 2IMJA 2LYXA 3NHXA 4HZ9B 1BRNL 5GSPA 2WOHA 4BTWA 3G6E3 1JNQA 1UUWB 2MF7A 2E2UA 2GBWB 1DE3A 1VQ43 1B3SA 4HOHA 1BIRA 2B1XB 5BIRA 9RNTA 1W7CA 1BVIA 3NQYA 1YI23 4O2HA 1JBTA 3FG1A 1X1UA 2XGLA 4HM8B 3GZRA 4XM4A 2FNQA 1RNBA 1BNRA 3LZAA 3MPHA 1STFI 2R4IA 5G2GA 1LNIA 1BRGA 3DGYA 4L8PA 1BNSA 4MMZB 5CK6A 3E99A 1TTOA 3CXC2 2XGNA 1AV4A 4HZBB 4JF8A 4WWUC 3GSPA 3AGOA 4OUQA 2KXGA 1IV9A 1BOXA 3GRDA 3KKGA 4I5QA 2FGTA 1EKMA 1LOVA 3X3ZA 2CW9A 1ULJB 3K7CA 2QGUA 1BNJA 1N8QA 1VQQA 3N54B 5JPPA 1GMRA 1FUSA 3LTDA 3CCE3 3IMAB 4CJNA 1MGWA 1TP6A 1OGXA 4G1MB 1JN5A 2RBIA 2RNTA 4IPBA 1HZ1A 1IVVA 5CF1A 2BMOB 3WR2A 2F4YA 1RN4A 2KAAA 3OV4A 1B27A 4STDA 3UNLA 1FA3A 3F7XA 4PEJA 4HM1B 4IT7A 5JPUA 3CCR3 1N5HA 2B24B 3KZTA 3RGAA 1JBRA 1JKGA 2W03A 3AHWA 1GOYA 3H3HA 4HM0B 3HK4A 1CQSA 1UI8A 5KP4A 1YIJ3 4LGQA 1HU9A 1UGHI 2GBXB 3VF1A 1BNIA 1N5PA 2ZA4A 3FSDA 2H0GA 2I9WA 7STDA 1GYBA 1HYFA 3I0YA 5IF6A 2C10A 1IQXA 3NV0B 1ASKA 3Q2PA 2CC3A 4N6TA 4WFOA 3UL6A 1JBSA 4R1KA 4KZ1A 3CD63 1BRIA 3JUNA 1IVXA 1DMNA 1E3VA 1RDSA 1W00A 1YNVX 4R9KA 1FGOA 4FMBA 1W01A 4EV2A 3DH2A 4XB5A 1X1WA 1LNHA 1QAFA 3D5IA 1S723 1JZDA 1OHPA 4X2HA 1YJW3 3EB8A 2LQVA 5IW9A 2ML5A 3FKAA 3CPOA 4NREA 2P38A 1A90A 3U97A 3CCJ3 1Q40B 1PY3A 3JUOA 5AIIA 4LMIA 3HOHA 4CPKA 5FGOA 3UL5A 1UW1A 3SOAA 1RJOA 2K54A 3D79A 3FLJA 3LTAA 4WHAA 1YIT3 1LOXA 1MWRA 2CFDA 2K3DA 3HZPA 3EF8A 3NM7A 4FMCA 5G1LA 2W0QA 3UJMA 1G96A 3JUMA 3O8YA 3MKIA 1OCVA 3X3YA 4N6MA 1RKYA 2WO0A 2QEX3 1SPUA 1Q7HA 3CCL3 3DM8A 1EUIC 3CU3A 2W9PA 5AIGA 2BMRB 1KQS2 2UX0A 4MMXB 1JV2B 2BHMA 1Q40A 2UGIA 3X41A 5LC6A 3EE1A 1GY5A 3TDGA 6STDA 1A2VA 1I0VA 3WDGB 1EEJA 2SBLA 2Z77A 1MWTA 1GD3A 1QVF2 2CG0A 4J5KA 1EG9B 1DYUA 1DMQA 1I2GA 3LYGA 4O3VA 2W04A 4RNZA 1WMPA 4Q53A 2BU4A 3FG3A 5TGNA 3KE7A 5JBSA 2L1SA 1O7HB 1IVWA 3ECFA 3T8UA 2XFSA 1YHQ3 1Q7Y4 4WYKA 3KFQC 1FGQA 2HMOB 5CLKA 3CC43 3NV0A 3FG4A 1I0XA 1NU3A 3MHEA 4EW5A 1G0TA 1K28A 3V92A 2D1WA 2J8XB 3WA3A 5IENA 1M1XB 3U1WA 1BNEA 1JKGB 1RGAA 4GSPA 2ML6A 1VQ83 1US1A 2CFWA 1VZZA 5STDA 3NBJA 2F5MA 1FGTA 2Y73A 3Q3FA 1BU4A 4KVHA 3IJEB 1B2SA 4MJDA 3G8ZA 3NBBA 5KP3A 5AIFA 1GSPA 1IDPA 2O3OA 5IERA 2PZVA 1MOLA 1LQMB 1V58A 4BTYA 2W56B 2E2TA 1UCLA 3FZWA 1OF5B 1V57A 4HKVB 1FGRA 3PCSA 5I97A 1RCKA 3ALAA 3ER7A 3HIGA 3JVCA 1K9M4 1SQWA 4KFDA 1A67A 4HM2B 4HVNA 3FH1A 4BIRA 1NDOB 1TJDA 1YJ93 1GMQA 1AVLA 1LOYA 4U13A 2F99A 4H61A 3CCU3 3F7SA 2XSOB 1QALA 1BNFA 1W2ZA 2F56A 2RFRA 1W6CA 1RGHA 1TRPA 3G713 2W2CA 1BSBA 2P05A 1VQN3 2ZDJA 3F8XA 4EYCA 1WTHA 3KCHA 4KFEA 3RGRA 3LT8A 6GSPA 2CH9A 2CFGA 1QAKA 3HX8A 3G0KA 5IG3A 3DGMA 1VQ63 1BANA 3F8HA 1D6UA 5AI1A 1OH0A 1I3FA 1E97A 2H0HA 3B7CA 2C11A 1BSAA 2BO9B 3MYTA 3MG2A 1W2B2 1IU7A 4OVMA 1YVBI 1W6YA 2OOVC 2F98A 2XR8B 3QRDA 1BRKA
chains in the Genus database with same CATH topology
3FCSB 1IT7A 1ZX2A 2QA43 1LXEA 5AYRB 3J7Yd 1IV7A 3KSED 4CDLA 4LEHA 1O7PB 4EV5A 1UUVB 3CNXA 1DVDA 3DGNA 1PU4A 2M7OA 4AEQA 1QVG2 2CHCA 2HMLB 3CCQ3 5AEUB 3GZXB 4AKYA 1T5YA 1QMAA 3BNBA 3K5TA 3BLZA 1PFPA 3DUKA 3CNMA 1RN7A 4AKZA 2CG1A 4N6NB 1OUNA 4EBGA 3JUPA 1D6ZA 5CK6A 2OTJ3 1DVCA 1TFKA 1FUWA 1Z1SA 4I4KA 1NO3A 3D9RA 4N6OB 1VQK3 3NX0A 3OWUA 1O7MB 2W56A 3RDEA 2YFLB 3NUVA 1JB2A 4NHFA 2W9QA 4R4KA 1IQYA 5DREA 3OW22 2ZL8A 4N6UA 3SX1A 1OHSA 3OX9A 3FGYA 3PXMA 1J2BA 1UI7A 5AIHA 3Q1CA 4HJLB 1W6GA 2O9UX 1ROVA 4FCJA 3STDA 1KC84 1N9EA 3K0ZA 1ISKA 4FR9A 2HMMB 3LXUX 3V99A 3IPTA 3VGNA 2CFLA 3CME3 1GY6A 2P0XA 4K90B 3EN1B 2OOVA 1IQ8A 1HKXA 1NB3I 3GZBA 3SXXA 4N6LA 3PZWA 3S5CA 5ELUA 1OACA 2CFKA 2STDA 2E2VA 1ZO2A 3F9SA 4HM3B 4CCVA 3AMOB 1FGMA 2XH9A 5EQLA 1L5GB 3NQZA 2KCDA 1NWWA 3LTBA 2BT3A 4FMDA 3N8BA 3CCS3 1A2KA 1F8NA 1OHOA 2P0MA 4J8TA 3ROBA 3I553 4HBRA 2WGQA 2PNCA 2CWUA 3GZYB 2IUJA 4N3VA 4ORLA 3I563 1NB5I 2IUKA 3DGOA 2Z6BA 4XBTA 4R9LA 1ROAA 3PS8A 3BB9A 4O8SA 4XBYA 2XF3A 2L4VA 1M1K4 4HM7B 1R4CA 2OCTA 3CC73 1S5AA 5DRVA 3EQQB 4RBNA 4LSOA 2K0MA 4K1UA 3OWYA 4ZM8A 3DZLA 1ULIB 3LTCA 8CHOA 2CK3H 3S28A 1N9JA 5D81A 4FCMA 1TU5A 1KD14 3KIIA 4GL6A 2OTL3 2QIYA 3BNEA 3QK9A 3WOEB 2CWVA 4RZMA 1WNHA 5AEWB 3B8LA 2GXFA 2WGOA 2OWPA 1AR0A 1OF5A 4L7KA 3S67A 1GY7A 3JUQA 4J9AA 2XEPA 3EN8A 3LOYA 3CPW2 3FF2A 5D83A 3T8NA 1IT8A 1TFOA 4LZIA 4L8OA 3SVAA 3MG3A 1VQO3 3LT9A 5EVHA 5HGRA 1TUHA 3V98A 5CF2A 3WMDA 1RRLA 1K734 2RSXA 3N9HA 5EEOA 3HI7A 3NM2A 4TX4A 1NJI4 3SEDA 5BXQA 1W02A 1KWIA 5IG0A 4EC6A 2FXTA 4H3UA 1GD4A 3BNDA 2OQEA 3S29A 1RRHA 3G16A 2GU1A 1O7GB 1O7WB 1C7HA 2OQEC 3PYJA 4WYKB 5IEOA 1K41A 2YFJB 1VQ93 1YJN3 2INXA 1YGEA 3CC23 1D6YA 3LH4A 5BVBA 1JB5A 3GAXA 1Q42A 3F14A 1WMOA 1OGZA 3K9MC 1EA2A 3CMA3 3EBYA 2RGQA 3X3XA 2XFTA 1O7NB 5KP1A 2GEXA 5A0OB 1Y4KA 1VQL3 3EC9A 1TIJA 3B4PA 2WOFA 2MC8A 1VQ53 3F40A 3HIIA 2YX9A 1SIIA 2IA7A 4N6V0 2HMNB 2F86B 2Z7AA 3LMLA 4JRFA 3UB1A 3L0RA 4MMYB 5LC7A 2HMKB 4R80A 3X42A 3WA2X 1EQKA 4XBXA 5FW5A 4FCZA 3VSYA 3OWSA 2Z76A 1W5ZA 2A15A 4OK0A 3B4OA 3SLUA 4EXRA 5IG4A 3NBRA 2BNGA 3BNCA 1BUQA 2YFIB 5ELJA 1E3RA 3M8CA 4QWTA 4HYZA 5D82A 1VQM3 3A76A 3AMOA 2D42A 2JQ5A 3KSPA 4BTXA 2RCDA 3X40A 3EBTA 3MSOA 3EJVA 4K1VA 1SJWA 2V1LA 1MNLA 2Q07A 3EX9A 2CKFB 5AYSC 3WODG 1M904 3GWRA 1Q814 3CCM3 5IEPA 2W6JH 3D3LA 2Y74A 1DMMA 1W4NA 3PCRA 4O02B 1GS3A 4MEIA 1U8CB 1AVKA 3DGLA 3G4S3 3DY5A 4RNYA 3Q90A 1OPYA 4IIAA 1VQP3 1Q824 1V74A 1WQLB 3KN4A 3PGBA 4GB5A 1VQ73 3NXJA 1CEWI 2CIUA 1K8A4 1IK3A 2GU3A 4X2OA 4XDWA 2KRTA 4HM4B 3SOYA 4HM5B 1WMNA 3MWZA 3S27A 1JRQA 1LVNA 1JN5B 2BMQB 1N8R4 1IVUA 3H51A 5IG5A 3EHCA 1U5OA 2JDIH 4KFFA 4HM6B 1CYUA 3WOFB 3OXAA 1Q864 4FMAA 4XDVA 2GEYA 2HMJB 5CXOA 1QJGA 1M9GA 1SIHA 1STDA 3T0UA 2XSHB 3K63A 1KSIA 3DXOA 1JJ22 3DMCA 3MG1A 2XRXB 4WP5A 1JB4A 1CYVA 3CCV3 2P09A 2CWTA 3FF0A 4K61A 2IMJA 2LYXA 3NHXA 4HZ9B 2WOHA 4BTWA 3G6E3 1JNQA 1UUWB 2MF7A 2E2UA 2GBWB 1VQ43 2B1XB 1W7CA 3NQYA 1YI23 4O2HA 3FG1A 2XGLA 4HM8B 3GZRA 4XM4A 2FNQA 3LZAA 3MPHA 1STFI 2R4IA 5G2GA 4L8PA 4MMZB 3E99A 3CXC2 2XGNA 1AV4A 4HZBB 4JF8A 4WWUC 4OUQA 2KXGA 1IV9A 3KKGA 3GRDA 2FGTA 1EKMA 3X3ZA 2CW9A 1ULJB 3K7CA 2QGUA 1N8QA 3N54B 5JPPA 3LTDA 3CCE3 3IMAB 1TP6A 1OGXA 4G1MB 1JN5A 4IPBA 1IVVA 5CF1A 2BMOB 3OV4A 4STDA 3UNLA 1FA3A 3F7XA 4PEJA 4HM1B 4IT7A 5JPUA 3CCR3 1N5HA 2B24B 3KZTA 3RGAA 1JKGA 2W03A 3H3HA 4HM0B 3HK4A 1CQSA 1UI8A 5KP4A 1YIJ3 4LGQA 1HU9A 2GBXB 3VF1A 1N5PA 3FSDA 2I9WA 7STDA 1GYBA 3I0YA 5IF6A 2C10A 1IQXA 3NV0B 1ASKA 3Q2PA 2CC3A 4N6TA 4WFOA 3UL6A 4R1KA 4KZ1A 3CD63 3JUNA 1IVXA 1DMNA 1E3VA 1W00A 4R9KA 1FGOA 4FMBA 1W01A 4EV2A 4XB5A 1LNHA 1QAFA 1S723 1OHPA 4X2HA 1YJW3 3EB8A 2LQVA 5IW9A 2ML5A 3FKAA 3CPOA 4NREA 2P38A 1A90A 3U97A 3CCJ3 1Q40B 3JUOA 5AIIA 4LMIA 5FGOA 3UL5A 1UW1A 3SOAA 1RJOA 2K54A 3FLJA 3LTAA 4WHAA 1YIT3 1LOXA 2CFDA 3NM7A 4FMCA 3HZPA 3EF8A 3UJMA 2W0QA 1G96A 3JUMA 3O8YA 3MKIA 1OCVA 3X3YA 4N6MA 1RKYA 2WO0A 2QEX3 1SPUA 3CCL3 3DM8A 3CU3A 2W9PA 5AIGA 2BMRB 1KQS2 2UX0A 4MMXB 1JV2B 2BHMA 1Q40A 3X41A 5LC6A 3EE1A 1GY5A 3TDGA 6STDA 1A2VA 3WDGB 2SBLA 2Z77A 1GD3A 1QVF2 2CG0A 1EG9B 1DYUA 1DMQA 3LYGA 4O3VA 2W04A 4RNZA 1WMPA 4Q53A 3FG3A 5TGNA 3KE7A 5JBSA 1O7HB 1IVWA 3ECFA 3T8UA 2XFSA 1YHQ3 1Q7Y4 4WYKA 3KFQC 1FGQA 2HMOB 5CLKA 3CC43 3NV0A 3FG4A 1NU3A 3MHEA 1K28A 3V92A 2D1WA 3WA3A 5IENA 1M1XB 3U1WA 1JKGB 2ML6A 1VQ83 1US1A 2CFWA 1VZZA 5STDA 3NBJA 1FGTA 2Y73A 4KVHA 3IJEB 4MJDA 3G8ZA 3NBBA 5KP3A 5AIFA 1IDPA 2O3OA 5IERA 2PZVA 1MOLA 4BTYA 2W56B 2E2TA 3FZWA 1OF5B 4HKVB 1FGRA 3PCSA 5I97A 3ALAA 3ER7A 3HIGA 1K9M4 3JVCA 1SQWA 4KFDA 1A67A 4HM2B 4HVNA 3FH1A 1YJ93 1NDOB 1AVLA 4U13A 2F99A 4H61A 3CCU3 3F7SA 2XSOB 1QALA 1W2ZA 2RFRA 1W6CA 3G713 2W2CA 2P05A 1VQN3 2ZDJA 3F8XA 4EYCA 1WTHA 4KFEA 3RGRA 3LT8A 2CH9A 2CFGA 1QAKA 3HX8A 3G0KA 5IG3A 3DGMA 1VQ63 3F8HA 1D6UA 5AI1A 1OH0A 1E97A 3B7CA 2C11A 2BO9B 3MYTA 3MG2A 1W2B2 1IU7A 4OVMA 1YVBI 1W6YA 2OOVC 2F98A 2XR8B 3QRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GB5 A;  4R9K A;  3NXJ A;  1ZX2 A;  4RZM A;  1W01 A;  4X2O A;  4XB5 A;  4XDW A;  5AEW B;  4HM4 B;  3SOY A;  1OHP A;  3B8L A;  4HM5 B;  4X2H A;  4CDL A;  4LEH A;  2GXF A;  1O7P B;  2OWP A;  1UUV B;  3CNX A;  1AR0 A;  3CPO A;  1JN5 B;  1OF5 A;  2BMQ B;  3FKA A;  3H51 A;  4L7K A;  1GY7 A;  3JUQ A;  3EHC A;  4J9A A;  2CHC A;  1Q40 B;  1U5O A;  2HML B;  3EN8 A;  4HM6 B;  3JUO A;  5AII A;  4LMI A;  5AEU B;  3OXA A;  3FF2 A;  5D83 A;  3GZX B;  3T8N A;  3SOA A;  2K54 A;  3FLJ A;  4XDV A;  4L8O A;  2GEY A;  2HMJ B;  1QMA A;  3MG3 A;  5CXO A;  3BLZ A;  3EF8 A;  3HZP A;  1STD A;  3DUK A;  3UJM A;  5EVH A;  3CNM A;  2XSH B;  1TUH A;  3JUM A;  3DXO A;  5HGR A;  5CF2 A;  3DMC A;  1OCV A;  2XRX B;  3MG1 A;  3MKI A;  1OUN A;  4WP5 A;  3WMD A;  1JB4 A;  3JUP A;  5CK6 A;  3DM8 A;  3NM2 A;  3CU3 A;  1Z1S A;  4I4K A;  5AIG A;  2BMR B;  3D9R A;  3SED A;  5BXQ A;  2UX0 A;  1W02 A;  3FF0 A;  2IMJ A;  3NHX A;  4HZ9 B;  5IG0 A;  1Q40 A;  4H3U A;  3OWU A;  1O7M B;  1GY5 A;  6STD A;  2YFL B;  3NUV A;  3G16 A;  1JB2 A;  1O7G B;  1O7W B;  1C7H A;  1UUW B;  4WYK B;  5DRE A;  5IEO A;  1K41 A;  2GBW B;  2YFJ B;  2Z77 A;  2INX A;  1EG9 B;  1OHS A;  1DMQ A;  3OX9 A;  3LYG A;  3FGY A;  2B1X B;  5BVB A;  5AIH A;  1JB5 A;  4Q53 A;  1Q42 A;  5TGN A;  3F14 A;  1OGZ A;  3KE7 A;  4HJL B;  1EA2 A;  1O7H B;  3ECF A;  3T8U A;  4HM8 B;  3GZR A;  4WYK A;  4XM4 A;  4FCJ A;  5CLK A;  2HMO B;  3EBY A;  3K0Z A;  2RGQ A;  3STD A;  3NV0 A;  1ISK A;  1O7N B;  2HMM B;  3LZA A;  3IPT A;  2R4I A;  3VGN A;  5KP1 A;  5JPP A;  1NU3 A;  2GEX A;  3MHE A;  5G2G A;  3EC9 A;  4L8P A;  3B4P A;  3E99 A;  1GY6 A;  4HZB B;  3F40 A;  4WWU C;  5IEN A;  4OUQ A;  1JKG B;  2HMN B;  3EN1 B;  2F86 B;  2Z7A A;  1HKX A;  3GZB A;  1VZZ A;  3KKG A;  3GRD A;  5STD A;  3S5C A;  2HMK B;  4KVH A;  4MJD A;  1ULJ B;  2STD A;  3K7C A;  2QGU A;  3G8Z A;  1ZO2 A;  4XBX A;  3F9S A;  4HM3 B;  5AIF A;  5FW5 A;  1IDP A;  5KP3 A;  3OWS A;  3VSY A;  2Z76 A;  2PZV A;  2A15 A;  5IER A;  3B4O A;  5IG5 A;  5IG4 A;  3NBR A;  1TP6 A;  2BNG A;  3FZW A;  1BUQ A;  1OGX A;  2YFI B;  1JN5 A;  1OF5 B;  1E3R A;  3M8C A;  4HKV B;  4U13 A;  1NWW A;  3ER7 A;  5D82 A;  3A76 A;  2BMO B;  5CF1 A;  4HM2 B;  4HVN A;  2JQ5 A;  3FH1 A;  3KSP A;  1NDO B;  2RCD A;  3OV4 A;  1A2K A;  4STD A;  3EBT A;  2F99 A;  1OHO A;  3EJV A;  3MSO A;  3F7S A;  4J8T A;  2XSO B;  1SJW A;  4K1V A;  3UNL A;  3F7X A;  2RFR A;  4HM1 B;  4PEJ A;  3EX9 A;  3ROB A;  5JPU A;  2CKF B;  2W2C A;  3GZY B;  4N3V A;  4ORL A;  2B24 B;  3KZT A;  3RGA A;  1JKG A;  3GWR A;  3H3H A;  4HM0 B;  3F8X A;  1CQS A;  3HK4 A;  4XBT A;  5IEP A;  5KP4 A;  4LGQ A;  4R9L A;  2GBX B;  3RGR A;  3BB9 A;  4XBY A;  1DMM A;  3FSD A;  3HX8 A;  4HM7 B;  1GS3 A;  2I9W A;  3G0K A;  7STD A;  1GYB A;  1S5A A;  3EQQ B;  3I0Y A;  5DRV A;  5IG3 A;  5IF6 A;  3NV0 B;  3F8H A;  1ASK A;  5AI1 A;  4K1U A;  1OH0 A;  3OWY A;  3DZL A;  1ULI B;  1E97 A;  4R1K A;  3B7C A;  8CHO A;  3MYT A;  3Q90 A;  1OPY A;  3JUN A;  3MG2 A;  4IIA A;  4FCM A;  1DMN A;  1WQL B;  5D81 A;  1E3V A;  4OVM A;  1QJG A;  1W00 A;  1W6Y A;  2QIY A;  2F98 A;  2XR8 B; 
#chains in the Genus database with same CATH topology
 3FCS B;  1IT7 A;  1ZX2 A;  2QA4 3;  1LXE A;  5AYR B;  3J7Y d;  1LRA A;  1IV7 A;  1B2M A;  3BIR A;  3KSE D;  1RMS A;  4CDL A;  4LEH A;  1O7P B;  4EV5 A;  1UUV B;  3CNX A;  1DVD A;  3DGN A;  1RGC A;  1PU4 A;  2M7O A;  4AEQ A;  1QVG 2;  2CHC A;  2HML B;  3CCQ 3;  1B2Z A;  5AEU B;  1RLS A;  3GZX B;  4AKY A;  1YGW A;  2AAD A;  1T5Y A;  1QMA A;  3BNB A;  2C4B A;  1GMP A;  3BLZ A;  1PFP A;  3K5T A;  3DUK A;  2CX1 A;  3CNM A;  4GHO A;  1RN7 A;  1RGE A;  4AKZ A;  2CG1 A;  4N6N B;  1OUN A;  4EBG A;  3JUP A;  1D6Z A;  1MWU A;  1R4Y A;  1UUG B;  1DVC A;  4NPB A;  1BAO A;  1TFK A;  2F5W A;  2OTJ 3;  1FUW A;  1Z1S A;  4I4K A;  1NO3 A;  3D9R A;  4N6O B;  1VQK 3;  3NX0 A;  6RNT A;  3OWU A;  1O7M B;  2W56 A;  3RDE A;  2YFL B;  3NUV A;  4RNT A;  1JB2 A;  4NHF A;  2W9Q A;  4R4K A;  1IQY A;  5DRE A;  3OW2 2;  2ZL8 A;  1BGS A;  1DET A;  4N6U A;  1C54 A;  2GSP A;  3SX1 A;  1OHS A;  3ZG0 A;  3OX9 A;  3FGY A;  2H0I A;  3PXM A;  1J2B A;  1UI7 A;  5AIH A;  1RGF A;  3Q1C A;  4HJL B;  3ZG5 A;  1W6G A;  1BUJ A;  2O9U X;  1ROV A;  4FCJ A;  3STD A;  1KC8 4;  1N9E A;  1MGR A;  3K0Z A;  1ISK A;  1SAR A;  4FR9 A;  2HMM B;  1AQZ A;  3LXU X;  3IPT A;  3V99 A;  3VGN A;  4DKI A;  2CFL A;  4LYL B;  1UGI A;  3CME 3;  1GY6 A;  2P0X A;  4HAA A;  4K90 B;  1T3B A;  3EN1 B;  2HOH A;  2OOV A;  1IQ8 A;  1HKX A;  1NB3 I;  3GZB A;  3SXX A;  3ZFZ A;  4N6L A;  3D4A A;  3PZW A;  3S5C A;  1BSC A;  5ELU A;  1OAC A;  2CFK A;  1B2U A;  1BNG A;  2E2V A;  2STD A;  1ZO2 A;  3F9S A;  4HM3 B;  1I8V A;  5RNT A;  2UUG C;  8RNT A;  4CCV A;  3AMO B;  1FGM A;  2XH9 A;  5EQL A;  1L5G B;  1X1X A;  3NQZ A;  2KCD A;  1NWW A;  3LTB A;  1AY7 A;  2BT3 A;  4FMD A;  1B2X A;  3N8B A;  3CCS 3;  1A2K A;  1F8N A;  1OHO A;  2P0M A;  2KF6 A;  4J8T A;  3ROB A;  3WHO A;  3I55 3;  4HBR A;  2WGQ A;  2PNC A;  2CWU A;  3GZY B;  2IUJ A;  4N3V A;  4ORL A;  3I56 3;  1UCJ A;  1NB5 I;  2IUK A;  3DGO A;  2Z6B A;  4XBT A;  4R9L A;  1I2E A;  1ROA A;  3PS8 A;  3BB9 A;  4O8S A;  4XBY A;  2XF3 A;  2BIR A;  2L4V A;  1M1K 4;  2KF5 A;  4HM7 B;  1R4C A;  2OCT A;  3CC7 3;  1S5A A;  5DRV A;  3EQQ B;  1FUT A;  4RBN A;  4LSO A;  2K0M A;  4K1U A;  3OWY A;  4ZM8 A;  3DZL A;  1ULI B;  1RCL A;  3URP A;  3LTC A;  8CHO A;  2CK3 H;  3S28 A;  1N9J A;  5D81 A;  4FCM A;  4KT3 B;  1TU5 A;  3KII A;  1KD1 4;  4GL6 A;  2OTL 3;  2QIY A;  3BU4 A;  3BNE A;  3QK9 A;  3WOE B;  2CWV A;  4RZM A;  1WNH A;  5AEW B;  3B8L A;  5HOH A;  2GXF A;  2WGO A;  2OWP A;  1AR0 A;  1OF5 A;  4L7K A;  1GOV A;  3S67 A;  1YVS A;  1GY7 A;  3JUQ A;  4J9A A;  4BL3 A;  2XEP A;  1T2H A;  3EN8 A;  3LOY A;  3CPW 2;  3FF2 A;  5D83 A;  3T8N A;  1IT8 A;  1TFO A;  4LZI A;  4L8O A;  3SVA A;  3MG3 A;  1VQO 3;  3LT9 A;  1NNV A;  5EVH A;  5HGR A;  1TUH A;  3V98 A;  5CF2 A;  1UCK A;  3WMD A;  1RRL A;  1K73 4;  2RSX A;  3N9H A;  5EEO A;  1RGL A;  1FYS A;  3HI7 A;  3NM2 A;  1LQG C;  4TX4 A;  1NJI 4;  3SED A;  5BXQ A;  1W02 A;  1KWI A;  5IG0 A;  4EC6 A;  2FXT A;  4H3U A;  1GD4 A;  3BND A;  2OQE A;  3S29 A;  1RHL A;  1JZO A;  1RRH A;  2GU1 A;  3G16 A;  1O7G B;  1O7W B;  1C7H A;  2OQE C;  3PYJ A;  4WYK B;  5IEO A;  1K41 A;  2YFJ B;  2CX0 A;  1VQ9 3;  1YJN 3;  2INX A;  7GSP A;  1YGE A;  3CC2 3;  1D6Y A;  3LH4 A;  5BVB A;  1JB5 A;  3GAX A;  1Q42 A;  2AAE A;  3F14 A;  1WMO A;  1OGZ A;  3K9M C;  1EA2 A;  1I2F A;  1TRQ A;  3D5G A;  3CMA 3;  1BSE A;  2IYJ A;  3AGN A;  3EBY A;  1I70 A;  2RGQ A;  3X3X A;  2XFT A;  1O7N B;  1FW7 A;  5KP1 A;  1IYY A;  2GEX A;  5A0O B;  1Y4K A;  5M19 A;  3EC9 A;  1TIJ A;  3B4P A;  1VQL 3;  1UCI A;  2WOF A;  2MC8 A;  1VQ5 3;  3F40 A;  3HII A;  2YX9 A;  1SII A;  1RGK A;  2IA7 A;  2HMN B;  2SAR A;  4N6V 0;  2F86 B;  2Z7A A;  3LML A;  4JRF A;  3UB1 A;  3L0R A;  4MMY B;  5LC7 A;  1LOW A;  1PYL A;  2HMK B;  4R80 A;  3X42 A;  1T2I A;  3WA2 X;  1EQK A;  4XBX A;  5FW5 A;  4FCZ A;  3VSY A;  3OWS A;  2Z76 A;  1W5Z A;  2A15 A;  4OK0 A;  3B4O A;  3SLU A;  4EXR A;  5IG4 A;  3NBR A;  2BNG A;  3BNC A;  1BUQ A;  2YFI B;  5ELJ A;  1FZU A;  1E3R A;  3M8C A;  4QWT A;  1RGG A;  4HYZ A;  5D82 A;  1VQM 3;  3A76 A;  3AMO A;  2D42 A;  2JQ5 A;  1BRH A;  3KSP A;  4BTX A;  2RCD A;  3X40 A;  1CH0 A;  3EBT A;  3MSO A;  3EJV A;  4K1V A;  1B20 A;  1SJW A;  2V1L A;  1MNL A;  1Q9E A;  2ZHX B;  2Q07 A;  3EX9 A;  2R41 A;  1BSD A;  2CKF B;  5AYS C;  3WOD G;  1M90 4;  3GWR A;  1Q81 4;  1ZS7 A;  3CCM 3;  5IEP A;  1G02 A;  2W6J H;  1ZGX A;  3A5E A;  3D3L A;  2Y74 A;  3AHS A;  1DMM A;  1B21 A;  1W4N A;  3PCR A;  4O02 B;  1GS3 A;  4MEI A;  1RN1 A;  1U8C B;  1AVK A;  3DGL A;  3G4S 3;  3DY5 A;  4RNY A;  3Q90 A;  1OPY A;  4IIA A;  1VQP 3;  1Q82 4;  1V74 A;  1WQL B;  3KN4 A;  5G1K A;  3PGB A;  4GB5 A;  1VQ7 3;  3NXJ A;  1CEW I;  2CIU A;  1K8A 4;  1IK3 A;  2GU3 A;  4X2O A;  4XDW A;  1UDI I;  2KRT A;  4HM4 B;  3SOY A;  1MWS A;  4HM5 B;  4J5G A;  1X1Y A;  1WMN A;  3MWZ A;  3S27 A;  1JRQ A;  1LVN A;  1JN5 B;  2BMQ B;  1N8R 4;  1IVU A;  3H51 A;  1BRS A;  5IG5 A;  3EHC A;  1U5O A;  2JDI H;  5BU4 A;  4KFF A;  4HM6 B;  7RNT A;  3WOF B;  1CYU A;  1BRJ A;  1RTU A;  3OXA A;  1RNT A;  1I3I A;  1Q86 4;  4FMA A;  4XDV A;  1GOU A;  2GEY A;  2HMJ B;  5CXO A;  1QJG A;  1M9G A;  1RSN A;  1SIH A;  2IY2 A;  2KF3 A;  1STD A;  5M18 A;  5M1A A;  3T0U A;  2XSH B;  3K63 A;  1KSI A;  3DXO A;  4ILF A;  1JJ2 2;  3DMC A;  1A2P A;  2KF4 A;  2XRX B;  3MG1 A;  4WP5 A;  1JB4 A;  3RNT A;  1CYV A;  4BL2 A;  3CCV 3;  2P09 A;  2CWT A;  4BU4 A;  3SYU A;  3FF0 A;  4K61 A;  2IMJ A;  2LYX A;  3NHX A;  4HZ9 B;  1BRN L;  5GSP A;  2WOH A;  4BTW A;  3G6E 3;  1JNQ A;  1UUW B;  2MF7 A;  2E2U A;  2GBW B;  1DE3 A;  1VQ4 3;  1B3S A;  4HOH A;  1BIR A;  2B1X B;  5BIR A;  9RNT A;  1W7C A;  1BVI A;  3NQY A;  1YI2 3;  4O2H A;  1JBT A;  3FG1 A;  1X1U A;  2XGL A;  4HM8 B;  3GZR A;  4XM4 A;  2FNQ A;  1RNB A;  1BNR A;  3LZA A;  3MPH A;  1STF I;  2R4I A;  5G2G A;  1LNI A;  1BRG A;  3DGY A;  4L8P A;  1BNS A;  4MMZ B;  5CK6 A;  3E99 A;  1TTO A;  3CXC 2;  2XGN A;  1AV4 A;  4HZB B;  4JF8 A;  4WWU C;  3GSP A;  3AGO A;  4OUQ A;  2KXG A;  1IV9 A;  1BOX A;  3GRD A;  3KKG A;  4I5Q A;  2FGT A;  1EKM A;  1LOV A;  3X3Z A;  2CW9 A;  1ULJ B;  3K7C A;  2QGU A;  1BNJ A;  1N8Q A;  1VQQ A;  3N54 B;  5JPP A;  1GMR A;  1FUS A;  3LTD A;  3CCE 3;  3IMA B;  4CJN A;  1MGW A;  1TP6 A;  1OGX A;  4G1M B;  1JN5 A;  2RBI A;  2RNT A;  4IPB A;  1HZ1 A;  1IVV A;  5CF1 A;  2BMO B;  3WR2 A;  2F4Y A;  1RN4 A;  2KAA A;  3OV4 A;  1B27 A;  4STD A;  3UNL A;  1FA3 A;  3F7X A;  4PEJ A;  4HM1 B;  4IT7 A;  5JPU A;  3CCR 3;  1N5H A;  2B24 B;  3KZT A;  3RGA A;  1JBR A;  1JKG A;  2W03 A;  3AHW A;  1GOY A;  3H3H A;  4HM0 B;  3HK4 A;  1CQS A;  1UI8 A;  5KP4 A;  1YIJ 3;  4LGQ A;  1HU9 A;  1UGH I;  2GBX B;  3VF1 A;  1BNI A;  1N5P A;  2ZA4 A;  3FSD A;  2H0G A;  2I9W A;  7STD A;  1GYB A;  1HYF A;  3I0Y A;  5IF6 A;  2C10 A;  1IQX A;  3NV0 B;  1ASK A;  3Q2P A;  2CC3 A;  4N6T A;  4WFO A;  3UL6 A;  1JBS A;  4R1K A;  4KZ1 A;  3CD6 3;  1BRI A;  3JUN A;  1IVX A;  1DMN A;  1E3V A;  1RDS A;  1W00 A;  1YNV X;  4R9K A;  1FGO A;  4FMB A;  1W01 A;  4EV2 A;  3DH2 A;  4XB5 A;  1X1W A;  1LNH A;  1QAF A;  3D5I A;  1S72 3;  1JZD A;  1OHP A;  4X2H A;  1YJW 3;  3EB8 A;  2LQV A;  5IW9 A;  2ML5 A;  3FKA A;  3CPO A;  4NRE A;  2P38 A;  1A90 A;  3U97 A;  3CCJ 3;  1Q40 B;  1PY3 A;  3JUO A;  5AII A;  4LMI A;  3HOH A;  4CPK A;  5FGO A;  3UL5 A;  1UW1 A;  3SOA A;  1RJO A;  2K54 A;  3D79 A;  3FLJ A;  3LTA A;  4WHA A;  1YIT 3;  1LOX A;  1MWR A;  2CFD A;  2K3D A;  3HZP A;  3EF8 A;  3NM7 A;  4FMC A;  5G1L A;  2W0Q A;  3UJM A;  1G96 A;  3JUM A;  3O8Y A;  3MKI A;  1OCV A;  3X3Y A;  4N6M A;  1RKY A;  2WO0 A;  2QEX 3;  1SPU A;  1Q7H A;  3CCL 3;  3DM8 A;  1EUI C;  3CU3 A;  2W9P A;  5AIG A;  2BMR B;  1KQS 2;  2UX0 A;  4MMX B;  1JV2 B;  2BHM A;  1Q40 A;  2UGI A;  3X41 A;  5LC6 A;  3EE1 A;  1GY5 A;  3TDG A;  6STD A;  1A2V A;  1I0V A;  3WDG B;  1EEJ A;  2SBL A;  2Z77 A;  1MWT A;  1GD3 A;  1QVF 2;  2CG0 A;  4J5K A;  1EG9 B;  1DYU A;  1DMQ A;  1I2G A;  3LYG A;  4O3V A;  2W04 A;  4RNZ A;  1WMP A;  4Q53 A;  2BU4 A;  3FG3 A;  5TGN A;  3KE7 A;  5JBS A;  2L1S A;  1O7H B;  1IVW A;  3ECF A;  3T8U A;  2XFS A;  1YHQ 3;  1Q7Y 4;  4WYK A;  3KFQ C;  1FGQ A;  2HMO B;  5CLK A;  3CC4 3;  3NV0 A;  3FG4 A;  1I0X A;  1NU3 A;  3MHE A;  4EW5 A;  1G0T A;  1K28 A;  3V92 A;  2D1W A;  2J8X B;  3WA3 A;  5IEN A;  1M1X B;  3U1W A;  1BNE A;  1JKG B;  1RGA A;  4GSP A;  2ML6 A;  1VQ8 3;  1US1 A;  2CFW A;  1VZZ A;  5STD A;  3NBJ A;  2F5M A;  1FGT A;  2Y73 A;  3Q3F A;  1BU4 A;  4KVH A;  3IJE B;  1B2S A;  4MJD A;  3G8Z A;  3NBB A;  5KP3 A;  5AIF A;  1GSP A;  1IDP A;  2O3O A;  5IER A;  2PZV A;  1MOL A;  1LQM B;  1V58 A;  4BTY A;  2W56 B;  2E2T A;  1UCL A;  3FZW A;  1OF5 B;  1V57 A;  4HKV B;  1FGR A;  3PCS A;  5I97 A;  1RCK A;  3ALA A;  3ER7 A;  3HIG A;  3JVC A;  1K9M 4;  1SQW A;  4KFD A;  1A67 A;  4HM2 B;  4HVN A;  3FH1 A;  4BIR A;  1NDO B;  1TJD A;  1YJ9 3;  1GMQ A;  1AVL A;  1LOY A;  4U13 A;  2F99 A;  4H61 A;  3CCU 3;  3F7S A;  2XSO B;  1QAL A;  1BNF A;  1W2Z A;  2F56 A;  2RFR A;  1W6C A;  1RGH A;  1TRP A;  3G71 3;  2W2C A;  1BSB A;  2P05 A;  1VQN 3;  2ZDJ A;  3F8X A;  4EYC A;  1WTH A;  3KCH A;  4KFE A;  3RGR A;  3LT8 A;  6GSP A;  2CH9 A;  2CFG A;  1QAK A;  3HX8 A;  3G0K A;  5IG3 A;  3DGM A;  1VQ6 3;  1BAN A;  3F8H A;  1D6U A;  5AI1 A;  1OH0 A;  1I3F A;  1E97 A;  2H0H A;  3B7C A;  2C11 A;  1BSA A;  2BO9 B;  3MYT A;  3MG2 A;  1W2B 2;  1IU7 A;  4OVM A;  1YVB I;  1W6Y A;  2OOV C;  2F98 A;  2XR8 B;  3QRD A;  1BRK A; 
#chains in the Genus database with same CATH homology
 3FCS B;  1IT7 A;  1ZX2 A;  2QA4 3;  1LXE A;  5AYR B;  3J7Y d;  1IV7 A;  3KSE D;  4CDL A;  4LEH A;  1O7P B;  4EV5 A;  1UUV B;  3CNX A;  1DVD A;  3DGN A;  1PU4 A;  2M7O A;  4AEQ A;  1QVG 2;  2CHC A;  2HML B;  3CCQ 3;  5AEU B;  3GZX B;  4AKY A;  1T5Y A;  1QMA A;  3BNB A;  3K5T A;  3BLZ A;  1PFP A;  3DUK A;  3CNM A;  1RN7 A;  4AKZ A;  2CG1 A;  4N6N B;  1OUN A;  4EBG A;  3JUP A;  1D6Z A;  5CK6 A;  2OTJ 3;  1DVC A;  1TFK A;  1FUW A;  1Z1S A;  4I4K A;  1NO3 A;  3D9R A;  4N6O B;  1VQK 3;  3NX0 A;  3OWU A;  1O7M B;  2W56 A;  3RDE A;  2YFL B;  3NUV A;  1JB2 A;  4NHF A;  2W9Q A;  4R4K A;  1IQY A;  5DRE A;  3OW2 2;  2ZL8 A;  4N6U A;  3SX1 A;  1OHS A;  3OX9 A;  3FGY A;  3PXM A;  1J2B A;  1UI7 A;  5AIH A;  3Q1C A;  4HJL B;  1W6G A;  2O9U X;  1ROV A;  4FCJ A;  3STD A;  1KC8 4;  1N9E A;  3K0Z A;  1ISK A;  4FR9 A;  2HMM B;  3LXU X;  3V99 A;  3IPT A;  3VGN A;  2CFL A;  3CME 3;  1GY6 A;  2P0X A;  4K90 B;  3EN1 B;  2OOV A;  1IQ8 A;  1HKX A;  1NB3 I;  3GZB A;  3SXX A;  4N6L A;  3PZW A;  3S5C A;  5ELU A;  1OAC A;  2CFK A;  2STD A;  2E2V A;  1ZO2 A;  3F9S A;  4HM3 B;  4CCV A;  3AMO B;  1FGM A;  2XH9 A;  5EQL A;  1L5G B;  3NQZ A;  2KCD A;  1NWW A;  3LTB A;  2BT3 A;  4FMD A;  3N8B A;  3CCS 3;  1A2K A;  1F8N A;  1OHO A;  2P0M A;  4J8T A;  3ROB A;  3I55 3;  4HBR A;  2WGQ A;  2PNC A;  2CWU A;  3GZY B;  2IUJ A;  4N3V A;  4ORL A;  3I56 3;  1NB5 I;  2IUK A;  3DGO A;  2Z6B A;  4XBT A;  4R9L A;  1ROA A;  3PS8 A;  3BB9 A;  4O8S A;  4XBY A;  2XF3 A;  2L4V A;  1M1K 4;  4HM7 B;  1R4C A;  2OCT A;  3CC7 3;  1S5A A;  5DRV A;  3EQQ B;  4RBN A;  4LSO A;  2K0M A;  4K1U A;  3OWY A;  4ZM8 A;  3DZL A;  1ULI B;  3LTC A;  8CHO A;  2CK3 H;  3S28 A;  1N9J A;  5D81 A;  4FCM A;  1TU5 A;  1KD1 4;  3KII A;  4GL6 A;  2OTL 3;  2QIY A;  3BNE A;  3QK9 A;  3WOE B;  2CWV A;  4RZM A;  1WNH A;  5AEW B;  3B8L A;  2GXF A;  2WGO A;  2OWP A;  1AR0 A;  1OF5 A;  4L7K A;  3S67 A;  1GY7 A;  3JUQ A;  4J9A A;  2XEP A;  3EN8 A;  3LOY A;  3CPW 2;  3FF2 A;  5D83 A;  3T8N A;  1IT8 A;  1TFO A;  4LZI A;  4L8O A;  3SVA A;  3MG3 A;  1VQO 3;  3LT9 A;  5EVH A;  5HGR A;  1TUH A;  3V98 A;  5CF2 A;  3WMD A;  1RRL A;  1K73 4;  2RSX A;  3N9H A;  5EEO A;  3HI7 A;  3NM2 A;  4TX4 A;  1NJI 4;  3SED A;  5BXQ A;  1W02 A;  1KWI A;  5IG0 A;  4EC6 A;  2FXT A;  4H3U A;  1GD4 A;  3BND A;  2OQE A;  3S29 A;  1RRH A;  3G16 A;  2GU1 A;  1O7G B;  1O7W B;  1C7H A;  2OQE C;  3PYJ A;  4WYK B;  5IEO A;  1K41 A;  2YFJ B;  1VQ9 3;  1YJN 3;  2INX A;  1YGE A;  3CC2 3;  1D6Y A;  3LH4 A;  5BVB A;  1JB5 A;  3GAX A;  1Q42 A;  3F14 A;  1WMO A;  1OGZ A;  3K9M C;  1EA2 A;  3CMA 3;  3EBY A;  2RGQ A;  3X3X A;  2XFT A;  1O7N B;  5KP1 A;  2GEX A;  5A0O B;  1Y4K A;  1VQL 3;  3EC9 A;  1TIJ A;  3B4P A;  2WOF A;  2MC8 A;  1VQ5 3;  3F40 A;  3HII A;  2YX9 A;  1SII A;  2IA7 A;  4N6V 0;  2HMN B;  2F86 B;  2Z7A A;  3LML A;  4JRF A;  3UB1 A;  3L0R A;  4MMY B;  5LC7 A;  2HMK B;  4R80 A;  3X42 A;  3WA2 X;  1EQK A;  4XBX A;  5FW5 A;  4FCZ A;  3VSY A;  3OWS A;  2Z76 A;  1W5Z A;  2A15 A;  4OK0 A;  3B4O A;  3SLU A;  4EXR A;  5IG4 A;  3NBR A;  2BNG A;  3BNC A;  1BUQ A;  2YFI B;  5ELJ A;  1E3R A;  3M8C A;  4QWT A;  4HYZ A;  5D82 A;  1VQM 3;  3A76 A;  3AMO A;  2D42 A;  2JQ5 A;  3KSP A;  4BTX A;  2RCD A;  3X40 A;  3EBT A;  3MSO A;  3EJV A;  4K1V A;  1SJW A;  2V1L A;  1MNL A;  2Q07 A;  3EX9 A;  2CKF B;  5AYS C;  3WOD G;  1M90 4;  3GWR A;  1Q81 4;  3CCM 3;  5IEP A;  2W6J H;  3D3L A;  2Y74 A;  1DMM A;  1W4N A;  3PCR A;  4O02 B;  1GS3 A;  4MEI A;  1U8C B;  1AVK A;  3DGL A;  3G4S 3;  3DY5 A;  4RNY A;  3Q90 A;  1OPY A;  4IIA A;  1VQP 3;  1Q82 4;  1V74 A;  1WQL B;  3KN4 A;  3PGB A;  4GB5 A;  1VQ7 3;  3NXJ A;  1CEW I;  2CIU A;  1K8A 4;  1IK3 A;  2GU3 A;  4X2O A;  4XDW A;  2KRT A;  4HM4 B;  3SOY A;  4HM5 B;  1WMN A;  3MWZ A;  3S27 A;  1JRQ A;  1LVN A;  1JN5 B;  2BMQ B;  1N8R 4;  1IVU A;  3H51 A;  5IG5 A;  3EHC A;  1U5O A;  2JDI H;  4KFF A;  4HM6 B;  1CYU A;  3WOF B;  3OXA A;  1Q86 4;  4FMA A;  4XDV A;  2GEY A;  2HMJ B;  5CXO A;  1QJG A;  1M9G A;  1SIH A;  1STD A;  3T0U A;  2XSH B;  3K63 A;  1KSI A;  3DXO A;  1JJ2 2;  3DMC A;  3MG1 A;  2XRX B;  4WP5 A;  1JB4 A;  1CYV A;  3CCV 3;  2P09 A;  2CWT A;  3FF0 A;  4K61 A;  2IMJ A;  2LYX A;  3NHX A;  4HZ9 B;  2WOH A;  4BTW A;  3G6E 3;  1JNQ A;  1UUW B;  2MF7 A;  2E2U A;  2GBW B;  1VQ4 3;  2B1X B;  1W7C A;  3NQY A;  1YI2 3;  4O2H A;  3FG1 A;  2XGL A;  4HM8 B;  3GZR A;  4XM4 A;  2FNQ A;  3LZA A;  3MPH A;  1STF I;  2R4I A;  5G2G A;  4L8P A;  4MMZ B;  3E99 A;  3CXC 2;  2XGN A;  1AV4 A;  4HZB B;  4JF8 A;  4WWU C;  4OUQ A;  2KXG A;  1IV9 A;  3KKG A;  3GRD A;  2FGT A;  1EKM A;  3X3Z A;  2CW9 A;  1ULJ B;  3K7C A;  2QGU A;  1N8Q A;  3N54 B;  5JPP A;  3LTD A;  3CCE 3;  3IMA B;  1TP6 A;  1OGX A;  4G1M B;  1JN5 A;  4IPB A;  1IVV A;  5CF1 A;  2BMO B;  3OV4 A;  4STD A;  3UNL A;  1FA3 A;  3F7X A;  4PEJ A;  4HM1 B;  4IT7 A;  5JPU A;  3CCR 3;  1N5H A;  2B24 B;  3KZT A;  3RGA A;  1JKG A;  2W03 A;  3H3H A;  4HM0 B;  3HK4 A;  1CQS A;  1UI8 A;  5KP4 A;  1YIJ 3;  4LGQ A;  1HU9 A;  2GBX B;  3VF1 A;  1N5P A;  3FSD A;  2I9W A;  7STD A;  1GYB A;  3I0Y A;  5IF6 A;  2C10 A;  1IQX A;  3NV0 B;  1ASK A;  3Q2P A;  2CC3 A;  4N6T A;  4WFO A;  3UL6 A;  4R1K A;  4KZ1 A;  3CD6 3;  3JUN A;  1IVX A;  1DMN A;  1E3V A;  1W00 A;  4R9K A;  1FGO A;  4FMB A;  1W01 A;  4EV2 A;  4XB5 A;  1LNH A;  1QAF A;  1S72 3;  1OHP A;  4X2H A;  1YJW 3;  3EB8 A;  2LQV A;  5IW9 A;  2ML5 A;  3FKA A;  3CPO A;  4NRE A;  2P38 A;  1A90 A;  3U97 A;  3CCJ 3;  1Q40 B;  3JUO A;  5AII A;  4LMI A;  5FGO A;  3UL5 A;  1UW1 A;  3SOA A;  1RJO A;  2K54 A;  3FLJ A;  3LTA A;  4WHA A;  1YIT 3;  1LOX A;  2CFD A;  3NM7 A;  4FMC A;  3HZP A;  3EF8 A;  3UJM A;  2W0Q A;  1G96 A;  3JUM A;  3O8Y A;  3MKI A;  1OCV A;  3X3Y A;  4N6M A;  1RKY A;  2WO0 A;  2QEX 3;  1SPU A;  3CCL 3;  3DM8 A;  3CU3 A;  2W9P A;  5AIG A;  2BMR B;  1KQS 2;  2UX0 A;  4MMX B;  1JV2 B;  2BHM A;  1Q40 A;  3X41 A;  5LC6 A;  3EE1 A;  1GY5 A;  3TDG A;  6STD A;  1A2V A;  3WDG B;  2SBL A;  2Z77 A;  1GD3 A;  1QVF 2;  2CG0 A;  1EG9 B;  1DYU A;  1DMQ A;  3LYG A;  4O3V A;  2W04 A;  4RNZ A;  1WMP A;  4Q53 A;  3FG3 A;  5TGN A;  3KE7 A;  5JBS A;  1O7H B;  1IVW A;  3ECF A;  3T8U A;  2XFS A;  1YHQ 3;  1Q7Y 4;  4WYK A;  3KFQ C;  1FGQ A;  2HMO B;  5CLK A;  3CC4 3;  3NV0 A;  3FG4 A;  1NU3 A;  3MHE A;  1K28 A;  3V92 A;  2D1W A;  3WA3 A;  5IEN A;  1M1X B;  3U1W A;  1JKG B;  2ML6 A;  1VQ8 3;  1US1 A;  2CFW A;  1VZZ A;  5STD A;  3NBJ A;  1FGT A;  2Y73 A;  4KVH A;  3IJE B;  4MJD A;  3G8Z A;  3NBB A;  5KP3 A;  5AIF A;  1IDP A;  2O3O A;  5IER A;  2PZV A;  1MOL A;  4BTY A;  2W56 B;  2E2T A;  3FZW A;  1OF5 B;  4HKV B;  1FGR A;  3PCS A;  5I97 A;  3ALA A;  3ER7 A;  3HIG A;  1K9M 4;  3JVC A;  1SQW A;  4KFD A;  1A67 A;  4HM2 B;  4HVN A;  3FH1 A;  1YJ9 3;  1NDO B;  1AVL A;  4U13 A;  2F99 A;  4H61 A;  3CCU 3;  3F7S A;  2XSO B;  1QAL A;  1W2Z A;  2RFR A;  1W6C A;  3G71 3;  2W2C A;  2P05 A;  1VQN 3;  2ZDJ A;  3F8X A;  4EYC A;  1WTH A;  4KFE A;  3RGR A;  3LT8 A;  2CH9 A;  2CFG A;  1QAK A;  3HX8 A;  3G0K A;  5IG3 A;  3DGM A;  1VQ6 3;  3F8H A;  1D6U A;  5AI1 A;  1OH0 A;  1E97 A;  3B7C A;  2C11 A;  2BO9 B;  3MYT A;  3MG2 A;  1W2B 2;  1IU7 A;  4OVM A;  1YVB I;  1W6Y A;  2OOV C;  2F98 A;  2XR8 B;  3QRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...