1OUNA

Crystal structure of nuclear transport factor 2 (ntf2)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.6 angstroms resolution crystal structure of nuclear transport factor 2 (NTF2).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
molecule keywords NUCLEAR TRANSPORT FACTOR 2
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ounA00
4XBXA 3CNMA 3F14A 4X2HA 1OF5B 1SJWA 4RZMA 3NUVA 4U13A 1NU3A 5IG4A 1U5OA 3I0YA 3MKIA 2F98A 4HVNA 4STDA 1O7PB 4WYKA 3EBYA 4XBYA 3NBRA 1O7WB 5AIHA 3JUMA 1ASKA 3K0ZA 3RGAA 1O7MB 3EJVA 5JPUA 5DREA 3F8HA 1O7GB 1JB2A 1W02A 5FW5A 3B7CA 3OWUA 1OUNA 4WWUC 5IG5A 1Q40B 1O7HB 2QIYA 4XDVA 1DMNA 2XSOB 4HM3B 3ECFA 1NDOB 2W2CA 5HGRA 1CQSA 5IF6A 2Z77A 3B4PA 4LEHA 1STDA 1A2KA 5KP4A 5AEUB 4FCJA 3GZXB 1HKXA 3JUNA 3T8NA 3KKGA 3MHEA 3CNXA 1AR0A 3DM8A 2F99A 1GYBA 1OH0A 1ZO2A 1UUWB 2I9WA 1JB4A 3B4OA 3BLZA 1DMQA 3EX9A 3NHXA 4J9AA 4L8PA 5JPPA 1TUHA 1OHPA 3S5CA 4HJLB 2RFRA 5DRVA 4HM5B 2A15A 3F40A 4K1VA 4R9KA 2GBWB 3OV4A 2JQ5A 2GXFA 4HZBB 1Q40A 3NV0B 3T8UA 5KP1A 3HX8A 1E3VA 1DMMA 2B1XB 2YFLB 5TGNA 3JUQA 5G2GA 3VSYA 5CF2A 2YFIB 3KZTA 5AIGA 1K41A 1ULIB 3CU3A 3EF8A 3MG1A 1OF5A 3F7SA 4KVHA 3DXOA 3CPOA 3G16A 2UX0A 4XB5A 3STDA 2GEXA 2HMJB 3DMCA 4I4KA 4GB5A 3UNLA 2QGUA 3GZRA 3H51A 3LYGA 3OWSA 5CXOA 1E3RA 2HMNB 2BNGA 1OHSA 3MG3A 3MSOA 1W6YA 2R4IA 1GY6A 2YFJB 1QJGA 1OHOA 2XRXB 3HK4A 5BXQA 3KSPA 4WYKB 1GY7A 3B8LA 4XBTA 1ZX2A 5STDA 3GRDA 1IDPA 1GY5A 4XDWA 5CF1A 2OWPA 5IENA 1JKGA 5IG0A 3FF0A 2HMLB 3EC9A 3F8XA 2RGQA 3GZYB 1S5AA 4MJDA 3ROBA 3VGNA 5CK6A 3EN1B 3H3HA 5AIFA 1WQLB 2CKFB 3FGYA 7STDA 2BMRB 3E99A 3EHCA 2XSHB 3A76A 2HMKB 3FZWA 1JN5B 1OGXA 2INXA 1VZZA 3D9RA 3OWYA 2XR8B 3G8ZA 4HZ9B 5D82A 4IIAA 2GEYA 2IMJA 4LMIA 1W00A 3G0KA 3NXJA 3EBTA 4HM8B 1NWWA 1TP6A 2HMMB 1OCVA 2STDA 3F7XA 4HM4B 4L7KA 4L8OA 3FKAA 4HKVB 4PEJA 4HM2B 3JUOA 2F86B 3DUKA 3Q90A 4J8TA 1BUQA 4HM7B 1W01A 3WMDA 3FSDA 3KE7A 1ISKA 1OGZA 4ORLA 5EVHA 3UJMA 3EQQB 3FH1A 5IEOA 1EA2A 1GS3A 3FF2A 6STDA 2GBXB 1Z1SA 1JB5A 2RCDA 3MG2A 1OPYA 4Q53A 4HM6B 4R1KA 3K7CA 4FCMA 4LGQA 3IPTA 3JUPA 4H3UA 4R9LA 3M8CA 3OXAA 5KP3A 3RGRA 2BMOB 3SOYA 2PZVA 3GWRA 5CLKA 5BVBA 1O7NB 4OVMA 5IEPA 1C7HA 3NM2A 1EG9B 4K1UA 4WP5A 3SEDA 1JKGB 4OUQA 3FLJA 4X2OA 5IG3A 1ULJB 2Z76A 3DZLA 3NV0A 3BB9A 5AEWB 1QMAA 2Z7AA 1JN5A 5D83A 4N3VA 8CHOA 2HMOB 3ER7A 2K54A 3SOAA 1E97A 3GZBA 5AI1A 5IERA 4XM4A 4HM0B 5AIIA 5D81A 4CDLA 2B24B 3HZPA 3OX9A 4HM1B 1UUVB 3MYTA 2BMQB 3LZAA 3F9SA 2CHCA 1Q42A 3EN8A
chains in the Genus database with same CATH superfamily
3CNMA 1RMSA 3NUVA 4U13A 3PZWA 5IG4A 1YJ93 4O3VA 4XBYA 3DH2A 3O8YA 3SYUA 1M904 1X1YA 3S28A 3WA3A 4GSPA 2H0GA 3PYJA 1X1UA 3WDGB 4EYCA 5JPUA 1GSPA 1O7GB 3FG3A 1JB2A 2C4BA 1VQL3 1BU4A 1UCIA 3L0RA 1OUNA 4WWUC 2LQVA 5IG5A 3X41A 2XEPA 2QIYA 3LOYA 3K63A 5HGRA 2Z77A 5AEUB 4FCJA 3JUNA 1HKXA 3T8NA 1YIT3 1A2VA 1JNQA 1B27A 3CD63 1KWIA 1BRSA 1GYBA 3PXMA 4N6OB 3SEDA 3B4OA 3NHXA 1DMQA 2H0HA 4O2HA 3VF1A 1TUHA 1OHPA 5GSPA 1KC84 2E2TA 1WMPA 2KF6A 2P05A 2Y74A 2F56A 2CG1A 2OQEA 1KD14 1WMOA 5TGNA 2YFLB 1PYLA 3D5GA 2YFIB 1T3BA 4N6UA 1ULIB 4NPBA 1C54A 3G16A 4ZM8A 2CFLA 1LQGC 2GEXA 2HMJB 2KF5A 3DGNA 2BO9B 2SARA 1LQMB 1I8VA 1B2SA 3H51A 1YIJ3 1RNTA 4JF8A 1B2XA 1CYUA 2HMNB 1MWTA 2GU3A 5I97A 1IQYA 1G0TA 1W6YA 1BRIA 2XRXB 1YNVX 4WYKB 3D79A 1RGKA 1I3FA 1IVUA 1RRLA 2L1SA 5STDA 1UI7A 1V58A 1DVCA 1IDPA 1GY5A 1RN1A 3K9MC 1OACA 3LT9A 2KAAA 4FR9A 4EC6A 5IENA 1VQM3 2RBIA 4KFDA 2HMLB 2Z6BA 3F8XA 3VGNA 3U97A 3AGOA 1IT8A 1DVDA 5CK6A 4RNTA 4ILFA 3FGYA 4RNYA 1V74A 2BMRB 2OQEC 3EHCA 2O3OA 2XSHB 3A76A 7STDA 1BAOA 1JN5B 3HI7A 2INXA 3IJEB 1BANA 1WTHA 4LMIA 4RNZA 1VQQA 4L8OA 2XGLA 3CC23 1I70A 5AIGA 3S67A 4G1MB 4HKVB 3Q1CA 4HM2B 3CXC2 1A67A 1W6CA 3G713 4BL3A 1YJN3 1VQ93 2FNQA 1B2ZA 9RNTA 1IV7A 3LTCA 1PY3A 3HOHA 4EV2A 1VQ73 4HM6B 4FCMA 4BTWA 1BNEA 4H3UA 1AY7A 2BMOB 4CCVA 2PZVA 5CLKA 2AADA 1BNJA 4OVMA 5BVBA 5IEPA 3MWZA 2WOFA 4LSOA 1IYYA 3X3YA 3T0UA 2IY2A 1VQK3 1FYSA 3NV0A 2KXGA 1ROAA 5ELJA 2BT3A 1BUJA 2HMOB 1RGHA 3ER7A 3V99A 3SOAA 3V92A 5D81A 4CDLA 1IT7A 4BL2A 2XH9A 1SIHA 1CH0A 3MYTA 2P0XA 4MEIA 2CHCA 3CC73 2W56B 4X2HA 1YHQ3 1IVVA 1Q814 4FCZA 2KCDA 1UI8A 1U5OA 1X1XA 4STDA 4HBRA 1O7PB 3EBYA 2ML5A 4EXRA 1BNRA 3OW22 2D42A 3K0ZA 1AVLA 5FW5A 2CH9A 1RSNA 3J7Yd 1IVWA 3URPA 2CFDA 1EKMA 4AKYA 1UUGB 5LC6A 3ECFA 2AAEA 3AHWA 1GMRA 4EV5A 2C10A 1B2UA 1STDA 2CC3A 4LEHA 3KCHA 1BOXA 1U8CB 3AMOB 2GSPA 1LXEA 1TTOA 3AGNA 1JBRA 2YX9A 3MHEA 3CCS3 1TRQA 1AR0A 1US1A 2CFGA 2M7OA 5EEOA 3N8BA 1ZO2A 4J9AA 1NO3A 1TIJA 2KRTA 3NX0A 1X1WA 1ZS7A 4IPBA 1RN4A 1ROVA 4KFFA 2RFRA 2E2UA 4HM5B 3F40A 4K1VA 1MWRA 4K90B 2GBWB 3NQYA 1BSAA 3QK9A 4GHOA 2W0QA 3KN4A 5AYRB 3X3ZA 3CCJ3 1Q40A 1IV9A 3NV0B 1BRNL 3HX8A 1DMMA 2CG0A 1B3SA 3JUQA 1I2FA 3DGYA 4N6LA 3STDA 3F7SA 3CMA3 3DXOA 4R80A 1LVNA 1SARA 3D3LA 3K5TA 2QGUA 4H61A 3LYGA 5CXOA 1E3RA 1BNSA 2F5WA 4MMXB 5M18A 1B2MA 2W56A 2R4IA 3HK4A 2MF7A 5BXQA 3KSPA 3PCSA 4XBTA 1VQ83 1VQ63 4IT7A 3PCRA 5CF1A 4HAAA 4QWTA 2C11A 2H0IA 5M19A 1FGOA 2CFKA 5IG0A 4WFOA 5BU4A 3GZYB 2OCTA 4MJDA 3ROBA 5A0OB 1EQKA 5AIFA 1I0VA 1WQLB 1BRJA 5G1KA 3UL5A 2XF3A 1GMPA 4NHFA 1UGIA 4BIRA 2JDIH 1IVXA 2W04A 2QA43 2XGNA 2ZDJA 1FGQA 1K28A 3D9RA 2XR8B 1GD4A 2ZHXB 1BRGA 1W00A 2W6JH 4HM8B 1TP6A 2HMMB 2RNTA 1LOYA 1OCVA 2STDA 4O8SA 1CYVA 4KFEA 4JRFA 1SPUA 1TJDA 1W01A 2F5MA 3EB8A 1BIRA 1VQP3 4CJNA 4ORLA 3CME3 1LOVA 6STDA 3UJMA 1Q864 5IEOA 3WOEB 1D6YA 2OOVC 1IU7A 2W9PA 2IA7A 3ZG5A 1IQXA 3A5EA 3K7CA 1T5YA 3JUPA 4R9LA 5KP3A 3OXAA 3SOYA 1D6ZA 1VQN3 3GWRA 4FMAA 2QEX3 1C7HA 2BU4A 2CIUA 2R41A 1WMNA 1JKGB 2CFWA 3LXUX 2ML6A 3WODG 4X2OA 3DZLA 1T2HA 3SX1A 2CW9A 2Z7AA 1QAKA 1MWUA 1YI23 1DETA 1Q9EA 4XM4A 5AIIA 2XFSA 1V57A 1Q7Y4 1UUVB 3WOFB 2BMQB 3LZAA 4LYLB 1RDSA 3OWSA 1RGFA 1G02A 1W7CA 1WNHA 2P38A 3F14A 4XBXA 3WA2X 1RNBA 4RZMA 3ZG0A 1NU3A 1BUQA 1AV4A 1YVSA 3LH4A 2F98A 4HVNA 4WYKA 7GSPA 1O7WB 3JUMA 2CK3H 3RGAA 1O7MB 3EJVA 5EQLA 4FMDA 5DREA 3RDEA 1W02A 3B7CA 3HIGA 1Q40B 1O7HB 1K734 1RCLA 2WGOA 1DMNA 4HM3B 2D1WA 1LRAA 2WOHA 1I3IA 5IF6A 3Q2PA 3GZXB 1FZUA 3CCM3 3KKGA 1LOWA 2L4VA 2IUKA 2Y73A 1FW7A 3DM8A 1FA3A 2F99A 2I9WA 2CX0A 3FF0A 3GSPA 3BLZA 3Q3FA 4L8PA 5AIHA 1W2B2 1Q7HA 5JPPA 3CCL3 1BRHA 3PGBA 4HJLB 1K9M4 2A15A 2PNCA 3AHSA 1Q824 3CCQ3 1A90A 3OV4A 3MPHA 5M1AA 1RRHA 2GXFA 3IMAB 1E3VA 2B1XB 1BNGA 3LTDA 3JVCA 5CF2A 1QVF2 5IW9A 1BNFA 2CWTA 4HOHA 1K41A 3CU3A 3UB1A 1UCJA 3MG1A 1OF5A 5G1LA 5KP4A 3CPOA 1QVG2 3DMCA 1JZOA 1R4YA 4GB5A 3FG4A 1SIIA 4K61A 3D4AA 1FUWA 2IYJA 1GOYA 1JV2B 3CCE3 2BNGA 3MG3A 1BSDA 2YFJB 1QJGA 1YGEA 1FGTA 3NBJA 1UCKA 1TRPA 1GY7A 3PS8A 3G4S3 1ZX2A 3BNCA 4J5KA 3GRDA 4HYZA 1I2GA 2K0MA 1FGRA 6GSPA 2OWPA 1JKGA 1B21A 1NNVA 3EC9A 2RGQA 1LNHA 4MMZB 2FXTA 1RGCA 1MWSA 1FUSA 2OTJ3 3FZWA 1OGXA 2F4YA 3SLUA 4HZ9B 1Y4KA 3OWYA 4IIAA 2GEYA 3LMLA 3G0KA 3NXJA 4BTYA 1EUIC 2LYXA 2W9QA 4L7KA 4RBNA 3F7XA 5LC7A 3JUOA 2F86B 2P09A 1YVBI 4TX4A 3FSDA 2KF3A 3DGMA 2OOVA 1IK3A 3CCR3 1KSIA 1BGSA 5EVHA 2O9UX 3EQQB 3FH1A 1M9GA 4LZIA 1T2IA 3UL6A 2GBXB 3X42A 1RN7A 1R4CA 5HOHA 1QAFA 1UDII 3KSED 2Q07A 4N6MA 3RNTA 4LGQA 2CX1A 1HYFA 2E2VA 3IPTA 3D5IA 3I553 2ZL8A 1G96A 1O7NB 2GU1A 4FMCA 4GL6A 3NM2A 1EG9B 1RGEA 4K1UA 1W6GA 4WP5A 1HZ1A 1RGLA 1NJI4 4OUQA 4KZ1A 3S29A 1ULJB 2Z76A 1GMQA 2SBLA 5AEWB 1JN5A 2V1LA 1J2BA 1ZGXA 3EE1A 1AQZA 4NREA 5AI1A 1NB3I 1K8A4 3V98A 3TDGA 4HM0B 1DYUA 1LOXA 4HM1B 3BNEA 4J5GA 1JBTA 3F9SA 3NM7A 3EN8A 5RNTA 1OF5B 1SJWA 5FGOA 4CPKA 1DE3A 1W4NA 3I0YA 1MNLA 1BSBA 3MKIA 4XDWA 1BVIA 2BHMA 3NBRA 1ASKA 3SVAA 4KT3B 3FCSB 3N54B 3F8HA 6RNTA 2CWVA 3CPW2 3OWUA 1N8QA 1QALA 1MGRA 4XDVA 2XSOB 1NDOB 2W2CA 3LTBA 1CQSA 1MGWA 2FGTA 3HIIA 3U1WA 3B4PA 1A2KA 1RHLA 1RTUA 1UW1A 2WO0A 8RNTA 3ZFZA 3DGOA 1F8NA 1FUTA 3CNXA 1RJOA 2J8XB 3GAXA 3M8CA 1OH0A 3EX9A 5G2GA 1UUWB 3CCV3 1JB4A 2K3DA 3CC43 3NBBA 3S5CA 1KQS2 4OK0A 5DRVA 1RKYA 2OTL3 1N5PA 4R9KA 2P0MA 1JZDA 1AVKA 2JQ5A 3BU4A 3KIIA 4HZBB 4BTXA 5KP1A 3T8UA 1TFKA 3VSYA 4AKZA 3S27A 1M1XB 2BIRA 3KZTA 4R4KA 3BIRA 1RGAA 3EF8A 4XB5A 4KVHA 3LTAA 4FMBA 3NQZA 2UX0A 4I4KA 1STFI 1JBSA 3CCU3 3UNLA 1VQO3 1IQ8A 3GZRA 4N6TA 3DY5A 1I0XA 3X3XA 3ALAA 3I563 1OHSA 3MSOA 1S723 1GY6A 1YJW3 1JRQA 1OHOA 3B8LA 3BNDA 4N6NB 5ELUA 5JBSA 1BNIA 2IUJA 3AMOA 1FGMA 4EW5A 1M1K4 2HOHA 4MMYB 4EBGA 1GD3A 1S5AA 3KFQC 1A2PA 3EN1B 1RGGA 3H3HA 1W2ZA 2CKFB 4WHAA 1GOUA 3E99A 3N9HA 4BU4A 1BRKA 2HMKB 3FG1A 1BSCA 1TFOA 1VZZA 3G8ZA 3X40A 5D82A 1TU5A 2IMJA 1L5GB 1VQ53 3EBTA 1NWWA 4HM4B 2RSXA 4I5QA 4PEJA 1UGHI 3FKAA 3Q90A 3DUKA 4J8TA 1N8R4 4HM7B 3WMDA 1JJ22 3KE7A 3QRDA 1ISKA 1OGZA 3G6E3 4O02B 1EA2A 1GS3A 3FF2A 4DKIA 1Z1SA 1JB5A 1UCLA 2RCDA 1OPYA 3MG2A 1NB5I 4Q53A 5AYSC 1MOLA 2UGIA 3BNBA 1GOVA 4R1KA 4AEQA 1W5ZA 2WGQA 2XFTA 3RGRA 1YGWA 1CEWI 2KF4A 3DGLA 3WR2A 1B20A 3FLJA 5BIRA 5IG3A 2CWUA 1D6UA 3BB9A 4N6V0 3SXXA 1QMAA 2MC8A 1I2EA 5D83A 4N3VA 8CHOA 1EEJA 2W03A 2K54A 1N9JA 1E97A 3GZBA 5IERA 1PFPA 1BSEA 1N5HA 2B24B 3HZPA 3OX9A 1N9EA 2UUGC 3LT8A 1VQ43 1RLSA 1LNIA 3WHOA 1RCKA 1SQWA 2ZA4A 1PU4A 1HU9A 7RNTA 1Q42A
chains in the Genus database with same CATH topology
3CNMA 3NUVA 4U13A 3PZWA 5IG4A 1YJ93 4O3VA 4XBYA 3O8YA 1M904 3S28A 3WA3A 3PYJA 3WDGB 4EYCA 5JPUA 1O7GB 3FG3A 1JB2A 1VQL3 3L0RA 1OUNA 4WWUC 2LQVA 5IG5A 3X41A 2XEPA 2QIYA 3LOYA 3K63A 5HGRA 2Z77A 5AEUB 4FCJA 3JUNA 1HKXA 3T8NA 1YIT3 1A2VA 1JNQA 3CD63 1KWIA 3PXMA 1GYBA 4N6OB 3SEDA 3B4OA 3NHXA 1DMQA 3VF1A 4O2HA 1TUHA 1OHPA 1KC84 2E2TA 1WMPA 2P05A 2Y74A 2CG1A 2OQEA 1KD14 1WMOA 5TGNA 2YFLB 2YFIB 4N6UA 1ULIB 3G16A 4ZM8A 2CFLA 2GEXA 2HMJB 3DGNA 2BO9B 3H51A 1YIJ3 4JF8A 1CYUA 2HMNB 2GU3A 5I97A 1IQYA 1W6YA 2XRXB 4WYKB 1IVUA 1RRLA 5STDA 1UI7A 1DVCA 1IDPA 1GY5A 3K9MC 3LT9A 1OACA 4FR9A 4EC6A 5IENA 1VQM3 4KFDA 2HMLB 2Z6BA 3F8XA 3VGNA 3U97A 1IT8A 1DVDA 5CK6A 3FGYA 4RNYA 1V74A 2BMRB 2OQEC 3EHCA 2O3OA 2XSHB 3A76A 7STDA 1JN5B 3HI7A 2INXA 3IJEB 1WTHA 4LMIA 4RNZA 4L8OA 2XGLA 3CC23 5AIGA 3S67A 4G1MB 4HKVB 3Q1CA 4HM2B 3CXC2 1A67A 1W6CA 3G713 1YJN3 1VQ93 2FNQA 1IV7A 3LTCA 4EV2A 1VQ73 4HM6B 4FCMA 4BTWA 4H3UA 2BMOB 4CCVA 2PZVA 5CLKA 5BVBA 4OVMA 5IEPA 3MWZA 2WOFA 4LSOA 3X3YA 3T0UA 1VQK3 3NV0A 2KXGA 1ROAA 5ELJA 2BT3A 2HMOB 3ER7A 3V99A 3SOAA 3V92A 5D81A 4CDLA 1IT7A 2XH9A 1SIHA 3MYTA 2P0XA 4MEIA 2CHCA 3CC73 2W56B 4X2HA 1YHQ3 1IVVA 1Q814 4FCZA 2KCDA 1UI8A 1U5OA 4STDA 4HBRA 1O7PB 3EBYA 2ML5A 4EXRA 3OW22 2D42A 3K0ZA 1AVLA 5FW5A 2CH9A 3J7Yd 1IVWA 2CFDA 1EKMA 4AKYA 5LC6A 3ECFA 4EV5A 2C10A 4LEHA 1STDA 2CC3A 1U8CB 3AMOB 1LXEA 2YX9A 3MHEA 3CCS3 1US1A 1AR0A 2CFGA 5EEOA 2M7OA 3N8BA 1ZO2A 4J9AA 1NO3A 1TIJA 2KRTA 3NX0A 3U1WA 4IPBA 4KFFA 1ROVA 2RFRA 2E2UA 4HM5B 3F40A 4K1VA 4K90B 2GBWB 3NQYA 3QK9A 2W0QA 3KN4A 5AYRB 3X3ZA 3CCJ3 1Q40A 1IV9A 3NV0B 3HX8A 1DMMA 2CG0A 3JUQA 4N6LA 3STDA 3F7SA 3CMA3 3DXOA 4R80A 1LVNA 3D3LA 3K5TA 2QGUA 4H61A 3LYGA 5CXOA 1E3RA 4MMXB 2W56A 2R4IA 3HK4A 2MF7A 5BXQA 3KSPA 3PCSA 4XBTA 1VQ83 1VQ63 4IT7A 3PCRA 5CF1A 4QWTA 2C11A 1FGOA 2CFKA 5IG0A 4WFOA 3GZYB 2OCTA 4MJDA 3ROBA 5A0OB 1EQKA 5AIFA 1WQLB 3UL5A 2XF3A 4NHFA 2JDIH 1IVXA 2W04A 2QA43 2XGNA 2ZDJA 1FGQA 1K28A 3D9RA 2XR8B 1GD4A 1W00A 2W6JH 4HM8B 1TP6A 2HMMB 1OCVA 2STDA 4O8SA 1CYVA 4KFEA 4JRFA 1SPUA 1W01A 3EB8A 1VQP3 4ORLA 3CME3 6STDA 3UJMA 1Q864 5IEOA 3WOEB 1D6YA 2OOVC 1IU7A 2W9PA 2IA7A 1IQXA 3K7CA 1T5YA 3JUPA 4R9LA 5KP3A 3OXAA 3SOYA 1D6ZA 1VQN3 3GWRA 4FMAA 2QEX3 1C7HA 2CIUA 1WMNA 1JKGB 2CFWA 3LXUX 2ML6A 3WODG 4X2OA 3DZLA 3SX1A 2CW9A 2Z7AA 1QAKA 1YI23 4XM4A 5AIIA 2XFSA 1Q7Y4 1UUVB 3WOFB 2BMQB 3LZAA 3OWSA 1W7CA 1WNHA 2P38A 3F14A 4XBXA 3WA2X 4RZMA 1NU3A 1BUQA 1AV4A 3LH4A 4HVNA 2F98A 4WYKA 1O7WB 3JUMA 2CK3H 3RGAA 1O7MB 3EJVA 5EQLA 4FMDA 5DREA 3RDEA 1W02A 3B7CA 3HIGA 1Q40B 1O7HB 1K734 2WGOA 1DMNA 4HM3B 2D1WA 2WOHA 5IF6A 3Q2PA 3GZXB 3CCM3 3KKGA 2L4VA 2IUKA 2Y73A 3DM8A 1FA3A 2F99A 2I9WA 3FF0A 5AIHA 1W2B2 3BLZA 4L8PA 5JPPA 3CCL3 3PGBA 4HJLB 1K9M4 2A15A 2PNCA 1Q824 3CCQ3 1A90A 3OV4A 3MPHA 1RRHA 2GXFA 3IMAB 1E3VA 2B1XB 3LTDA 5CF2A 3JVCA 1QVF2 5IW9A 2CWTA 3UB1A 1K41A 3CU3A 5KP4A 3MG1A 1OF5A 3CPOA 1QVG2 3DMCA 4GB5A 3FG4A 1SIIA 4K61A 1FUWA 1JV2B 3CCE3 2BNGA 3MG3A 2YFJB 1QJGA 1YGEA 1FGTA 3NBJA 1GY7A 3PS8A 3G4S3 1ZX2A 3BNCA 3GRDA 4HYZA 2K0MA 1FGRA 2OWPA 1JKGA 3EC9A 2RGQA 1LNHA 4MMZB 2FXTA 2OTJ3 3FZWA 1OGXA 3SLUA 4HZ9B 1Y4KA 3OWYA 4IIAA 2GEYA 3LMLA 3G0KA 3NXJA 4BTYA 2LYXA 2W9QA 4L7KA 4RBNA 3F7XA 5LC7A 3JUOA 2F86B 2P09A 1YVBI 4TX4A 3FSDA 3DGMA 2OOVA 1IK3A 3CCR3 1KSIA 5EVHA 2O9UX 3EQQB 3FH1A 1M9GA 4LZIA 3UL6A 2GBXB 3X42A 1RN7A 1R4CA 1QAFA 3KSED 2Q07A 4N6MA 4LGQA 3IPTA 2E2VA 3I553 2ZL8A 1G96A 1O7NB 2GU1A 4FMCA 4GL6A 3NM2A 1EG9B 4K1UA 1NJI4 1W6GA 4WP5A 4OUQA 4KZ1A 3S29A 1ULJB 2Z76A 2SBLA 5AEWB 1JN5A 2V1LA 1J2BA 3EE1A 4NREA 5AI1A 1NB3I 1K8A4 3V98A 3TDGA 4HM0B 1DYUA 1LOXA 4HM1B 3BNEA 3F9SA 3NM7A 3EN8A 1OF5B 1SJWA 5FGOA 1W4NA 3I0YA 1MNLA 3MKIA 4XDWA 3NBRA 2BHMA 1ASKA 3SVAA 3FCSB 3N54B 3F8HA 2CWVA 3CPW2 3OWUA 1N8QA 1QALA 4XDVA 2XSOB 1NDOB 2W2CA 3LTBA 1CQSA 2FGTA 3HIIA 3B4PA 1A2KA 1UW1A 2WO0A 3DGOA 1F8NA 3CNXA 1RJOA 3GAXA 3M8CA 1OH0A 3EX9A 5G2GA 1UUWB 3CCV3 1JB4A 3CC43 3NBBA 3S5CA 1KQS2 4OK0A 5DRVA 1RKYA 2OTL3 1N5PA 4R9KA 2P0MA 1AVKA 2JQ5A 3KIIA 4HZBB 4BTXA 5KP1A 3T8UA 1TFKA 3VSYA 4AKZA 3S27A 1M1XB 3KZTA 4R4KA 3EF8A 4XB5A 4KVHA 3LTAA 4FMBA 3NQZA 2UX0A 4I4KA 1STFI 3CCU3 3UNLA 1VQO3 1IQ8A 3GZRA 4N6TA 3DY5A 3X3XA 3ALAA 3I563 1OHSA 3MSOA 1S723 1GY6A 1YJW3 1JRQA 1OHOA 3B8LA 3BNDA 4N6NB 5ELUA 5JBSA 2IUJA 3AMOA 1FGMA 1M1K4 4MMYB 4EBGA 1GD3A 1S5AA 3KFQC 3EN1B 3H3HA 1W2ZA 2CKFB 4WHAA 3E99A 3N9HA 2HMKB 3FG1A 1VZZA 1TFOA 3X40A 3G8ZA 5D82A 1TU5A 2IMJA 1L5GB 1VQ53 3EBTA 1NWWA 4HM4B 2RSXA 4PEJA 3FKAA 3Q90A 3DUKA 4J8TA 1N8R4 4HM7B 3WMDA 1JJ22 3KE7A 3QRDA 1ISKA 1OGZA 3G6E3 4O02B 1EA2A 1GS3A 3FF2A 1Z1SA 1JB5A 2RCDA 3MG2A 1OPYA 1NB5I 4Q53A 5AYSC 1MOLA 3BNBA 4R1KA 4AEQA 1W5ZA 2WGQA 2XFTA 3RGRA 1CEWI 3DGLA 3FLJA 5IG3A 2CWUA 1D6UA 3BB9A 4N6V0 3SXXA 1QMAA 2MC8A 5D83A 4N3VA 8CHOA 2W03A 2K54A 1N9JA 1E97A 3GZBA 5IERA 1PFPA 1N5HA 2B24B 3HZPA 3OX9A 1N9EA 3LT8A 1VQ43 1SQWA 1PU4A 1HU9A 1Q42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBX A;  3CNM A;  3F14 A;  4X2H A;  1OF5 B;  1SJW A;  4RZM A;  3NUV A;  4U13 A;  1NU3 A;  5IG4 A;  1U5O A;  3I0Y A;  3MKI A;  2F98 A;  4HVN A;  4STD A;  1O7P B;  4WYK A;  3EBY A;  4XBY A;  3NBR A;  1O7W B;  5AIH A;  3JUM A;  1ASK A;  3K0Z A;  3RGA A;  1O7M B;  3EJV A;  5JPU A;  5DRE A;  3F8H A;  1O7G B;  1JB2 A;  1W02 A;  5FW5 A;  3B7C A;  3OWU A;  1OUN A;  4WWU C;  5IG5 A;  1Q40 B;  1O7H B;  2QIY A;  4XDV A;  1DMN A;  2XSO B;  4HM3 B;  3ECF A;  1NDO B;  2W2C A;  5HGR A;  1CQS A;  5IF6 A;  2Z77 A;  3B4P A;  4LEH A;  1STD A;  1A2K A;  5KP4 A;  5AEU B;  4FCJ A;  3GZX B;  1HKX A;  3JUN A;  3T8N A;  3KKG A;  3MHE A;  3CNX A;  1AR0 A;  3DM8 A;  2F99 A;  1GYB A;  1OH0 A;  1ZO2 A;  1UUW B;  2I9W A;  1JB4 A;  3B4O A;  3BLZ A;  1DMQ A;  3EX9 A;  3NHX A;  4J9A A;  4L8P A;  5JPP A;  1TUH A;  1OHP A;  3S5C A;  4HJL B;  2RFR A;  5DRV A;  4HM5 B;  2A15 A;  3F40 A;  4K1V A;  4R9K A;  2GBW B;  3OV4 A;  2JQ5 A;  2GXF A;  4HZB B;  1Q40 A;  3NV0 B;  3T8U A;  5KP1 A;  3HX8 A;  1E3V A;  1DMM A;  2B1X B;  2YFL B;  5TGN A;  3JUQ A;  5G2G A;  3VSY A;  5CF2 A;  2YFI B;  3KZT A;  5AIG A;  1K41 A;  1ULI B;  3CU3 A;  3EF8 A;  3MG1 A;  1OF5 A;  3F7S A;  4KVH A;  3DXO A;  3CPO A;  3G16 A;  2UX0 A;  4XB5 A;  3STD A;  2GEX A;  2HMJ B;  3DMC A;  4I4K A;  4GB5 A;  3UNL A;  2QGU A;  3GZR A;  3H51 A;  3LYG A;  3OWS A;  5CXO A;  1E3R A;  2HMN B;  2BNG A;  1OHS A;  3MG3 A;  3MSO A;  1W6Y A;  2R4I A;  1GY6 A;  2YFJ B;  1QJG A;  1OHO A;  2XRX B;  3HK4 A;  5BXQ A;  3KSP A;  4WYK B;  1GY7 A;  3B8L A;  4XBT A;  1ZX2 A;  5STD A;  3GRD A;  1IDP A;  1GY5 A;  4XDW A;  5CF1 A;  2OWP A;  5IEN A;  1JKG A;  5IG0 A;  3FF0 A;  2HML B;  3EC9 A;  3F8X A;  2RGQ A;  3GZY B;  1S5A A;  4MJD A;  3ROB A;  3VGN A;  5CK6 A;  3EN1 B;  3H3H A;  5AIF A;  1WQL B;  2CKF B;  3FGY A;  7STD A;  2BMR B;  3E99 A;  3EHC A;  2XSH B;  3A76 A;  2HMK B;  3FZW A;  1JN5 B;  1OGX A;  2INX A;  1VZZ A;  3D9R A;  3OWY A;  2XR8 B;  3G8Z A;  4HZ9 B;  5D82 A;  4IIA A;  2GEY A;  2IMJ A;  4LMI A;  1W00 A;  3G0K A;  3NXJ A;  3EBT A;  4HM8 B;  1NWW A;  1TP6 A;  2HMM B;  1OCV A;  2STD A;  3F7X A;  4HM4 B;  4L7K A;  4L8O A;  3FKA A;  4HKV B;  4PEJ A;  4HM2 B;  3JUO A;  2F86 B;  3DUK A;  3Q90 A;  4J8T A;  1BUQ A;  4HM7 B;  1W01 A;  3WMD A;  3FSD A;  3KE7 A;  1ISK A;  1OGZ A;  4ORL A;  5EVH A;  3UJM A;  3EQQ B;  3FH1 A;  5IEO A;  1EA2 A;  1GS3 A;  3FF2 A;  6STD A;  2GBX B;  1Z1S A;  1JB5 A;  2RCD A;  3MG2 A;  1OPY A;  4Q53 A;  4HM6 B;  4R1K A;  3K7C A;  4FCM A;  4LGQ A;  3IPT A;  3JUP A;  4H3U A;  4R9L A;  3M8C A;  3OXA A;  5KP3 A;  3RGR A;  2BMO B;  3SOY A;  2PZV A;  3GWR A;  5CLK A;  5BVB A;  1O7N B;  4OVM A;  5IEP A;  1C7H A;  3NM2 A;  1EG9 B;  4K1U A;  4WP5 A;  3SED A;  1JKG B;  4OUQ A;  3FLJ A;  4X2O A;  5IG3 A;  1ULJ B;  2Z76 A;  3DZL A;  3NV0 A;  3BB9 A;  5AEW B;  1QMA A;  2Z7A A;  1JN5 A;  5D83 A;  4N3V A;  8CHO A;  2HMO B;  3ER7 A;  2K54 A;  3SOA A;  1E97 A;  3GZB A;  5AI1 A;  5IER A;  4XM4 A;  4HM0 B;  5AII A;  5D81 A;  4CDL A;  2B24 B;  3HZP A;  3OX9 A;  4HM1 B;  1UUV B;  3MYT A;  2BMQ B;  3LZA A;  3F9S A;  2CHC A;  1Q42 A;  3EN8 A; 
#chains in the Genus database with same CATH topology
 3CNM A;  1RMS A;  3NUV A;  4U13 A;  3PZW A;  5IG4 A;  1YJ9 3;  4O3V A;  4XBY A;  3DH2 A;  3O8Y A;  3SYU A;  1M90 4;  1X1Y A;  3S28 A;  3WA3 A;  4GSP A;  2H0G A;  3PYJ A;  1X1U A;  3WDG B;  4EYC A;  5JPU A;  1GSP A;  1O7G B;  3FG3 A;  1JB2 A;  2C4B A;  1VQL 3;  1BU4 A;  1UCI A;  3L0R A;  1OUN A;  4WWU C;  2LQV A;  5IG5 A;  3X41 A;  2XEP A;  2QIY A;  3LOY A;  3K63 A;  5HGR A;  2Z77 A;  5AEU B;  4FCJ A;  3JUN A;  1HKX A;  3T8N A;  1YIT 3;  1A2V A;  1JNQ A;  1B27 A;  3CD6 3;  1KWI A;  1BRS A;  1GYB A;  3PXM A;  4N6O B;  3SED A;  3B4O A;  3NHX A;  1DMQ A;  2H0H A;  4O2H A;  3VF1 A;  1TUH A;  1OHP A;  5GSP A;  1KC8 4;  2E2T A;  1WMP A;  2KF6 A;  2P05 A;  2Y74 A;  2F56 A;  2CG1 A;  2OQE A;  1KD1 4;  1WMO A;  5TGN A;  2YFL B;  1PYL A;  3D5G A;  2YFI B;  1T3B A;  4N6U A;  1ULI B;  4NPB A;  1C54 A;  3G16 A;  4ZM8 A;  2CFL A;  1LQG C;  2GEX A;  2HMJ B;  2KF5 A;  3DGN A;  2BO9 B;  2SAR A;  1LQM B;  1I8V A;  1B2S A;  3H51 A;  1YIJ 3;  1RNT A;  4JF8 A;  1B2X A;  1CYU A;  2HMN B;  1MWT A;  2GU3 A;  5I97 A;  1IQY A;  1G0T A;  1W6Y A;  1BRI A;  2XRX B;  1YNV X;  4WYK B;  3D79 A;  1RGK A;  1I3F A;  1IVU A;  1RRL A;  2L1S A;  5STD A;  1UI7 A;  1V58 A;  1DVC A;  1IDP A;  1GY5 A;  1RN1 A;  3K9M C;  1OAC A;  3LT9 A;  2KAA A;  4FR9 A;  4EC6 A;  5IEN A;  1VQM 3;  2RBI A;  4KFD A;  2HML B;  2Z6B A;  3F8X A;  3VGN A;  3U97 A;  3AGO A;  1IT8 A;  1DVD A;  5CK6 A;  4RNT A;  4ILF A;  3FGY A;  4RNY A;  1V74 A;  2BMR B;  2OQE C;  3EHC A;  2O3O A;  2XSH B;  3A76 A;  7STD A;  1BAO A;  1JN5 B;  3HI7 A;  2INX A;  3IJE B;  1BAN A;  1WTH A;  4LMI A;  4RNZ A;  1VQQ A;  4L8O A;  2XGL A;  3CC2 3;  1I70 A;  5AIG A;  3S67 A;  4G1M B;  4HKV B;  3Q1C A;  4HM2 B;  3CXC 2;  1A67 A;  1W6C A;  3G71 3;  4BL3 A;  1YJN 3;  1VQ9 3;  2FNQ A;  1B2Z A;  9RNT A;  1IV7 A;  3LTC A;  1PY3 A;  3HOH A;  4EV2 A;  1VQ7 3;  4HM6 B;  4FCM A;  4BTW A;  1BNE A;  4H3U A;  1AY7 A;  2BMO B;  4CCV A;  2PZV A;  5CLK A;  2AAD A;  1BNJ A;  4OVM A;  5BVB A;  5IEP A;  3MWZ A;  2WOF A;  4LSO A;  1IYY A;  3X3Y A;  3T0U A;  2IY2 A;  1VQK 3;  1FYS A;  3NV0 A;  2KXG A;  1ROA A;  5ELJ A;  2BT3 A;  1BUJ A;  2HMO B;  1RGH A;  3ER7 A;  3V99 A;  3SOA A;  3V92 A;  5D81 A;  4CDL A;  1IT7 A;  4BL2 A;  2XH9 A;  1SIH A;  1CH0 A;  3MYT A;  2P0X A;  4MEI A;  2CHC A;  3CC7 3;  2W56 B;  4X2H A;  1YHQ 3;  1IVV A;  1Q81 4;  4FCZ A;  2KCD A;  1UI8 A;  1U5O A;  1X1X A;  4STD A;  4HBR A;  1O7P B;  3EBY A;  2ML5 A;  4EXR A;  1BNR A;  3OW2 2;  2D42 A;  3K0Z A;  1AVL A;  5FW5 A;  2CH9 A;  1RSN A;  3J7Y d;  1IVW A;  3URP A;  2CFD A;  1EKM A;  4AKY A;  1UUG B;  5LC6 A;  3ECF A;  2AAE A;  3AHW A;  1GMR A;  4EV5 A;  2C10 A;  1B2U A;  1STD A;  2CC3 A;  4LEH A;  3KCH A;  1BOX A;  1U8C B;  3AMO B;  2GSP A;  1LXE A;  1TTO A;  3AGN A;  1JBR A;  2YX9 A;  3MHE A;  3CCS 3;  1TRQ A;  1AR0 A;  1US1 A;  2CFG A;  2M7O A;  5EEO A;  3N8B A;  1ZO2 A;  4J9A A;  1NO3 A;  1TIJ A;  2KRT A;  3NX0 A;  1X1W A;  1ZS7 A;  4IPB A;  1RN4 A;  1ROV A;  4KFF A;  2RFR A;  2E2U A;  4HM5 B;  3F40 A;  4K1V A;  1MWR A;  4K90 B;  2GBW B;  3NQY A;  1BSA A;  3QK9 A;  4GHO A;  2W0Q A;  3KN4 A;  5AYR B;  3X3Z A;  3CCJ 3;  1Q40 A;  1IV9 A;  3NV0 B;  1BRN L;  3HX8 A;  1DMM A;  2CG0 A;  1B3S A;  3JUQ A;  1I2F A;  3DGY A;  4N6L A;  3STD A;  3F7S A;  3CMA 3;  3DXO A;  4R80 A;  1LVN A;  1SAR A;  3D3L A;  3K5T A;  2QGU A;  4H61 A;  3LYG A;  5CXO A;  1E3R A;  1BNS A;  2F5W A;  4MMX B;  5M18 A;  1B2M A;  2W56 A;  2R4I A;  3HK4 A;  2MF7 A;  5BXQ A;  3KSP A;  3PCS A;  4XBT A;  1VQ8 3;  1VQ6 3;  4IT7 A;  3PCR A;  5CF1 A;  4HAA A;  4QWT A;  2C11 A;  2H0I A;  5M19 A;  1FGO A;  2CFK A;  5IG0 A;  4WFO A;  5BU4 A;  3GZY B;  2OCT A;  4MJD A;  3ROB A;  5A0O B;  1EQK A;  5AIF A;  1I0V A;  1WQL B;  1BRJ A;  5G1K A;  3UL5 A;  2XF3 A;  1GMP A;  4NHF A;  1UGI A;  4BIR A;  2JDI H;  1IVX A;  2W04 A;  2QA4 3;  2XGN A;  2ZDJ A;  1FGQ A;  1K28 A;  3D9R A;  2XR8 B;  1GD4 A;  2ZHX B;  1BRG A;  1W00 A;  2W6J H;  4HM8 B;  1TP6 A;  2HMM B;  2RNT A;  1LOY A;  1OCV A;  2STD A;  4O8S A;  1CYV A;  4KFE A;  4JRF A;  1SPU A;  1TJD A;  1W01 A;  2F5M A;  3EB8 A;  1BIR A;  1VQP 3;  4CJN A;  4ORL A;  3CME 3;  1LOV A;  6STD A;  3UJM A;  1Q86 4;  5IEO A;  3WOE B;  1D6Y A;  2OOV C;  1IU7 A;  2W9P A;  2IA7 A;  3ZG5 A;  1IQX A;  3A5E A;  3K7C A;  1T5Y A;  3JUP A;  4R9L A;  5KP3 A;  3OXA A;  3SOY A;  1D6Z A;  1VQN 3;  3GWR A;  4FMA A;  2QEX 3;  1C7H A;  2BU4 A;  2CIU A;  2R41 A;  1WMN A;  1JKG B;  2CFW A;  3LXU X;  2ML6 A;  3WOD G;  4X2O A;  3DZL A;  1T2H A;  3SX1 A;  2CW9 A;  2Z7A A;  1QAK A;  1MWU A;  1YI2 3;  1DET A;  1Q9E A;  4XM4 A;  5AII A;  2XFS A;  1V57 A;  1Q7Y 4;  1UUV B;  3WOF B;  2BMQ B;  3LZA A;  4LYL B;  1RDS A;  3OWS A;  1RGF A;  1G02 A;  1W7C A;  1WNH A;  2P38 A;  3F14 A;  4XBX A;  3WA2 X;  1RNB A;  4RZM A;  3ZG0 A;  1NU3 A;  1BUQ A;  1AV4 A;  1YVS A;  3LH4 A;  2F98 A;  4HVN A;  4WYK A;  7GSP A;  1O7W B;  3JUM A;  2CK3 H;  3RGA A;  1O7M B;  3EJV A;  5EQL A;  4FMD A;  5DRE A;  3RDE A;  1W02 A;  3B7C A;  3HIG A;  1Q40 B;  1O7H B;  1K73 4;  1RCL A;  2WGO A;  1DMN A;  4HM3 B;  2D1W A;  1LRA A;  2WOH A;  1I3I A;  5IF6 A;  3Q2P A;  3GZX B;  1FZU A;  3CCM 3;  3KKG A;  1LOW A;  2L4V A;  2IUK A;  2Y73 A;  1FW7 A;  3DM8 A;  1FA3 A;  2F99 A;  2I9W A;  2CX0 A;  3FF0 A;  3GSP A;  3BLZ A;  3Q3F A;  4L8P A;  5AIH A;  1W2B 2;  1Q7H A;  5JPP A;  3CCL 3;  1BRH A;  3PGB A;  4HJL B;  1K9M 4;  2A15 A;  2PNC A;  3AHS A;  1Q82 4;  3CCQ 3;  1A90 A;  3OV4 A;  3MPH A;  5M1A A;  1RRH A;  2GXF A;  3IMA B;  1E3V A;  2B1X B;  1BNG A;  3LTD A;  3JVC A;  5CF2 A;  1QVF 2;  5IW9 A;  1BNF A;  2CWT A;  4HOH A;  1K41 A;  3CU3 A;  3UB1 A;  1UCJ A;  3MG1 A;  1OF5 A;  5G1L A;  5KP4 A;  3CPO A;  1QVG 2;  3DMC A;  1JZO A;  1R4Y A;  4GB5 A;  3FG4 A;  1SII A;  4K61 A;  3D4A A;  1FUW A;  2IYJ A;  1GOY A;  1JV2 B;  3CCE 3;  2BNG A;  3MG3 A;  1BSD A;  2YFJ B;  1QJG A;  1YGE A;  1FGT A;  3NBJ A;  1UCK A;  1TRP A;  1GY7 A;  3PS8 A;  3G4S 3;  1ZX2 A;  3BNC A;  4J5K A;  3GRD A;  4HYZ A;  1I2G A;  2K0M A;  1FGR A;  6GSP A;  2OWP A;  1JKG A;  1B21 A;  1NNV A;  3EC9 A;  2RGQ A;  1LNH A;  4MMZ B;  2FXT A;  1RGC A;  1MWS A;  1FUS A;  2OTJ 3;  3FZW A;  1OGX A;  2F4Y A;  3SLU A;  4HZ9 B;  1Y4K A;  3OWY A;  4IIA A;  2GEY A;  3LML A;  3G0K A;  3NXJ A;  4BTY A;  1EUI C;  2LYX A;  2W9Q A;  4L7K A;  4RBN A;  3F7X A;  5LC7 A;  3JUO A;  2F86 B;  2P09 A;  1YVB I;  4TX4 A;  3FSD A;  2KF3 A;  3DGM A;  2OOV A;  1IK3 A;  3CCR 3;  1KSI A;  1BGS A;  5EVH A;  2O9U X;  3EQQ B;  3FH1 A;  1M9G A;  4LZI A;  1T2I A;  3UL6 A;  2GBX B;  3X42 A;  1RN7 A;  1R4C A;  5HOH A;  1QAF A;  1UDI I;  3KSE D;  2Q07 A;  4N6M A;  3RNT A;  4LGQ A;  2CX1 A;  1HYF A;  2E2V A;  3IPT A;  3D5I A;  3I55 3;  2ZL8 A;  1G96 A;  1O7N B;  2GU1 A;  4FMC A;  4GL6 A;  3NM2 A;  1EG9 B;  1RGE A;  4K1U A;  1W6G A;  4WP5 A;  1HZ1 A;  1RGL A;  1NJI 4;  4OUQ A;  4KZ1 A;  3S29 A;  1ULJ B;  2Z76 A;  1GMQ A;  2SBL A;  5AEW B;  1JN5 A;  2V1L A;  1J2B A;  1ZGX A;  3EE1 A;  1AQZ A;  4NRE A;  5AI1 A;  1NB3 I;  1K8A 4;  3V98 A;  3TDG A;  4HM0 B;  1DYU A;  1LOX A;  4HM1 B;  3BNE A;  4J5G A;  1JBT A;  3F9S A;  3NM7 A;  3EN8 A;  5RNT A;  1OF5 B;  1SJW A;  5FGO A;  4CPK A;  1DE3 A;  1W4N A;  3I0Y A;  1MNL A;  1BSB A;  3MKI A;  4XDW A;  1BVI A;  2BHM A;  3NBR A;  1ASK A;  3SVA A;  4KT3 B;  3FCS B;  3N54 B;  3F8H A;  6RNT A;  2CWV A;  3CPW 2;  3OWU A;  1N8Q A;  1QAL A;  1MGR A;  4XDV A;  2XSO B;  1NDO B;  2W2C A;  3LTB A;  1CQS A;  1MGW A;  2FGT A;  3HII A;  3U1W A;  3B4P A;  1A2K A;  1RHL A;  1RTU A;  1UW1 A;  2WO0 A;  8RNT A;  3ZFZ A;  3DGO A;  1F8N A;  1FUT A;  3CNX A;  1RJO A;  2J8X B;  3GAX A;  3M8C A;  1OH0 A;  3EX9 A;  5G2G A;  1UUW B;  3CCV 3;  1JB4 A;  2K3D A;  3CC4 3;  3NBB A;  3S5C A;  1KQS 2;  4OK0 A;  5DRV A;  1RKY A;  2OTL 3;  1N5P A;  4R9K A;  2P0M A;  1JZD A;  1AVK A;  2JQ5 A;  3BU4 A;  3KII A;  4HZB B;  4BTX A;  5KP1 A;  3T8U A;  1TFK A;  3VSY A;  4AKZ A;  3S27 A;  1M1X B;  2BIR A;  3KZT A;  4R4K A;  3BIR A;  1RGA A;  3EF8 A;  4XB5 A;  4KVH A;  3LTA A;  4FMB A;  3NQZ A;  2UX0 A;  4I4K A;  1STF I;  1JBS A;  3CCU 3;  3UNL A;  1VQO 3;  1IQ8 A;  3GZR A;  4N6T A;  3DY5 A;  1I0X A;  3X3X A;  3ALA A;  3I56 3;  1OHS A;  3MSO A;  1S72 3;  1GY6 A;  1YJW 3;  1JRQ A;  1OHO A;  3B8L A;  3BND A;  4N6N B;  5ELU A;  5JBS A;  1BNI A;  2IUJ A;  3AMO A;  1FGM A;  4EW5 A;  1M1K 4;  2HOH A;  4MMY B;  4EBG A;  1GD3 A;  1S5A A;  3KFQ C;  1A2P A;  3EN1 B;  1RGG A;  3H3H A;  1W2Z A;  2CKF B;  4WHA A;  1GOU A;  3E99 A;  3N9H A;  4BU4 A;  1BRK A;  2HMK B;  3FG1 A;  1BSC A;  1TFO A;  1VZZ A;  3G8Z A;  3X40 A;  5D82 A;  1TU5 A;  2IMJ A;  1L5G B;  1VQ5 3;  3EBT A;  1NWW A;  4HM4 B;  2RSX A;  4I5Q A;  4PEJ A;  1UGH I;  3FKA A;  3Q90 A;  3DUK A;  4J8T A;  1N8R 4;  4HM7 B;  3WMD A;  1JJ2 2;  3KE7 A;  3QRD A;  1ISK A;  1OGZ A;  3G6E 3;  4O02 B;  1EA2 A;  1GS3 A;  3FF2 A;  4DKI A;  1Z1S A;  1JB5 A;  1UCL A;  2RCD A;  1OPY A;  3MG2 A;  1NB5 I;  4Q53 A;  5AYS C;  1MOL A;  2UGI A;  3BNB A;  1GOV A;  4R1K A;  4AEQ A;  1W5Z A;  2WGQ A;  2XFT A;  3RGR A;  1YGW A;  1CEW I;  2KF4 A;  3DGL A;  3WR2 A;  1B20 A;  3FLJ A;  5BIR A;  5IG3 A;  2CWU A;  1D6U A;  3BB9 A;  4N6V 0;  3SXX A;  1QMA A;  2MC8 A;  1I2E A;  5D83 A;  4N3V A;  8CHO A;  1EEJ A;  2W03 A;  2K54 A;  1N9J A;  1E97 A;  3GZB A;  5IER A;  1PFP A;  1BSE A;  1N5H A;  2B24 B;  3HZP A;  3OX9 A;  1N9E A;  2UUG C;  3LT8 A;  1VQ4 3;  1RLS A;  1LNI A;  3WHO A;  1RCK A;  1SQW A;  2ZA4 A;  1PU4 A;  1HU9 A;  7RNT A;  1Q42 A; 
#chains in the Genus database with same CATH homology
 3CNM A;  3NUV A;  4U13 A;  3PZW A;  5IG4 A;  1YJ9 3;  4O3V A;  4XBY A;  3O8Y A;  1M90 4;  3S28 A;  3WA3 A;  3PYJ A;  3WDG B;  4EYC A;  5JPU A;  1O7G B;  3FG3 A;  1JB2 A;  1VQL 3;  3L0R A;  1OUN A;  4WWU C;  2LQV A;  5IG5 A;  3X41 A;  2XEP A;  2QIY A;  3LOY A;  3K63 A;  5HGR A;  2Z77 A;  5AEU B;  4FCJ A;  3JUN A;  1HKX A;  3T8N A;  1YIT 3;  1A2V A;  1JNQ A;  3CD6 3;  1KWI A;  3PXM A;  1GYB A;  4N6O B;  3SED A;  3B4O A;  3NHX A;  1DMQ A;  3VF1 A;  4O2H A;  1TUH A;  1OHP A;  1KC8 4;  2E2T A;  1WMP A;  2P05 A;  2Y74 A;  2CG1 A;  2OQE A;  1KD1 4;  1WMO A;  5TGN A;  2YFL B;  2YFI B;  4N6U A;  1ULI B;  3G16 A;  4ZM8 A;  2CFL A;  2GEX A;  2HMJ B;  3DGN A;  2BO9 B;  3H51 A;  1YIJ 3;  4JF8 A;  1CYU A;  2HMN B;  2GU3 A;  5I97 A;  1IQY A;  1W6Y A;  2XRX B;  4WYK B;  1IVU A;  1RRL A;  5STD A;  1UI7 A;  1DVC A;  1IDP A;  1GY5 A;  3K9M C;  3LT9 A;  1OAC A;  4FR9 A;  4EC6 A;  5IEN A;  1VQM 3;  4KFD A;  2HML B;  2Z6B A;  3F8X A;  3VGN A;  3U97 A;  1IT8 A;  1DVD A;  5CK6 A;  3FGY A;  4RNY A;  1V74 A;  2BMR B;  2OQE C;  3EHC A;  2O3O A;  2XSH B;  3A76 A;  7STD A;  1JN5 B;  3HI7 A;  2INX A;  3IJE B;  1WTH A;  4LMI A;  4RNZ A;  4L8O A;  2XGL A;  3CC2 3;  5AIG A;  3S67 A;  4G1M B;  4HKV B;  3Q1C A;  4HM2 B;  3CXC 2;  1A67 A;  1W6C A;  3G71 3;  1YJN 3;  1VQ9 3;  2FNQ A;  1IV7 A;  3LTC A;  4EV2 A;  1VQ7 3;  4HM6 B;  4FCM A;  4BTW A;  4H3U A;  2BMO B;  4CCV A;  2PZV A;  5CLK A;  5BVB A;  4OVM A;  5IEP A;  3MWZ A;  2WOF A;  4LSO A;  3X3Y A;  3T0U A;  1VQK 3;  3NV0 A;  2KXG A;  1ROA A;  5ELJ A;  2BT3 A;  2HMO B;  3ER7 A;  3V99 A;  3SOA A;  3V92 A;  5D81 A;  4CDL A;  1IT7 A;  2XH9 A;  1SIH A;  3MYT A;  2P0X A;  4MEI A;  2CHC A;  3CC7 3;  2W56 B;  4X2H A;  1YHQ 3;  1IVV A;  1Q81 4;  4FCZ A;  2KCD A;  1UI8 A;  1U5O A;  4STD A;  4HBR A;  1O7P B;  3EBY A;  2ML5 A;  4EXR A;  3OW2 2;  2D42 A;  3K0Z A;  1AVL A;  5FW5 A;  2CH9 A;  3J7Y d;  1IVW A;  2CFD A;  1EKM A;  4AKY A;  5LC6 A;  3ECF A;  4EV5 A;  2C10 A;  4LEH A;  1STD A;  2CC3 A;  1U8C B;  3AMO B;  1LXE A;  2YX9 A;  3MHE A;  3CCS 3;  1US1 A;  1AR0 A;  2CFG A;  5EEO A;  2M7O A;  3N8B A;  1ZO2 A;  4J9A A;  1NO3 A;  1TIJ A;  2KRT A;  3NX0 A;  3U1W A;  4IPB A;  4KFF A;  1ROV A;  2RFR A;  2E2U A;  4HM5 B;  3F40 A;  4K1V A;  4K90 B;  2GBW B;  3NQY A;  3QK9 A;  2W0Q A;  3KN4 A;  5AYR B;  3X3Z A;  3CCJ 3;  1Q40 A;  1IV9 A;  3NV0 B;  3HX8 A;  1DMM A;  2CG0 A;  3JUQ A;  4N6L A;  3STD A;  3F7S A;  3CMA 3;  3DXO A;  4R80 A;  1LVN A;  3D3L A;  3K5T A;  2QGU A;  4H61 A;  3LYG A;  5CXO A;  1E3R A;  4MMX B;  2W56 A;  2R4I A;  3HK4 A;  2MF7 A;  5BXQ A;  3KSP A;  3PCS A;  4XBT A;  1VQ8 3;  1VQ6 3;  4IT7 A;  3PCR A;  5CF1 A;  4QWT A;  2C11 A;  1FGO A;  2CFK A;  5IG0 A;  4WFO A;  3GZY B;  2OCT A;  4MJD A;  3ROB A;  5A0O B;  1EQK A;  5AIF A;  1WQL B;  3UL5 A;  2XF3 A;  4NHF A;  2JDI H;  1IVX A;  2W04 A;  2QA4 3;  2XGN A;  2ZDJ A;  1FGQ A;  1K28 A;  3D9R A;  2XR8 B;  1GD4 A;  1W00 A;  2W6J H;  4HM8 B;  1TP6 A;  2HMM B;  1OCV A;  2STD A;  4O8S A;  1CYV A;  4KFE A;  4JRF A;  1SPU A;  1W01 A;  3EB8 A;  1VQP 3;  4ORL A;  3CME 3;  6STD A;  3UJM A;  1Q86 4;  5IEO A;  3WOE B;  1D6Y A;  2OOV C;  1IU7 A;  2W9P A;  2IA7 A;  1IQX A;  3K7C A;  1T5Y A;  3JUP A;  4R9L A;  5KP3 A;  3OXA A;  3SOY A;  1D6Z A;  1VQN 3;  3GWR A;  4FMA A;  2QEX 3;  1C7H A;  2CIU A;  1WMN A;  1JKG B;  2CFW A;  3LXU X;  2ML6 A;  3WOD G;  4X2O A;  3DZL A;  3SX1 A;  2CW9 A;  2Z7A A;  1QAK A;  1YI2 3;  4XM4 A;  5AII A;  2XFS A;  1Q7Y 4;  1UUV B;  3WOF B;  2BMQ B;  3LZA A;  3OWS A;  1W7C A;  1WNH A;  2P38 A;  3F14 A;  4XBX A;  3WA2 X;  4RZM A;  1NU3 A;  1BUQ A;  1AV4 A;  3LH4 A;  4HVN A;  2F98 A;  4WYK A;  1O7W B;  3JUM A;  2CK3 H;  3RGA A;  1O7M B;  3EJV A;  5EQL A;  4FMD A;  5DRE A;  3RDE A;  1W02 A;  3B7C A;  3HIG A;  1Q40 B;  1O7H B;  1K73 4;  2WGO A;  1DMN A;  4HM3 B;  2D1W A;  2WOH A;  5IF6 A;  3Q2P A;  3GZX B;  3CCM 3;  3KKG A;  2L4V A;  2IUK A;  2Y73 A;  3DM8 A;  1FA3 A;  2F99 A;  2I9W A;  3FF0 A;  5AIH A;  1W2B 2;  3BLZ A;  4L8P A;  5JPP A;  3CCL 3;  3PGB A;  4HJL B;  1K9M 4;  2A15 A;  2PNC A;  1Q82 4;  3CCQ 3;  1A90 A;  3OV4 A;  3MPH A;  1RRH A;  2GXF A;  3IMA B;  1E3V A;  2B1X B;  3LTD A;  5CF2 A;  3JVC A;  1QVF 2;  5IW9 A;  2CWT A;  3UB1 A;  1K41 A;  3CU3 A;  5KP4 A;  3MG1 A;  1OF5 A;  3CPO A;  1QVG 2;  3DMC A;  4GB5 A;  3FG4 A;  1SII A;  4K61 A;  1FUW A;  1JV2 B;  3CCE 3;  2BNG A;  3MG3 A;  2YFJ B;  1QJG A;  1YGE A;  1FGT A;  3NBJ A;  1GY7 A;  3PS8 A;  3G4S 3;  1ZX2 A;  3BNC A;  3GRD A;  4HYZ A;  2K0M A;  1FGR A;  2OWP A;  1JKG A;  3EC9 A;  2RGQ A;  1LNH A;  4MMZ B;  2FXT A;  2OTJ 3;  3FZW A;  1OGX A;  3SLU A;  4HZ9 B;  1Y4K A;  3OWY A;  4IIA A;  2GEY A;  3LML A;  3G0K A;  3NXJ A;  4BTY A;  2LYX A;  2W9Q A;  4L7K A;  4RBN A;  3F7X A;  5LC7 A;  3JUO A;  2F86 B;  2P09 A;  1YVB I;  4TX4 A;  3FSD A;  3DGM A;  2OOV A;  1IK3 A;  3CCR 3;  1KSI A;  5EVH A;  2O9U X;  3EQQ B;  3FH1 A;  1M9G A;  4LZI A;  3UL6 A;  2GBX B;  3X42 A;  1RN7 A;  1R4C A;  1QAF A;  3KSE D;  2Q07 A;  4N6M A;  4LGQ A;  3IPT A;  2E2V A;  3I55 3;  2ZL8 A;  1G96 A;  1O7N B;  2GU1 A;  4FMC A;  4GL6 A;  3NM2 A;  1EG9 B;  4K1U A;  1NJI 4;  1W6G A;  4WP5 A;  4OUQ A;  4KZ1 A;  3S29 A;  1ULJ B;  2Z76 A;  2SBL A;  5AEW B;  1JN5 A;  2V1L A;  1J2B A;  3EE1 A;  4NRE A;  5AI1 A;  1NB3 I;  1K8A 4;  3V98 A;  3TDG A;  4HM0 B;  1DYU A;  1LOX A;  4HM1 B;  3BNE A;  3F9S A;  3NM7 A;  3EN8 A;  1OF5 B;  1SJW A;  5FGO A;  1W4N A;  3I0Y A;  1MNL A;  3MKI A;  4XDW A;  3NBR A;  2BHM A;  1ASK A;  3SVA A;  3FCS B;  3N54 B;  3F8H A;  2CWV A;  3CPW 2;  3OWU A;  1N8Q A;  1QAL A;  4XDV A;  2XSO B;  1NDO B;  2W2C A;  3LTB A;  1CQS A;  2FGT A;  3HII A;  3B4P A;  1A2K A;  1UW1 A;  2WO0 A;  3DGO A;  1F8N A;  3CNX A;  1RJO A;  3GAX A;  3M8C A;  1OH0 A;  3EX9 A;  5G2G A;  1UUW B;  3CCV 3;  1JB4 A;  3CC4 3;  3NBB A;  3S5C A;  1KQS 2;  4OK0 A;  5DRV A;  1RKY A;  2OTL 3;  1N5P A;  4R9K A;  2P0M A;  1AVK A;  2JQ5 A;  3KII A;  4HZB B;  4BTX A;  5KP1 A;  3T8U A;  1TFK A;  3VSY A;  4AKZ A;  3S27 A;  1M1X B;  3KZT A;  4R4K A;  3EF8 A;  4XB5 A;  4KVH A;  3LTA A;  4FMB A;  3NQZ A;  2UX0 A;  4I4K A;  1STF I;  3CCU 3;  3UNL A;  1VQO 3;  1IQ8 A;  3GZR A;  4N6T A;  3DY5 A;  3X3X A;  3ALA A;  3I56 3;  1OHS A;  3MSO A;  1S72 3;  1GY6 A;  1YJW 3;  1JRQ A;  1OHO A;  3B8L A;  3BND A;  4N6N B;  5ELU A;  5JBS A;  2IUJ A;  3AMO A;  1FGM A;  1M1K 4;  4MMY B;  4EBG A;  1GD3 A;  1S5A A;  3KFQ C;  3EN1 B;  3H3H A;  1W2Z A;  2CKF B;  4WHA A;  3E99 A;  3N9H A;  2HMK B;  3FG1 A;  1VZZ A;  1TFO A;  3X40 A;  3G8Z A;  5D82 A;  1TU5 A;  2IMJ A;  1L5G B;  1VQ5 3;  3EBT A;  1NWW A;  4HM4 B;  2RSX A;  4PEJ A;  3FKA A;  3Q90 A;  3DUK A;  4J8T A;  1N8R 4;  4HM7 B;  3WMD A;  1JJ2 2;  3KE7 A;  3QRD A;  1ISK A;  1OGZ A;  3G6E 3;  4O02 B;  1EA2 A;  1GS3 A;  3FF2 A;  1Z1S A;  1JB5 A;  2RCD A;  3MG2 A;  1OPY A;  1NB5 I;  4Q53 A;  5AYS C;  1MOL A;  3BNB A;  4R1K A;  4AEQ A;  1W5Z A;  2WGQ A;  2XFT A;  3RGR A;  1CEW I;  3DGL A;  3FLJ A;  5IG3 A;  2CWU A;  1D6U A;  3BB9 A;  4N6V 0;  3SXX A;  1QMA A;  2MC8 A;  5D83 A;  4N3V A;  8CHO A;  2W03 A;  2K54 A;  1N9J A;  1E97 A;  3GZB A;  5IER A;  1PFP A;  1N5H A;  2B24 B;  3HZP A;  3OX9 A;  1N9E A;  3LT8 A;  1VQ4 3;  1SQW A;  1PU4 A;  1HU9 A;  1Q42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...