1OUVA

Helicobacter cysteine rich protein c (hcpc)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
265
structure length
265
Chain Sequence
DPKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFYAKACDLNYSNGCHLLGNLYYSGQGVSQNTNKALQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTKACDLNDGDGCTILGSLYDAGRGTPKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEALARYSKACELENGGGCFNLGAMQYNGEGVTRNEKQAIENFKKGCKLGAKGACDILKQLKIKVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Helicobacter Cysteine-rich Protein C at 2.0A Resolution: Similar Peptide-binding Sites in TPR and SEL1-like Repeat Proteins
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords conserved hypothetical secreted protein
total genus 111
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08238 Sel1 Sel1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ouvA00
2KCLA 2J9QA 4U04A 3RO2A 4HOTA 2XPIA 3S7DA 3ULQA 5D0OD 4H7YA 4BTAA 2AVPA 5FZRA 4JA7A 4N3AA 4GYOA 3CV0A 4GZ5A 4UQXA 5KJNA 2XCBA 2HYZA 2Y4UA 1NA3A 1NA0A 2QFCA 3AS4A 5JJTA 1HH8A 3QWPA 2HO1A 2YQ8A 4LEUA 3CVNA 4N39A 3QWWA 5D0QD 3ZGQA 5CCMA 5G05J 2PQNA 4GZ3A 1W3BA 2C0MA 3KAEA 4UI9J 5G04J 4GYYA 3RU0A 3U4TA 4WNGA 5AYWD 2LSVA 3FFLA 4H7XA 2FI7A 3RO3A 4G24A 4G2VA 3Q15A 3N71A 4GCOA 4WNFA 4AY6A 1P5QA 2IFUA 3ESKA 3TG5A 4G1TA 4GA0A 4N3CA 4U0ZA 3SF4A 4U0UA 5C1DA 2I6HA 3CVLA 2UY1A 3Q47B 2VQ2A 3R9AB 5FJYA 4WUYA 1YA0A 3LCAA 4G26A 4I17A 2LSUA 5JJ7A 2FO7A 3Q4AB 3QWVA 1B89A 1Y8MA 2DBAA 3MKRA 5JJ6A 1NZNA 4RG9A 2FEZA 1E96B 1KT0A 2KCKA 4Y6WA 4HOUA 4Y6CA 3O48A 4ABNA 4F3VA 2IF4A 5A6CA 3PE4A 5M72A 2WQHA 1OUVA 2XCCA 4AM9A 4UQZA 3ASGA 3LKUA 4W9RA 3LPZA 3VTXA 4XI0A 3ASDA 2Y4TA 2ONDA 4A1SA 1A17A 4GA2A 4HORA 3JYSA 2VGYA 3OXLA 3KD7A 2VSYA 4G23A 4KBQA 4RG6A 3NF1A 2WPVA 4I9CA 5G05C 4GA1A 3CVQA 3QDNA 1QQEA 1TJCA 2P58C 3EDTB 4U0SA 1WM5A 5BW8C 3S7FA 3U3WA 1QZ2A 4JHRA 5DIZA 1ELRA 2C0LA 3GYZA 3GZ2A 3MV3B 3CEQA 3QOUA 5CHEE 2HR2A 2KC7A 3PDNA 3UUXA 4CGVA 3TGOA 4WNEA 3S7BA 3OXGA 4YNDA 3S7JA 4BTBA 5KJKA 3AS5A 4UQYA 3UPVA 4GPKA 2NC9A 2C2LA 1WAO1 3TAXA 3KS2A 4BT8A 3URZA 2PL2A 3LYAA 4J8FA 2VGXB 5BNWA 4NRHB 1ZU2A 4U07A 1KLXA 4UI9C 4WNDA 3MV2B 5G04C 3CKBA 4AY5A 3CK8A 2OOEA 3PE3A 4CGWA 3ZFWA 5HQ8A 4JA9A 2XEVA 5EX3A 3CKCA 3LY7A 4O6FA 5DBKA 4HOSA 3RKVA 4N2SA 5EKQD 2YHCA 5CCLA 1FCHA 3ZN3A 4GYWA 2R5SA 3IEGA 2V5FA 3MEKA 4G25A 3Q49B 4UI9K 2L6JA 5LCWJ 4GCNA 5KJLA 3CK7A 4KYOB 3CVPA 4APOA 3BEEA 4I2WA 4XI9A 3E4BA 3TG4A 1ELWA 5ARFA 4J8DA 4NQ0A 4GZ6A 4EQFA 4XIFA 2FF4A 3FP3A 4N2QA 3WXXA 2VSNA 3ZHEB 4KXKB 2FBNA 3GZ1A 2KATA 4J8EA 5FTPA 3RIBA 5HI7A 1ZBPA 3HYMB 3ASFA 3K9IA 3QKYA 1KT1A 2XGSA 4JL0A 2UWJG 5ARGA 4N5CA 2PZIA 5FZQA 2Q7FA 4BT9A 5BT1A 3SZ7A 2XGOA 3ZHEA 3LY8A 2XGMA 3Q5MA 5LCWC 2UY1B 3OXFA 3UQ3A 3GW4A 5FT9A 2JLBA 4BWRA 3LY9A 4I9EA 2PQRA 2MHKA 4ME2A 3MA5A 5EX0A 5A7DB 3RJVA 2GW1A 4YVQC 3ZPJA 4J0UA 3VTYA 4B94A 4AIFA 2KCVA 4HOQA 1HZ4A 2VGXA 1PC2A 2E2EA 1IYGA 1HXIA 4N3BA 3AS8A 3FWVA 2VYIA 4I2ZA 1XNFA 5FZSA 5KJMA 4I1AA 4CDRA 2LNIA 4YVOA 3ASHA 2BUGA 4IN3B 3CK9A 1IHGA
chains in the Genus database with same CATH superfamily
5AJDA 2BKGA 1S63A 3U66A 2XPIA 3CQCB 4HVBA 4TXPA 4GYOA 1HH8A 3C3QA 1U3CA 5IY5E 5CEAA 4ZHBA 5HKPA 2AXZA 3EIJA 3ESKA 4G1TA 4GA0A 3ULEG 2LSUA 2BEDA 1NZNA 5M72A 2XCCA 2ZXWE 2X6IA 3FTZA 5T4YA 4HLEA 4G23A 5AARA 4I9CA 3EDTB 2P58C 2RKKA 3GZ2A 3FY4A 4XKCA 3J5PA 4UQYA 4CEMA 5G04C 3CHSA 2XEEA 4HS2A 1H2TC 3RKVA 5EKQD 3ZN3A 1IQUA 3L08A 5LCWJ 3PNLB 3CVPA 4KYOB 5EN5D 2L9BA 4F1PA 2CG2A 4EQFA 2I9CA 2M63A 2V5QC 2P9KG 3I3NA 2V0PA 4CDMA 3UT4A 4HBDA 3IBEA 3DWLG 3ZIMA 3EUVA 4GB9A 3W9FA 3ZXPA 3LS8A 3SD5A 4CDRA 3P1UA 4IN3B 3CK9A 1N0RA 3FUDA 2XPZA 3UT8A 4I6JA 1LD7A 5FZRA 3ABLE 1BLXB 1MYOA 2P2CP 3L9TA 2Y4UA 3ZRHA 1XGWA 4DLOA 4Q94A 1ELKA 4GAAA 3T8KA 5A23A 1OCRE 4U0ZA 5C1DA 2PM6A 3FUMA 1G3NB 3QWVA 1HG5A 2Y3AA 4NIKA 2XS8A 2EILE 3PE4A 2V4LA 5J90A 3AG2E 3LKUA 2ONDA 3RAUA 2IQCA 2VSYA 3O4ZA 4ANWA 4GA1A 3TWVA 4KVOA 3ZYKA 5EIBE 1ELRA 2BTDA 3CEQA 4UWLA 5B1BE 1HF8A 1U3DA 2GRNB 3S7JA 3CVWA 3P2BA 4NRHB 4CGWA 2OOEA 3UTMA 4O6FA 5DBKA 1DVPA 2YHCA 4GYWA 4BETA 4GCNA 2B6CA 3FH8A 3FP3A 3ZHEB 4L7TA 1JCSA 4YDWA 4ATZD 1EF1C 1UN8A 4O1PA 4BTAA 2MHKA 3RJVA 3D9KA 2WXKA 1PY1A 1PC2A 1DNPA 4M3OA 3T5XA 5H7PA 1TNUA 2ILRA 2WB2A 3VLFA 4BT8A 2WMNA 3SI5A 4HOTA 2XZTG 4BX9A 3ULQA 4GZ5A 3QB2A 5D0QD 3L54A 3FEYA 3NOCD 1K8KG 3DSUA 2OCCE 3CHPA 2E0IA 4WUYA 4CDNA 1B89A 2DBAA 1KT0A 3SNXA 3ML8A 4U8VD 3MKQA 4PDXA 4MKTA 2WPVA 1TJCA 3RK6A 3SQVA 2X6KA 2GRMA 3FTVA 2KC7A 4U8HA 3AG3E 2AJAA 4GPKA 2MYOA 4PS7A 4R7LA 2P9SG 4J8FA 3S2AA 4JB8P 3Q78A 4GTQA 1KLXA 4EZJA 3B7SA 3MV2B 1TN7A 4JA9A 3ZKJA 3FU6A 4GU5A 5AQAA 2J49A 3MEKA 1H19A 2X6HA 3CK7A 3SBTB 4OVUA 4F53A 5B1AE 1L5JA 1TNYA 2GRPB 4AOFA 3ASOE 3ASFA 4JL0A 1FVHA 5EYLA 4DX2A 4E85A 2VJ8A 1MX4A 2R17C 2E2EA 2X3MA 4TUUA 2J9QA 4XX5A 4MBGA 2AVPA 2XCBA 3MJWA 1N54A 4C0EA 3FUJA 4G11A 2WXQA 5G05J 2AWIA 2F8YA 2FI7A 4JHJA 3MGBA 2CFUA 1H6KA 2WXFA 1SVXA 4CT0A 3EU5A 4JPSA 1Y8MA 4LUNU 1DCEA 4Y6CA 5BUZA 2R03A 4LCTA 1OCCE 4RG6A 3UIOC 4BERA 4UWFA 4GTSA 2ZIRA 3HG0D 2BKKB 3IHYA 2NC9A 2WXGA 3UT7A 3URZA 4GTRA 5G2NA 3APCA 3JXIA 3L22A 1Z3YA 3ZFWA 5EX3A 4EBAG 2H6HA 3B7UX 1BI8B 5KJLA 2WXPA 5CBOA 4HFGA 3EHNA 4NQ0A 3OTNA 4B0ZA 2ETAA 4PH4B 3WXXA 4HQDA 3RIBA 3NQPA 1N4QA 3U9WA 3FTXA 3Q5MA 3LJNA 4O60A 2LAIA 3ZPJA 2HM8A 3HVEA 2XS1A 1HO8A 3ABME 3AS8A 3FWVA 3MYVA 5J08A 3SFXA 1SA4A 4I6GA 1BI7B 4BY6A 3CV0A 5KJNA 3D9PA 3AS4A 5CBNA 4GPMA 4UI9J 2WQ6A 5ITZF 4DPRA 4AY6A 4LNBA 3PH0C 4C9BB 4HRMB 3Q4AB 3BUAA 4XZ4A 2WQHA 1OUVA 3QJZA 3RRUA 3TWUA 3L13A 4DI4A 3ML9A 3JYSA 2P9UG 3UKRG 3PRZA 3NF1A 5G05C 3D9LA 3Q79A 4YDEA 4ILHB 3DSTA 3UM3A 4KZCA 2PL2A 4HOSA 3PS6A 5AJLA 1EPUA 2L6JA 4P29A 3SFYA 2WM9A 4GZDA 3LDZA 1ELWA 3UX4A 4HNAD 1N94A 4EHMA 2BF0X 4B8CB 3K9IA 3AG1E 4GMRA 3TL5A 2EIJE 3FUHA 3OXFA 3LJ3A 4L2YA 4KZ0A 3CVVA 2VYIA 3D3MA 3SO8A 3PZ1A 4N3AA 1O5MA 4CYMD 3DXMG 3TG5A 2IFUA 4FHJA 4ILGA 2B0OE 4BX8A 4I1OB 1INZA 4CZ2D 4Y6WA 3C3OA 3FDHA 4K0RA 1JUQA 1TN8A 2ETBA 3V79K 4ANUA 4W9RA 1IQRA 1K1AA 4B8AA 3B7BA 2VGYA 3HVEB 1MZCA 2CHXA 3MKQB 5G55A 5CMWA 5CHEE 3TWWA 1MX2A 5ENOD 1UN9A 1KZPA 3TAXA 1JCQA 1QBQA 3CK8A 1Z3XA 4EZLA 1VDYA 1SZAA 3NZUA 3Q49B 4PUCA 2IU1A 2GRQB 4I2WA 1FT2A 4XI9A 2Y69E 3Q7FA 4F1SA 5ARFA 3ZEFA 4URKA 5LFAA 5HRYA 3PNTB 4J7WA 2VSNA 2XEHA 4L9PA 4WWNA 3DXKG 1MJ0A 4N5CA 5ANLA 4RSYA 3UQ3A 2WXRA 2WXMA 4FLBA 5EX0A 4BSZB 2GW1A 4Q96A 1IKND 4AIFA 3KSLA 4HRLA 3ZYQA 1TNBA 2YNQA 2YHEA 1BPOA 4K5AB 4GTOA 2LXLA 1OWOA 4MRUA 1NA0A 3FTYA 3QWPA 5CRVA 2HO1A 2YQ8A 3R9MA 2DWZA 3G2SA 1OXJA 4AV7A 2FULA 4HXIA 3ZVVA 3U64A 4GCOA 4NACA 4WNFA 1QNFA 3CVYA 3QK0A 3ZU7B 3CVLA 3HDXA 3R9AB 1YA0A 3MCXA 4GTPA 1Z5SC 2V8SE 3PZ2A 4RG9A 1OWNA 1UJJA 4HOUA 4JEHA 3T9KA 2LO6A 4HRNA 3MX3A 4O1OA 1MHQA 2FO1E 4AJWA 3OXLA 5JMND 2HE0A 1LTXA 3GYZA 3QAQA 1H6OA 3TGOA 4F6RD 1NP7A 1UOHA 2XHEA 3V2OA 2WXOA 4K5BA 4RLYA 1IXVA 3APFA 2XEVA 2OVBA 5KCMA 2GROB 3UIPC 4UI9K 4G25A 2J4BA 1OWMA 3E4BA 4XIFA 4N2QA 3UXGA 4LNUD 2OV8A 5EYPF 5FZQA 3LEWA 5BPPA 4AEZC 2IOSA 1U2VG 4I6EA 4J8SA 4ME2A 1WG0A 3TWRA 1XNFA 4YVOA 5JHBA 1X81A 3BU8A 5JJTA 1E8ZA 4Q69A 3D9JA 4GZCA 4GYYA 5AYWD 4G2VA 1E7VA 5AAOA 3VLDA 2UY1A 3Q47B 3LCAA 1OT8A 2ZGGA 3WG7E 2IY0C 4ABNA 1TYQG 5KNGA 3JUIA 4LG6A 2Y1LE 4A55A 3CGHA 1HU3A 3CHRA 3KD7A 1H0AA 2J08A 2X38A 4AVXA 1YCSB 3TWQA 4BTBA 3PZ4A 1GW6A 4EPZA 4FHKA 4OVVA 4EBAA 3VLEA 3CKCA 1N11A 2J8SD 1UJKA 3UMVA 4FJZA 3HRAA 2F37A 3G2UA 1SW6A 5EDSA 3CQGB 3DSVA 5LP0A 3FTSA 3HHMA 2F8XK 1Z6TA 4EECA 2XGSA 2PZIA 5T8IA 3SY2A 2XGOA 3RRMB 1BU9A 2UY1B 2KM4A 2JLBA 2NYJA 3Q75A 5BV0A 3L17A 5D2MC 1WDYA 3HXBA 3TG4A 2IJGX 4BSXA 1LF8A 4H7YA 4V3IA 1WY6A 4PS8A 1H2UA 4N39A 3CVNA 3QWWA 2XQ0A 3KAEA 3L82A 4WNGA 4JVSA 4H7XA 4K5CA 4LRZA 2DZOA 1P5QA 3AU4A 3PZ3A 3UM0A 2CHWA 1EYHA 1JWFA 1YYHA 3JUEA 1NI1A 2KCKA 1E96B 1V54E 5A6CA 3AAAC 3DBSA 4CCAA 1A17A 3LXUX 4BFRA 3DSXA 2WMOA 4QFVA 2QY7A 3QOUA 1NFIE 2HR2A 1PAQA 3OXGA 2IONA 1E8XA 5LX8A 1WAO1 2PNNA 3KS2A 1TEZA 3PUJA 2EQXA 2JABA 4C0MA 3PZDA 4JC8A 3TJPA 3L6AA 5CCLA 4ATGA 2R5SA 4ZFHA 4LNGA 3ZW3A 3CHMA 4ANXA 4KXKB 4ACLA 3TWTA 2Q7FA 4BT9A 2P9IG 2I2OA 3E33A 3Q9UC 2KZTA 5JA4D 3I5PA 3MA5A 5A7DB 3VTYA 3ZYLA 1FPPA 4B94A 4HOQA 1FVFA 2VGXA 1N9AA 2IEJA 4I2ZA 2IOLA 4IRUA 3FH7A 4J6IA 2RFMA 3RO2A 3FUFA 3Q73A 4UQXA 1S64A 4DUIA 2PQNA 3FUNA 1W3BA 5G04J 5KWDA 4XE0A 3FFLA 4NURA 3D9IA 3SFZA 4TXQA 4TV3A 3D9MA 3QARA 4I17A 3I4RB 1O1RA 5JJ6A 2GRRB 3O48A 2IF4A 4C48B 1TN6A 4OAVB 4DX7D 4UQZA 2Y4TA 4HORA 4UWHA 2QC9A 1QQEA 4M7CA 3FUIA 2CHZA 3FUKA 3UUXA 1O1SA 2I1JA 3CKBA 4AY5A 3G2VA 4L1BA 2IO3C 4KVMA 3FHEA 3CSTA 4WAFA 4E6HA 3ZUVB 3BG1B 5BXUA 5FTPA 2KATA 3CHQA 5HI7A 3I4GA 4A1GA 2DVWA 1S0PA 4A3TA 4EZKA 4FLHA 3FH5A 3SHFA 4OYSA 4YVQC 3JCKC 3Q7AA 4J0UA 5FQ6A 3CIAA 5FQ8A 4N3BA 2PM7A 2WXLA 4U04A 2JEKA 5D0OD 4LSZE 2WXJA 1H2VC 4JXTA 4LEUA 1LD8A 5ENNA 1E7UA 1OCOE 2C0MA 1RZ4A 5AQ9A 4A63B 3FU3A 3QNKA 1OY3D 4DLQA 2VGEA 1E8YA 1D9SA 2VQ2A 3MZLB 3E32A 2R59A 3PEUB 4MLPA 2FEZA 1Y6IA 4B89A 5CEDB 4OAUC 3NOGD 2EINE 3VTXA 5ENRD 3QDNA 4TUMA 5DIZA 2X6JA 3TXNA 4WNEA 5B3SE 3G2TA 3UPVA 2C2LA 1E90A 5HQ8A 4ACKA 4GMLA 3IEGA 1K1BA 3NAWA 3E30A 1Q2ZA 2GRLA 4J8EA 1D8DA 1UG3A 4J8YA 3EHMA 3DEOA 1N4PA 4DX6D 3GW4A 4I43A 3JXJA 5AN8A 5FQ4A 5CERB 4AXHA 4I1AA 2EIME 2RG8A 2BUGA 3V2XA 5FQ7A 1OWLA 3CSFA 4WWPA 2QFCA 3ZGQA 4U7EB 3AG4E 3RU0A 4GTVA 4G24A 3Q15A 4N3CA 2I6HA 5D66A 5JJ7A 3IV0A 3ZNGA 3RSEG 3R7QA 3MKRA 4DX1A 5JHAA 4XI0A 3UM2A 3ASDA 1BD8A 3ZXSA 4JHKA 3CVQA 5BW8C 3BG0B 3U3WA 3MV3B 2XRZA 2XENA 3DEPA 3AS5A 4UI9C 4WNDA 2VSXE 3JQ0A 4JW1A 1NL4A 4HI8A 3LY7A 1JWGA 2LXMA 1FCHA 1N0QA 5HS0A 4IULA 2J09A 2VSOE 4GZ6A 3B7RL 4FJYA 3KEZA 4YDYA 3GZ1A 2LUHA 1YMPA 3C5RA 3HYMB 3KEAA 4L23A 3C98A 4HLLA 4I1MA 4F7AA 2L0TB 1OWPA 1SQMA 4I9EA 4U8YD 3R7RA 3CVXA 3E34A 2KCVA 2ETCA 1HZ4A 2R05A 3TWXA 1IYGA 5ENSD 1UW4B 2LNIA 3HXFA 4B93B 1S70B 4KT6B 3UINC 2XPYA 3S7DA 4AP2A 2H6GA 2LAHA 1A5EA 3FUEA 1HFAA 4D10C 3DSWA 3W9GA 1RW2A 3N71A 3D9NA 4KMOA 3CLJA 3G2WA 3ISMC 4FU3A 3J5QB 1TNZA 3CR3A 3HXDA 4RVBA 4G26A 3UI2A 3B13A 2WXHA 3HXEA 2KBXA 3DSSA 3ASGA 4GA2A 1K3ZD 2RD0A 3S7FA 2C0LA 2A5UA 3E37A 3V31A 1V55E 2AW6A 2VTBB 2QYJA 2VGXB 2AXUA 4XKBA 2P9LG 2DYSE 1MX6A 2WQ7A 1FT1A 3OAWA 2QYUA 5FINA 3ULYA 5EILA 5BXOA 4APFA 5T3RA 2OEWA 4BESA 1QYMA 5BV1A 2FF4A 3L16A 3UM1A 5LOZA 5ARGA 5E75A 2UWJG 5BT1A 2P9NG 2CFZA 1KZOA 2XGMA 3EHQA 5FT9A 2OEVA 3FULA 4LERA 4GTTA 2EIKE 3X2QE 1IHGA 4FC8A 3D9OA 3UKUG 3TWSA 4UWGA 4JA7A 3GZSA 2A4ZA 2HYZA 1NA3A 3FTUA 5CCMA 2IO2C 3RO3A 4ANVA 5CECB 2CG3A 2OVFA 4A3VA 2NSZA 5FJYA 1ZB1A 2FO7A 3SGHA 4F3VA 4WWOA 4TRQA 3FEXA 4FADA 3APDA 4U0SA 4U95D 1QZ2A 2ZU6B 2YINA 1HS6A 1O1TA 3PDNA 3D9HA 3S7BA 5KJKA 3FTWA 3LYAA 1ZU2A 5AENA 5ENQD 4DX5D 3JQ1A 4DJAA 1MQSA 3ONLA 4MS6A 4UUCA 3ABKE 2DCPA 3CHOA 1N95A 4GMJA 4X8QA 4GTMA 3T8MA 3ESLA 3QKYA 3ONKA 4JZYA 3EJNA 4PS3A 3KSQA 3LY9A 4HI9A 2H6IA 5ENTD 1HXIA 5FZSA 2DZNA 4G8LA 4L2LA 1N4SA 4BEPA 3IKOB 2L6BA 3QC1A 3EIQC 1AWCB 3ASNE 1SZ9A 1TNOA 4GZ3A 1KPSB 3EHRA 3U4TA 5C2YA 1EDUA 2MRIA 2V4HC 4FP7A 3SF4A 3C72A 4JD2G 4U0UA 2R02A 4AM9A 3SBSA 3DPYA 1TR4A 4A1SA 1N52A 1JPLA 4UWKA 5AQBA 2DYRE 4JHRA 3FU5A 4FULA 2L0IA 4YNDA 1X5BA 4QQIA 5KNHD 2I1KA 3IHVA 2QZAA 3V30A 3B95A 3HXCA 2XZDG 5CRUA 1HG2A 5ANRA 3PE3A 3C3RA 5CMYA 2V5FA 3PREA 4U96D 4DK5A 1HE8A 4APOA 4CRWA 4J8DA 2F0YA 1DC2A 2WVIA 4DRXE 5AQ7A 1OCZE 3B7TA 4Z68A 3SZ7A 3ZHEA 4DI3A 3BQOA 2J07A 2ZGDA 4FA6A 1AP7A 3NB2A 2KZTB 3ASHA 2Y0BG 2KCLA 3AJIA 3RRNB 5E76A 5EIDA 2ZISA 1TJFA 2LSVA 3ENEA 3F6QA 4K03A 3PUKA 3PEVB 3CVUA 3TXMA 4G8KA 3EU9A 2WXNA 3T5VA 4IYPA 2J4DA 4XEIG 3LPZA 1E8WA 1SA5A 3LVQE 4YDOA 1D8EA 2RFAA 3AU5A 4KBQA 4RQIA 2WXIA 1WM5A 2KXPC 2VTBA 4CGVA 5FIOA 3PVLA 2AXVA 5ENPD 4ILIA 1IHBA 5BNWA 5KBAA 4U07A 3IXEA 1JCRA 3FU0A 4U63A 3NZSA 1N4RA 4N2SA 3ZYMA 2DIWA 3HIZA 3LVRE 3NBNB 2H6FA 3BEEA 5AIJA 2MOWA 2A5EA 2FBNA 2X6FA 2XRYA 4JEUA 1ZBPA 1KT1A 4CT4A 2R2LA 3Q9NC 2NXPA 1DCQA 2P9PG 3LY8A 5LCWC 4HB5A 5FWQA 4BWRA 2GGFA 2PQRA 3DRAA 1H6PA 4N5QA 4TXRA 5KJMA 1HX8A 3DPDA
chains in the Genus database with same CATH topology
4BSXA 5AJDA 4KT6B 2XPYA 3U66A 1LF8A 2XPIA 3S7DA 3CQCB 4H7YA 4V3IA 4AP2A 4I6GA 4HVBA 4BY6A 1WY6A 4GYOA 4PS8A 2LAHA 3CV0A 5KJNA 3D9PA 1H2UA 3AS4A 1HH8A 3FUEA 4N39A 1HFAA 3CVNA 3QWWA 1U3CA 2XQ0A 4D10C 3KAEA 4UI9J 2WQ6A 4WNGA 4JVSA 4H7XA 4LRZA 3N71A 3D9NA 4DPRA 4AY6A 1P5QA 2AXZA 3AU4A 3CLJA 3EIJA 3ESKA 3G2WA 4FU3A 4G1TA 4GA0A 3CR3A 3PH0C 2CHWA 4C9BB 1EYHA 1JWFA 4RVBA 4G26A 2LSUA 3Q4AB 3B13A 1NZNA 4XZ4A 2KCKA 1E96B 5M72A 5A6CA 2WXHA 2WQHA 1OUVA 3DBSA 2XCCA 3ASGA 3QJZA 3RRUA 2X6IA 3FTZA 3L13A 4CCAA 1A17A 5T4YA 4GA2A 3LXUX 4DI4A 3ML9A 3JYSA 4HLEA 4BFRA 3PRZA 4G23A 3NF1A 4I9CA 5G05C 2WMOA 3D9LA 2RD0A 3EDTB 2P58C 4QFVA 3S7FA 2QY7A 2C0LA 3GZ2A 3QOUA 4ILHB 2A5UA 3FY4A 2HR2A 1PAQA 2AW6A 4KZCA 3OXGA 2IONA 1E8XA 4XKCA 4UQYA 4CEMA 5LX8A 2VTBB 1WAO1 3KS2A 1TEZA 2PL2A 2VGXB 2AXUA 3PUJA 2EQXA 3CHSA 4XKBA 5G04C 4C0MA 3PZDA 4JC8A 3TJPA 4HOSA 2WQ7A 3PS6A 3OAWA 4HS2A 3L6AA 1H2TC 3RKVA 5EKQD 5CCLA 4APFA 3ZN3A 4ATGA 5T3RA 2R5SA 5AJLA 1EPUA 1IQUA 3L08A 2L6JA 4P29A 5LCWJ 2WM9A 3CHMA 3ZW3A 3PNLB 3CVPA 4KYOB 4GZDA 2L9BA 5BV1A 3LDZA 1ELWA 3UX4A 2CG2A 4EQFA 2FF4A 3L16A 4ANXA 4KXKB 2BF0X 4B8CB 4ACLA 3K9IA 2I9CA 5LOZA 5ARGA 5E75A 2UWJG 2M63A 5BT1A 2Q7FA 4BT9A 3I3NA 2V0PA 2CFZA 3TL5A 2I2OA 3FUHA 2XGMA 4CDMA 3OXFA 3LJ3A 5FT9A 2KZTA 3UT4A 4L2YA 3FULA 3I5PA 3IBEA 3MA5A 4LERA 4KZ0A 5A7DB 3VTYA 3ZYLA 4B94A 3ZIMA 4HOQA 1FVFA 2VGXA 3CVVA 4GB9A 3LS8A 4I2ZA 2VYIA 3SD5A 2IOLA 4CDRA 3D3MA 4IRUA 3P1UA 4IN3B 3CK9A 1IHGA 3FH7A 4J6IA 3FUDA 4FC8A 3RO2A 2XPZA 3D9OA 4UWGA 3UT8A 4I6JA 5FZRA 4JA7A 3GZSA 4N3AA 3FUFA 4UQXA 2A4ZA 2HYZA 1NA3A 2Y4UA 3ZRHA 1XGWA 4DLOA 4Q94A 1ELKA 3FTUA 5CCMA 4GAAA 2PQNA 3FUNA 1W3BA 5G04J 4XE0A 3FFLA 4NURA 3RO3A 3D9IA 3SFZA 4ANVA 5A23A 3TG5A 2IFUA 4TV3A 2CG3A 4FHJA 4U0ZA 2OVFA 4ILGA 3D9MA 4A3VA 5C1DA 2NSZA 4BX8A 4I1OB 5FJYA 3QARA 4I17A 3I4RB 2PM6A 3FUMA 2FO7A 1INZA 3QWVA 1HG5A 2Y3AA 5JJ6A 3SGHA 4F3VA 4WWOA 4Y6WA 3O48A 2IF4A 3PE4A 2V4LA 3FDHA 3FEXA 4K0RA 4TRQA 5J90A 1JUQA 4UQZA 3LKUA 4W9RA 4ANUA 2Y4TA 1IQRA 2ONDA 4B8AA 4FADA 4HORA 2VGYA 2IQCA 2VSYA 3HVEB 3O4ZA 4UWHA 4ANWA 3APDA 4GA1A 4U0SA 1QQEA 4KVOA 1QZ2A 2ZU6B 2CHXA 3ZYKA 1ELRA 2BTDA 2YINA 1HS6A 3FUIA 2CHZA 3CEQA 3MKQB 4UWLA 5G55A 5CMWA 5CHEE 1HF8A 3PDNA 3FUKA 3UUXA 1U3DA 3S7BA 5KJKA 3S7JA 3CVWA 1UN9A 2I1JA 3TAXA 3P2BA 3FTWA 3LYAA 4NRHB 1ZU2A 5AENA 4CGWA 3CKBA 4AY5A 3CK8A 2OOEA 1Z3XA 4EZLA 3JQ1A 4O6FA 5DBKA 3G2VA 4DJAA 4L1BA 1DVPA 1MQSA 1SZAA 1VDYA 2YHCA 3ONLA 4MS6A 3NZUA 4GYWA 3Q49B 4PUCA 4KVMA 2IU1A 4GCNA 3FHEA 3CSTA 4WAFA 4I2WA 4XI9A 2DCPA 4E6HA 4F1SA 5ARFA 3ZEFA 4URKA 3FH8A 5LFAA 3PNTB 3CHOA 3BG1B 3FP3A 4GMJA 2VSNA 3ZHEB 4L7TA 4WWNA 3T8MA 5FTPA 2KATA 3CHQA 5HI7A 3ESLA 3QKYA 3ONKA 1EF1C 3I4GA 1UN8A 4N5CA 4A1GA 5ANLA 4RSYA 4JZYA 3EJNA 4PS3A 1S0PA 4A3TA 4EZKA 3UQ3A 4FLHA 2WXRA 3FH5A 3SHFA 3LY9A 4BTAA 2MHKA 2WXMA 4FLBA 5EX0A 3RJVA 4OYSA 2GW1A 3D9KA 3JCKC 4Q96A 4J0UA 2WXKA 4YVQC 3CIAA 5FQ6A 5FQ8A 1PY1A 4AIFA 1PC2A 1DNPA 1HXIA 4M3OA 4N3BA 5FZSA 3T5XA 2ILRA 2WB2A 3VLFA 3ZYQA 4BT8A 2PM7A 2WMNA 2YNQA 3SI5A 2YHEA 2WXLA 1BPOA 4U04A 4HOTA 4L2LA 4BX9A 3ULQA 2JEKA 5D0OD 3IKOB 3QC1A 3EIQC 1OWOA 4GZ5A 4MRUA 1SZ9A 1H2VC 1NA0A 2WXJA 3QB2A 3FTYA 3QWPA 4JXTA 2HO1A 2YQ8A 4LEUA 5D0QD 5ENNA 3L54A 3FEYA 4GZ3A 1E7UA 2C0MA 3G2SA 3U4TA 4AV7A 5C2YA 3FU3A 2FULA 1EDUA 2MRIA 3QNKA 4HXIA 4GCOA 3U64A 4NACA 4WNFA 3ZVVA 4DLQA 1QNFA 4FP7A 3CVYA 3CHPA 3QK0A 1E8YA 2E0IA 3SF4A 4U0UA 3CVLA 3HDXA 2VQ2A 3MZLB 3R9AB 4WUYA 1YA0A 4CDNA 1B89A 3MCXA 2R59A 2V8SE 2DBAA 3PEUB 4MLPA 2FEZA 1OWNA 1KT0A 1UJJA 1Y6IA 4HOUA 4RG9A 4B89A 4JEHA 2LO6A 4AM9A 3SNXA 3ML8A 3MX3A 3SBSA 3VTXA 1MHQA 3MKQA 4A1SA 4PDXA 4AJWA 1N52A 1JPLA 3OXLA 4MKTA 4UWKA 2WPVA 3QDNA 1TJCA 4JHRA 5DIZA 3RK6A 2X6KA 3GYZA 3FU5A 2GRMA 3QAQA 4FULA 3FTVA 2KC7A 4U8HA 2X6JA 2L0IA 3TXNA 3TGOA 4WNEA 4YNDA 1X5BA 1NP7A 3G2TA 2XHEA 4GPKA 3UPVA 2C2LA 2WXOA 4PS7A 4R7LA 2I1KA 3IHVA 4J8FA 3S2AA 1HG2A 1E90A 1KLXA 3B7SA 3MV2B 5ANRA 4EZJA 3APFA 3PE3A 5HQ8A 4JA9A 2XEVA 3FU6A 4GU5A 2OVBA 5KCMA 4ACKA 5CMYA 4GMLA 2J49A 3IEGA 2V5FA 1H19A 3MEKA 4G25A 3PREA 2J4BA 4UI9K 2X6HA 4DK5A 3CK7A 3SBTB 1HE8A 1OWMA 4APOA 4CRWA 3E4BA 4J8DA 4OVUA 4XIFA 4N2QA 4F53A 1L5JA 2GRLA 4J8EA 2WVIA 4AOFA 3ASFA 1UG3A 4JL0A 1FVHA 2OV8A 3B7TA 3EHMA 5FZQA 3LEWA 3SZ7A 5BPPA 3ZHEA 4DI3A 4AEZC 4E85A 2VJ8A 3GW4A 2IOSA 4I43A 4I6EA 2J07A 4J8SA 4ME2A 2R17C 5FQ4A 4FA6A 2E2EA 4AXHA 1XNFA 2KZTB 4I1AA 2RG8A 4YVOA 3ASHA 2BUGA 5JHBA 2KCLA 2X3MA 4TUUA 3RRNB 2J9QA 5FQ7A 4XX5A 1OWLA 2AVPA 3CSFA 4WWPA 2XCBA 3MJWA 1N54A 4C0EA 2QFCA 5JJTA 1E8ZA 3ZGQA 3FUJA 4G11A 4Q69A 2WXQA 5G05J 5E76A 3D9JA 2AWIA 4GZCA 4GYYA 3RU0A 1TJFA 5AYWD 2LSVA 2FI7A 3ENEA 4G24A 4G2VA 1E7VA 3PUKA 3Q15A 4K03A 4JHJA 3MGBA 2CFUA 4N3CA 3VLDA 1H6KA 2WXFA 2I6HA 2UY1A 3PEVB 3Q47B 4CT0A 3LCAA 5JJ7A 4JPSA 3IV0A 3CVUA 1Y8MA 4LUNU 3R7QA 3MKRA 4Y6CA 3TXMA 4ABNA 5BUZA 2WXNA 5JHAA 3T5VA 4IYPA 2J4DA 3JUIA 3LPZA 1E8WA 4LCTA 4XI0A 3ASDA 3LVQE 4A55A 3CGHA 1HU3A 3CHRA 3ZXSA 4JHKA 3KD7A 1H0AA 3AU5A 2J08A 4KBQA 4RG6A 3CVQA 4UWFA 2WXIA 5BW8C 2X38A 3BG0B 1WM5A 3U3WA 3MV3B 2VTBA 4AVXA 2XRZA 4CGVA 3IHYA 4BTBA 3PVLA 3AS5A 2AXVA 2NC9A 2WXGA 3UT7A 4ILIA 3URZA 5G2NA 1GW6A 5BNWA 4U07A 4UI9C 4EPZA 4FHKA 4WNDA 2VSXE 3JQ0A 4OVVA 3APCA 4EBAA 3FU0A 4JW1A 3L22A 1Z3YA 3NZSA 4U63A 3VLEA 3ZFWA 5EX3A 3CKCA 1JWGA 3LY7A 1UJKA 4EBAG 4N2SA 3UMVA 1FCHA 3B7UX 3ZYMA 2DIWA 4FJZA 3HIZA 3LVRE 5KJLA 3G2UA 5EDSA 3BEEA 2WXPA 3CQGB 5LP0A 4HFGA 3EHNA 4IULA 2J09A 2VSOE 3OTNA 4GZ6A 4NQ0A 4B0ZA 3FTSA 3HHMA 4PH4B 3WXXA 2MOWA 3B7RL 4FJYA 5AIJA 3KEZA 2FBNA 2X6FA 3GZ1A 1Z6TA 2XRYA 4JEUA 3RIBA 3NQPA 1ZBPA 3HYMB 1KT1A 2XGSA 4L23A 3U9WA 4CT4A 4EECA 3C98A 2PZIA 5T8IA 2XGOA 4I1MA 3RRMB 4KMOA 2NXPA 3LY8A 4F7AA 3FTXA 3Q5MA 5LCWC 2UY1B 2KM4A 2JLBA 2L0TB 2LAIA 5FWQA 1OWPA 4BWRA 1SQMA 5BV0A 4I9EA 2GGFA 2PQRA 3R7RA 3ZPJA 3CVXA 2HM8A 3L17A 2KCVA 3HVEA 1HZ4A 1IYGA 1HO8A 3AS8A 3FWVA 3MYVA 5J08A 1UW4B 5KJMA 1HX8A 2LNIA 3DPDA 3TG4A 2IJGX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCL A;  2J9Q A;  4U04 A;  3RO2 A;  4HOT A;  2XPI A;  3S7D A;  3ULQ A;  5D0O D;  4H7Y A;  4BTA A;  2AVP A;  5FZR A;  4JA7 A;  4N3A A;  4GYO A;  3CV0 A;  4GZ5 A;  4UQX A;  5KJN A;  2XCB A;  2HYZ A;  2Y4U A;  1NA3 A;  1NA0 A;  2QFC A;  3AS4 A;  5JJT A;  1HH8 A;  3QWP A;  2HO1 A;  2YQ8 A;  4LEU A;  3CVN A;  4N39 A;  3QWW A;  5D0Q D;  3ZGQ A;  5CCM A;  5G05 J;  2PQN A;  4GZ3 A;  1W3B A;  2C0M A;  3KAE A;  4UI9 J;  5G04 J;  4GYY A;  3RU0 A;  3U4T A;  4WNG A;  5AYW D;  2LSV A;  3FFL A;  4H7X A;  2FI7 A;  3RO3 A;  4G24 A;  4G2V A;  3Q15 A;  3N71 A;  4GCO A;  4WNF A;  4AY6 A;  1P5Q A;  2IFU A;  3ESK A;  3TG5 A;  4G1T A;  4GA0 A;  4N3C A;  4U0Z A;  3SF4 A;  4U0U A;  5C1D A;  2I6H A;  3CVL A;  2UY1 A;  3Q47 B;  2VQ2 A;  3R9A B;  5FJY A;  4WUY A;  1YA0 A;  3LCA A;  4G26 A;  4I17 A;  2LSU A;  5JJ7 A;  2FO7 A;  3Q4A B;  3QWV A;  1B89 A;  1Y8M A;  2DBA A;  3MKR A;  5JJ6 A;  1NZN A;  4RG9 A;  2FEZ A;  1E96 B;  1KT0 A;  2KCK A;  4Y6W A;  4HOU A;  4Y6C A;  3O48 A;  4ABN A;  4F3V A;  2IF4 A;  5A6C A;  3PE4 A;  5M72 A;  2WQH A;  1OUV A;  2XCC A;  4AM9 A;  4UQZ A;  3ASG A;  3LKU A;  4W9R A;  3LPZ A;  3VTX A;  4XI0 A;  3ASD A;  2Y4T A;  2OND A;  4A1S A;  1A17 A;  4GA2 A;  4HOR A;  3JYS A;  2VGY A;  3OXL A;  3KD7 A;  2VSY A;  4G23 A;  4KBQ A;  4RG6 A;  3NF1 A;  2WPV A;  4I9C A;  5G05 C;  4GA1 A;  3CVQ A;  3QDN A;  1QQE A;  1TJC A;  2P58 C;  3EDT B;  4U0S A;  1WM5 A;  5BW8 C;  3S7F A;  3U3W A;  1QZ2 A;  4JHR A;  5DIZ A;  1ELR A;  2C0L A;  3GYZ A;  3GZ2 A;  3MV3 B;  3CEQ A;  3QOU A;  5CHE E;  2HR2 A;  2KC7 A;  3PDN A;  3UUX A;  4CGV A;  3TGO A;  4WNE A;  3S7B A;  3OXG A;  4YND A;  3S7J A;  4BTB A;  5KJK A;  3AS5 A;  4UQY A;  3UPV A;  4GPK A;  2NC9 A;  2C2L A;  1WAO 1;  3TAX A;  3KS2 A;  4BT8 A;  3URZ A;  2PL2 A;  3LYA A;  4J8F A;  2VGX B;  5BNW A;  4NRH B;  1ZU2 A;  4U07 A;  1KLX A;  4UI9 C;  4WND A;  3MV2 B;  5G04 C;  3CKB A;  4AY5 A;  3CK8 A;  2OOE A;  3PE3 A;  4CGW A;  3ZFW A;  5HQ8 A;  4JA9 A;  2XEV A;  5EX3 A;  3CKC A;  3LY7 A;  4O6F A;  5DBK A;  4HOS A;  3RKV A;  4N2S A;  5EKQ D;  2YHC A;  5CCL A;  1FCH A;  3ZN3 A;  4GYW A;  2R5S A;  3IEG A;  2V5F A;  3MEK A;  4G25 A;  3Q49 B;  4UI9 K;  2L6J A;  5LCW J;  4GCN A;  5KJL A;  3CK7 A;  4KYO B;  3CVP A;  4APO A;  3BEE A;  4I2W A;  4XI9 A;  3E4B A;  3TG4 A;  1ELW A;  5ARF A;  4J8D A;  4NQ0 A;  4GZ6 A;  4EQF A;  4XIF A;  2FF4 A;  3FP3 A;  4N2Q A;  3WXX A;  2VSN A;  3ZHE B;  4KXK B;  2FBN A;  3GZ1 A;  2KAT A;  4J8E A;  5FTP A;  3RIB A;  5HI7 A;  1ZBP A;  3HYM B;  3ASF A;  3K9I A;  3QKY A;  1KT1 A;  2XGS A;  4JL0 A;  2UWJ G;  5ARG A;  4N5C A;  2PZI A;  5FZQ A;  2Q7F A;  4BT9 A;  5BT1 A;  3SZ7 A;  2XGO A;  3ZHE A;  3LY8 A;  2XGM A;  3Q5M A;  5LCW C;  2UY1 B;  3OXF A;  3UQ3 A;  3GW4 A;  5FT9 A;  2JLB A;  4BWR A;  3LY9 A;  4I9E A;  2PQR A;  2MHK A;  4ME2 A;  3MA5 A;  5EX0 A;  5A7D B;  3RJV A;  2GW1 A;  4YVQ C;  3ZPJ A;  4J0U A;  3VTY A;  4B94 A;  4AIF A;  2KCV A;  4HOQ A;  1HZ4 A;  2VGX A;  1PC2 A;  2E2E A;  1IYG A;  1HXI A;  4N3B A;  3AS8 A;  3FWV A;  2VYI A;  4I2Z A;  1XNF A;  5FZS A;  5KJM A;  4I1A A;  4CDR A;  2LNI A;  4YVO A;  3ASH A;  2BUG A;  4IN3 B;  3CK9 A;  1IHG A; 
#chains in the Genus database with same CATH topology
 5AJD A;  2BKG A;  1S63 A;  3U66 A;  2XPI A;  3CQC B;  4HVB A;  4TXP A;  4GYO A;  1HH8 A;  3C3Q A;  1U3C A;  5IY5 E;  5CEA A;  4ZHB A;  5HKP A;  2AXZ A;  3EIJ A;  3ESK A;  4G1T A;  4GA0 A;  3ULE G;  2LSU A;  2BED A;  1NZN A;  5M72 A;  2XCC A;  2ZXW E;  2X6I A;  3FTZ A;  5T4Y A;  4HLE A;  4G23 A;  5AAR A;  4I9C A;  3EDT B;  2P58 C;  2RKK A;  3GZ2 A;  3FY4 A;  4XKC A;  3J5P A;  4UQY A;  4CEM A;  5G04 C;  3CHS A;  2XEE A;  4HS2 A;  1H2T C;  3RKV A;  5EKQ D;  3ZN3 A;  1IQU A;  3L08 A;  5LCW J;  3PNL B;  3CVP A;  4KYO B;  5EN5 D;  2L9B A;  4F1P A;  2CG2 A;  4EQF A;  2I9C A;  2M63 A;  2V5Q C;  2P9K G;  3I3N A;  2V0P A;  4CDM A;  3UT4 A;  4HBD A;  3IBE A;  3DWL G;  3ZIM A;  3EUV A;  4GB9 A;  3W9F A;  3ZXP A;  3LS8 A;  3SD5 A;  4CDR A;  3P1U A;  4IN3 B;  3CK9 A;  1N0R A;  3FUD A;  2XPZ A;  3UT8 A;  4I6J A;  1LD7 A;  5FZR A;  3ABL E;  1BLX B;  1MYO A;  2P2C P;  3L9T A;  2Y4U A;  3ZRH A;  1XGW A;  4DLO A;  4Q94 A;  1ELK A;  4GAA A;  3T8K A;  5A23 A;  1OCR E;  4U0Z A;  5C1D A;  2PM6 A;  3FUM A;  1G3N B;  3QWV A;  1HG5 A;  2Y3A A;  4NIK A;  2XS8 A;  2EIL E;  3PE4 A;  2V4L A;  5J90 A;  3AG2 E;  3LKU A;  2OND A;  3RAU A;  2IQC A;  2VSY A;  3O4Z A;  4ANW A;  4GA1 A;  3TWV A;  4KVO A;  3ZYK A;  5EIB E;  1ELR A;  2BTD A;  3CEQ A;  4UWL A;  5B1B E;  1HF8 A;  1U3D A;  2GRN B;  3S7J A;  3CVW A;  3P2B A;  4NRH B;  4CGW A;  2OOE A;  3UTM A;  4O6F A;  5DBK A;  1DVP A;  2YHC A;  4GYW A;  4BET A;  4GCN A;  2B6C A;  3FH8 A;  3FP3 A;  3ZHE B;  4L7T A;  1JCS A;  4YDW A;  4ATZ D;  1EF1 C;  1UN8 A;  4O1P A;  4BTA A;  2MHK A;  3RJV A;  3D9K A;  2WXK A;  1PY1 A;  1PC2 A;  1DNP A;  4M3O A;  3T5X A;  5H7P A;  1TNU A;  2ILR A;  2WB2 A;  3VLF A;  4BT8 A;  2WMN A;  3SI5 A;  4HOT A;  2XZT G;  4BX9 A;  3ULQ A;  4GZ5 A;  3QB2 A;  5D0Q D;  3L54 A;  3FEY A;  3NOC D;  1K8K G;  3DSU A;  2OCC E;  3CHP A;  2E0I A;  4WUY A;  4CDN A;  1B89 A;  2DBA A;  1KT0 A;  3SNX A;  3ML8 A;  4U8V D;  3MKQ A;  4PDX A;  4MKT A;  2WPV A;  1TJC A;  3RK6 A;  3SQV A;  2X6K A;  2GRM A;  3FTV A;  2KC7 A;  4U8H A;  3AG3 E;  2AJA A;  4GPK A;  2MYO A;  4PS7 A;  4R7L A;  2P9S G;  4J8F A;  3S2A A;  4JB8 P;  3Q78 A;  4GTQ A;  1KLX A;  4EZJ A;  3B7S A;  3MV2 B;  1TN7 A;  4JA9 A;  3ZKJ A;  3FU6 A;  4GU5 A;  5AQA A;  2J49 A;  3MEK A;  1H19 A;  2X6H A;  3CK7 A;  3SBT B;  4OVU A;  4F53 A;  5B1A E;  1L5J A;  1TNY A;  2GRP B;  4AOF A;  3ASO E;  3ASF A;  4JL0 A;  1FVH A;  5EYL A;  4DX2 A;  4E85 A;  2VJ8 A;  1MX4 A;  2R17 C;  2E2E A;  2X3M A;  4TUU A;  2J9Q A;  4XX5 A;  4MBG A;  2AVP A;  2XCB A;  3MJW A;  1N54 A;  4C0E A;  3FUJ A;  4G11 A;  2WXQ A;  5G05 J;  2AWI A;  2F8Y A;  2FI7 A;  4JHJ A;  3MGB A;  2CFU A;  1H6K A;  2WXF A;  1SVX A;  4CT0 A;  3EU5 A;  4JPS A;  1Y8M A;  4LUN U;  1DCE A;  4Y6C A;  5BUZ A;  2R03 A;  4LCT A;  1OCC E;  4RG6 A;  3UIO C;  4BER A;  4UWF A;  4GTS A;  2ZIR A;  3HG0 D;  2BKK B;  3IHY A;  2NC9 A;  2WXG A;  3UT7 A;  3URZ A;  4GTR A;  5G2N A;  3APC A;  3JXI A;  3L22 A;  1Z3Y A;  3ZFW A;  5EX3 A;  4EBA G;  2H6H A;  3B7U X;  1BI8 B;  5KJL A;  2WXP A;  5CBO A;  4HFG A;  3EHN A;  4NQ0 A;  3OTN A;  4B0Z A;  2ETA A;  4PH4 B;  3WXX A;  4HQD A;  3RIB A;  3NQP A;  1N4Q A;  3U9W A;  3FTX A;  3Q5M A;  3LJN A;  4O60 A;  2LAI A;  3ZPJ A;  2HM8 A;  3HVE A;  2XS1 A;  1HO8 A;  3ABM E;  3AS8 A;  3FWV A;  3MYV A;  5J08 A;  3SFX A;  1SA4 A;  4I6G A;  1BI7 B;  4BY6 A;  3CV0 A;  5KJN A;  3D9P A;  3AS4 A;  5CBN A;  4GPM A;  4UI9 J;  2WQ6 A;  5ITZ F;  4DPR A;  4AY6 A;  4LNB A;  3PH0 C;  4C9B B;  4HRM B;  3Q4A B;  3BUA A;  4XZ4 A;  2WQH A;  1OUV A;  3QJZ A;  3RRU A;  3TWU A;  3L13 A;  4DI4 A;  3ML9 A;  3JYS A;  2P9U G;  3UKR G;  3PRZ A;  3NF1 A;  5G05 C;  3D9L A;  3Q79 A;  4YDE A;  4ILH B;  3DST A;  3UM3 A;  4KZC A;  2PL2 A;  4HOS A;  3PS6 A;  5AJL A;  1EPU A;  2L6J A;  4P29 A;  3SFY A;  2WM9 A;  4GZD A;  3LDZ A;  1ELW A;  3UX4 A;  4HNA D;  1N94 A;  4EHM A;  2BF0 X;  4B8C B;  3K9I A;  3AG1 E;  4GMR A;  3TL5 A;  2EIJ E;  3FUH A;  3OXF A;  3LJ3 A;  4L2Y A;  4KZ0 A;  3CVV A;  2VYI A;  3D3M A;  3SO8 A;  3PZ1 A;  4N3A A;  1O5M A;  4CYM D;  3DXM G;  3TG5 A;  2IFU A;  4FHJ A;  4ILG A;  2B0O E;  4BX8 A;  4I1O B;  1INZ A;  4CZ2 D;  4Y6W A;  3C3O A;  3FDH A;  4K0R A;  1JUQ A;  1TN8 A;  2ETB A;  3V79 K;  4ANU A;  4W9R A;  1IQR A;  1K1A A;  4B8A A;  3B7B A;  2VGY A;  3HVE B;  1MZC A;  2CHX A;  3MKQ B;  5G55 A;  5CMW A;  5CHE E;  3TWW A;  1MX2 A;  5ENO D;  1UN9 A;  1KZP A;  3TAX A;  1JCQ A;  1QBQ A;  3CK8 A;  1Z3X A;  4EZL A;  1VDY A;  1SZA A;  3NZU A;  3Q49 B;  4PUC A;  2IU1 A;  2GRQ B;  4I2W A;  1FT2 A;  4XI9 A;  2Y69 E;  3Q7F A;  4F1S A;  5ARF A;  3ZEF A;  4URK A;  5LFA A;  5HRY A;  3PNT B;  4J7W A;  2VSN A;  2XEH A;  4L9P A;  4WWN A;  3DXK G;  1MJ0 A;  4N5C A;  5ANL A;  4RSY A;  3UQ3 A;  2WXR A;  2WXM A;  4FLB A;  5EX0 A;  4BSZ B;  2GW1 A;  4Q96 A;  1IKN D;  4AIF A;  3KSL A;  4HRL A;  3ZYQ A;  1TNB A;  2YNQ A;  2YHE A;  1BPO A;  4K5A B;  4GTO A;  2LXL A;  1OWO A;  4MRU A;  1NA0 A;  3FTY A;  3QWP A;  5CRV A;  2HO1 A;  2YQ8 A;  3R9M A;  2DWZ A;  3G2S A;  1OXJ A;  4AV7 A;  2FUL A;  4HXI A;  3ZVV A;  3U64 A;  4GCO A;  4NAC A;  4WNF A;  1QNF A;  3CVY A;  3QK0 A;  3ZU7 B;  3CVL A;  3HDX A;  3R9A B;  1YA0 A;  3MCX A;  4GTP A;  1Z5S C;  2V8S E;  3PZ2 A;  4RG9 A;  1OWN A;  1UJJ A;  4HOU A;  4JEH A;  3T9K A;  2LO6 A;  4HRN A;  3MX3 A;  4O1O A;  1MHQ A;  2FO1 E;  4AJW A;  3OXL A;  5JMN D;  2HE0 A;  1LTX A;  3GYZ A;  3QAQ A;  1H6O A;  3TGO A;  4F6R D;  1NP7 A;  1UOH A;  2XHE A;  3V2O A;  2WXO A;  4K5B A;  4RLY A;  1IXV A;  3APF A;  2XEV A;  2OVB A;  5KCM A;  2GRO B;  3UIP C;  4UI9 K;  4G25 A;  2J4B A;  1OWM A;  3E4B A;  4XIF A;  4N2Q A;  3UXG A;  4LNU D;  2OV8 A;  5EYP F;  5FZQ A;  3LEW A;  5BPP A;  4AEZ C;  2IOS A;  1U2V G;  4I6E A;  4J8S A;  4ME2 A;  1WG0 A;  3TWR A;  1XNF A;  4YVO A;  5JHB A;  1X81 A;  3BU8 A;  5JJT A;  1E8Z A;  4Q69 A;  3D9J A;  4GZC A;  4GYY A;  5AYW D;  4G2V A;  1E7V A;  5AAO A;  3VLD A;  2UY1 A;  3Q47 B;  3LCA A;  1OT8 A;  2ZGG A;  3WG7 E;  2IY0 C;  4ABN A;  1TYQ G;  5KNG A;  3JUI A;  4LG6 A;  2Y1L E;  4A55 A;  3CGH A;  1HU3 A;  3CHR A;  3KD7 A;  1H0A A;  2J08 A;  2X38 A;  4AVX A;  1YCS B;  3TWQ A;  4BTB A;  3PZ4 A;  1GW6 A;  4EPZ A;  4FHK A;  4OVV A;  4EBA A;  3VLE A;  3CKC A;  1N11 A;  2J8S D;  1UJK A;  3UMV A;  4FJZ A;  3HRA A;  2F37 A;  3G2U A;  1SW6 A;  5EDS A;  3CQG B;  3DSV A;  5LP0 A;  3FTS A;  3HHM A;  2F8X K;  1Z6T A;  4EEC A;  2XGS A;  2PZI A;  5T8I A;  3SY2 A;  2XGO A;  3RRM B;  1BU9 A;  2UY1 B;  2KM4 A;  2JLB A;  2NYJ A;  3Q75 A;  5BV0 A;  3L17 A;  5D2M C;  1WDY A;  3HXB A;  3TG4 A;  2IJG X;  4BSX A;  1LF8 A;  4H7Y A;  4V3I A;  1WY6 A;  4PS8 A;  1H2U A;  4N39 A;  3CVN A;  3QWW A;  2XQ0 A;  3KAE A;  3L82 A;  4WNG A;  4JVS A;  4H7X A;  4K5C A;  4LRZ A;  2DZO A;  1P5Q A;  3AU4 A;  3PZ3 A;  3UM0 A;  2CHW A;  1EYH A;  1JWF A;  1YYH A;  3JUE A;  1NI1 A;  2KCK A;  1E96 B;  1V54 E;  5A6C A;  3AAA C;  3DBS A;  4CCA A;  1A17 A;  3LXU X;  4BFR A;  3DSX A;  2WMO A;  4QFV A;  2QY7 A;  3QOU A;  1NFI E;  2HR2 A;  1PAQ A;  3OXG A;  2ION A;  1E8X A;  5LX8 A;  1WAO 1;  2PNN A;  3KS2 A;  1TEZ A;  3PUJ A;  2EQX A;  2JAB A;  4C0M A;  3PZD A;  4JC8 A;  3TJP A;  3L6A A;  5CCL A;  4ATG A;  2R5S A;  4ZFH A;  4LNG A;  3ZW3 A;  3CHM A;  4ANX A;  4KXK B;  4ACL A;  3TWT A;  2Q7F A;  4BT9 A;  2P9I G;  2I2O A;  3E33 A;  3Q9U C;  2KZT A;  5JA4 D;  3I5P A;  3MA5 A;  5A7D B;  3VTY A;  3ZYL A;  1FPP A;  4B94 A;  4HOQ A;  1FVF A;  2VGX A;  1N9A A;  2IEJ A;  4I2Z A;  2IOL A;  4IRU A;  3FH7 A;  4J6I A;  2RFM A;  3RO2 A;  3FUF A;  3Q73 A;  4UQX A;  1S64 A;  4DUI A;  2PQN A;  3FUN A;  1W3B A;  5G04 J;  5KWD A;  4XE0 A;  3FFL A;  4NUR A;  3D9I A;  3SFZ A;  4TXQ A;  4TV3 A;  3D9M A;  3QAR A;  4I17 A;  3I4R B;  1O1R A;  5JJ6 A;  2GRR B;  3O48 A;  2IF4 A;  4C48 B;  1TN6 A;  4OAV B;  4DX7 D;  4UQZ A;  2Y4T A;  4HOR A;  4UWH A;  2QC9 A;  1QQE A;  4M7C A;  3FUI A;  2CHZ A;  3FUK A;  3UUX A;  1O1S A;  2I1J A;  3CKB A;  4AY5 A;  3G2V A;  4L1B A;  2IO3 C;  4KVM A;  3FHE A;  3CST A;  4WAF A;  4E6H A;  3ZUV B;  3BG1 B;  5BXU A;  5FTP A;  2KAT A;  3CHQ A;  5HI7 A;  3I4G A;  4A1G A;  2DVW A;  1S0P A;  4A3T A;  4EZK A;  4FLH A;  3FH5 A;  3SHF A;  4OYS A;  4YVQ C;  3JCK C;  3Q7A A;  4J0U A;  5FQ6 A;  3CIA A;  5FQ8 A;  4N3B A;  2PM7 A;  2WXL A;  4U04 A;  2JEK A;  5D0O D;  4LSZ E;  2WXJ A;  1H2V C;  4JXT A;  4LEU A;  1LD8 A;  5ENN A;  1E7U A;  1OCO E;  2C0M A;  1RZ4 A;  5AQ9 A;  4A63 B;  3FU3 A;  3QNK A;  1OY3 D;  4DLQ A;  2VGE A;  1E8Y A;  1D9S A;  2VQ2 A;  3MZL B;  3E32 A;  2R59 A;  3PEU B;  4MLP A;  2FEZ A;  1Y6I A;  4B89 A;  5CED B;  4OAU C;  3NOG D;  2EIN E;  3VTX A;  5ENR D;  3QDN A;  4TUM A;  5DIZ A;  2X6J A;  3TXN A;  4WNE A;  5B3S E;  3G2T A;  3UPV A;  2C2L A;  1E90 A;  5HQ8 A;  4ACK A;  4GML A;  3IEG A;  1K1B A;  3NAW A;  3E30 A;  1Q2Z A;  2GRL A;  4J8E A;  1D8D A;  1UG3 A;  4J8Y A;  3EHM A;  3DEO A;  1N4P A;  4DX6 D;  3GW4 A;  4I43 A;  3JXJ A;  5AN8 A;  5FQ4 A;  5CER B;  4AXH A;  4I1A A;  2EIM E;  2RG8 A;  2BUG A;  3V2X A;  5FQ7 A;  1OWL A;  3CSF A;  4WWP A;  2QFC A;  3ZGQ A;  4U7E B;  3AG4 E;  3RU0 A;  4GTV A;  4G24 A;  3Q15 A;  4N3C A;  2I6H A;  5D66 A;  5JJ7 A;  3IV0 A;  3ZNG A;  3RSE G;  3R7Q A;  3MKR A;  4DX1 A;  5JHA A;  4XI0 A;  3UM2 A;  3ASD A;  1BD8 A;  3ZXS A;  4JHK A;  3CVQ A;  5BW8 C;  3BG0 B;  3U3W A;  3MV3 B;  2XRZ A;  2XEN A;  3DEP A;  3AS5 A;  4UI9 C;  4WND A;  2VSX E;  3JQ0 A;  4JW1 A;  1NL4 A;  4HI8 A;  3LY7 A;  1JWG A;  2LXM A;  1FCH A;  1N0Q A;  5HS0 A;  4IUL A;  2J09 A;  2VSO E;  4GZ6 A;  3B7R L;  4FJY A;  3KEZ A;  4YDY A;  3GZ1 A;  2LUH A;  1YMP A;  3C5R A;  3HYM B;  3KEA A;  4L23 A;  3C98 A;  4HLL A;  4I1M A;  4F7A A;  2L0T B;  1OWP A;  1SQM A;  4I9E A;  4U8Y D;  3R7R A;  3CVX A;  3E34 A;  2KCV A;  2ETC A;  1HZ4 A;  2R05 A;  3TWX A;  1IYG A;  5ENS D;  1UW4 B;  2LNI A;  3HXF A;  4B93 B;  1S70 B;  4KT6 B;  3UIN C;  2XPY A;  3S7D A;  4AP2 A;  2H6G A;  2LAH A;  1A5E A;  3FUE A;  1HFA A;  4D10 C;  3DSW A;  3W9G A;  1RW2 A;  3N71 A;  3D9N A;  4KMO A;  3CLJ A;  3G2W A;  3ISM C;  4FU3 A;  3J5Q B;  1TNZ A;  3CR3 A;  3HXD A;  4RVB A;  4G26 A;  3UI2 A;  3B13 A;  2WXH A;  3HXE A;  2KBX A;  3DSS A;  3ASG A;  4GA2 A;  1K3Z D;  2RD0 A;  3S7F A;  2C0L A;  2A5U A;  3E37 A;  3V31 A;  1V55 E;  2AW6 A;  2VTB B;  2QYJ A;  2VGX B;  2AXU A;  4XKB A;  2P9L G;  2DYS E;  1MX6 A;  2WQ7 A;  1FT1 A;  3OAW A;  2QYU A;  5FIN A;  3ULY A;  5EIL A;  5BXO A;  4APF A;  5T3R A;  2OEW A;  4BES A;  1QYM A;  5BV1 A;  2FF4 A;  3L16 A;  3UM1 A;  5LOZ A;  5ARG A;  5E75 A;  2UWJ G;  5BT1 A;  2P9N G;  2CFZ A;  1KZO A;  2XGM A;  3EHQ A;  5FT9 A;  2OEV A;  3FUL A;  4LER A;  4GTT A;  2EIK E;  3X2Q E;  1IHG A;  4FC8 A;  3D9O A;  3UKU G;  3TWS A;  4UWG A;  4JA7 A;  3GZS A;  2A4Z A;  2HYZ A;  1NA3 A;  3FTU A;  5CCM A;  2IO2 C;  3RO3 A;  4ANV A;  5CEC B;  2CG3 A;  2OVF A;  4A3V A;  2NSZ A;  5FJY A;  1ZB1 A;  2FO7 A;  3SGH A;  4F3V A;  4WWO A;  4TRQ A;  3FEX A;  4FAD A;  3APD A;  4U0S A;  4U95 D;  1QZ2 A;  2ZU6 B;  2YIN A;  1HS6 A;  1O1T A;  3PDN A;  3D9H A;  3S7B A;  5KJK A;  3FTW A;  3LYA A;  1ZU2 A;  5AEN A;  5ENQ D;  4DX5 D;  3JQ1 A;  4DJA A;  1MQS A;  3ONL A;  4MS6 A;  4UUC A;  3ABK E;  2DCP A;  3CHO A;  1N95 A;  4GMJ A;  4X8Q A;  4GTM A;  3T8M A;  3ESL A;  3QKY A;  3ONK A;  4JZY A;  3EJN A;  4PS3 A;  3KSQ A;  3LY9 A;  4HI9 A;  2H6I A;  5ENT D;  1HXI A;  5FZS A;  2DZN A;  4G8L A;  4L2L A;  1N4S A;  4BEP A;  3IKO B;  2L6B A;  3QC1 A;  3EIQ C;  1AWC B;  3ASN E;  1SZ9 A;  1TNO A;  4GZ3 A;  1KPS B;  3EHR A;  3U4T A;  5C2Y A;  1EDU A;  2MRI A;  2V4H C;  4FP7 A;  3SF4 A;  3C72 A;  4JD2 G;  4U0U A;  2R02 A;  4AM9 A;  3SBS A;  3DPY A;  1TR4 A;  4A1S A;  1N52 A;  1JPL A;  4UWK A;  5AQB A;  2DYR E;  4JHR A;  3FU5 A;  4FUL A;  2L0I A;  4YND A;  1X5B A;  4QQI A;  5KNH D;  2I1K A;  3IHV A;  2QZA A;  3V30 A;  3B95 A;  3HXC A;  2XZD G;  5CRU A;  1HG2 A;  5ANR A;  3PE3 A;  3C3R A;  5CMY A;  2V5F A;  3PRE A;  4U96 D;  4DK5 A;  1HE8 A;  4APO A;  4CRW A;  4J8D A;  2F0Y A;  1DC2 A;  2WVI A;  4DRX E;  5AQ7 A;  1OCZ E;  3B7T A;  4Z68 A;  3SZ7 A;  3ZHE A;  4DI3 A;  3BQO A;  2J07 A;  2ZGD A;  4FA6 A;  1AP7 A;  3NB2 A;  2KZT B;  3ASH A;  2Y0B G;  2KCL A;  3AJI A;  3RRN B;  5E76 A;  5EID A;  2ZIS A;  1TJF A;  2LSV A;  3ENE A;  3F6Q A;  4K03 A;  3PUK A;  3PEV B;  3CVU A;  3TXM A;  4G8K A;  3EU9 A;  2WXN A;  3T5V A;  4IYP A;  2J4D A;  4XEI G;  3LPZ A;  1E8W A;  1SA5 A;  3LVQ E;  4YDO A;  1D8E A;  2RFA A;  3AU5 A;  4KBQ A;  4RQI A;  2WXI A;  1WM5 A;  2KXP C;  2VTB A;  4CGV A;  5FIO A;  3PVL A;  2AXV A;  5ENP D;  4ILI A;  1IHB A;  5BNW A;  5KBA A;  4U07 A;  3IXE A;  1JCR A;  3FU0 A;  4U63 A;  3NZS A;  1N4R A;  4N2S A;  3ZYM A;  2DIW A;  3HIZ A;  3LVR E;  3NBN B;  2H6F A;  3BEE A;  5AIJ A;  2MOW A;  2A5E A;  2FBN A;  2X6F A;  2XRY A;  4JEU A;  1ZBP A;  1KT1 A;  4CT4 A;  2R2L A;  3Q9N C;  2NXP A;  1DCQ A;  2P9P G;  3LY8 A;  5LCW C;  4HB5 A;  5FWQ A;  4BWR A;  2GGF A;  2PQR A;  3DRA A;  1H6P A;  4N5Q A;  4TXR A;  5KJM A;  1HX8 A;  3DPD A; 
#chains in the Genus database with same CATH homology
 4BSX A;  5AJD A;  4KT6 B;  2XPY A;  3U66 A;  1LF8 A;  2XPI A;  3S7D A;  3CQC B;  4H7Y A;  4V3I A;  4AP2 A;  4I6G A;  4HVB A;  4BY6 A;  1WY6 A;  4GYO A;  4PS8 A;  2LAH A;  3CV0 A;  5KJN A;  3D9P A;  1H2U A;  3AS4 A;  1HH8 A;  3FUE A;  4N39 A;  1HFA A;  3CVN A;  3QWW A;  1U3C A;  2XQ0 A;  4D10 C;  3KAE A;  4UI9 J;  2WQ6 A;  4WNG A;  4JVS A;  4H7X A;  4LRZ A;  3N71 A;  3D9N A;  4DPR A;  4AY6 A;  1P5Q A;  2AXZ A;  3AU4 A;  3CLJ A;  3EIJ A;  3ESK A;  3G2W A;  4FU3 A;  4G1T A;  4GA0 A;  3CR3 A;  3PH0 C;  2CHW A;  4C9B B;  1EYH A;  1JWF A;  4RVB A;  4G26 A;  2LSU A;  3Q4A B;  3B13 A;  1NZN A;  4XZ4 A;  2KCK A;  1E96 B;  5M72 A;  5A6C A;  2WXH A;  2WQH A;  1OUV A;  3DBS A;  2XCC A;  3ASG A;  3QJZ A;  3RRU A;  2X6I A;  3FTZ A;  3L13 A;  4CCA A;  1A17 A;  5T4Y A;  4GA2 A;  3LXU X;  4DI4 A;  3ML9 A;  3JYS A;  4HLE A;  4BFR A;  3PRZ A;  4G23 A;  3NF1 A;  4I9C A;  5G05 C;  2WMO A;  3D9L A;  2RD0 A;  3EDT B;  2P58 C;  4QFV A;  3S7F A;  2QY7 A;  2C0L A;  3GZ2 A;  3QOU A;  4ILH B;  2A5U A;  3FY4 A;  2HR2 A;  1PAQ A;  2AW6 A;  4KZC A;  3OXG A;  2ION A;  1E8X A;  4XKC A;  4UQY A;  4CEM A;  5LX8 A;  2VTB B;  1WAO 1;  3KS2 A;  1TEZ A;  2PL2 A;  2VGX B;  2AXU A;  3PUJ A;  2EQX A;  3CHS A;  4XKB A;  5G04 C;  4C0M A;  3PZD A;  4JC8 A;  3TJP A;  4HOS A;  2WQ7 A;  3PS6 A;  3OAW A;  4HS2 A;  3L6A A;  1H2T C;  3RKV A;  5EKQ D;  5CCL A;  4APF A;  3ZN3 A;  4ATG A;  5T3R A;  2R5S A;  5AJL A;  1EPU A;  1IQU A;  3L08 A;  2L6J A;  4P29 A;  5LCW J;  2WM9 A;  3CHM A;  3ZW3 A;  3PNL B;  3CVP A;  4KYO B;  4GZD A;  2L9B A;  5BV1 A;  3LDZ A;  1ELW A;  3UX4 A;  2CG2 A;  4EQF A;  2FF4 A;  3L16 A;  4ANX A;  4KXK B;  2BF0 X;  4B8C B;  4ACL A;  3K9I A;  2I9C A;  5LOZ A;  5ARG A;  5E75 A;  2UWJ G;  2M63 A;  5BT1 A;  2Q7F A;  4BT9 A;  3I3N A;  2V0P A;  2CFZ A;  3TL5 A;  2I2O A;  3FUH A;  2XGM A;  4CDM A;  3OXF A;  3LJ3 A;  5FT9 A;  2KZT A;  3UT4 A;  4L2Y A;  3FUL A;  3I5P A;  3IBE A;  3MA5 A;  4LER A;  4KZ0 A;  5A7D B;  3VTY A;  3ZYL A;  4B94 A;  3ZIM A;  4HOQ A;  1FVF A;  2VGX A;  3CVV A;  4GB9 A;  3LS8 A;  4I2Z A;  2VYI A;  3SD5 A;  2IOL A;  4CDR A;  3D3M A;  4IRU A;  3P1U A;  4IN3 B;  3CK9 A;  1IHG A;  3FH7 A;  4J6I A;  3FUD A;  4FC8 A;  3RO2 A;  2XPZ A;  3D9O A;  4UWG A;  3UT8 A;  4I6J A;  5FZR A;  4JA7 A;  3GZS A;  4N3A A;  3FUF A;  4UQX A;  2A4Z A;  2HYZ A;  1NA3 A;  2Y4U A;  3ZRH A;  1XGW A;  4DLO A;  4Q94 A;  1ELK A;  3FTU A;  5CCM A;  4GAA A;  2PQN A;  3FUN A;  1W3B A;  5G04 J;  4XE0 A;  3FFL A;  4NUR A;  3RO3 A;  3D9I A;  3SFZ A;  4ANV A;  5A23 A;  3TG5 A;  2IFU A;  4TV3 A;  2CG3 A;  4FHJ A;  4U0Z A;  2OVF A;  4ILG A;  3D9M A;  4A3V A;  5C1D A;  2NSZ A;  4BX8 A;  4I1O B;  5FJY A;  3QAR A;  4I17 A;  3I4R B;  2PM6 A;  3FUM A;  2FO7 A;  1INZ A;  3QWV A;  1HG5 A;  2Y3A A;  5JJ6 A;  3SGH A;  4F3V A;  4WWO A;  4Y6W A;  3O48 A;  2IF4 A;  3PE4 A;  2V4L A;  3FDH A;  3FEX A;  4K0R A;  4TRQ A;  5J90 A;  1JUQ A;  4UQZ A;  3LKU A;  4W9R A;  4ANU A;  2Y4T A;  1IQR A;  2OND A;  4B8A A;  4FAD A;  4HOR A;  2VGY A;  2IQC A;  2VSY A;  3HVE B;  3O4Z A;  4UWH A;  4ANW A;  3APD A;  4GA1 A;  4U0S A;  1QQE A;  4KVO A;  1QZ2 A;  2ZU6 B;  2CHX A;  3ZYK A;  1ELR A;  2BTD A;  2YIN A;  1HS6 A;  3FUI A;  2CHZ A;  3CEQ A;  3MKQ B;  4UWL A;  5G55 A;  5CMW A;  5CHE E;  1HF8 A;  3PDN A;  3FUK A;  3UUX A;  1U3D A;  3S7B A;  5KJK A;  3S7J A;  3CVW A;  1UN9 A;  2I1J A;  3TAX A;  3P2B A;  3FTW A;  3LYA A;  4NRH B;  1ZU2 A;  5AEN A;  4CGW A;  3CKB A;  4AY5 A;  3CK8 A;  2OOE A;  1Z3X A;  4EZL A;  3JQ1 A;  4O6F A;  5DBK A;  3G2V A;  4DJA A;  4L1B A;  1DVP A;  1MQS A;  1SZA A;  1VDY A;  2YHC A;  3ONL A;  4MS6 A;  3NZU A;  4GYW A;  3Q49 B;  4PUC A;  4KVM A;  2IU1 A;  4GCN A;  3FHE A;  3CST A;  4WAF A;  4I2W A;  4XI9 A;  2DCP A;  4E6H A;  4F1S A;  5ARF A;  3ZEF A;  4URK A;  3FH8 A;  5LFA A;  3PNT B;  3CHO A;  3BG1 B;  3FP3 A;  4GMJ A;  2VSN A;  3ZHE B;  4L7T A;  4WWN A;  3T8M A;  5FTP A;  2KAT A;  3CHQ A;  5HI7 A;  3ESL A;  3QKY A;  3ONK A;  1EF1 C;  3I4G A;  1UN8 A;  4N5C A;  4A1G A;  5ANL A;  4RSY A;  4JZY A;  3EJN A;  4PS3 A;  1S0P A;  4A3T A;  4EZK A;  3UQ3 A;  4FLH A;  2WXR A;  3FH5 A;  3SHF A;  3LY9 A;  4BTA A;  2MHK A;  2WXM A;  4FLB A;  5EX0 A;  3RJV A;  4OYS A;  2GW1 A;  3D9K A;  3JCK C;  4Q96 A;  4J0U A;  2WXK A;  4YVQ C;  3CIA A;  5FQ6 A;  5FQ8 A;  1PY1 A;  4AIF A;  1PC2 A;  1DNP A;  1HXI A;  4M3O A;  4N3B A;  5FZS A;  3T5X A;  2ILR A;  2WB2 A;  3VLF A;  3ZYQ A;  4BT8 A;  2PM7 A;  2WMN A;  2YNQ A;  3SI5 A;  2YHE A;  2WXL A;  1BPO A;  4U04 A;  4HOT A;  4L2L A;  4BX9 A;  3ULQ A;  2JEK A;  5D0O D;  3IKO B;  3QC1 A;  3EIQ C;  1OWO A;  4GZ5 A;  4MRU A;  1SZ9 A;  1H2V C;  1NA0 A;  2WXJ A;  3QB2 A;  3FTY A;  3QWP A;  4JXT A;  2HO1 A;  2YQ8 A;  4LEU A;  5D0Q D;  5ENN A;  3L54 A;  3FEY A;  4GZ3 A;  1E7U A;  2C0M A;  3G2S A;  3U4T A;  4AV7 A;  5C2Y A;  3FU3 A;  2FUL A;  1EDU A;  2MRI A;  3QNK A;  4HXI A;  4GCO A;  3U64 A;  4NAC A;  4WNF A;  3ZVV A;  4DLQ A;  1QNF A;  4FP7 A;  3CVY A;  3CHP A;  3QK0 A;  1E8Y A;  2E0I A;  3SF4 A;  4U0U A;  3CVL A;  3HDX A;  2VQ2 A;  3MZL B;  3R9A B;  4WUY A;  1YA0 A;  4CDN A;  1B89 A;  3MCX A;  2R59 A;  2V8S E;  2DBA A;  3PEU B;  4MLP A;  2FEZ A;  1OWN A;  1KT0 A;  1UJJ A;  1Y6I A;  4HOU A;  4RG9 A;  4B89 A;  4JEH A;  2LO6 A;  4AM9 A;  3SNX A;  3ML8 A;  3MX3 A;  3SBS A;  3VTX A;  1MHQ A;  3MKQ A;  4A1S A;  4PDX A;  4AJW A;  1N52 A;  1JPL A;  3OXL A;  4MKT A;  4UWK A;  2WPV A;  3QDN A;  1TJC A;  4JHR A;  5DIZ A;  3RK6 A;  2X6K A;  3GYZ A;  3FU5 A;  2GRM A;  3QAQ A;  4FUL A;  3FTV A;  2KC7 A;  4U8H A;  2X6J A;  2L0I A;  3TXN A;  3TGO A;  4WNE A;  4YND A;  1X5B A;  1NP7 A;  3G2T A;  2XHE A;  4GPK A;  3UPV A;  2C2L A;  2WXO A;  4PS7 A;  4R7L A;  2I1K A;  3IHV A;  4J8F A;  3S2A A;  1HG2 A;  1E90 A;  1KLX A;  3B7S A;  3MV2 B;  5ANR A;  4EZJ A;  3APF A;  3PE3 A;  5HQ8 A;  4JA9 A;  2XEV A;  3FU6 A;  4GU5 A;  2OVB A;  5KCM A;  4ACK A;  5CMY A;  4GML A;  2J49 A;  3IEG A;  2V5F A;  1H19 A;  3MEK A;  4G25 A;  3PRE A;  2J4B A;  4UI9 K;  2X6H A;  4DK5 A;  3CK7 A;  3SBT B;  1HE8 A;  1OWM A;  4APO A;  4CRW A;  3E4B A;  4J8D A;  4OVU A;  4XIF A;  4N2Q A;  4F53 A;  1L5J A;  2GRL A;  4J8E A;  2WVI A;  4AOF A;  3ASF A;  1UG3 A;  4JL0 A;  1FVH A;  2OV8 A;  3B7T A;  3EHM A;  5FZQ A;  3LEW A;  3SZ7 A;  5BPP A;  3ZHE A;  4DI3 A;  4AEZ C;  4E85 A;  2VJ8 A;  3GW4 A;  2IOS A;  4I43 A;  4I6E A;  2J07 A;  4J8S A;  4ME2 A;  2R17 C;  5FQ4 A;  4FA6 A;  2E2E A;  4AXH A;  1XNF A;  2KZT B;  4I1A A;  2RG8 A;  4YVO A;  3ASH A;  2BUG A;  5JHB A;  2KCL A;  2X3M A;  4TUU A;  3RRN B;  2J9Q A;  5FQ7 A;  4XX5 A;  1OWL A;  2AVP A;  3CSF A;  4WWP A;  2XCB A;  3MJW A;  1N54 A;  4C0E A;  2QFC A;  5JJT A;  1E8Z A;  3ZGQ A;  3FUJ A;  4G11 A;  4Q69 A;  2WXQ A;  5G05 J;  5E76 A;  3D9J A;  2AWI A;  4GZC A;  4GYY A;  3RU0 A;  1TJF A;  5AYW D;  2LSV A;  2FI7 A;  3ENE A;  4G24 A;  4G2V A;  1E7V A;  3PUK A;  3Q15 A;  4K03 A;  4JHJ A;  3MGB A;  2CFU A;  4N3C A;  3VLD A;  1H6K A;  2WXF A;  2I6H A;  2UY1 A;  3PEV B;  3Q47 B;  4CT0 A;  3LCA A;  5JJ7 A;  4JPS A;  3IV0 A;  3CVU A;  1Y8M A;  4LUN U;  3R7Q A;  3MKR A;  4Y6C A;  3TXM A;  4ABN A;  5BUZ A;  2WXN A;  5JHA A;  3T5V A;  4IYP A;  2J4D A;  3JUI A;  3LPZ A;  1E8W A;  4LCT A;  4XI0 A;  3ASD A;  3LVQ E;  4A55 A;  3CGH A;  1HU3 A;  3CHR A;  3ZXS A;  4JHK A;  3KD7 A;  1H0A A;  3AU5 A;  2J08 A;  4KBQ A;  4RG6 A;  3CVQ A;  4UWF A;  2WXI A;  5BW8 C;  2X38 A;  3BG0 B;  1WM5 A;  3U3W A;  3MV3 B;  2VTB A;  4AVX A;  2XRZ A;  4CGV A;  3IHY A;  4BTB A;  3PVL A;  3AS5 A;  2AXV A;  2NC9 A;  2WXG A;  3UT7 A;  4ILI A;  3URZ A;  5G2N A;  1GW6 A;  5BNW A;  4U07 A;  4UI9 C;  4EPZ A;  4FHK A;  4WND A;  2VSX E;  3JQ0 A;  4OVV A;  3APC A;  4EBA A;  3FU0 A;  4JW1 A;  3L22 A;  1Z3Y A;  3NZS A;  4U63 A;  3VLE A;  3ZFW A;  5EX3 A;  3CKC A;  1JWG A;  3LY7 A;  1UJK A;  4EBA G;  4N2S A;  3UMV A;  1FCH A;  3B7U X;  3ZYM A;  2DIW A;  4FJZ A;  3HIZ A;  3LVR E;  5KJL A;  3G2U A;  5EDS A;  3BEE A;  2WXP A;  3CQG B;  5LP0 A;  4HFG A;  3EHN A;  4IUL A;  2J09 A;  2VSO E;  3OTN A;  4GZ6 A;  4NQ0 A;  4B0Z A;  3FTS A;  3HHM A;  4PH4 B;  3WXX A;  2MOW A;  3B7R L;  4FJY A;  5AIJ A;  3KEZ A;  2FBN A;  2X6F A;  3GZ1 A;  1Z6T A;  2XRY A;  4JEU A;  3RIB A;  3NQP A;  1ZBP A;  3HYM B;  1KT1 A;  2XGS A;  4L23 A;  3U9W A;  4CT4 A;  4EEC A;  3C98 A;  2PZI A;  5T8I A;  2XGO A;  4I1M A;  3RRM B;  4KMO A;  2NXP A;  3LY8 A;  4F7A A;  3FTX A;  3Q5M A;  5LCW C;  2UY1 B;  2KM4 A;  2JLB A;  2L0T B;  2LAI A;  5FWQ A;  1OWP A;  4BWR A;  1SQM A;  5BV0 A;  4I9E A;  2GGF A;  2PQR A;  3R7R A;  3ZPJ A;  3CVX A;  2HM8 A;  3L17 A;  2KCV A;  3HVE A;  1HZ4 A;  1IYG A;  1HO8 A;  3AS8 A;  3FWV A;  3MYV A;  5J08 A;  1UW4 B;  5KJM A;  1HX8 A;  2LNI A;  3DPD A;  3TG4 A;  2IJG X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...