1OUVA

Helicobacter cysteine rich protein c (hcpc)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
265
structure length
265
Chain Sequence
DPKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFYAKACDLNYSNGCHLLGNLYYSGQGVSQNTNKALQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTKACDLNDGDGCTILGSLYDAGRGTPKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEALARYSKACELENGGGCFNLGAMQYNGEGVTRNEKQAIENFKKGCKLGAKGACDILKQLKIKVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Helicobacter Cysteine-rich Protein C at 2.0A Resolution: Similar Peptide-binding Sites in TPR and SEL1-like Repeat Proteins
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords conserved hypothetical secreted protein
total genus 111
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08238 Sel1 Sel1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ouvA00
3Q15A 2AVPA 5FT9A 2KCLA 1ELWA 2FBNA 3CK9A 2QFCA 2I6HA 2XGMA 2GW1A 4LEUA 1W3BA 4BT9A 3ASDA 1IYGA 2V5FA 2IF4A 2R5SA 3Q4AB 4N2SA 4XI9A 2Y4TA 2XGOA 3ESKA 4G23A 4G2VA 4GZ3A 4XI0A 4UQZA 4B94A 4GPKA 2JLBA 4AY6A 3GZ1A 3ZFWA 3CVNA 2Y4UA 1IHGA 2PZIA 4GCNA 3UUXA 2LNIA 4J8FA 4N39A 2FF4A 4AM9A 2NC9A 2Q7FA 4BTAA 2DBAA 4KXKB 3S7BA 1KT0A 3CK7A 5ARFA 3PE3A 2YHCA 5HI7A 3GW4A 3RIBA 3LCAA 3S7DA 2YQ8A 3ASFA 4GZ6A 4GA0A 4WNEA 3S7JA 3SZ7A 3MKRA 2WPVA 1ZBPA 3TGOA 4U07A 1HH8A 2IFUA 4UQXA 4I17A 4H7YA 3MV2B 3VTYA 3FWVA 4RG6A 4JL0A 4NRHB 4YNDA 3OXGA 5FZSA 4GYOA 2FI7A 4EQFA 4JHRA 1HZ4A 3RJVA 4WUYA 3TAXA 4APOA 3QOUA 3MA5A 3URZA 4HOQA 3O48A 2XEVA 4WNDA 3UQ3A 3QWPA 3MV3B 3N71A 5LCWC 2VGYA 4Y6CA 4O6FA 4U0ZA 3RO2A 3QWVA 2KATA 2J9QA 4CGVA 4G26A 2PL2A 4KYOB 3ZHEB 4AIFA 2VSYA 2HYZA 3BEEA 1P5QA 4U0UA 5M72A 4U0SA 1A17A 1QQEA 2E2EA 4YVOA 5FZQA 5A7DB 3IEGA 2PQNA 5KJLA 3ZPJA 3KAEA 2XCCA 4G25A 3S7FA 4HOSA 4HOTA 3GYZA 2PQRA 1TJCA 2UY1A 4J8EA 2UY1B 3UPVA 3AS8A 4GZ5A 2UWJG 2C0LA 5BT1A 5KJNA 5KJMA 4HORA 2VGXB 2VSNA 4I1AA 4UI9C 2KC7A 2XCBA 3GZ2A 4GCOA 4N3AA 3AS4A 4UI9J 4G1TA 5FJYA 3MEKA 5ARGA 1NZNA 5FTPA 5G05J 3WXXA 3LY9A 5LCWJ 2WQHA 3KD7A 2VYIA 5EX0A 3RU0A 1PC2A 1B89A 1YA0A 2C0MA 2L6JA 3AS5A 3QWWA 4IN3B 4I2ZA 4YVQC 5BW8C 2P58C 3CK8A 4I9CA 5D0OD 4N2QA 4A1SA 3CVPA 3ULQA 2ONDA 5CHEE 2MHKA 5DBKA 4H7XA 5CCMA 3CEQA 1HXIA 3ZGQA 3Q47B 4GYYA 5DIZA 1KLXA 5A6CA 3ASHA 2FO7A 2KCKA 2KCVA 3ASGA 3CKCA 3OXFA 4RG9A 4W9RA 5D0QD 4CDRA 4NQ0A 4BWRA 3EDTB 3FP3A 3Q49B 4N5CA 4J8DA 4N3CA 3CVLA 4XIFA 4U04A 1E96B 4JA9A 1ZU2A 3R9AB 4WNFA 3U4TA 3TG5A 1NA0A 5EKQD 4Y6WA 5JJ6A 1NA3A 1WAO1 2C2LA 1WM5A 3LKUA 2LSVA 3OXLA 4G24A 3NF1A 3ZN3A 4N3BA 5AYWD 3CKBA 3SF4A 2VQ2A 3KS2A 3PDNA 1Y8MA 2OOEA 4BT8A 3LYAA 2FEZA 2HR2A 3HYMB 2BUGA 4I2WA 5G04C 5C1DA 5JJTA 2XGSA 5EX3A 3VTXA 1FCHA 1XNFA 1QZ2A 4UI9K 2LSUA 3CVQA 3PE4A 3Q5MA 4GA2A 3QDNA 4UQYA 5G05C 3TG4A 5BNWA 4CGWA 5HQ8A 1OUVA 3RKVA 2VGXA 4ABNA 4GYWA 3U3WA 4HOUA 1ELRA 3CV0A 4GA1A 4JA7A 4KBQA 5CCLA 1KT1A 2XPIA 3LY8A 4AY5A 2HO1A 3LPZA 4BTBA 3E4BA 5FZRA 4I9EA 5KJKA 4J0UA 3K9IA 3FFLA 5G04J 4F3VA 4WNGA 3RO3A 3JYSA 3LY7A 4ME2A 3QKYA 5JJ7A 3ZHEA
chains in the Genus database with same CATH superfamily
1V55E 1FT1A 1KZPA 3CK9A 3NOGD 4U7EB 4EZJA 4G23A 5LP0A 4CT4A 3FTYA 4A3VA 4AM9A 4ANUA 2NC9A 1MX6A 1OT8A 4KXKB 3E34A 5BV0A 4J6IA 1FVFA 4I6JA 4GTRA 1HZ4A 3TAXA 4APOA 3CVWA 1HS6A 4V3IA 4IULA 1SA4A 3QWVA 3SBSA 3L6AA 4I43A 3UXGA 5CBNA 2WXNA 3D3MA 2VSYA 3UINC 5M72A 1MHQA 3KAEA 4G25A 3CLJA 3RAUA 5BT1A 4L2YA 4UI9C 4GTSA 1E7VA 3MEKA 4F6RD 3NZSA 2C0MA 3RO3A 2V4HC 2CHXA 1HG5A 2ONDA 4QFVA 4NACA 3SFYA 5CCMA 2Y1LE 4FU3A 1ZB1A 3CKCA 1U3DA 4NQ0A 2KZTB 1TR4A 4N5CA 4WNFA 3QK0A 4G24A 2J49A 2NXPA 2WQ6A 1H6PA 1OWLA 4YDOA 3TG4A 4GYWA 2P9NG 5JMND 2KZTA 4UWKA 3DSTA 2VGEA 2J08A 4I9EA 4C48B 1JCRA 4TV3A 5E75A 3CVVA 4Q69A 4B93B 3CVNA 3O4ZA 4ACKA 2FF4A 4HRLA 1TJFA 3HDXA 4GA0A 1HH8A 1TN8A 1RZ4A 4WAFA 2BF0X 1Z5SC 2J8SD 4FLHA 4WUYA 4BX8A 3T8MA 2V0PA 3B7RL 3UQ3A 4K03A 4CGVA 1QBQA 3T5XA 4AIFA 2L0IA 5T8IA 5CEAA 3Q73A 3ZRHA 3APCA 3TWUA 3EHMA 2CHZA 2AXZA 1U2VG 5FJYA 2ILRA 2DZNA 3E32A 4RSYA 4M7CA 2WXPA 4LCTA 5ENRD 3L9TA 4TXRA 4U04A 3U66A 3FTXA 5G55A 1BI7B 1KZOA 5AYWD 1BD8A 4FHJA 2AJAA 2Y3AA 4HI9A 1RW2A 2RFAA 3R9MA 1MQSA 3G2TA 5AQAA 1LD7A 5CHEE 2I1JA 5FT9A 1ELWA 2P9PG 2VJ8A 3TWTA 4BT9A 2GW1A 2ETAA 4B94A 5A23A 2Y69E 3ZIMA 3BU8A 4J8FA 1N94A 4I6GA 3QJZA 3E37A 2BTDA 3FH5A 1KT0A 3S7BA 2P9LG 2DCPA 4AV7A 3HIZA 4RQIA 4B89A 3OXGA 3TXMA 3NBNB 5FQ6A 3QWPA 5CEDB 3NZUA 4LERA 3V2OA 4TUMA 4HOSA 1H2TC 3ZKJA 2DVWA 5KJMA 3HHMA 4M3OA 4G1TA 4CEMA 1H6OA 3AAAC 3RU0A 3CK8A 2P9IG 3ABME 4Q94A 2EILE 3FUFA 1JWFA 2E0IA 4C0EA 4DX5D 4HLEA 3D9JA 5E76A 3V30A 4BT8A 4B0ZA 3DSVA 1S0PA 4UI9K 5G05C 4EZKA 5AQ9A 3I4GA 4GA1A 1LTXA 3FUIA 4TRQA 1MYOA 5LFAA 3DXKG 2QFCA 4LEUA 1OWMA 4JVSA 3I5PA 3ZNGA 3CHQA 1TN6A 4X8QA 4LNUD 5FINA 1ZBPA 5HRYA 1HX8A 2CG3A 1LF8A 2VTBA 3SFZA 3PNLB 3QC1A 4EPZA 2KATA 2Y0BG 1P5QA 4WWOA 2X38A 3ULYA 1UOHA 1U3CA 1TNOA 3U9WA 3EHNA 1NL4A 2VYIA 2KBXA 2V5QC 2WXKA 4N2QA 4GTTA 1E8XA 3G2UA 3FTWA 4ZHBA 3RRMB 4K0RA 3DSSA 4JA9A 4HBDA 2VSXE 2H6FA 3OXLA 3J5PA 4CRWA 5G04C 3BG0B 2AW6A 5CMYA 1DVPA 2GRNB 2FULA 3W9GA 4HOUA 3LPZA 4J0UA 4EZLA 3QKYA 4KZ0A 4GMRA 2P9KG 2IF4A 4HS2A 4GPKA 2XS1A 5KNHD 4YDWA 4BSZB 1SVXA 5CRUA 3GZ1A 1L5JA 1HO8A 4GCNA 3JUEA 2J4BA 4BTAA 4J8YA 5AENA 4CDMA 2DYSE 3MKRA 4AP2A 3AG4E 1TN7A 4JL0A 1MX4A 2IONA 1TNYA 3MV3B 3NOCD 4JD2G 4R7LA 4RVBA 3RO2A 2J9QA 3CR3A 3PEUB 3CVXA 4O1PA 1A17A 1FPPA 2E2EA 2L9BA 4XX5A 1BI8B 3D9PA 4I1AA 4N3AA 3FUHA 5G05J 2X6KA 3PUJA 3SO8A 4AVXA 4I2ZA 3FUNA 3QWWA 4TXQA 4F53A 4XZ4A 1E7UA 5ENOD 3ASOE 4H7XA 2MYOA 3DEPA 2GGFA 3JXIA 4L9PA 2J07A 3FDHA 3B7TA 4N3CA 5T4YA 3Q9NC 4L23A 1Q2ZA 1WM5A 3ZXPA 1HG2A 3FH8A 3OTNA 1VDYA 2FEZA 1N0QA 2XGSA 5ITZF 2KXPC 2LXLA 3Q7AA 2WXOA 2B6CA 3CV0A 5CMWA 4FULA 2HO1A 3SNXA 4KMOA 4WNGA 2PM7A 4ME2A 3FU0A 3ASDA 3IHVA 4N2SA 3UKRG 3EIQC 1UG3A 1LD8A 1HE8A 1OCRE 1Y6IA 4LG6A 3LDZA 3DPYA 4GTPA 3S7JA 2IFUA 2NYJA 4PH4B 3VTYA 4JW1A 5D2MC 3TWWA 1NP7A 2VSOE 5KBAA 2GRLA 4ATZD 1HFAA 3D9OA 4DI4A 3ZHEB 2WXQA 2EIKE 2R05A 3BEEA 3QB2A 3DSXA 3IBEA 3FHEA 4HVBA 3ZPJA 3Q75A 3T9KA 3UPVA 2EINE 5KJNA 4GU5A 4XIFA 2KC7A 5ARGA 1NZNA 1MX2A 1BLXB 4MRUA 4AEZC 3SBTB 4C9BB 1BU9A 4GMJA 1Z3YA 1HXIA 3PZ4A 4GYYA 5DIZA 3GZSA 4LSZE 3PREA 3OXFA 3TWSA 4BWRA 2WXHA 3Q49B 2X6HA 4J8DA 4APFA 4J8SA 3WG7E 3ZN3A 3UKUG 1K1BA 3KS2A 3BQOA 5T3RA 2WXIA 3ISMC 2B0OE 3RRUA 2CFZA 2VTBB 2R59A 2YNQA 4JA7A 4A3TA 4BTBA 2KCLA 5FWQA 4ILIA 3AJIA 3ZUVB 2AXUA 3UUXA 3E33A 4HLLA 2ETCA 3ZYQA 1OWOA 2YQ8A 3JQ1A 5BXOA 2X6JA 3TGOA 3IKOB 4U07A 2WB2A 3I4RB 4NRHB 4URKA 2FI7A 4EQFA 1TNZA 3O48A 4YDYA 3MKQA 1E90A 1DC2A 4KYOB 5ENSD 3IHYA 2GROB 3SFXA 3FEYA 4GZ5A 1D9SA 3PS6A 5EYPF 3PUKA 2BKKB 3EUVA 4TUUA 3FTSA 3DPDA 4I1OB 1Z3XA 4YVQC 5KWDA 4ATGA 2DIWA 4B8CB 4RG9A 3ASGA 2H6GA 3PZ1A 3JUIA 3EDTB 1K8KG 5HS0A 1WAO1 2ZU6B 4J7WA 4GZDA 4KVMA 4TXPA 4UWFA 3FU6A 3P2BA 3C98A 3LYAA 2DWZA 2F0YA 3VTXA 2CFUA 3SQVA 4GA2A 4UQYA 1IKND 4ABNA 2VGXA 3U3WA 4KBQA 2XPIA 3CSFA 5FZRA 3K9IA 1N4PA 3J5QB 2ZGDA 1H6KA 3ESKA 4XI0A 2OVBA 3CHPA 4F7AA 1K1AA 4N39A 5G2NA 4P29A 3PE3A 3RK6A 3HXEA 5B1BE 4F1SA 4GZ6A 3UIPC 3EU9A 4IYPA 3DRAA 3FWVA 3PNTB 2R03A 3FEXA 2CG2A 3S2AA 2WMNA 1OY3D 3ONKA 1G3NB 2DYRE 2WXJA 3LS8A 1E8ZA 4BETA 2HYZA 3SY2A 1QQEA 4YVOA 1OWPA 1N52A 2BKGA 4HOTA 3B13A 5JHAA 2C0LA 4MS6A 5FTPA 2FO1E 3LY9A 3UM0A 2WXGA 2L6JA 3R9AB 3MCXA 3QARA 4CZ2D 1WY6A 3L08A 5EILA 3ML9A 2KCKA 3CVLA 3ASNE 3TG5A 2R17C 4DRXE 1S63A 5J90A 3LKUA 3UTMA 5EN5D 4PDXA 1N54A 3X2QE 3HYMB 3FUJA 5HQ8A 4CGWA 3L16A 3ZYLA 2PM6A 3SHFA 4CDNA 5G04J 3FFLA 1HU3A 2L0TB 2CHWA 2XZDG 1TNUA 3LJNA 1N4SA 3JQ0A 3FUMA 2WVIA 3TXNA 4I6EA 4EECA 1IHGA 3CK7A 4LRZA 3LCAA 2QYJA 5ANRA 1WDYA 3SZ7A 3PZ3A 3AU5A 3G2VA 3UT7A 4YNDA 2F8YA 4HNAD 3PRZA 5AQ7A 3ESLA 2AXVA 4NURA 5A7DB 3IEGA 2PQNA 3NQPA 5FQ7A 3GYZA 1O1SA 4FJZA 2VSNA 3AS4A 4CYMD 4QQIA 3FU3A 4KT6B 3CIAA 4O1OA 4DX1A 4BFRA 5AARA 3FULA 1QNFA 1KLXA 4BY6A 4XKCA 1ELKA 4FLBA 1OCZE 2A5EA 1ZU2A 1JWGA 1GW6A 3HVEA 5BXUA 1NA3A 1S64A 2LSVA 2MRIA 3CSTA 1YMPA 3VLEA 2HR2A 5JJTA 1FCHA 1X81A 1H2VC 3ULEG 3DWLG 4DLOA 1N11A 5CCLA 1OWNA 2I2OA 3FU5A 3FUKA 4ZFHA 4CCAA 2FBNA 2I6HA 2XGMA 5ENNA 2V5FA 2Y4TA 4G2VA 2X3MA 3BG1B 4K5CA 2Q7FA 4WWPA 4AJWA 3ONLA 3CGHA 4FA6A 3Q78A 3DSUA 3DXMG 4BEPA 4I17A 3Q79A 1E8YA 4DLQA 3QOUA 3MA5A 2XEVA 1TYQG 4ILGA 4XE0A 4IRUA 2L6BA 4U0SA 2QC9A 2PNNA 3FH7A 4HQDA 3FUEA 2IOSA 4U8VD 1O5MA 3LVRE 1K3ZD 4BERA 2XCBA 3GZ2A 2GRPB 2DZOA 1PC2A 3FTVA 4I9CA 3B7UX 5BPPA 5ANLA 1H0AA 4GB9A 3KSLA 5A6CA 2X6FA 3D9IA 2KCVA 4KZCA 3NB2A 3PZ2A 1UN8A 4B8AA 3NF1A 3Q9UC 2J4DA 3UT4A 2OOEA 4U95D 3B7BA 5EX3A 1QZ2A 3D9KA 5BNWA 3RKVA 5EIBE 5CRVA 3LY8A 4AY5A 3D9MA 3E4BA 4FP7A 5JJ7A 2XRZA 4EBAG 3FTZA 2IO2C 4FHKA 1IYGA 1S70B 2XGOA 2R02A 1IQUA 3LEWA 2XQ0A 1D8DA 3RIBA 5FQ8A 5IY5E 2V8SE 3UX4A 1N4QA 3CQGB 3N71A 1N0RA 2ETBA 3T5VA 3PEVB 2XEEA 3B95A 4FADA 1N4RA 2OEVA 3ZW3A 2UY1A 3V31A 2UWJG 4GAAA 4C0MA 4UI9J 4HB5A 3ZEFA 4GTVA 3ABLE 3HRAA 1O1TA 4GTQA 4GTMA 5EX0A 3VLDA 4A1SA 5AQBA 3CVPA 3HXDA 3ZGQA 1Z6TA 3ASHA 2P2CP 3EJNA 4FJYA 2J09A 4Y6WA 3EHQA 3CKBA 3SF4A 1OCCE 3SD5A 1N9AA 5KCMA 4DX7D 4G8LA 3QDNA 3UIOC 4HXIA 2GRQB 4OVUA 4F3VA 4DX2A 2RD0A 3Q15A 3ML8A 3ZYKA 3ZU7B 1UJKA 4AY6A 2LXMA 4NIKA 2IEJA 2ZIRA 4JEHA 2YHCA 2EQXA 2WPVA 4E6HA 4I1MA 3G2SA 1SZ9A 4RG6A 3CHSA 5AJDA 4UUCA 2V4LA 1MJ0A 2WM9A 5CERB 4O6FA 4A55A 2HE0A 3APDA 2I9CA 4L1BA 1EPUA 3S7FA 1JUQA 5JA4D 3CHRA 1KPSB 3TJPA 1TJCA 3HXCA 2UY1B 3FTUA 4JHJA 5B1AE 3OAWA 4A63B 3AU4A 3U64A 3TWVA 1HF8A 3WXXA 5LCWJ 4HI8A 3KD7A 3URZA 1B89A 3JCKC 5BW8C 4LNBA 5D0OD 3APFA 3MGBA 3NAWA 5DBKA 2FO7A 3I3NA 3V79K 1AWCB 2A4ZA 4JB8P 3W9FA 1XGWA 4PS8A 3HG0D 2VQ2A 3PDNA 4O60A 2LSUA 1SA5A 4EHMA 1EYHA 5AIJA 2OCCE 4FC8A 3R7QA 1DCEA 2ZISA 1V54E 2ZXWE 2YHEA 2IOLA 2R5SA 2YINA 4JEUA 3MYVA 4K5BA 1MZCA 4GZ3A 1TEZA 3UMVA 1DNPA 2P9UG 3JXJA 5JHBA 4K5AB 1BPOA 3CQCB 4DX6D 4UWGA 2XRYA 3MV2B 1PY1A 3D9HA 4JHKA 4DK5A 4U63A 2X6IA 1YYHA 3QAQA 3ZVVA 2WXLA 4OAVB 5KJLA 2WXMA 1EDUA 3LXUX 5FQ4A 3MJWA 4DI3A 4HRNA 4HORA 3KEZA 3F6QA 3ZXSA 2WQHA 4Q96A 4GTOA 3KSQA 2P58C 3ULQA 3HVEB 3HXFA 2R2LA 5LX8A 3Q47B 3C3QA 1YCSB 5EDSA 3L13A 3FP3A 4OVVA 3CHMA 2C2LA 4N3BA 4U96D 1OCOE 2BUGA 4I2WA 4AXHA 4ANWA 2GRRB 4DPRA 1ELRA 2EIJE 4YDEA 2A5UA 4BSXA 3ZHEA 2AVPA 5ENQD 3QNKA 1W3BA 2QY7A 3MZLB 3B7SA 4PS7A 2JLBA 4UWHA 4JPSA 2PZIA 1WG0A 4OAUC 2LNIA 2OVFA 2GRMA 2DBAA 1SZAA 4Z68A 3ASFA 2XHEA 4U8YD 4UQXA 4XEIG 4XKBA 4RLYA 2P9SG 2RKKA 5FZSA 4JHRA 4EBAA 1H19A 2VGYA 4ACLA 4JZYA 4U0ZA 3CVUA 3AG3E 4JXTA 4G26A 3L22A 5J08A 4AOFA 3L82A 3AS8A 4BX9A 1SW6A 2H6HA 3TWXA 2XENA 3VLFA 4IN3B 1YA0A 3R7RA 4ANVA 4N5QA 1IXVA 3UM1A 5AN8A 3BUAA 3CEQA 4GMLA 3D9LA 3ABKE 2LAHA 5D0QD 4CDRA 4MKTA 1TNBA 2OEWA 1NA0A 5EKQD 1NI1A 1PAQA 3UI2A 2WXRA 1Y8MA 3DBSA 3MKQB 4MBGA 1XNFA 3EIJA 3Q5MA 4GPMA 1OXJA 5C2YA 1O1RA 2RFMA 2I1KA 2WXFA 3JYSA 3PH0C 3MX3A 4PS3A 1EF1C 1D8EA 5D66A 4KVOA 4XI9A 3EHRA 4JC8A 3KEAA 3ZFWA 3C72A 2ZGGA 4E85A 2XEHA 2LAIA 2HM8A 1AP7A 4WNEA 1JCSA 4LNGA 4LUNU 5EYLA 4OYSA 4ILHB 3SGHA 2F8XK 4DUIA 4F1PA 4WNDA 5FIOA 3P1UA 5LCWC 4Y6CA 1INZA 2IY0C 3T8KA 1E8WA 2H6IA 3PZDA 4G11A 4U0UA 2JABA 3LJ3A 3C5RA 3UM3A 5CBOA 1QYMA 1FT2A 2PQRA 2XPYA 3CVYA 1UJJA 2LO6A 4ANXA 2VGXB 4GCOA 5AJLA 4HFGA 2XZTG 1UW4B 5H7PA 1IHBA 4L2LA 4U8HA 3AG1E 4MLPA 5AAOA 3TL5A 2AWIA 2F37A 1X5BA 2BEDA 3D9NA 3PVLA 1E96B 1SQMA 2LUHA 3RRNB 1NFIE 2WMOA 3RSEG 3CVQA 3IV0A 5LOZA 3TWRA 1OUVA 3ENEA 3L17A 3C3OA 1KT1A 4DJAA 1JPLA 5KJKA 2IU1A 2QZAA 3HXBA 3EU5A 2XS8A 3LY7A 2JEKA 3IXEA 2WQ7A 3LVQE 3FUDA 3Q4AB 2MOWA 3UT8A 2RG8A 4UQZA 1A5EA 2Y4UA 2IJGX 2NSZA 5ARFA 5HI7A 5KNGA 2M63A 3GW4A 3S7DA 4H7YA 2KM4A 2OV8A 4GYOA 3RJVA 3TWQA 4HOQA 1H2UA 3G2WA 4WWNA 3FY4A 1N95A 2IO3C 3E30A 2PL2A 4CT0A 5FZQA 2XCCA 3UM2A 4GZCA 4J8EA 1IQRA 1FVHA 5BV1A 3AG2E 5B3SE 1JCQA 2EIME 3AS5A 3DSWA 4PUCA 5ENTD 4D10C 2MHKA 5CECB 4W9RA 3C3RA 2IQCA 2XPZA 4A1GA 3U4TA 3Q7FA 5JJ6A 2QYUA 4HRMB 4UWLA 4G8KA 5BUZA 5EIDA 4BESA 5HKPA 1UN9A 5C1DA 3V2XA 5ENPD 3SI5A 3PE4A 1DCQA 3ZYMA 3CHOA 3L54A 3DEOA 4L7TA
chains in the Genus database with same CATH topology
3CK9A 2IF4A 2IOLA 2R5SA 2YHEA 2YINA 4HS2A 4JEUA 4EZJA 3MYVA 4GPKA 4G23A 3JQ0A 4GZ3A 3FUMA 5LP0A 2WVIA 3TXNA 4I6EA 1TEZA 3GZ1A 1L5JA 3UMVA 4EECA 1DNPA 1HO8A 1IHGA 4CT4A 4GCNA 3FTYA 4A3VA 4AM9A 4ANUA 2NC9A 2J4BA 4BTAA 5JHBA 4KXKB 3CK7A 5AENA 5BV0A 4LRZA 4CDMA 3LCAA 4J6IA 1BPOA 3CQCB 5ANRA 3SZ7A 4UWGA 1FVFA 3MKRA 2XRYA 4AP2A 3MV2B 4I6JA 3AU5A 3G2VA 3UT7A 1PY1A 4JHKA 4JL0A 4YNDA 1HZ4A 3TAXA 4APOA 4DK5A 3CVWA 2IONA 1HS6A 3MV3B 4V3IA 4U63A 4R7LA 4RVBA 4IULA 3RO2A 2X6IA 3QWVA 3SBSA 3L6AA 2J9QA 3CR3A 4I43A 3PRZA 2WXNA 3D3MA 2VSYA 2WXLA 3PEUB 3ESLA 3QAQA 2AXVA 3ZVVA 5M72A 1A17A 4NURA 2E2EA 1MHQA 5A7DB 2L9BA 3IEGA 2PQNA 3NQPA 5KJLA 3KAEA 2WXMA 4G25A 1EDUA 3CLJA 4XX5A 5FQ7A 3GYZA 3LXUX 5FQ4A 3MJWA 4DI3A 3D9PA 4FJZA 5BT1A 4HORA 4L2YA 2VSNA 4I1AA 4UI9C 4N3AA 3AS4A 3FUHA 1E7VA 3KEZA 3MEKA 5G05J 2X6KA 3PUJA 3ZXSA 2WQHA 3NZSA 2C0MA 3FU3A 3FUNA 3QWWA 4I2ZA 4KT6B 4Q96A 3RO3A 4AVXA 2CHXA 2P58C 3CIAA 4XZ4A 1E7UA 4F53A 4BFRA 3ULQA 1HG5A 2ONDA 4QFVA 3HVEB 4NACA 3FULA 5CCMA 4H7XA 5LX8A 3Q47B 1QNFA 4FU3A 1KLXA 2GGFA 3CKCA 4BY6A 1U3DA 4XKCA 5EDSA 4NQ0A 2J07A 2KZTB 3FP3A 3FDHA 3L13A 1ELKA 4FLBA 3B7TA 4N3CA 4N5CA 4OVVA 1ZU2A 5T4YA 4WNFA 1JWGA 1GW6A 3CHMA 3QK0A 3HVEA 4L23A 1NA3A 2C2LA 1WM5A 2LSVA 4G24A 2J49A 4N3BA 1HG2A 2NXPA 2WQ6A 2MRIA 3CSTA 3FH8A 3OTNA 1VDYA 3VLEA 2FEZA 2HR2A 2BUGA 4I2WA 5JJTA 2XGSA 1FCHA 1OWLA 4AXHA 3TG4A 1H2VC 4ANWA 2WXOA 4GYWA 4DLOA 4DPRA 1ELRA 3CV0A 2KZTA 4UWKA 5CMWA 4FULA 5CCLA 2J08A 2HO1A 4I9EA 3SNXA 1OWNA 2I2OA 4KMOA 3FU5A 4WNGA 2PM7A 4ME2A 2A5UA 3FUKA 4BSXA 3ZHEA 2AVPA 4CCAA 2FBNA 4TV3A 3QNKA 5E75A 2I6HA 2XGMA 3CVVA 3FU0A 1W3BA 5ENNA 2QY7A 3ASDA 2V5FA 3IHVA 3MZLB 4Q69A 4N2SA 2Y4TA 4G2VA 3B7SA 4PS7A 3EIQC 1UG3A 2JLBA 4UWHA 3CVNA 4JPSA 3O4ZA 2X3MA 2PZIA 3BG1B 2LNIA 4ACKA 2FF4A 2Q7FA 4WWPA 1HE8A 2OVFA 4AJWA 2GRMA 2DBAA 1Y6IA 1TJFA 3ONLA 1SZAA 3CGHA 3LDZA 3HDXA 3ASFA 4FA6A 4GA0A 3S7JA 1HH8A 2IFUA 2XHEA 4PH4B 4UQXA 4XKBA 4I17A 3VTYA 4WAFA 4JW1A 2BF0X 5FZSA 1E8YA 4FLHA 4JHRA 1NP7A 4WUYA 4DLQA 3QOUA 3MA5A 4BX8A 3T8MA 4EBAA 2V0PA 2XEVA 3B7RL 2VSOE 3UQ3A 2GRLA 1H19A 2VGYA 4ACLA 4K03A 1HFAA 3D9OA 4JZYA 4U0ZA 4ILGA 4DI4A 3CVUA 4XE0A 4CGVA 4IRUA 4JXTA 4G26A 3ZHEB 2WXQA 3T5XA 4AIFA 2L0IA 3BEEA 5T8IA 3QB2A 4U0SA 3L22A 3IBEA 3FHEA 4HVBA 5J08A 4AOFA 3ZPJA 3FH7A 3FUEA 2IOSA 3ZRHA 3APCA 3EHMA 2CHZA 3AS8A 3UPVA 2AXZA 3LVRE 5KJNA 4GU5A 4XIFA 2KC7A 2XCBA 3GZ2A 4BX9A 5FJYA 2ILRA 5ARGA 1NZNA 3VLFA 1PC2A 1YA0A 4IN3B 4MRUA 3FTVA 3R7RA 4ANVA 4RSYA 4I9CA 4AEZC 3SBTB 3B7UX 5BPPA 5ANLA 2WXPA 4C9BB 4LCTA 1H0AA 4GMJA 1Z3YA 4GB9A 3CEQA 1HXIA 4GMLA 4GYYA 5DIZA 2X6FA 3D9LA 3D9IA 2KCVA 3GZSA 3OXFA 3PREA 2LAHA 5D0QD 4CDRA 4MKTA 4BWRA 4KZCA 2WXHA 3Q49B 2X6HA 4J8DA 4U04A 4APFA 4J8SA 3U66A 1NA0A 3FTXA 5EKQD 5G55A 1UN8A 1PAQA 4B8AA 3NF1A 3ZN3A 5AYWD 2J4DA 3UT4A 2WXRA 3KS2A 1Y8MA 2OOEA 4FHJA 3DBSA 5T3RA 2WXIA 3MKQB 5EX3A 1XNFA 1QZ2A 3RRUA 2CFZA 3EIJA 3Q5MA 2Y3AA 3D9KA 2R59A 2VTBB 5BNWA 2YNQA 3RKVA 4JA7A 4A3TA 1MQSA 3LY8A 4AY5A 4BTBA 3D9MA 3E4BA 3G2TA 5C2YA 2WXFA 2I1KA 4FP7A 5JJ7A 3JYSA 3PH0C 3MX3A 2I1JA 5CHEE 2XRZA 4PS3A 4EBAG 5FT9A 1EF1C 2KCLA 1ELWA 3FTZA 5FWQA 4FHKA 4ILIA 2VJ8A 1IYGA 4BT9A 2GW1A 4KVOA 4XI9A 2XGOA 4B94A 4JC8A 5A23A 3ZFWA 2AXUA 1IQUA 3UUXA 3ZIMA 4J8FA 4I6GA 3LEWA 2XQ0A 3QJZA 3ZYQA 4E85A 2LAIA 2BTDA 3FH5A 1KT0A 3S7BA 3RIBA 1OWOA 2DCPA 2YQ8A 2HM8A 3JQ1A 4WNEA 2X6JA 3TGOA 3IKOB 4U07A 5FQ8A 2WB2A 4LUNU 3I4RB 4AV7A 4OYSA 4ILHB 3HIZA 2V8SE 4NRHB 3UX4A 3OXGA 3SGHA 4B89A 4URKA 2FI7A 4EQFA 3TXMA 4WNDA 3O48A 3CQGB 5FQ6A 3QWPA 3N71A 3P1UA 5LCWC 3MKQA 3T5VA 4Y6CA 1E90A 1INZA 3PEVB 1E8WA 4KYOB 3PZDA 4G11A 3NZUA 4U0UA 3LJ3A 4LERA 3IHYA 4FADA 4HOSA 3ZW3A 1H2TC 2PQRA 2UY1A 2XPYA 3FEYA 3CVYA 1UJJA 4GZ5A 2UWJG 2LO6A 5KJMA 3HHMA 3PS6A 4GAAA 2VGXB 4ANXA 4C0MA 4M3OA 4GCOA 5AJLA 4UI9J 4HFGA 4G1TA 3PUKA 3ZEFA 4TUUA 3FTSA 4CEMA 1UW4B 3DPDA 4I1OB 1Z3XA 5EX0A 4L2LA 3RU0A 4YVQC 3VLDA 3CK8A 4U8HA 4A1SA 3CVPA 4MLPA 3CVXA 4ATGA 2DIWA 4B8CB 4Q94A 3ZGQA 1Z6TA 3FUFA 3ASHA 4RG9A 3ASGA 1JWFA 3TL5A 3JUIA 5A6CA 2AWIA 3EDTB 1X5BA 3D9NA 3PVLA 2E0IA 1E96B 3EJNA 4FJYA 4C0EA 2J09A 4Y6WA 1WAO1 4HLEA 2ZU6B 3D9JA 4GZDA 4KVMA 5E76A 1SQMA 3RRNB 3CKBA 4UWFA 3FU6A 3SF4A 3P2BA 4BT8A 3SD5A 3C98A 3LYAA 5KCMA 3VTXA 4B0ZA 2WMOA 1S0PA 2CFUA 4UI9K 4GA2A 3CVQA 5G05C 3QDNA 3IV0A 4UQYA 4EZKA 5LOZA 1OUVA 4ABNA 2VGXA 3ENEA 3U3WA 3L17A 3I4GA 4GA1A 4KBQA 1KT1A 2XPIA 3CSFA 3FUIA 4HXIA 5FZRA 1JPLA 4TRQA 4DJAA 5KJKA 2IU1A 3K9IA 4OVUA 4F3VA 3LY7A 2RD0A 3Q15A 2JEKA 5LFAA 2WQ7A 3LVQE 2QFCA 3ML8A 4LEUA 3FUDA 3Q4AB 3ZYKA 1OWMA 2MOWA 4JVSA 1H6KA 1UJKA 3ESKA 3I5PA 4XI0A 3UT8A 2RG8A 4UQZA 2OVBA 4AY6A 3CHPA 2Y4UA 4F7AA 4JEHA 4N39A 2IJGX 3CHQA 5G2NA 2NSZA 4P29A 5ARFA 5HI7A 3PE3A 2M63A 2YHCA 3GW4A 3RK6A 3S7DA 4F1SA 4GZ6A 2EQXA 2WPVA 1ZBPA 4E6HA 1HX8A 4I1MA 2CG3A 4IYPA 4H7YA 3FWVA 3G2SA 3PNTB 1SZ9A 2KM4A 1LF8A 4RG6A 2VTBA 2OV8A 3SFZA 4GYOA 3FEXA 3RJVA 2CG2A 3CHSA 3PNLB 3QC1A 4HOQA 5AJDA 3S2AA 2V4LA 1H2UA 2WMNA 3G2WA 4WWNA 2WM9A 3ONKA 3FY4A 4O6FA 4EPZA 4A55A 2KATA 2WXJA 3LS8A 4CT0A 2PL2A 3APDA 1E8ZA 2HYZA 2I9CA 1P5QA 4WWOA 4L1BA 2X38A 1QQEA 4YVOA 5FZQA 1OWPA 1N52A 1EPUA 2XCCA 1JUQA 3S7FA 3CHRA 4HOTA 3TJPA 3B13A 1TJCA 4GZCA 4J8EA 1IQRA 1FVHA 2UY1B 5BV1A 3FTUA 4JHJA 5JHAA 2C0LA 1U3CA 3OAWA 3U9WA 4MS6A 3AU4A 3EHNA 3U64A 5FTPA 1HF8A 3WXXA 3LY9A 5LCWJ 3KD7A 2VYIA 2WXGA 3URZA 1B89A 2L6JA 3AS5A 3JCKC 3R9AB 2WXKA 5BW8C 4N2QA 1E8XA 3G2UA 5D0OD 3APFA 3MCXA 3FTWA 3QARA 3MGBA 1WY6A 4PUCA 4D10C 3RRMB 2MHKA 3L08A 4K0RA 5DBKA 3ML9A 2FO7A 2KCKA 3I3NA 4W9RA 2IQCA 2A4ZA 3CVLA 2XPZA 4JA9A 4A1GA 3U4TA 3TG5A 2R17C 5JJ6A 2VSXE 5J90A 3LKUA 3OXLA 1XGWA 4UWLA 4PS8A 4PDXA 1N54A 2VQ2A 3PDNA 4CRWA 5BUZA 3HYMB 5G04C 1UN9A 3BG0B 5C1DA 2AW6A 3FUJA 1DVPA 5CMYA 3SI5A 2FULA 2LSUA 3PE4A 5HQ8A 4CGWA 1EYHA 3ZYMA 3L16A 4HOUA 5AIJA 3CHOA 3L54A 3ZYLA 2PM6A 3LPZA 4L7TA 3SHFA 4CDNA 4FC8A 4J0UA 5G04J 3FFLA 1HU3A 3R7QA 4EZLA 3QKYA 4KZ0A 2L0TB 2CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q15 A;  2AVP A;  5FT9 A;  2KCL A;  1ELW A;  2FBN A;  3CK9 A;  2QFC A;  2I6H A;  2XGM A;  2GW1 A;  4LEU A;  1W3B A;  4BT9 A;  3ASD A;  1IYG A;  2V5F A;  2IF4 A;  2R5S A;  3Q4A B;  4N2S A;  4XI9 A;  2Y4T A;  2XGO A;  3ESK A;  4G23 A;  4G2V A;  4GZ3 A;  4XI0 A;  4UQZ A;  4B94 A;  4GPK A;  2JLB A;  4AY6 A;  3GZ1 A;  3ZFW A;  3CVN A;  2Y4U A;  1IHG A;  2PZI A;  4GCN A;  3UUX A;  2LNI A;  4J8F A;  4N39 A;  2FF4 A;  4AM9 A;  2NC9 A;  2Q7F A;  4BTA A;  2DBA A;  4KXK B;  3S7B A;  1KT0 A;  3CK7 A;  5ARF A;  3PE3 A;  2YHC A;  5HI7 A;  3GW4 A;  3RIB A;  3LCA A;  3S7D A;  2YQ8 A;  3ASF A;  4GZ6 A;  4GA0 A;  4WNE A;  3S7J A;  3SZ7 A;  3MKR A;  2WPV A;  1ZBP A;  3TGO A;  4U07 A;  1HH8 A;  2IFU A;  4UQX A;  4I17 A;  4H7Y A;  3MV2 B;  3VTY A;  3FWV A;  4RG6 A;  4JL0 A;  4NRH B;  4YND A;  3OXG A;  5FZS A;  4GYO A;  2FI7 A;  4EQF A;  4JHR A;  1HZ4 A;  3RJV A;  4WUY A;  3TAX A;  4APO A;  3QOU A;  3MA5 A;  3URZ A;  4HOQ A;  3O48 A;  2XEV A;  4WND A;  3UQ3 A;  3QWP A;  3MV3 B;  3N71 A;  5LCW C;  2VGY A;  4Y6C A;  4O6F A;  4U0Z A;  3RO2 A;  3QWV A;  2KAT A;  2J9Q A;  4CGV A;  4G26 A;  2PL2 A;  4KYO B;  3ZHE B;  4AIF A;  2VSY A;  2HYZ A;  3BEE A;  1P5Q A;  4U0U A;  5M72 A;  4U0S A;  1A17 A;  1QQE A;  2E2E A;  4YVO A;  5FZQ A;  5A7D B;  3IEG A;  2PQN A;  5KJL A;  3ZPJ A;  3KAE A;  2XCC A;  4G25 A;  3S7F A;  4HOS A;  4HOT A;  3GYZ A;  2PQR A;  1TJC A;  2UY1 A;  4J8E A;  2UY1 B;  3UPV A;  3AS8 A;  4GZ5 A;  2UWJ G;  2C0L A;  5BT1 A;  5KJN A;  5KJM A;  4HOR A;  2VGX B;  2VSN A;  4I1A A;  4UI9 C;  2KC7 A;  2XCB A;  3GZ2 A;  4GCO A;  4N3A A;  3AS4 A;  4UI9 J;  4G1T A;  5FJY A;  3MEK A;  5ARG A;  1NZN A;  5FTP A;  5G05 J;  3WXX A;  3LY9 A;  5LCW J;  2WQH A;  3KD7 A;  2VYI A;  5EX0 A;  3RU0 A;  1PC2 A;  1B89 A;  1YA0 A;  2C0M A;  2L6J A;  3AS5 A;  3QWW A;  4IN3 B;  4I2Z A;  4YVQ C;  5BW8 C;  2P58 C;  3CK8 A;  4I9C A;  5D0O D;  4N2Q A;  4A1S A;  3CVP A;  3ULQ A;  2OND A;  5CHE E;  2MHK A;  5DBK A;  4H7X A;  5CCM A;  3CEQ A;  1HXI A;  3ZGQ A;  3Q47 B;  4GYY A;  5DIZ A;  1KLX A;  5A6C A;  3ASH A;  2FO7 A;  2KCK A;  2KCV A;  3ASG A;  3CKC A;  3OXF A;  4RG9 A;  4W9R A;  5D0Q D;  4CDR A;  4NQ0 A;  4BWR A;  3EDT B;  3FP3 A;  3Q49 B;  4N5C A;  4J8D A;  4N3C A;  3CVL A;  4XIF A;  4U04 A;  1E96 B;  4JA9 A;  1ZU2 A;  3R9A B;  4WNF A;  3U4T A;  3TG5 A;  1NA0 A;  5EKQ D;  4Y6W A;  5JJ6 A;  1NA3 A;  1WAO 1;  2C2L A;  1WM5 A;  3LKU A;  2LSV A;  3OXL A;  4G24 A;  3NF1 A;  3ZN3 A;  4N3B A;  5AYW D;  3CKB A;  3SF4 A;  2VQ2 A;  3KS2 A;  3PDN A;  1Y8M A;  2OOE A;  4BT8 A;  3LYA A;  2FEZ A;  2HR2 A;  3HYM B;  2BUG A;  4I2W A;  5G04 C;  5C1D A;  5JJT A;  2XGS A;  5EX3 A;  3VTX A;  1FCH A;  1XNF A;  1QZ2 A;  4UI9 K;  2LSU A;  3CVQ A;  3PE4 A;  3Q5M A;  4GA2 A;  3QDN A;  4UQY A;  5G05 C;  3TG4 A;  5BNW A;  4CGW A;  5HQ8 A;  1OUV A;  3RKV A;  2VGX A;  4ABN A;  4GYW A;  3U3W A;  4HOU A;  1ELR A;  3CV0 A;  4GA1 A;  4JA7 A;  4KBQ A;  5CCL A;  1KT1 A;  2XPI A;  3LY8 A;  4AY5 A;  2HO1 A;  3LPZ A;  4BTB A;  3E4B A;  5FZR A;  4I9E A;  5KJK A;  4J0U A;  3K9I A;  3FFL A;  5G04 J;  4F3V A;  4WNG A;  3RO3 A;  3JYS A;  3LY7 A;  4ME2 A;  3QKY A;  5JJ7 A;  3ZHE A; 
#chains in the Genus database with same CATH topology
 1V55 E;  1FT1 A;  1KZP A;  3CK9 A;  3NOG D;  4U7E B;  4EZJ A;  4G23 A;  5LP0 A;  4CT4 A;  3FTY A;  4A3V A;  4AM9 A;  4ANU A;  2NC9 A;  1MX6 A;  1OT8 A;  4KXK B;  3E34 A;  5BV0 A;  4J6I A;  1FVF A;  4I6J A;  4GTR A;  1HZ4 A;  3TAX A;  4APO A;  3CVW A;  1HS6 A;  4V3I A;  4IUL A;  1SA4 A;  3QWV A;  3SBS A;  3L6A A;  4I43 A;  3UXG A;  5CBN A;  2WXN A;  3D3M A;  2VSY A;  3UIN C;  5M72 A;  1MHQ A;  3KAE A;  4G25 A;  3CLJ A;  3RAU A;  5BT1 A;  4L2Y A;  4UI9 C;  4GTS A;  1E7V A;  3MEK A;  4F6R D;  3NZS A;  2C0M A;  3RO3 A;  2V4H C;  2CHX A;  1HG5 A;  2OND A;  4QFV A;  4NAC A;  3SFY A;  5CCM A;  2Y1L E;  4FU3 A;  1ZB1 A;  3CKC A;  1U3D A;  4NQ0 A;  2KZT B;  1TR4 A;  4N5C A;  4WNF A;  3QK0 A;  4G24 A;  2J49 A;  2NXP A;  2WQ6 A;  1H6P A;  1OWL A;  4YDO A;  3TG4 A;  4GYW A;  2P9N G;  5JMN D;  2KZT A;  4UWK A;  3DST A;  2VGE A;  2J08 A;  4I9E A;  4C48 B;  1JCR A;  4TV3 A;  5E75 A;  3CVV A;  4Q69 A;  4B93 B;  3CVN A;  3O4Z A;  4ACK A;  2FF4 A;  4HRL A;  1TJF A;  3HDX A;  4GA0 A;  1HH8 A;  1TN8 A;  1RZ4 A;  4WAF A;  2BF0 X;  1Z5S C;  2J8S D;  4FLH A;  4WUY A;  4BX8 A;  3T8M A;  2V0P A;  3B7R L;  3UQ3 A;  4K03 A;  4CGV A;  1QBQ A;  3T5X A;  4AIF A;  2L0I A;  5T8I A;  5CEA A;  3Q73 A;  3ZRH A;  3APC A;  3TWU A;  3EHM A;  2CHZ A;  2AXZ A;  1U2V G;  5FJY A;  2ILR A;  2DZN A;  3E32 A;  4RSY A;  4M7C A;  2WXP A;  4LCT A;  5ENR D;  3L9T A;  4TXR A;  4U04 A;  3U66 A;  3FTX A;  5G55 A;  1BI7 B;  1KZO A;  5AYW D;  1BD8 A;  4FHJ A;  2AJA A;  2Y3A A;  4HI9 A;  1RW2 A;  2RFA A;  3R9M A;  1MQS A;  3G2T A;  5AQA A;  1LD7 A;  5CHE E;  2I1J A;  5FT9 A;  1ELW A;  2P9P G;  2VJ8 A;  3TWT A;  4BT9 A;  2GW1 A;  2ETA A;  4B94 A;  5A23 A;  2Y69 E;  3ZIM A;  3BU8 A;  4J8F A;  1N94 A;  4I6G A;  3QJZ A;  3E37 A;  2BTD A;  3FH5 A;  1KT0 A;  3S7B A;  2P9L G;  2DCP A;  4AV7 A;  3HIZ A;  4RQI A;  4B89 A;  3OXG A;  3TXM A;  3NBN B;  5FQ6 A;  3QWP A;  5CED B;  3NZU A;  4LER A;  3V2O A;  4TUM A;  4HOS A;  1H2T C;  3ZKJ A;  2DVW A;  5KJM A;  3HHM A;  4M3O A;  4G1T A;  4CEM A;  1H6O A;  3AAA C;  3RU0 A;  3CK8 A;  2P9I G;  3ABM E;  4Q94 A;  2EIL E;  3FUF A;  1JWF A;  2E0I A;  4C0E A;  4DX5 D;  4HLE A;  3D9J A;  5E76 A;  3V30 A;  4BT8 A;  4B0Z A;  3DSV A;  1S0P A;  4UI9 K;  5G05 C;  4EZK A;  5AQ9 A;  3I4G A;  4GA1 A;  1LTX A;  3FUI A;  4TRQ A;  1MYO A;  5LFA A;  3DXK G;  2QFC A;  4LEU A;  1OWM A;  4JVS A;  3I5P A;  3ZNG A;  3CHQ A;  1TN6 A;  4X8Q A;  4LNU D;  5FIN A;  1ZBP A;  5HRY A;  1HX8 A;  2CG3 A;  1LF8 A;  2VTB A;  3SFZ A;  3PNL B;  3QC1 A;  4EPZ A;  2KAT A;  2Y0B G;  1P5Q A;  4WWO A;  2X38 A;  3ULY A;  1UOH A;  1U3C A;  1TNO A;  3U9W A;  3EHN A;  1NL4 A;  2VYI A;  2KBX A;  2V5Q C;  2WXK A;  4N2Q A;  4GTT A;  1E8X A;  3G2U A;  3FTW A;  4ZHB A;  3RRM B;  4K0R A;  3DSS A;  4JA9 A;  4HBD A;  2VSX E;  2H6F A;  3OXL A;  3J5P A;  4CRW A;  5G04 C;  3BG0 B;  2AW6 A;  5CMY A;  1DVP A;  2GRN B;  2FUL A;  3W9G A;  4HOU A;  3LPZ A;  4J0U A;  4EZL A;  3QKY A;  4KZ0 A;  4GMR A;  2P9K G;  2IF4 A;  4HS2 A;  4GPK A;  2XS1 A;  5KNH D;  4YDW A;  4BSZ B;  1SVX A;  5CRU A;  3GZ1 A;  1L5J A;  1HO8 A;  4GCN A;  3JUE A;  2J4B A;  4BTA A;  4J8Y A;  5AEN A;  4CDM A;  2DYS E;  3MKR A;  4AP2 A;  3AG4 E;  1TN7 A;  4JL0 A;  1MX4 A;  2ION A;  1TNY A;  3MV3 B;  3NOC D;  4JD2 G;  4R7L A;  4RVB A;  3RO2 A;  2J9Q A;  3CR3 A;  3PEU B;  3CVX A;  4O1P A;  1A17 A;  1FPP A;  2E2E A;  2L9B A;  4XX5 A;  1BI8 B;  3D9P A;  4I1A A;  4N3A A;  3FUH A;  5G05 J;  2X6K A;  3PUJ A;  3SO8 A;  4AVX A;  4I2Z A;  3FUN A;  3QWW A;  4TXQ A;  4F53 A;  4XZ4 A;  1E7U A;  5ENO D;  3ASO E;  4H7X A;  2MYO A;  3DEP A;  2GGF A;  3JXI A;  4L9P A;  2J07 A;  3FDH A;  3B7T A;  4N3C A;  5T4Y A;  3Q9N C;  4L23 A;  1Q2Z A;  1WM5 A;  3ZXP A;  1HG2 A;  3FH8 A;  3OTN A;  1VDY A;  2FEZ A;  1N0Q A;  2XGS A;  5ITZ F;  2KXP C;  2LXL A;  3Q7A A;  2WXO A;  2B6C A;  3CV0 A;  5CMW A;  4FUL A;  2HO1 A;  3SNX A;  4KMO A;  4WNG A;  2PM7 A;  4ME2 A;  3FU0 A;  3ASD A;  3IHV A;  4N2S A;  3UKR G;  3EIQ C;  1UG3 A;  1LD8 A;  1HE8 A;  1OCR E;  1Y6I A;  4LG6 A;  3LDZ A;  3DPY A;  4GTP A;  3S7J A;  2IFU A;  2NYJ A;  4PH4 B;  3VTY A;  4JW1 A;  5D2M C;  3TWW A;  1NP7 A;  2VSO E;  5KBA A;  2GRL A;  4ATZ D;  1HFA A;  3D9O A;  4DI4 A;  3ZHE B;  2WXQ A;  2EIK E;  2R05 A;  3BEE A;  3QB2 A;  3DSX A;  3IBE A;  3FHE A;  4HVB A;  3ZPJ A;  3Q75 A;  3T9K A;  3UPV A;  2EIN E;  5KJN A;  4GU5 A;  4XIF A;  2KC7 A;  5ARG A;  1NZN A;  1MX2 A;  1BLX B;  4MRU A;  4AEZ C;  3SBT B;  4C9B B;  1BU9 A;  4GMJ A;  1Z3Y A;  1HXI A;  3PZ4 A;  4GYY A;  5DIZ A;  3GZS A;  4LSZ E;  3PRE A;  3OXF A;  3TWS A;  4BWR A;  2WXH A;  3Q49 B;  2X6H A;  4J8D A;  4APF A;  4J8S A;  3WG7 E;  3ZN3 A;  3UKU G;  1K1B A;  3KS2 A;  3BQO A;  5T3R A;  2WXI A;  3ISM C;  2B0O E;  3RRU A;  2CFZ A;  2VTB B;  2R59 A;  2YNQ A;  4JA7 A;  4A3T A;  4BTB A;  2KCL A;  5FWQ A;  4ILI A;  3AJI A;  3ZUV B;  2AXU A;  3UUX A;  3E33 A;  4HLL A;  2ETC A;  3ZYQ A;  1OWO A;  2YQ8 A;  3JQ1 A;  5BXO A;  2X6J A;  3TGO A;  3IKO B;  4U07 A;  2WB2 A;  3I4R B;  4NRH B;  4URK A;  2FI7 A;  4EQF A;  1TNZ A;  3O48 A;  4YDY A;  3MKQ A;  1E90 A;  1DC2 A;  4KYO B;  5ENS D;  3IHY A;  2GRO B;  3SFX A;  3FEY A;  4GZ5 A;  1D9S A;  3PS6 A;  5EYP F;  3PUK A;  2BKK B;  3EUV A;  4TUU A;  3FTS A;  3DPD A;  4I1O B;  1Z3X A;  4YVQ C;  5KWD A;  4ATG A;  2DIW A;  4B8C B;  4RG9 A;  3ASG A;  2H6G A;  3PZ1 A;  3JUI A;  3EDT B;  1K8K G;  5HS0 A;  1WAO 1;  2ZU6 B;  4J7W A;  4GZD A;  4KVM A;  4TXP A;  4UWF A;  3FU6 A;  3P2B A;  3C98 A;  3LYA A;  2DWZ A;  2F0Y A;  3VTX A;  2CFU A;  3SQV A;  4GA2 A;  4UQY A;  1IKN D;  4ABN A;  2VGX A;  3U3W A;  4KBQ A;  2XPI A;  3CSF A;  5FZR A;  3K9I A;  1N4P A;  3J5Q B;  2ZGD A;  1H6K A;  3ESK A;  4XI0 A;  2OVB A;  3CHP A;  4F7A A;  1K1A A;  4N39 A;  5G2N A;  4P29 A;  3PE3 A;  3RK6 A;  3HXE A;  5B1B E;  4F1S A;  4GZ6 A;  3UIP C;  3EU9 A;  4IYP A;  3DRA A;  3FWV A;  3PNT B;  2R03 A;  3FEX A;  2CG2 A;  3S2A A;  2WMN A;  1OY3 D;  3ONK A;  1G3N B;  2DYR E;  2WXJ A;  3LS8 A;  1E8Z A;  4BET A;  2HYZ A;  3SY2 A;  1QQE A;  4YVO A;  1OWP A;  1N52 A;  2BKG A;  4HOT A;  3B13 A;  5JHA A;  2C0L A;  4MS6 A;  5FTP A;  2FO1 E;  3LY9 A;  3UM0 A;  2WXG A;  2L6J A;  3R9A B;  3MCX A;  3QAR A;  4CZ2 D;  1WY6 A;  3L08 A;  5EIL A;  3ML9 A;  2KCK A;  3CVL A;  3ASN E;  3TG5 A;  2R17 C;  4DRX E;  1S63 A;  5J90 A;  3LKU A;  3UTM A;  5EN5 D;  4PDX A;  1N54 A;  3X2Q E;  3HYM B;  3FUJ A;  5HQ8 A;  4CGW A;  3L16 A;  3ZYL A;  2PM6 A;  3SHF A;  4CDN A;  5G04 J;  3FFL A;  1HU3 A;  2L0T B;  2CHW A;  2XZD G;  1TNU A;  3LJN A;  1N4S A;  3JQ0 A;  3FUM A;  2WVI A;  3TXN A;  4I6E A;  4EEC A;  1IHG A;  3CK7 A;  4LRZ A;  3LCA A;  2QYJ A;  5ANR A;  1WDY A;  3SZ7 A;  3PZ3 A;  3AU5 A;  3G2V A;  3UT7 A;  4YND A;  2F8Y A;  4HNA D;  3PRZ A;  5AQ7 A;  3ESL A;  2AXV A;  4NUR A;  5A7D B;  3IEG A;  2PQN A;  3NQP A;  5FQ7 A;  3GYZ A;  1O1S A;  4FJZ A;  2VSN A;  3AS4 A;  4CYM D;  4QQI A;  3FU3 A;  4KT6 B;  3CIA A;  4O1O A;  4DX1 A;  4BFR A;  5AAR A;  3FUL A;  1QNF A;  1KLX A;  4BY6 A;  4XKC A;  1ELK A;  4FLB A;  1OCZ E;  2A5E A;  1ZU2 A;  1JWG A;  1GW6 A;  3HVE A;  5BXU A;  1NA3 A;  1S64 A;  2LSV A;  2MRI A;  3CST A;  1YMP A;  3VLE A;  2HR2 A;  5JJT A;  1FCH A;  1X81 A;  1H2V C;  3ULE G;  3DWL G;  4DLO A;  1N11 A;  5CCL A;  1OWN A;  2I2O A;  3FU5 A;  3FUK A;  4ZFH A;  4CCA A;  2FBN A;  2I6H A;  2XGM A;  5ENN A;  2V5F A;  2Y4T A;  4G2V A;  2X3M A;  3BG1 B;  4K5C A;  2Q7F A;  4WWP A;  4AJW A;  3ONL A;  3CGH A;  4FA6 A;  3Q78 A;  3DSU A;  3DXM G;  4BEP A;  4I17 A;  3Q79 A;  1E8Y A;  4DLQ A;  3QOU A;  3MA5 A;  2XEV A;  1TYQ G;  4ILG A;  4XE0 A;  4IRU A;  2L6B A;  4U0S A;  2QC9 A;  2PNN A;  3FH7 A;  4HQD A;  3FUE A;  2IOS A;  4U8V D;  1O5M A;  3LVR E;  1K3Z D;  4BER A;  2XCB A;  3GZ2 A;  2GRP B;  2DZO A;  1PC2 A;  3FTV A;  4I9C A;  3B7U X;  5BPP A;  5ANL A;  1H0A A;  4GB9 A;  3KSL A;  5A6C A;  2X6F A;  3D9I A;  2KCV A;  4KZC A;  3NB2 A;  3PZ2 A;  1UN8 A;  4B8A A;  3NF1 A;  3Q9U C;  2J4D A;  3UT4 A;  2OOE A;  4U95 D;  3B7B A;  5EX3 A;  1QZ2 A;  3D9K A;  5BNW A;  3RKV A;  5EIB E;  5CRV A;  3LY8 A;  4AY5 A;  3D9M A;  3E4B A;  4FP7 A;  5JJ7 A;  2XRZ A;  4EBA G;  3FTZ A;  2IO2 C;  4FHK A;  1IYG A;  1S70 B;  2XGO A;  2R02 A;  1IQU A;  3LEW A;  2XQ0 A;  1D8D A;  3RIB A;  5FQ8 A;  5IY5 E;  2V8S E;  3UX4 A;  1N4Q A;  3CQG B;  3N71 A;  1N0R A;  2ETB A;  3T5V A;  3PEV B;  2XEE A;  3B95 A;  4FAD A;  1N4R A;  2OEV A;  3ZW3 A;  2UY1 A;  3V31 A;  2UWJ G;  4GAA A;  4C0M A;  4UI9 J;  4HB5 A;  3ZEF A;  4GTV A;  3ABL E;  3HRA A;  1O1T A;  4GTQ A;  4GTM A;  5EX0 A;  3VLD A;  4A1S A;  5AQB A;  3CVP A;  3HXD A;  3ZGQ A;  1Z6T A;  3ASH A;  2P2C P;  3EJN A;  4FJY A;  2J09 A;  4Y6W A;  3EHQ A;  3CKB A;  3SF4 A;  1OCC E;  3SD5 A;  1N9A A;  5KCM A;  4DX7 D;  4G8L A;  3QDN A;  3UIO C;  4HXI A;  2GRQ B;  4OVU A;  4F3V A;  4DX2 A;  2RD0 A;  3Q15 A;  3ML8 A;  3ZYK A;  3ZU7 B;  1UJK A;  4AY6 A;  2LXM A;  4NIK A;  2IEJ A;  2ZIR A;  4JEH A;  2YHC A;  2EQX A;  2WPV A;  4E6H A;  4I1M A;  3G2S A;  1SZ9 A;  4RG6 A;  3CHS A;  5AJD A;  4UUC A;  2V4L A;  1MJ0 A;  2WM9 A;  5CER B;  4O6F A;  4A55 A;  2HE0 A;  3APD A;  2I9C A;  4L1B A;  1EPU A;  3S7F A;  1JUQ A;  5JA4 D;  3CHR A;  1KPS B;  3TJP A;  1TJC A;  3HXC A;  2UY1 B;  3FTU A;  4JHJ A;  5B1A E;  3OAW A;  4A63 B;  3AU4 A;  3U64 A;  3TWV A;  1HF8 A;  3WXX A;  5LCW J;  4HI8 A;  3KD7 A;  3URZ A;  1B89 A;  3JCK C;  5BW8 C;  4LNB A;  5D0O D;  3APF A;  3MGB A;  3NAW A;  5DBK A;  2FO7 A;  3I3N A;  3V79 K;  1AWC B;  2A4Z A;  4JB8 P;  3W9F A;  1XGW A;  4PS8 A;  3HG0 D;  2VQ2 A;  3PDN A;  4O60 A;  2LSU A;  1SA5 A;  4EHM A;  1EYH A;  5AIJ A;  2OCC E;  4FC8 A;  3R7Q A;  1DCE A;  2ZIS A;  1V54 E;  2ZXW E;  2YHE A;  2IOL A;  2R5S A;  2YIN A;  4JEU A;  3MYV A;  4K5B A;  1MZC A;  4GZ3 A;  1TEZ A;  3UMV A;  1DNP A;  2P9U G;  3JXJ A;  5JHB A;  4K5A B;  1BPO A;  3CQC B;  4DX6 D;  4UWG A;  2XRY A;  3MV2 B;  1PY1 A;  3D9H A;  4JHK A;  4DK5 A;  4U63 A;  2X6I A;  1YYH A;  3QAQ A;  3ZVV A;  2WXL A;  4OAV B;  5KJL A;  2WXM A;  1EDU A;  3LXU X;  5FQ4 A;  3MJW A;  4DI3 A;  4HRN A;  4HOR A;  3KEZ A;  3F6Q A;  3ZXS A;  2WQH A;  4Q96 A;  4GTO A;  3KSQ A;  2P58 C;  3ULQ A;  3HVE B;  3HXF A;  2R2L A;  5LX8 A;  3Q47 B;  3C3Q A;  1YCS B;  5EDS A;  3L13 A;  3FP3 A;  4OVV A;  3CHM A;  2C2L A;  4N3B A;  4U96 D;  1OCO E;  2BUG A;  4I2W A;  4AXH A;  4ANW A;  2GRR B;  4DPR A;  1ELR A;  2EIJ E;  4YDE A;  2A5U A;  4BSX A;  3ZHE A;  2AVP A;  5ENQ D;  3QNK A;  1W3B A;  2QY7 A;  3MZL B;  3B7S A;  4PS7 A;  2JLB A;  4UWH A;  4JPS A;  2PZI A;  1WG0 A;  4OAU C;  2LNI A;  2OVF A;  2GRM A;  2DBA A;  1SZA A;  4Z68 A;  3ASF A;  2XHE A;  4U8Y D;  4UQX A;  4XEI G;  4XKB A;  4RLY A;  2P9S G;  2RKK A;  5FZS A;  4JHR A;  4EBA A;  1H19 A;  2VGY A;  4ACL A;  4JZY A;  4U0Z A;  3CVU A;  3AG3 E;  4JXT A;  4G26 A;  3L22 A;  5J08 A;  4AOF A;  3L82 A;  3AS8 A;  4BX9 A;  1SW6 A;  2H6H A;  3TWX A;  2XEN A;  3VLF A;  4IN3 B;  1YA0 A;  3R7R A;  4ANV A;  4N5Q A;  1IXV A;  3UM1 A;  5AN8 A;  3BUA A;  3CEQ A;  4GML A;  3D9L A;  3ABK E;  2LAH A;  5D0Q D;  4CDR A;  4MKT A;  1TNB A;  2OEW A;  1NA0 A;  5EKQ D;  1NI1 A;  1PAQ A;  3UI2 A;  2WXR A;  1Y8M A;  3DBS A;  3MKQ B;  4MBG A;  1XNF A;  3EIJ A;  3Q5M A;  4GPM A;  1OXJ A;  5C2Y A;  1O1R A;  2RFM A;  2I1K A;  2WXF A;  3JYS A;  3PH0 C;  3MX3 A;  4PS3 A;  1EF1 C;  1D8E A;  5D66 A;  4KVO A;  4XI9 A;  3EHR A;  4JC8 A;  3KEA A;  3ZFW A;  3C72 A;  2ZGG A;  4E85 A;  2XEH A;  2LAI A;  2HM8 A;  1AP7 A;  4WNE A;  1JCS A;  4LNG A;  4LUN U;  5EYL A;  4OYS A;  4ILH B;  3SGH A;  2F8X K;  4DUI A;  4F1P A;  4WND A;  5FIO A;  3P1U A;  5LCW C;  4Y6C A;  1INZ A;  2IY0 C;  3T8K A;  1E8W A;  2H6I A;  3PZD A;  4G11 A;  4U0U A;  2JAB A;  3LJ3 A;  3C5R A;  3UM3 A;  5CBO A;  1QYM A;  1FT2 A;  2PQR A;  2XPY A;  3CVY A;  1UJJ A;  2LO6 A;  4ANX A;  2VGX B;  4GCO A;  5AJL A;  4HFG A;  2XZT G;  1UW4 B;  5H7P A;  1IHB A;  4L2L A;  4U8H A;  3AG1 E;  4MLP A;  5AAO A;  3TL5 A;  2AWI A;  2F37 A;  1X5B A;  2BED A;  3D9N A;  3PVL A;  1E96 B;  1SQM A;  2LUH A;  3RRN B;  1NFI E;  2WMO A;  3RSE G;  3CVQ A;  3IV0 A;  5LOZ A;  3TWR A;  1OUV A;  3ENE A;  3L17 A;  3C3O A;  1KT1 A;  4DJA A;  1JPL A;  5KJK A;  2IU1 A;  2QZA A;  3HXB A;  3EU5 A;  2XS8 A;  3LY7 A;  2JEK A;  3IXE A;  2WQ7 A;  3LVQ E;  3FUD A;  3Q4A B;  2MOW A;  3UT8 A;  2RG8 A;  4UQZ A;  1A5E A;  2Y4U A;  2IJG X;  2NSZ A;  5ARF A;  5HI7 A;  5KNG A;  2M63 A;  3GW4 A;  3S7D A;  4H7Y A;  2KM4 A;  2OV8 A;  4GYO A;  3RJV A;  3TWQ A;  4HOQ A;  1H2U A;  3G2W A;  4WWN A;  3FY4 A;  1N95 A;  2IO3 C;  3E30 A;  2PL2 A;  4CT0 A;  5FZQ A;  2XCC A;  3UM2 A;  4GZC A;  4J8E A;  1IQR A;  1FVH A;  5BV1 A;  3AG2 E;  5B3S E;  1JCQ A;  2EIM E;  3AS5 A;  3DSW A;  4PUC A;  5ENT D;  4D10 C;  2MHK A;  5CEC B;  4W9R A;  3C3R A;  2IQC A;  2XPZ A;  4A1G A;  3U4T A;  3Q7F A;  5JJ6 A;  2QYU A;  4HRM B;  4UWL A;  4G8K A;  5BUZ A;  5EID A;  4BES A;  5HKP A;  1UN9 A;  5C1D A;  3V2X A;  5ENP D;  3SI5 A;  3PE4 A;  1DCQ A;  3ZYM A;  3CHO A;  3L54 A;  3DEO A;  4L7T A; 
#chains in the Genus database with same CATH homology
 3CK9 A;  2IF4 A;  2IOL A;  2R5S A;  2YHE A;  2YIN A;  4HS2 A;  4JEU A;  4EZJ A;  3MYV A;  4GPK A;  4G23 A;  3JQ0 A;  4GZ3 A;  3FUM A;  5LP0 A;  2WVI A;  3TXN A;  4I6E A;  1TEZ A;  3GZ1 A;  1L5J A;  3UMV A;  4EEC A;  1DNP A;  1HO8 A;  1IHG A;  4CT4 A;  4GCN A;  3FTY A;  4A3V A;  4AM9 A;  4ANU A;  2NC9 A;  2J4B A;  4BTA A;  5JHB A;  4KXK B;  3CK7 A;  5AEN A;  5BV0 A;  4LRZ A;  4CDM A;  3LCA A;  4J6I A;  1BPO A;  3CQC B;  5ANR A;  3SZ7 A;  4UWG A;  1FVF A;  3MKR A;  2XRY A;  4AP2 A;  3MV2 B;  4I6J A;  3AU5 A;  3G2V A;  3UT7 A;  1PY1 A;  4JHK A;  4JL0 A;  4YND A;  1HZ4 A;  3TAX A;  4APO A;  4DK5 A;  3CVW A;  2ION A;  1HS6 A;  3MV3 B;  4V3I A;  4U63 A;  4R7L A;  4RVB A;  4IUL A;  3RO2 A;  2X6I A;  3QWV A;  3SBS A;  3L6A A;  2J9Q A;  3CR3 A;  4I43 A;  3PRZ A;  2WXN A;  3D3M A;  2VSY A;  2WXL A;  3PEU B;  3ESL A;  3QAQ A;  2AXV A;  3ZVV A;  5M72 A;  1A17 A;  4NUR A;  2E2E A;  1MHQ A;  5A7D B;  2L9B A;  3IEG A;  2PQN A;  3NQP A;  5KJL A;  3KAE A;  2WXM A;  4G25 A;  1EDU A;  3CLJ A;  4XX5 A;  5FQ7 A;  3GYZ A;  3LXU X;  5FQ4 A;  3MJW A;  4DI3 A;  3D9P A;  4FJZ A;  5BT1 A;  4HOR A;  4L2Y A;  2VSN A;  4I1A A;  4UI9 C;  4N3A A;  3AS4 A;  3FUH A;  1E7V A;  3KEZ A;  3MEK A;  5G05 J;  2X6K A;  3PUJ A;  3ZXS A;  2WQH A;  3NZS A;  2C0M A;  3FU3 A;  3FUN A;  3QWW A;  4I2Z A;  4KT6 B;  4Q96 A;  3RO3 A;  4AVX A;  2CHX A;  2P58 C;  3CIA A;  4XZ4 A;  1E7U A;  4F53 A;  4BFR A;  3ULQ A;  1HG5 A;  2OND A;  4QFV A;  3HVE B;  4NAC A;  3FUL A;  5CCM A;  4H7X A;  5LX8 A;  3Q47 B;  1QNF A;  4FU3 A;  1KLX A;  2GGF A;  3CKC A;  4BY6 A;  1U3D A;  4XKC A;  5EDS A;  4NQ0 A;  2J07 A;  2KZT B;  3FP3 A;  3FDH A;  3L13 A;  1ELK A;  4FLB A;  3B7T A;  4N3C A;  4N5C A;  4OVV A;  1ZU2 A;  5T4Y A;  4WNF A;  1JWG A;  1GW6 A;  3CHM A;  3QK0 A;  3HVE A;  4L23 A;  1NA3 A;  2C2L A;  1WM5 A;  2LSV A;  4G24 A;  2J49 A;  4N3B A;  1HG2 A;  2NXP A;  2WQ6 A;  2MRI A;  3CST A;  3FH8 A;  3OTN A;  1VDY A;  3VLE A;  2FEZ A;  2HR2 A;  2BUG A;  4I2W A;  5JJT A;  2XGS A;  1FCH A;  1OWL A;  4AXH A;  3TG4 A;  1H2V C;  4ANW A;  2WXO A;  4GYW A;  4DLO A;  4DPR A;  1ELR A;  3CV0 A;  2KZT A;  4UWK A;  5CMW A;  4FUL A;  5CCL A;  2J08 A;  2HO1 A;  4I9E A;  3SNX A;  1OWN A;  2I2O A;  4KMO A;  3FU5 A;  4WNG A;  2PM7 A;  4ME2 A;  2A5U A;  3FUK A;  4BSX A;  3ZHE A;  2AVP A;  4CCA A;  2FBN A;  4TV3 A;  3QNK A;  5E75 A;  2I6H A;  2XGM A;  3CVV A;  3FU0 A;  1W3B A;  5ENN A;  2QY7 A;  3ASD A;  2V5F A;  3IHV A;  3MZL B;  4Q69 A;  4N2S A;  2Y4T A;  4G2V A;  3B7S A;  4PS7 A;  3EIQ C;  1UG3 A;  2JLB A;  4UWH A;  3CVN A;  4JPS A;  3O4Z A;  2X3M A;  2PZI A;  3BG1 B;  2LNI A;  4ACK A;  2FF4 A;  2Q7F A;  4WWP A;  1HE8 A;  2OVF A;  4AJW A;  2GRM A;  2DBA A;  1Y6I A;  1TJF A;  3ONL A;  1SZA A;  3CGH A;  3LDZ A;  3HDX A;  3ASF A;  4FA6 A;  4GA0 A;  3S7J A;  1HH8 A;  2IFU A;  2XHE A;  4PH4 B;  4UQX A;  4XKB A;  4I17 A;  3VTY A;  4WAF A;  4JW1 A;  2BF0 X;  5FZS A;  1E8Y A;  4FLH A;  4JHR A;  1NP7 A;  4WUY A;  4DLQ A;  3QOU A;  3MA5 A;  4BX8 A;  3T8M A;  4EBA A;  2V0P A;  2XEV A;  3B7R L;  2VSO E;  3UQ3 A;  2GRL A;  1H19 A;  2VGY A;  4ACL A;  4K03 A;  1HFA A;  3D9O A;  4JZY A;  4U0Z A;  4ILG A;  4DI4 A;  3CVU A;  4XE0 A;  4CGV A;  4IRU A;  4JXT A;  4G26 A;  3ZHE B;  2WXQ A;  3T5X A;  4AIF A;  2L0I A;  3BEE A;  5T8I A;  3QB2 A;  4U0S A;  3L22 A;  3IBE A;  3FHE A;  4HVB A;  5J08 A;  4AOF A;  3ZPJ A;  3FH7 A;  3FUE A;  2IOS A;  3ZRH A;  3APC A;  3EHM A;  2CHZ A;  3AS8 A;  3UPV A;  2AXZ A;  3LVR E;  5KJN A;  4GU5 A;  4XIF A;  2KC7 A;  2XCB A;  3GZ2 A;  4BX9 A;  5FJY A;  2ILR A;  5ARG A;  1NZN A;  3VLF A;  1PC2 A;  1YA0 A;  4IN3 B;  4MRU A;  3FTV A;  3R7R A;  4ANV A;  4RSY A;  4I9C A;  4AEZ C;  3SBT B;  3B7U X;  5BPP A;  5ANL A;  2WXP A;  4C9B B;  4LCT A;  1H0A A;  4GMJ A;  1Z3Y A;  4GB9 A;  3CEQ A;  1HXI A;  4GML A;  4GYY A;  5DIZ A;  2X6F A;  3D9L A;  3D9I A;  2KCV A;  3GZS A;  3OXF A;  3PRE A;  2LAH A;  5D0Q D;  4CDR A;  4MKT A;  4BWR A;  4KZC A;  2WXH A;  3Q49 B;  2X6H A;  4J8D A;  4U04 A;  4APF A;  4J8S A;  3U66 A;  1NA0 A;  3FTX A;  5EKQ D;  5G55 A;  1UN8 A;  1PAQ A;  4B8A A;  3NF1 A;  3ZN3 A;  5AYW D;  2J4D A;  3UT4 A;  2WXR A;  3KS2 A;  1Y8M A;  2OOE A;  4FHJ A;  3DBS A;  5T3R A;  2WXI A;  3MKQ B;  5EX3 A;  1XNF A;  1QZ2 A;  3RRU A;  2CFZ A;  3EIJ A;  3Q5M A;  2Y3A A;  3D9K A;  2R59 A;  2VTB B;  5BNW A;  2YNQ A;  3RKV A;  4JA7 A;  4A3T A;  1MQS A;  3LY8 A;  4AY5 A;  4BTB A;  3D9M A;  3E4B A;  3G2T A;  5C2Y A;  2WXF A;  2I1K A;  4FP7 A;  5JJ7 A;  3JYS A;  3PH0 C;  3MX3 A;  2I1J A;  5CHE E;  2XRZ A;  4PS3 A;  4EBA G;  5FT9 A;  1EF1 C;  2KCL A;  1ELW A;  3FTZ A;  5FWQ A;  4FHK A;  4ILI A;  2VJ8 A;  1IYG A;  4BT9 A;  2GW1 A;  4KVO A;  4XI9 A;  2XGO A;  4B94 A;  4JC8 A;  5A23 A;  3ZFW A;  2AXU A;  1IQU A;  3UUX A;  3ZIM A;  4J8F A;  4I6G A;  3LEW A;  2XQ0 A;  3QJZ A;  3ZYQ A;  4E85 A;  2LAI A;  2BTD A;  3FH5 A;  1KT0 A;  3S7B A;  3RIB A;  1OWO A;  2DCP A;  2YQ8 A;  2HM8 A;  3JQ1 A;  4WNE A;  2X6J A;  3TGO A;  3IKO B;  4U07 A;  5FQ8 A;  2WB2 A;  4LUN U;  3I4R B;  4AV7 A;  4OYS A;  4ILH B;  3HIZ A;  2V8S E;  4NRH B;  3UX4 A;  3OXG A;  3SGH A;  4B89 A;  4URK A;  2FI7 A;  4EQF A;  3TXM A;  4WND A;  3O48 A;  3CQG B;  5FQ6 A;  3QWP A;  3N71 A;  3P1U A;  5LCW C;  3MKQ A;  3T5V A;  4Y6C A;  1E90 A;  1INZ A;  3PEV B;  1E8W A;  4KYO B;  3PZD A;  4G11 A;  3NZU A;  4U0U A;  3LJ3 A;  4LER A;  3IHY A;  4FAD A;  4HOS A;  3ZW3 A;  1H2T C;  2PQR A;  2UY1 A;  2XPY A;  3FEY A;  3CVY A;  1UJJ A;  4GZ5 A;  2UWJ G;  2LO6 A;  5KJM A;  3HHM A;  3PS6 A;  4GAA A;  2VGX B;  4ANX A;  4C0M A;  4M3O A;  4GCO A;  5AJL A;  4UI9 J;  4HFG A;  4G1T A;  3PUK A;  3ZEF A;  4TUU A;  3FTS A;  4CEM A;  1UW4 B;  3DPD A;  4I1O B;  1Z3X A;  5EX0 A;  4L2L A;  3RU0 A;  4YVQ C;  3VLD A;  3CK8 A;  4U8H A;  4A1S A;  3CVP A;  4MLP A;  3CVX A;  4ATG A;  2DIW A;  4B8C B;  4Q94 A;  3ZGQ A;  1Z6T A;  3FUF A;  3ASH A;  4RG9 A;  3ASG A;  1JWF A;  3TL5 A;  3JUI A;  5A6C A;  2AWI A;  3EDT B;  1X5B A;  3D9N A;  3PVL A;  2E0I A;  1E96 B;  3EJN A;  4FJY A;  4C0E A;  2J09 A;  4Y6W A;  1WAO 1;  4HLE A;  2ZU6 B;  3D9J A;  4GZD A;  4KVM A;  5E76 A;  1SQM A;  3RRN B;  3CKB A;  4UWF A;  3FU6 A;  3SF4 A;  3P2B A;  4BT8 A;  3SD5 A;  3C98 A;  3LYA A;  5KCM A;  3VTX A;  4B0Z A;  2WMO A;  1S0P A;  2CFU A;  4UI9 K;  4GA2 A;  3CVQ A;  5G05 C;  3QDN A;  3IV0 A;  4UQY A;  4EZK A;  5LOZ A;  1OUV A;  4ABN A;  2VGX A;  3ENE A;  3U3W A;  3L17 A;  3I4G A;  4GA1 A;  4KBQ A;  1KT1 A;  2XPI A;  3CSF A;  3FUI A;  4HXI A;  5FZR A;  1JPL A;  4TRQ A;  4DJA A;  5KJK A;  2IU1 A;  3K9I A;  4OVU A;  4F3V A;  3LY7 A;  2RD0 A;  3Q15 A;  2JEK A;  5LFA A;  2WQ7 A;  3LVQ E;  2QFC A;  3ML8 A;  4LEU A;  3FUD A;  3Q4A B;  3ZYK A;  1OWM A;  2MOW A;  4JVS A;  1H6K A;  1UJK A;  3ESK A;  3I5P A;  4XI0 A;  3UT8 A;  2RG8 A;  4UQZ A;  2OVB A;  4AY6 A;  3CHP A;  2Y4U A;  4F7A A;  4JEH A;  4N39 A;  2IJG X;  3CHQ A;  5G2N A;  2NSZ A;  4P29 A;  5ARF A;  5HI7 A;  3PE3 A;  2M63 A;  2YHC A;  3GW4 A;  3RK6 A;  3S7D A;  4F1S A;  4GZ6 A;  2EQX A;  2WPV A;  1ZBP A;  4E6H A;  1HX8 A;  4I1M A;  2CG3 A;  4IYP A;  4H7Y A;  3FWV A;  3G2S A;  3PNT B;  1SZ9 A;  2KM4 A;  1LF8 A;  4RG6 A;  2VTB A;  2OV8 A;  3SFZ A;  4GYO A;  3FEX A;  3RJV A;  2CG2 A;  3CHS A;  3PNL B;  3QC1 A;  4HOQ A;  5AJD A;  3S2A A;  2V4L A;  1H2U A;  2WMN A;  3G2W A;  4WWN A;  2WM9 A;  3ONK A;  3FY4 A;  4O6F A;  4EPZ A;  4A55 A;  2KAT A;  2WXJ A;  3LS8 A;  4CT0 A;  2PL2 A;  3APD A;  1E8Z A;  2HYZ A;  2I9C A;  1P5Q A;  4WWO A;  4L1B A;  2X38 A;  1QQE A;  4YVO A;  5FZQ A;  1OWP A;  1N52 A;  1EPU A;  2XCC A;  1JUQ A;  3S7F A;  3CHR A;  4HOT A;  3TJP A;  3B13 A;  1TJC A;  4GZC A;  4J8E A;  1IQR A;  1FVH A;  2UY1 B;  5BV1 A;  3FTU A;  4JHJ A;  5JHA A;  2C0L A;  1U3C A;  3OAW A;  3U9W A;  4MS6 A;  3AU4 A;  3EHN A;  3U64 A;  5FTP A;  1HF8 A;  3WXX A;  3LY9 A;  5LCW J;  3KD7 A;  2VYI A;  2WXG A;  3URZ A;  1B89 A;  2L6J A;  3AS5 A;  3JCK C;  3R9A B;  2WXK A;  5BW8 C;  4N2Q A;  1E8X A;  3G2U A;  5D0O D;  3APF A;  3MCX A;  3FTW A;  3QAR A;  3MGB A;  1WY6 A;  4PUC A;  4D10 C;  3RRM B;  2MHK A;  3L08 A;  4K0R A;  5DBK A;  3ML9 A;  2FO7 A;  2KCK A;  3I3N A;  4W9R A;  2IQC A;  2A4Z A;  3CVL A;  2XPZ A;  4JA9 A;  4A1G A;  3U4T A;  3TG5 A;  2R17 C;  5JJ6 A;  2VSX E;  5J90 A;  3LKU A;  3OXL A;  1XGW A;  4UWL A;  4PS8 A;  4PDX A;  1N54 A;  2VQ2 A;  3PDN A;  4CRW A;  5BUZ A;  3HYM B;  5G04 C;  1UN9 A;  3BG0 B;  5C1D A;  2AW6 A;  3FUJ A;  1DVP A;  5CMY A;  3SI5 A;  2FUL A;  2LSU A;  3PE4 A;  5HQ8 A;  4CGW A;  1EYH A;  3ZYM A;  3L16 A;  4HOU A;  5AIJ A;  3CHO A;  3L54 A;  3ZYL A;  2PM6 A;  3LPZ A;  4L7T A;  3SHF A;  4CDN A;  4FC8 A;  4J0U A;  5G04 J;  3FFL A;  1HU3 A;  3R7Q A;  4EZL A;  3QKY A;  4KZ0 A;  2L0T B;  2CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...