1OVBA

The mechanism of iron uptake by transferrins: the structure of an 18kd nii-domain fragment at 2.3 angstroms resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
159
structure length
159
Chain Sequence
b'SYYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAGWNIPIGTLIHREDIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLKDGKGDVAFVKHTTVQENAPEEKDEYELLCLDGSRQPVDSYKTCNWARVAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OVOTRANSFERRIN
publication title The mechanism of iron uptake by transferrins: the structure of an 18 kDa NII-domain fragment from duck ovotransferrin at 2.3 A resolution.
pubmed doi rcsb
source organism Anas sp.
molecule tags Iron transport protein
total genus 39
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1992-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ovbA00
4H5GA 1QULA 5ICQA 1FCKA 1USYE 5EHSA 5IKBA 1JEVA 3C4MA 4KQPA 1OLAA 3FUZA 1M5CA 3CFLA 5KDTB 1UTHB 1ZBMA 1B3LA 1MG1A 5DVFA 4MF3A 4R6YA 3IJXB 3C9HA 1KWHA 2ALUA 5IAIA 1PDAA 3DM0A 4OFOA 4F19A 4LUBA 5L9MA 1NNTA 4QFKA 3TYHA 4HW8A 3CIJA 1LFIA 1LAXA 1B2HA 3HHGA 2REGA 4RJZA 4KCCA 5I2KB 2M8CA 4F2QA 1N3WA 3KBRA 2WKYA 4YB7A 4AB6A 3CG3A 5A5XA 4ZZEA 2O51A 3CFXA 3PU5A 3TCHA 1GGGA 4QFOA 2HXWA 1O63A 2AYSA 2H99A 1ZU0A 2PT2A 4G68B 4FORA 4OEUA 1NNKA 1FQDA 1QKAA 4C0RA 3K1PA 1FQFA 5CMBA 4NWDA 4KYDA 1S9TA 4MBPA 1II5A 1MQIA 3VE1B 3K6VA 1MQGA 1YAEA 4BDQA 3F11A 3TQWA 2XD2A 2XXUA 2PVUA 3SEWA 4JXIA 4XKRA 1N04A 4ZEKA 4LP2B 3VVEA 3IJOB 1GR2A 3ZSFA 1AL3A 2XXWA 2D21A 2QPQA 5HBCA 1DMBA 1MQJA 3IO4A 4QFNA 4L17A 3RNNA 4U4XA 2H9BA 2DSFA 4H65A 4POXA 2H98A 5CRYA 2OZZA 4Q30B 3SEYA 3LC8A 3VXBA 3N6UA 4I8CA 2Y7RA 2GHBA 2NUVA 5M2VA 4RK2A 4U22A 2Q89A 3C33A 2G29A 2ZYOA 2HQ0A 1AIVA 4YICA 4ELRA 1URDA 2QS4A 3MZ9A 1OQHA 1S50A 1HSJA 1B40A 3BBRA 1M5DA 4MFIA 1XVXA 3LSWA 3TZAA 1F9BA 5L9OA 3C31A 4M4GA 4PQJA 4YKPA 2XD3A 1XS5A 1USYH 2DVCA 2F34A 2H25A 2I6EA 1H43A 1SI1A 3IR1A 1SQYA 2F6GA 4HTGA 4NF5B 3TCGA 4H5FA 2QRYA 1Y3QA 1UTBA 4GXSB 3QYTA 1FTOA 1MY3A 1R9LA 4OYVA 3RGYA 5I2NA 1B5HA 3W9WA 4GD5A 4U1ZA 3MPKA 1WDNA 5CM6A 3JV9A 3UGWA 2XXTA 4GIZA 4I1DA 5K2YA 4Q0CA 4NE4A 4DIGA 3PUYE 4IO5A 5KCJA 4FIMA 2DWIA 3CSBA 4DCYA 5DT6A 3KSJA 2O7UA 4JWYA 1OMPA 1PBPA 3K1NA 3EF7A 3U94A 3H06B 4F3GA 4TLMB 3Q26A 1Y1ZA 4LA9A 2F5XA 3T96B 3IORA 1JW1A 1OLCA 2DE3A 2AL4A 1B7ZA 3R6UA 4EF1A 4BDMA 4YMBA 4IO3A 3R7XA 4H67A 4GL0A 1A8FA 5EYFA 1JETA 3H3GA 2O84X 3S9NC 2A5SA 1TWYA 4BDOA 3CI8A 4OMBA 1NNPA 1US5A 2VD3A 3HHFA 3N26A 1B6HA 3PD9A 2DWAA 2V3TA 4ESWA 1EZPA 1VR5A 1B52A 3GBBA 5DVIA 3KZGA 5A5XB 3FD3A 2RC9A 3RQTA 5CC2A 3V8XB 3MBPA 4QFLA 4F1VA 4ZZAA 3TFLA 1MQHA 2DS9A 2NVUB 3G3GA 4X48A 3CVGA 3U72A 4F31B 1N3XA 1B3EA 3OXNA 1R6ZA 1OQGA 2O1MA 1B0HA 1URSA 1DTGA 1MY2A 3PUXE 1JVXA 3FV2A 3RN8A 1LGBC 3ECRA 3QK6A 3E9XA 4ZEIA 1B7UA 2R71A 4OESA 2RC7A 2ONRA 2DE2A 4Q8RA 1EZOA 1MXVA 3G3HA 3H6UA 4OHNA 3H6VA 4BDNA 4ZDMA 1MY0A 4K3FA 3FJGA 4YAHX 1MDQA 2I58A 1SBPA 1SW1A 3I3VA 2I3VA 4P11A 4U23A 4PFUA 3VVFA 2XXVA 2ZMBA 3S9LC 3T9UA 3OOAA 5JEIA 3FXRA 3M3KA 3V89B 4DLDA 2O68A 3MWBA 2Y7PA 1UQWA 2CZLA 2F6PA 2OLBA 4GFRA 2UVJA 3MC2A 5DYHA 2BJJX 4POWA 3TCFA 4YKIA 1NNFA 1MPBA 4IY6A 3A09A 3FASA 3IOTA 2UXAA 3U93A 2PT1A 1H3DA 4XKPA 4N6PA 2I4BA 3EN3A 2D3IA 1LLSA 4MH5A 4Z0IA 4ISUA 1UTBB 1B0LA 1QUIA 3IB2A 3H4ZA 4X1BA 1MXWA 3SKPA 2NWJA 3MZBA 1LB8A 2DXRA 4ELPA 2PMSA 2UVHA 3GLBA 5JTYB 4PP0A 1ZLQA 1EH3A 1SVXB 4LVQA 4KFQA 3ODBA 5KCJB 3O2AA 3MVYA 3TAJA 3H7MA 4R74A 3MUQA 2E0SA 3E3KA 3HCQA 1Y1MA 3FVGA 1DTZA 3G3FA 4R73A 1SYIA 4H0WA 5ITOA 1J1NA 1JQFA 2YPNA 1VFEA 4OWDA 5ITPA 4YB6A 3FXUA 3Q27A 5J1DA 4I9DA 3TTNA 3V83A 3FJ7A 4KR5A 3RUMA 4DXCA 4U2RA 2CMOA 2RC8A 4KHZE 3PV0E 3R26A 4JBZA 4YKKA 1EZ9A 1JW4A 3H03A 3CRBA 3RLFE 3U8QA 4G2ZA 3KEIA 4Z7EA 3TMGA 3O6HA 4PETA 4PFYA 3B7DA 2A5TA 4EQ9A 4G68C 2H4IA 3M3FA 1JW5A 2ZNUA 1MXYA 4EF2A 4XIGQ 1TT1A 3RT8A 3MVZA 1B05A 1N76A 3K6WA 1YPNA 4FE8A 5AA2A 1NFTA 3MPLA 3KFMA 2AL5A 3OENA 4HCWA 2YLNA 2HZKA 1FQCA 2PX1A 3JZJA 4GF8A 5EHMA 4KCDA 3IX1A 4P0IA 4JB7A 4YU0A 3S9MC 3D4CA 3I6VA 4KYSA 2E1SA 3QUJA 1QUJA 3D4GA 1B1HA 4C1TA 3ZKKA 2X7QA 3OELA 3AXFA 1GV8A 1LCFA 1DPPA 4F3PA 5TP9A 2VD2A 3MZ1A 1IXGA 1GTKA 1B1XA 5H8QA 5KZTA 3T9XB 1ATGA 4IY5A 2O69A 4H8IA 3SEXA 1CE2A 1B46A 4O3CA 3K4UA 2Y7KA 4JWXA 2THIA 3QSLA 3DP4A 5ISUA 4DXUA 5FTIA 3TODA 1IZ1A 4MLVA 4RA1A 5CMKA 3L6GA 1SI0A 1PEBA 1VFDA 2QJEA 5K2XA 2FYIA 2ZXTA 2DYXA 1MS7A 1S7YA 1LAFE 1ZJLA 3TKDA 2DQVA 2AIXA 1US4A 3TEPA 2Q2CA 5AA3A 1Y9UA 5FHMA 3L6HA 1WODA 4NF4A 3KN7A 4OETA 2GHAA 3K02A 3CFZA 2ONKE 4F2OA 1H45A 4XXUA 4R6HA 4TLLB 3RY3A 4IGTA 2UYEA 3U92A 3E13X 4IO6A 2O7IA 2ESNA 4FAJA 2OBGA 5I56A 3UA8A 1A7LA 1IXHA 5AA2D 4EXKA 1I6AA 3HPIA 2XXPA 3ILUB 1B5JA 3H6WA 1Y4TA 1SYHA 4YKJA 5B70A 5I84A 2H5YA 3HV1A 1A54A 5JTYA 3VXCA 3EPEA 5BWJA 1HSEA 1H44A 2UYFA 2OCUA 2XXXA 1ANFA 4YZZA 1N7WA 5ELVA 3OEMA 4O3BA 3GZGA 3PGFA 3K6XA 1A40A 4ZEDA 1B4ZA 2I3WA 3TTKA 4EUOA 2IA4A 1BIYA 4LATA 1ZTYA 2Y7IA 5L9SA 3T93B 4F22A 5I57A 3PMXA 2B3BA 4EQ7A 3HO7A 1SW5A 3KSXA 5CBRA 1MRPA 4GL8A 1MXUA 2V84A 5FHOA 4KYEA 2QMXA 4TQUQ 4RPOA 4RPNA 1B3FA 3VLUA 2XXHA 3PPPA 3KN3A 4R9GA 3V5AA 3LR1A 3JYRA 3PD8A 2V3UA 4PFTA 1FTMA 1LFGA 3Q25A 5H8NA 2QS3A 3G3KA 4WEDA 1BP5A 3SEVA 4G4PA 2V25A 3KJTA 2A5TB 3IOUA 3RPWA 3T22A 3DP6A 4ESXA 2HFBA 3VLWA 1LSTA 2Q9TA 3KOSA 2OK2A 1Y20A 4KI0E 4DZ1A 3TDJA 3MW0A 5AA2B 2Z8EA 1IQ7A 3OO8A 3W9VA 5CBSA 1H76A 4U1OA 3TUSA 4H6DA 1P1OA 2XXIA 3C34A 1P1UA 1MH4A 3O29A 2I0BA 5FHNA 3ZS6A 4JDFA 1I6BA 4OFLA 4F29A 3OSQA 1MDP1 5AA4A 1MY4A 3K1MA 3T66A 4RY1A 4ZEBA 3GXAA 3Q29A 4JSOA 2GRVA 4P0GA 3T9VA 1L5TA 5TP9B 5CMCA 2V93A 5H8QB 4WXJA 2QSXA 1LAGE 3S4UA 4H1XA 4OZ9A 1FQBA 3O6GA 4GXAA 3OD7A 1MM6A 1OVTA 4OFJA 3B6TA 4F1YA 3OO6A 3BFUA 1RYOA 1JNFA 1R9QA 1P1NA 1NMUA 3LUYA 2Z8DA 1P1WA 3C36A 4FECA 3TTMA 3VLVA 1QUKA 3MP8A 4F1UA 1PB7A 4Q5TA 3TTRA 3MAMA 1IEJA 1XHYA 4AB5A 1FTJA 1B9JA 4OQOA 3KG2A 4FEBA 2OJTA 2UVGA 3RT6B 4HS7A 4NF4B 4GVOA 1D9YA 4F39A 4IO2A 3M8UA 3MP1A 4QHQA 1LFHA 1MH3A 2RCAA 4JSDA 3SETA 4LONB 1EU8A 1NH7A 4N13A 5H8HA 2D5WA 1HSLA 4R75A 2VGQA 5I56B 3QUFA 1JEUA 3OMBA 3S2VA 2ZNTA 3QXMA 3FVNA 4YB5A 1TXFA 4IO7A 3EHTA 3N94A 4F18A 1IITA 1FTLA 5TU0A 4E0WA 2F8DA 4QSEA 3TPAA 3K00A 4DCXA 2QL3A 4OTEA 1O7TA 5F1QA 2DWJA 4XKNA 2XX7A 3SERA 1MPCA 1D9VA 4U4SA 2F97A 2ONSA 3FVOA 3IL1B 3UIFA 1B32A 1PBQA 1MM7A 5CMMA 2IEEA 5I57B 4XTCQ 2XXRA 4LZ7A 1A8EA 1LAHE 3DP8A 2O1LA 3BKIB 1B4HA 1BTJA 2PBWA 4X1DA 4GLIA 1URGA 3RTFB 3PUVE 2GFEA 3A3UA 4C1UA 1PB9A 4NF8A 4G8HA 5I58A 1P99A 5I59A 1IUDA 3MQ9A 1UIVA 3OSRA 4BDLA 3TELA 4ELQA 1VSOA 4KD5A 4QSDA 2QMWA 3KOTA 4NMYA 2X7PA 3IB0A 5H8NB 1POTA 1XOCA 3OEKA 1B7HA 4UACA 4O3AA 4N07A 4U21A 4OENA 3IB1A 3A3CA 4QSCA 2RCBA 3C35A 2X26A 3HSTA 2OWSA 3PPQA 3E4RA 4OERA 2HAVA 3O6IA 3MVWA 4GQOA 1Y3PA 2G93A 4ZECA 2YJPA 4ECFA 4R2FA 5AE4A 2OWTA 1NKXA 1SD3A 4ZE9A 3K0VA 1Z7NE 2I0CA 3WAFA 3MVXA 1MXZA 3DELB 5F7VA 3QIMA 2PYYA 4I62A 4R6KA 1POY1 5H8FA 1SW4A 1NL5A 2ZYMA 1I69A 1WVJA 3B6WA 5AA4B 4ZS9A 4LQ5A 5HM4B 2R6GE 2XX9A 3UN6A 2I49A 4OEVA 1PC3A 5H8SA 1LBBA 1TFAA 3N6TA 3EHSA 3THIA 3IO6A 3FJMA 4OVJA 3VV5A 1SDXA 1YCJA 4NEDA 3UORA 2UVIA 2ABHA 2F78A 4IB2A 1Q1KA 2F35A 2QS2A 4WEPA 3PPNA 1B5IA 3IAZA 4WKMA 1XC1A 3Q28A 4XKQA 2V3QA 4H8JA 4F3SA 4RNSA 5BUUA 3UK4A 4G8NA 2ZYKA 2VOZA 3VVDA 3KJ7A 3OO9A 1MXXA 1Q35A 2ZYNA 2Z22A 1N7XA 5B7DA 1GVCA 1LCTA 3S9EA 3HN0A 3FGSA 4ZEFA 3G3JA 1B58A 5H8HB 3EQ1A 3PPRA 3FXQA 5TPAA 2QS1A 2VP1A 3MP6A 1RKMA 2RKMA 3O9PA 4RK9A 1XT8A 1Y3NA 2DOJA 4QRZA 3PUZE 4NF6A 5DEXA 2FA7A 2P1SA 3OO7A 3TQLA 4EDPA 4G77A 3W15C 4THIA 2KLFA 2NXOA 4NWCA 3FZVA 4F3BA 2P2AA 1AH5A 1N84A 1T0KA 4PFWA 1A55A 5ICTA 2Q8JA 2ANJA 3WAEA 3FATA 3IOWA 2I48A 5CI5A 3FVKA 3EHUA 2GH9A 4UA8A 1FW0A 1M5EA 1SW2A 5KDTA 3PMVA 1UTHA 1DOTA 4IGRA 3RTWB 2Z23A 3C32A 1IXCA 2Z8FA 3CR9A 4IO4A 1QW0A 4PE5B 4RYAA 4NF8B 5I58B 5I59B 2B3FA 3PPOA 2HEUA 2XHDA 4JWOA 3P7IA 3VFJA 2I4CA 1MPDA 2HAUA 4OXVA 5HPQA 3BFTA 3O66A 5I2KA 4EXLA 2Q88A 1Z7ME 3B6QA 1RYXA 2DE4A 3LSLA 1I6QA 4DE8A 3KN8A 4AQ4A 3FV1A 4ELOA 3CG1A 5AA1A 4GRKA 2F7CA 2DVZA 3UP9A 2Y84A 4G68A 3N5LA 1FQEA 4QFPA 1DSNA 4HCYA 1BLFA 5JK4A 3O97A 1JVYA 2ZNSA 1UIUA 5H8FB 2VHAA 1ELJA 2P0SA 1O64A 1DPEA 1B51A 1BKAA 4DXBA 2F7BA 3CSGA 1QJMA 3VDFA 4R9FA 4NTLA 1AOVA 3T9HB 2HCAA 3I5OA 2DP8A 3FIRA 5FTHA 2W7YA 3ILTB 4LZ8A 3SDFA 2DWHA 3ZKLA 3K01A 1B3HA 3USDA 1OIBA 4KPTA 3LSFB 3G3IA 3M3LA 3LSXA 3KGCA 3QAXA 4GOTA 1FTKA 1FQAA 4YMAA 1QKBA 2XX8A 1OVBA 1ZKBA 4ONYA 4MLQA 3H6TA 3ONMA 4QF9A 4E0XA 3PUWE 4M1VA 1LBCA 2F36A 1LB9A 4RXLA 4ND9A 3LBSA 1ZMGA 1B3GA 3PMWA 1Y4CA 3DLNA 1IXIA 4LZ5A 3GBAA 4FJPA 5LOMA 2XXQA 1MQDA 3G7WA 3TTLA 1N0TA 1QVSA 3K6UA 3SEUA 4BDRA 3MJNA 5DTBA 3O28A 5DVJA 1YTVA 2B65A 4TOZA 2RF1A 4FEDA 2O6AA 1XVYA 4NF5A 3SESA 3IOVA 1VE4A 4X9TA 2Q2AA 3IK6B 5TPAB 4ZE8A 4FATA 3U1OA 2FNCA 1CB6A 2HZLA 1R1NA 2Y7WA 1AMFA 4R2BA 4BLAA 2DXYA 5I2NB 2XXYA 2LAOA 2R9JA 1TFDA 1M5FA 1A99A 1MY1A 2RINA 3K2DA 4GWOA 2REJA 4EQBA 4G8MA 4NF6B 4DDDA 5DEXB 1D4NA 1IIWA 1P1QA 1M5BA 5L8DA 4R72A 1PB8A 2NOOA 1ZIUA 4LQ2A 1NH8A 2F7AA 1D3KA
chains in the Genus database with same CATH superfamily
4H5GA 1QULA 5ICQA 1FCKA 1USYE 5EHSA 5IKBA 1JEVA 3C4MA 4KQPA 1OLAA 3FUZA 1M5CA 3CFLA 5KDTB 2FIEA 1UTHB 1ZBMA 1B3LA 4FBPA 1MG1A 5DVFA 4MF3A 4R6YA 3IJXB 3FBPA 3C9HA 1KWHA 2ALUA 5EQ7A 1PDAA 5IAIA 1KA1A 3DM0A 4OFOA 4F19A 4LUBA 5L9MA 1NNTA 4QFKA 3TYHA 4HW8A 3CIJA 1LFIA 1LAXA 1B2HA 3HHGA 2REGA 4NQ8A 4RJZA 4KCCA 5I2KB 1DBZA 2M8CA 2B4LA 4F2QA 5ET6A 2XA5A 1N3WA 3KBRA 1RDZA 2WKYA 4YB7A 4AB6A 3CG3A 5A5XA 4ZZEA 2O51A 3CFXA 3PU5A 4MIJA 3TCHA 1GGGA 4QFOA 2HXWA 2XWVA 5IZ1A 1O63A 2AYSA 2H99A 3BIGA 1ZU0A 2PT2A 4G68B 4FORA 4OEUA 1NNKA 1FQDA 1QKAA 4C0RA 3K1PA 1FQFA 5CMBA 4NWDA 4KYDA 1S9TA 4MBPA 1II5A 1MQIA 3VE1B 4MJOA 3K6VA 1MQGA 1YAEA 4BDQA 3F11A 3TQWA 2XD2A 2XXUA 2PVUA 1BK4A 3SEWA 4JXIA 4XKRA 1N04A 4ZEKA 4LP2B 3VVEA 3IJOB 1GR2A 3ZSFA 1AL3A 2XXWA 1AWBA 2D21A 2QPQA 5HBCA 1DMBA 1MQJA 3IO4A 4QFNA 4L17A 3RNNA 4U4XA 2H9BA 2DSFA 3E78A 4H65A 4POXA 2H98A 5CRYA 1FBPA 2OZZA 4Q30B 3SEYA 3LC8A 3VXBA 3N6UA 4I8CA 4OVSA 2Y7RA 5ET5A 2GHBA 2NUVA 5M2VA 4RK2A 4U22A 2Q89A 3C33A 2HPGA 2G29A 2ZYOA 2HQ0A 1AIVA 4YICA 4ELRA 1URDA 3IFAA 2QS4A 3MZ9A 1OQHA 1S50A 1HSJA 1B40A 3BBRA 1M5DA 4MFIA 4MNIA 1XVXA 3LSWA 3TZAA 1F9BA 5L9OA 3C31A 4M4GA 4PQJA 4YKPA 2XD3A 1XS5A 1USYH 2DVCA 1FPFA 2F34A 2H25A 1FBFA 2I6EA 1H43A 1SI1A 3IR1A 1SQYA 2F6GA 4HTGA 4NF5B 3TCGA 4H5FA 2QRYA 1Y3QA 1UTBA 4GXSB 3QYTA 1FTOA 1MY3A 1R9LA 2FBPA 4NX1A 4OYVA 1KA0A 1FSAA 3RGYA 1IMEA 4AS4A 5I2NA 1B5HA 3W9WA 4GD5A 4U1ZA 5EQ8A 3MPKA 1WDNA 5CM6A 3JV9A 3UGWA 5FBPA 2PFZA 1NV2A 2XXTA 4GIZA 4I1DA 5K2YA 3KBZA 1G0HA 4Q0CA 2XWOA 2HXRA 4NE4A 4DIGA 3PUYE 4IO5A 5KCJA 4FIMA 2DWIA 3CSBA 4DCYA 5DT6A 3KSJA 2O7UA 4JWYA 1OMPA 1PBPA 4N6KA 3K1NA 4N6DA 3EF7A 1RDYA 3U94A 3H06B 4P56A 2WEFA 4F3GA 2FIXA 4TLMB 3Q26A 1Y1ZA 4LA9A 2F5XA 3T96B 3IORA 1JW1A 1OLCA 3ISPA 2DE3A 4MX6A 2AL4A 1B7ZA 3R6UA 4EF1A 4BDMA 4YMBA 4IO3A 4P1LA 3R7XA 4H67A 2QVVA 4GL0A 4IR8A 1A8FA 5EYFA 1JETA 3H3GA 2O84X 3S9NC 1LBYA 2A5SA 1TWYA 4BDOA 3CI8A 4OMBA 1NNPA 1US5A 2VD3A 3HHFA 3N26A 1B6HA 3PD9A 2DWAA 2V3TA 4ESWA 1EZPA 1VR5A 1B52A 3GBBA 5DVIA 3KZGA 5A5XB 2QVRA 3FD3A 2RC9A 3B8BA 3RQTA 5CC2A 5I3SA 3V8XB 3MBPA 4QFLA 4F1VA 4ZZAA 3TFLA 3LV0A 1MQHA 2DS9A 2NVUB 3G3GA 4GX4A 4X48A 3CVGA 3U72A 4F31B 1N3XA 1B3EA 3OXNA 1R6ZA 1OQGA 2O1MA 1B0HA 1URSA 1DTGA 2CEXA 1MY2A 3PUXE 1FPLA 1JVXA 3FV2A 3RN8A 1LGBC 4DI3D 1FPEA 1K9YA 4MHFA 3ECRA 3QK6A 3E9XA 4ZEIA 1B7UA 2R71A 4OESA 2RC7A 1FBGA 2ONRA 2DE2A 3BIHA 4Q8RA 1NV7A 1EZOA 3ROJA 1MXVA 3G3HA 5T3JA 3H6UA 4OHNA 3H6VA 4BDNA 4ZDMA 1NV5A 1MY0A 3D1RA 4K3FA 2V4CA 3FJGA 4YAHX 1MDQA 2I58A 1SBPA 1SW1A 3I3VA 2I3VA 4P11A 4U23A 4PFUA 3VVFA 4GX3A 5ESYA 2XXVA 1IMAA 2ZMBA 3S9LC 3T9UA 3OOAA 5JEIA 3FXRA 3M3KA 3V89B 5A5LA 2ZZWA 4DLDA 2O68A 3MWBA 2Y7PA 1UQWA 2CZLA 4PGPA 2F6PA 2OLBA 4GFRA 2UVJA 3MC2A 5DYHA 2BJJX 4POWA 3TCFA 4YKIA 1NNFA 1MPBA 4IY6A 3A09A 3QMFA 3FASA 4PFRA 4PF8A 3IOTA 2UXAA 3U93A 5I7IA 2PT1A 1H3DA 4XKPA 1FPIA 4N6PA 2I4BA 3EN3A 2D3IA 1LLSA 4MH5A 4Z0IA 3EKIA 4ISUA 2ZZVA 1UTBB 1B0LA 4OA4A 1QUIA 3IB2A 3H4ZA 1FBDA 4X1BA 1MXWA 3SKPA 2NWJA 3MZBA 1LB8A 2DXRA 4ELPA 2PMSA 2UVHA 3GLBA 5JTYB 4PP0A 1ZLQA 1EH3A 1SVXB 4LVQA 4KFQA 3ODBA 5KCJB 3O2AA 3MVYA 3TAJA 3H7MA 4R74A 3MUQA 1FPJA 2E0SA 1FBHA 4GWWA 3E3KA 3HCQA 1Y1MA 3FVGA 1DTZA 3G3FA 4R73A 1SYIA 4H0WA 5ITOA 1J1NA 1JQFA 2YPNA 3LUZA 1VFEA 4OWDA 1DK4A 2CZIA 5ITPA 4YB6A 3FXUA 3Q27A 5J1DA 4O7MA 4I9DA 3TTNA 3V83A 3FJ7A 4KR5A 3KC0A 3RUMA 4DXCA 4U2RA 2P3NA 2CMOA 2RC8A 4KHZE 3PV0E 4OVRA 3R26A 4JBZA 4YKKA 1EZ9A 1JW4A 3H03A 3CRBA 3RLFE 3U8QA 1IMCA 4G2ZA 3KEIA 4Z7EA 3TMGA 3O6HA 4PETA 4PAIA 4PFYA 3B7DA 2A5TA 4EQ9A 4G68C 2H4IA 3M3FA 1JW5A 2ZNUA 1MXYA 4EF2A 4UABA 4XIGQ 1TT1A 2R8TA 3RT8A 3MVZA 1B05A 1N76A 3K6WA 4I3YA 1YPNA 4FE8A 5AA2A 1NFTA 3MPLA 3KFMA 2AL5A 3OENA 4HCWA 2YLNA 2HZKA 1NUXA 1FQCA 2PX1A 3JZJA 4GF8A 5EHMA 1INPA 4KCDA 3IX1A 4P0IA 4JB7A 4YU0A 3S9MC 3D4CA 3RYDA 3I6VA 4KYSA 2E1SA 3QUJA 1QUJA 3D4GA 1LBZA 1B1HA 4C1TA 3ZKKA 2X7QA 3OELA 3AXFA 1GV8A 1LCFA 1DPPA 4F3PA 5TP9A 2VD2A 3MZ1A 1IXGA 1GTKA 1B1XA 5H8QA 5KZTA 3T9XB 1ATGA 4IY5A 2O69A 4H8IA 1VDWA 3SEXA 1CE2A 1B46A 4O3CA 3K4UA 4P47A 2Y7KA 4JWXA 2THIA 3QSLA 3DP4A 5ISUA 4DXUA 5FTIA 3TODA 1IZ1A 4MLVA 2QVUA 4RA1A 5IM2A 3L6GA 5CMKA 1SI0A 1PEBA 1VFDA 2WBDA 2QJEA 5K2XA 2FYIA 2ZXTA 2DYXA 1MS7A 4GWSA 1S7YA 1LAFE 1ZJLA 3TKDA 2DQVA 2AIXA 1US4A 5IZZA 3TEPA 2Q2CA 5AA3A 1Y9UA 3NOHA 5FHMA 5I5PA 3L6HA 1WODA 4NF4A 4XF5A 3KN7A 4OETA 2GHAA 1LBWA 4QXDA 3K02A 3CFZA 2ONKE 4F2OA 2P3VA 1H45A 4XXUA 4R6HA 4TLLB 3RY3A 4IGTA 2UYEA 1LBVA 3U92A 3E13X 4IO6A 2B4MA 1YZ0A 2O7IA 2ESNA 4FAJA 2OBGA 5I56A 3UA8A 1A7LA 1IXHA 5AA2D 4EXKA 3T0JA 1I6AA 3HPIA 2XXPA 3ILUB 1B5JA 3H6WA 1Y4TA 1SYHA 4YKJA 5B70A 5I84A 2H5YA 3HV1A 1A54A 5JTYA 2OX3A 3VXCA 3EPEA 3MYUA 5BWJA 1HSEA 1NUWA 1H44A 2UYFA 2OCUA 4PAFA 2XXXA 1ANFA 4NN3A 4YZZA 1N7WA 5ELVA 3OEMA 4O3BA 3GZGA 3PGFA 3K6XA 1A40A 3RPLA 4ZEDA 1B4ZA 2I3WA 3TTKA 4EUOA 2IA4A 1BIYA 4LATA 4N17A 4PTKA 1ZTYA 2Y7IA 5L9SA 3T93B 3CHGA 4F22A 1NV3A 5I57A 3PMXA 2B3BA 4EQ7A 4PFIA 3HO7A 1SW5A 3KSXA 5CBRA 4HXVA 1RDXA 1MRPA 4GL8A 1MXUA 1Q9DA 2V84A 5FHOA 4KYEA 2QMXA 4PC9A 4TQUQ 4N91A 4RPOA 4P8BA 4RPNA 1B3FA 3VLUA 2XXHA 3PPPA 3KN3A 4R9GA 3V5AA 3LR1A 3JYRA 3PD8A 2ZZXA 2V3UA 4PFTA 4PBHA 1FTMA 1LFGA 3Q25A 4GBWA 1SPIA 2XXKA 5H8NA 2QS3A 3G3KA 4WEDA 1BP5A 3SEVA 4G4PA 2V25A 3KJTA 5IZ3B 4MNCA 2A5TB 3IOUA 3RPWA 3T22A 1NV1A 3DP6A 4ESXA 2HFBA 3VLWA 1LSTA 2Q9TA 4GX6A 3KOSA 2OK2A 1Y20A 4KI0E 2QFLA 4DZ1A 3TDJA 3MW0A 4AS5A 5AA2B 2Z8EA 1IQ7A 3OO8A 4HE0A 3W9VA 5CBSA 1H76A 4U1OA 5EQ9A 3GYYA 3TUSA 4H6DA 1P1OA 2XXIA 3C34A 1P1UA 1MH4A 2BJIA 2I0BA 3O29A 5FHNA 3ZS6A 4JDFA 1I6BA 4OFLA 4NHBA 4F29A 3OSQA 1MDP1 5AA4A 1MY4A 3IFCA 3K1MA 3T66A 4RY1A 4ZEBA 1CNQA 3GXAA 3Q29A 4JSOA 2GRVA 4P0GA 3T9VA 1L5TA 5TP9B 5CMCA 1FBEA 1G0IA 2V93A 2WYKA 4N8GA 5H8QB 2PFYA 4WXJA 2QSXA 1LAGE 3S4UA 4H1XA 4OZ9A 1FQBA 3O6GA 4GXAA 3OD7A 1MM6A 1OVTA 4OFJA 3B6TA 4F1YA 3OO6A 3BFUA 1RYOA 1JNFA 2GQ1A 4GWYA 1R9QA 1P1NA 1NMUA 3LUYA 2Z8DA 1P1WA 3C36A 4FECA 3TTMA 3VLVA 1LBXA 1QUKA 3MP8A 4F1UA 1EYKA 1PB7A 4P3LA 4Q5TA 3TTRA 3MAMA 1IEJA 1XHYA 4AB5A 4QBAA 1FTJA 1B9JA 4OQOA 4PFBA 3KG2A 4X8RA 4FEBA 2OJTA 4N4UA 4LN5A 2UVGA 2XWIA 3RT6B 4HS7A 4HE1A 4NF4B 4GVOA 1D9YA 4F39A 4IO2A 3M8UA 3MP1A 4QHQA 1LFHA 1MH3A 2RCAA 4JSDA 3SETA 4LONB 1EU8A 1NH7A 4N13A 2MKZA 2D5WA 5H8HA 1HSLA 4R75A 2VGQA 5I56B 3QUFA 1JEUA 3OMBA 3S2VA 2DDKA 2ZNTA 3QXMA 3FVNA 4YB5A 1TXFA 4IO7A 3EHTA 3N94A 4F18A 1IITA 2Q74A 1FTLA 2FHYA 5DW8A 5TU0A 4E0WA 2F8DA 4GWZA 4QSEA 3TPAA 4OVQA 3K00A 4DCXA 2QL3A 3KC1A 4OTEA 4GWXA 1O7TA 5F1QA 2DWJA 4JVDA 3RPLB 3PTYA 4XKNA 2XX7A 1FPKA 3SERA 1MPCA 1D9VA 2HHMA 4U4SA 2F97A 2ONSA 3FVOA 3IL1B 2CEYA 3UIFA 1B32A 1PBQA 1NV0A 1MM7A 5CMMA 2IEEA 5I57B 4XTCQ 2FVZA 2XXRA 4LZ7A 1A8EA 1LAHE 3DP8A 4PF6A 2O1LA 5LDZA 3BKIB 1B4HA 1BTJA 2PBWA 4X1DA 4GLIA 1URGA 3PUVE 2GFEA 3RTFB 4XEQA 4NGUA 3A3UA 4C1UA 1PB9A 4NF8A 3SZPA 4G8HA 5I58A 1P99A 5I59A 1IUDA 3MQ9A 1UIVA 3OSRA 4I3EA 4BDLA 4NF0A 3TELA 4ELQA 1VSOA 4KD5A 2WBBA 4QSDA 2QMWA 5IZ3A 3KOTA 4NMYA 2X7PA 3IB0A 5H8NB 1POTA 1XOCA 3OEKA 1NV4A 1B7HA 4UACA 4O3AA 4N07A 4U21A 4OENA 4H46A 4PDDA 3IB1A 3A3CA 5F24A 4QSCA 2RCBA 3C35A 2X26A 3HSTA 2OWSA 3PPQA 4NAPA 3E4RA 1QGXA 4OERA 2CZHA 2HAVA 2JJKA 4P9KA 3O6IA 4DI4B 3MVWA 4GQOA 1Y3PA 2G93A 4ZECA 2YJPA 4N8YA 4ECFA 4R2FA 5AE4A 1YXIA 2OWTA 1NKXA 1SD3A 4ZE9A 3K0VA 1NUYA 1Z7NE 2I0CA 3WAFA 3MVXA 1MXZA 3DELB 5F7VA 2VPNA 3QIMA 4NG7A 2PYYA 4I62A 4R6KA 1POY1 5H8FA 1SW4A 1NL5A 2ZYMA 1I69A 1WVJA 3B6WA 5AA4B 4ZS9A 4LQ5A 2WX9A 5HM4B 2R6GE 2XX9A 3UN6A 2I49A 4OEVA 1FPGA 1PC3A 2KQZA 5H8SA 1LBBA 1TFAA 3N6TA 3EHSA 3THIA 3IO6A 3FJMA 4OVJA 4MMPA 3VV5A 1SDXA 4PGNA 1YCJA 4NEDA 3UORA 2UVIA 4O94A 2ABHA 3MSTA 2F78A 4IB2A 1LEVA 1Q1KA 2F35A 2QS2A 4WEPA 3PPNA 1B5IA 2CZKA 4PDHA 3IAZA 4WKMA 1XC1A 3Q28A 4XKQA 4MNPA 2V3QA 4H8JA 4F3SA 4RNSA 5BUUA 3UK4A 4G8NA 2ZYKA 2VOZA 3VVDA 5ET7A 3KJ7A 3OO9A 1MXXA 4PBQA 4PE3A 1Q35A 2ZYNA 2Z22A 1N7XA 4MEVA 3T1BA 5B7DA 1GVCA 4GWUA 1LCTA 3S9EA 3HN0A 3FGSA 4ZEFA 3G3JA 1B58A 5H8HB 4PAKA 3EQ1A 3PPRA 3FXQA 5TPAA 2QS1A 2VP1A 3MP6A 1RKMA 2RKMA 3O9PA 4RK9A 1XT8A 1Y3NA 2DOJA 4QRZA 5EQAA 3PUZE 4NF6A 5DEXA 2FA7A 2P1SA 3OO7A 3TQLA 4EDPA 1FPBA 4G77A 3W15C 4THIA 2KLFA 2NXOA 4NWCA 3FZVA 4F3BA 3B50A 2P2AA 2XWKA 1AH5A 4XFEA 1N84A 1T0KA 4PFWA 1A55A 4G61A 5ICTA 2Q8JA 2ANJA 3WAEA 3FATA 3IOWA 2OWZA 2I48A 5CI5A 3FVKA 3EHUA 1FJ9A 2GH9A 4UA8A 1FW0A 1XI6A 1M5EA 1SW2A 5KDTA 1NI9A 3PMVA 1UTHA 1DOTA 4IGRA 3RTWB 2Z23A 1FBCA 3C32A 1IXCA 2Z8FA 3CR9A 4JVIA 4IO4A 1QW0A 4PE5B 4RYAA 4NF8B 5I58B 5I59B 4P1EA 2VPOA 2B3FA 3FXBA 2Y5KA 3PPOA 4X04A 2HEUA 2XHDA 4JWOA 3P7IA 3VFJA 1EYIA 2I4CA 1MPDA 2HAUA 4OXVA 5EYHA 5HPQA 3BFTA 3O66A 5I2KA 4EXLA 3A29A 1YYZA 2Q88A 1Z7ME 3B6QA 1RYXA 2DE4A 3LSLA 1I6QA 4DE8A 3KN8A 4AQ4A 3FV1A 4ELOA 5IGAA 3CG1A 5AA1A 4GRKA 2F7CA 4H45A 2DVZA 3UP9A 2Y84A 4G68A 1IMBA 4GBVA 1NUZA 3N5LA 1FQEA 4QFPA 2KR0A 1DSNA 3E79A 4HCYA 1BLFA 5JK4A 3O97A 1JVYA 2ZNSA 4MAGA 1UIUA 5H8FB 2VHAA 2F3BA 2PCRA 1ELJA 2P0SA 1O64A 1DPEA 4O8MA 1B51A 4MCOA 1BKAA 4DXBA 2F7BA 3CSGA 5ET8A 1IMFA 1QJMA 3VDFA 4OVPA 3U65A 4R9FA 4NTLA 1AOVA 3T9HB 2HCAA 3I5OA 2DP8A 3FIRA 4KXPA 5FTHA 2W7YA 3ILTB 4LZ8A 3SDFA 2DWHA 3ZKLA 3K01A 1B3HA 3USDA 1OIBA 1JP4A 4KPTA 3LSFB 3G3IA 3M3LA 3LSXA 3KGCA 3QAXA 1FJ6A 2WYPA 4GOTA 1DCUA 1FTKA 1FQAA 4YMAA 1QKBA 2XX8A 1EYJA 1OVBA 1ZKBA 4MLQA 4ONYA 3H6TA 3ONMA 4QF9A 4E0XA 3PUWE 4M1VA 4N15A 1LBCA 2F36A 1LB9A 5J16A 4RXLA 4ND9A 3LBSA 1ZMGA 1B3GA 3HFUA 3PMWA 1D9QA 1Y4CA 3DLNA 1IXIA 4JVCA 4LZ5A 3GBAA 4FJPA 4OVTA 2VT5A 5LOMA 2XXQA 1MQDA 3G7WA 1IMDA 2F3DA 3TTLA 1N0TA 1QVSA 3K6UA 3SEUA 4BDRA 3MJNA 1FPDA 5DTBA 3O28A 5DVJA 1YTVA 2B65A 4TOZA 2RF1A 4FEDA 4PCDA 2L5VA 2O6AA 1XVYA 4N81A 4NF5A 3SESA 3IOVA 5LTCA 5EYGA 1K9ZA 1VE4A 4X9TA 2Q2AA 3IK6B 5TPAB 4ZE8A 4FATA 1FRPA 3U1OA 1FTAA 2FNCA 1CB6A 2HZLA 1R1NA 2Y7WA 1AMFA 4R2BA 4BLAA 2DXYA 4HE2A 4I40A 5I2NB 2XXYA 2LAOA 2R9JA 1TFDA 1M5FA 1A99A 1MY1A 2RINA 4OANA 3K2DA 1KZ8A 4GWOA 2REJA 4EQBA 4G8MA 4NF6B 4DDDA 5DEXB 1D4NA 1IIWA 1P1QA 2Y5LA 1M5BA 5L8DA 4R72A 1PB8A 2NOOA 2Q8MA 1ZIUA 4O7IA 4LQ2A 1NV6A 1NH8A 2F7AA 1D3KA
chains in the Genus database with same CATH topology
4H5GA 1QULA 5ICQA 1FCKA 1USYE 5EHSA 5IKBA 1JEVA 3C4MA 4KQPA 1OLAA 3FUZA 1M5CA 3CFLA 5KDTB 1UTHB 1ZBMA 1B3LA 1MG1A 5DVFA 4MF3A 4R6YA 3IJXB 3C9HA 1KWHA 2ALUA 5IAIA 1PDAA 3DM0A 4OFOA 4F19A 4LUBA 5L9MA 1NNTA 4QFKA 3TYHA 4HW8A 3CIJA 1LFIA 1LAXA 1B2HA 3HHGA 2REGA 4RJZA 4KCCA 5I2KB 2M8CA 4F2QA 1N3WA 3KBRA 2WKYA 4YB7A 4AB6A 3CG3A 5A5XA 4ZZEA 2O51A 3CFXA 3PU5A 3TCHA 1GGGA 4QFOA 2HXWA 1O63A 2AYSA 2H99A 1ZU0A 2PT2A 4G68B 4FORA 4OEUA 1NNKA 1FQDA 1QKAA 4C0RA 3K1PA 1FQFA 5CMBA 4NWDA 4KYDA 1S9TA 4MBPA 1II5A 1MQIA 3VE1B 3K6VA 1MQGA 1YAEA 4BDQA 3F11A 3TQWA 2XD2A 2XXUA 2PVUA 3SEWA 4JXIA 4XKRA 1N04A 4ZEKA 4LP2B 3VVEA 3IJOB 1GR2A 3ZSFA 1AL3A 2XXWA 2D21A 2QPQA 5HBCA 1DMBA 1MQJA 3IO4A 4QFNA 4L17A 3RNNA 4U4XA 2H9BA 2DSFA 4H65A 4POXA 2H98A 5CRYA 2OZZA 4Q30B 3SEYA 3LC8A 3VXBA 3N6UA 4I8CA 2Y7RA 2GHBA 2NUVA 5M2VA 4RK2A 4U22A 2Q89A 3C33A 2G29A 2ZYOA 2HQ0A 1AIVA 4YICA 4ELRA 1URDA 2QS4A 3MZ9A 1OQHA 1S50A 1HSJA 1B40A 3BBRA 1M5DA 4MFIA 1XVXA 3LSWA 3TZAA 1F9BA 5L9OA 3C31A 4M4GA 4PQJA 4YKPA 2XD3A 1XS5A 1USYH 2DVCA 2F34A 2H25A 2I6EA 1H43A 1SI1A 3IR1A 1SQYA 2F6GA 4HTGA 4NF5B 3TCGA 4H5FA 2QRYA 1Y3QA 1UTBA 4GXSB 3QYTA 1FTOA 1MY3A 1R9LA 4OYVA 3RGYA 5I2NA 1B5HA 3W9WA 4GD5A 4U1ZA 3MPKA 1WDNA 5CM6A 3JV9A 3UGWA 2XXTA 4GIZA 4I1DA 5K2YA 4Q0CA 4NE4A 4DIGA 3PUYE 4IO5A 5KCJA 4FIMA 2DWIA 3CSBA 4DCYA 5DT6A 3KSJA 2O7UA 4JWYA 1OMPA 1PBPA 3K1NA 3EF7A 3U94A 3H06B 4F3GA 4TLMB 3Q26A 1Y1ZA 4LA9A 2F5XA 3T96B 3IORA 1JW1A 1OLCA 2DE3A 2AL4A 1B7ZA 3R6UA 4EF1A 4BDMA 4YMBA 4IO3A 3R7XA 4H67A 4GL0A 1A8FA 5EYFA 1JETA 3H3GA 2O84X 3S9NC 2A5SA 1TWYA 4BDOA 3CI8A 4OMBA 1NNPA 1US5A 2VD3A 3HHFA 3N26A 1B6HA 3PD9A 2DWAA 2V3TA 4ESWA 1EZPA 1VR5A 1B52A 3GBBA 5DVIA 3KZGA 5A5XB 3FD3A 2RC9A 3RQTA 5CC2A 3V8XB 3MBPA 4QFLA 4F1VA 4ZZAA 3TFLA 1MQHA 2DS9A 2NVUB 3G3GA 4X48A 3CVGA 3U72A 4F31B 1N3XA 1B3EA 3OXNA 1R6ZA 1OQGA 2O1MA 1B0HA 1URSA 1DTGA 1MY2A 3PUXE 1JVXA 3FV2A 3RN8A 1LGBC 3ECRA 3QK6A 3E9XA 4ZEIA 1B7UA 2R71A 4OESA 2RC7A 2ONRA 2DE2A 4Q8RA 1EZOA 1MXVA 3G3HA 3H6UA 4OHNA 3H6VA 4BDNA 4ZDMA 1MY0A 4K3FA 3FJGA 4YAHX 1MDQA 2I58A 1SBPA 1SW1A 3I3VA 2I3VA 4P11A 4U23A 4PFUA 3VVFA 2XXVA 2ZMBA 3S9LC 3T9UA 3OOAA 5JEIA 3FXRA 3M3KA 3V89B 4DLDA 2O68A 3MWBA 2Y7PA 1UQWA 2CZLA 2F6PA 2OLBA 4GFRA 2UVJA 3MC2A 5DYHA 2BJJX 4POWA 3TCFA 4YKIA 1NNFA 1MPBA 4IY6A 3A09A 3FASA 3IOTA 2UXAA 3U93A 2PT1A 1H3DA 4XKPA 4N6PA 2I4BA 3EN3A 2D3IA 1LLSA 4MH5A 4Z0IA 4ISUA 1UTBB 1B0LA 1QUIA 3IB2A 3H4ZA 4X1BA 1MXWA 3SKPA 2NWJA 3MZBA 1LB8A 2DXRA 4ELPA 2PMSA 2UVHA 3GLBA 5JTYB 4PP0A 1ZLQA 1EH3A 1SVXB 4LVQA 4KFQA 3ODBA 5KCJB 3O2AA 3MVYA 3TAJA 3H7MA 4R74A 3MUQA 2E0SA 3E3KA 3HCQA 1Y1MA 3FVGA 1DTZA 3G3FA 4R73A 1SYIA 4H0WA 5ITOA 1J1NA 1JQFA 2YPNA 1VFEA 4OWDA 5ITPA 4YB6A 3FXUA 3Q27A 5J1DA 4I9DA 3TTNA 3V83A 3FJ7A 4KR5A 3RUMA 4DXCA 4U2RA 2CMOA 2RC8A 4KHZE 3PV0E 3R26A 4JBZA 4YKKA 1EZ9A 1JW4A 3H03A 3CRBA 3RLFE 3U8QA 4G2ZA 3KEIA 4Z7EA 3TMGA 3O6HA 4PETA 4PFYA 3B7DA 2A5TA 4EQ9A 4G68C 2H4IA 3M3FA 1JW5A 2ZNUA 1MXYA 4EF2A 4XIGQ 1TT1A 3RT8A 3MVZA 1B05A 1N76A 3K6WA 1YPNA 4FE8A 5AA2A 1NFTA 3MPLA 3KFMA 2AL5A 3OENA 4HCWA 2YLNA 2HZKA 1FQCA 2PX1A 3JZJA 4GF8A 5EHMA 4KCDA 3IX1A 4P0IA 4JB7A 4YU0A 3S9MC 3D4CA 3I6VA 4KYSA 2E1SA 3QUJA 1QUJA 3D4GA 1B1HA 4C1TA 3ZKKA 2X7QA 3OELA 3AXFA 1GV8A 1LCFA 1DPPA 4F3PA 5TP9A 2VD2A 3MZ1A 1IXGA 1GTKA 1B1XA 5H8QA 5KZTA 3T9XB 1ATGA 4IY5A 2O69A 4H8IA 3SEXA 1CE2A 1B46A 4O3CA 3K4UA 2Y7KA 4JWXA 2THIA 3QSLA 3DP4A 5ISUA 4DXUA 5FTIA 3TODA 1IZ1A 4MLVA 4RA1A 5CMKA 3L6GA 1SI0A 1PEBA 1VFDA 2QJEA 5K2XA 2FYIA 2ZXTA 2DYXA 1MS7A 1S7YA 1LAFE 1ZJLA 3TKDA 2DQVA 2AIXA 1US4A 3TEPA 2Q2CA 5AA3A 1Y9UA 5FHMA 3L6HA 1WODA 4NF4A 3KN7A 4OETA 2GHAA 3K02A 3CFZA 2ONKE 4F2OA 1H45A 4XXUA 4R6HA 4TLLB 3RY3A 4IGTA 2UYEA 3U92A 3E13X 4IO6A 2O7IA 2ESNA 4FAJA 2OBGA 5I56A 3UA8A 1A7LA 1IXHA 5AA2D 4EXKA 1I6AA 3HPIA 2XXPA 3ILUB 1B5JA 3H6WA 1Y4TA 1SYHA 4YKJA 5B70A 5I84A 2H5YA 3HV1A 1A54A 5JTYA 3VXCA 3EPEA 5BWJA 1HSEA 1H44A 2UYFA 2OCUA 2XXXA 1ANFA 4YZZA 1N7WA 5ELVA 3OEMA 4O3BA 3GZGA 3PGFA 3K6XA 1A40A 4ZEDA 1B4ZA 2I3WA 3TTKA 4EUOA 2IA4A 1BIYA 4LATA 1ZTYA 2Y7IA 5L9SA 3T93B 4F22A 5I57A 3PMXA 2B3BA 4EQ7A 3HO7A 1SW5A 3KSXA 5CBRA 1MRPA 4GL8A 1MXUA 2V84A 5FHOA 4KYEA 2QMXA 4TQUQ 4RPOA 4RPNA 1B3FA 3VLUA 2XXHA 3PPPA 3KN3A 4R9GA 3V5AA 3LR1A 3JYRA 3PD8A 2V3UA 4PFTA 1FTMA 1LFGA 3Q25A 5H8NA 2QS3A 3G3KA 4WEDA 1BP5A 3SEVA 4G4PA 2V25A 3KJTA 2A5TB 3IOUA 3RPWA 3T22A 3DP6A 4ESXA 2HFBA 3VLWA 1LSTA 2Q9TA 3KOSA 2OK2A 1Y20A 4KI0E 4DZ1A 3TDJA 3MW0A 5AA2B 2Z8EA 1IQ7A 3OO8A 3W9VA 5CBSA 1H76A 4U1OA 3TUSA 4H6DA 1P1OA 2XXIA 3C34A 1P1UA 1MH4A 3O29A 2I0BA 5FHNA 3ZS6A 4JDFA 1I6BA 4OFLA 4F29A 3OSQA 1MDP1 5AA4A 1MY4A 3K1MA 3T66A 4RY1A 4ZEBA 3GXAA 3Q29A 4JSOA 2GRVA 4P0GA 3T9VA 1L5TA 5TP9B 5CMCA 2V93A 5H8QB 4WXJA 2QSXA 1LAGE 3S4UA 4H1XA 4OZ9A 1FQBA 3O6GA 4GXAA 3OD7A 1MM6A 1OVTA 4OFJA 3B6TA 4F1YA 3OO6A 3BFUA 1RYOA 1JNFA 1R9QA 1P1NA 1NMUA 3LUYA 2Z8DA 1P1WA 3C36A 4FECA 3TTMA 3VLVA 1QUKA 3MP8A 4F1UA 1PB7A 4Q5TA 3TTRA 3MAMA 1IEJA 1XHYA 4AB5A 1FTJA 1B9JA 4OQOA 3KG2A 4FEBA 2OJTA 2UVGA 3RT6B 4HS7A 4NF4B 4GVOA 1D9YA 4F39A 4IO2A 3M8UA 3MP1A 4QHQA 1LFHA 1MH3A 2RCAA 4JSDA 3SETA 4LONB 1EU8A 1NH7A 4N13A 5H8HA 2D5WA 1HSLA 4R75A 2VGQA 5I56B 3QUFA 1JEUA 3OMBA 3S2VA 2ZNTA 3QXMA 3FVNA 4YB5A 1TXFA 4IO7A 3EHTA 3N94A 4F18A 1IITA 1FTLA 5TU0A 4E0WA 2F8DA 4QSEA 3TPAA 3K00A 4DCXA 2QL3A 4OTEA 1O7TA 5F1QA 2DWJA 4XKNA 2XX7A 3SERA 1MPCA 1D9VA 4U4SA 2F97A 2ONSA 3FVOA 3IL1B 3UIFA 1B32A 1PBQA 1MM7A 5CMMA 2IEEA 5I57B 4XTCQ 2XXRA 4LZ7A 1A8EA 1LAHE 3DP8A 2O1LA 3BKIB 1B4HA 1BTJA 2PBWA 4X1DA 4GLIA 1URGA 3RTFB 3PUVE 2GFEA 3A3UA 4C1UA 1PB9A 4NF8A 4G8HA 5I58A 1P99A 5I59A 1IUDA 3MQ9A 1UIVA 3OSRA 4BDLA 3TELA 4ELQA 1VSOA 4KD5A 4QSDA 2QMWA 3KOTA 4NMYA 2X7PA 3IB0A 5H8NB 1POTA 1XOCA 3OEKA 1B7HA 4UACA 4O3AA 4N07A 4U21A 4OENA 3IB1A 3A3CA 4QSCA 2RCBA 3C35A 2X26A 3HSTA 2OWSA 3PPQA 3E4RA 4OERA 2HAVA 3O6IA 3MVWA 4GQOA 1Y3PA 2G93A 4ZECA 2YJPA 4ECFA 4R2FA 5AE4A 2OWTA 1NKXA 1SD3A 4ZE9A 3K0VA 1Z7NE 2I0CA 3WAFA 3MVXA 1MXZA 3DELB 5F7VA 3QIMA 2PYYA 4I62A 4R6KA 1POY1 5H8FA 1SW4A 1NL5A 2ZYMA 1I69A 1WVJA 3B6WA 5AA4B 4ZS9A 4LQ5A 5HM4B 2R6GE 2XX9A 3UN6A 2I49A 4OEVA 1PC3A 5H8SA 1LBBA 1TFAA 3N6TA 3EHSA 3THIA 3IO6A 3FJMA 4OVJA 3VV5A 1SDXA 1YCJA 4NEDA 3UORA 2UVIA 2ABHA 2F78A 4IB2A 1Q1KA 2F35A 2QS2A 4WEPA 3PPNA 1B5IA 3IAZA 4WKMA 1XC1A 3Q28A 4XKQA 2V3QA 4H8JA 4F3SA 4RNSA 5BUUA 3UK4A 4G8NA 2ZYKA 2VOZA 3VVDA 3KJ7A 3OO9A 1MXXA 1Q35A 2ZYNA 2Z22A 1N7XA 5B7DA 1GVCA 1LCTA 3S9EA 3HN0A 3FGSA 4ZEFA 3G3JA 1B58A 5H8HB 3EQ1A 3PPRA 3FXQA 5TPAA 2QS1A 2VP1A 3MP6A 1RKMA 2RKMA 3O9PA 4RK9A 1XT8A 1Y3NA 2DOJA 4QRZA 3PUZE 4NF6A 5DEXA 2FA7A 2P1SA 3OO7A 3TQLA 4EDPA 4G77A 3W15C 4THIA 2KLFA 2NXOA 4NWCA 3FZVA 4F3BA 2P2AA 1AH5A 1N84A 1T0KA 4PFWA 1A55A 5ICTA 2Q8JA 2ANJA 3WAEA 3FATA 3IOWA 2I48A 5CI5A 3FVKA 3EHUA 2GH9A 4UA8A 1FW0A 1M5EA 1SW2A 5KDTA 3PMVA 1UTHA 1DOTA 4IGRA 3RTWB 2Z23A 3C32A 1IXCA 2Z8FA 3CR9A 4IO4A 1QW0A 4PE5B 4RYAA 4NF8B 5I58B 5I59B 2B3FA 3PPOA 2HEUA 2XHDA 4JWOA 3P7IA 3VFJA 2I4CA 1MPDA 2HAUA 4OXVA 5HPQA 3BFTA 3O66A 5I2KA 4EXLA 2Q88A 1Z7ME 3B6QA 1RYXA 2DE4A 3LSLA 1I6QA 4DE8A 3KN8A 4AQ4A 3FV1A 4ELOA 3CG1A 5AA1A 4GRKA 2F7CA 2DVZA 3UP9A 2Y84A 4G68A 3N5LA 1FQEA 4QFPA 1DSNA 4HCYA 1BLFA 5JK4A 3O97A 1JVYA 2ZNSA 1UIUA 5H8FB 2VHAA 1ELJA 2P0SA 1O64A 1DPEA 1B51A 1BKAA 4DXBA 2F7BA 3CSGA 1QJMA 3VDFA 4R9FA 4NTLA 1AOVA 3T9HB 2HCAA 3I5OA 2DP8A 3FIRA 5FTHA 2W7YA 3ILTB 4LZ8A 3SDFA 2DWHA 3ZKLA 3K01A 1B3HA 3USDA 1OIBA 4KPTA 3LSFB 3G3IA 3M3LA 3LSXA 3KGCA 3QAXA 4GOTA 1FTKA 1FQAA 4YMAA 1QKBA 2XX8A 1OVBA 1ZKBA 4ONYA 4MLQA 3H6TA 3ONMA 4QF9A 4E0XA 3PUWE 4M1VA 1LBCA 2F36A 1LB9A 4RXLA 4ND9A 3LBSA 1ZMGA 1B3GA 3PMWA 1Y4CA 3DLNA 1IXIA 4LZ5A 3GBAA 4FJPA 5LOMA 2XXQA 1MQDA 3G7WA 3TTLA 1N0TA 1QVSA 3K6UA 3SEUA 4BDRA 3MJNA 5DTBA 3O28A 5DVJA 1YTVA 2B65A 4TOZA 2RF1A 4FEDA 2O6AA 1XVYA 4NF5A 3SESA 3IOVA 1VE4A 4X9TA 2Q2AA 3IK6B 5TPAB 4ZE8A 4FATA 3U1OA 2FNCA 1CB6A 2HZLA 1R1NA 2Y7WA 1AMFA 4R2BA 4BLAA 2DXYA 5I2NB 2XXYA 2LAOA 2R9JA 1TFDA 1M5FA 1A99A 1MY1A 2RINA 3K2DA 4GWOA 2REJA 4EQBA 4G8MA 4NF6B 4DDDA 5DEXB 1D4NA 1IIWA 1P1QA 1M5BA 5L8DA 4R72A 1PB8A 2NOOA 1ZIUA 4LQ2A 1NH8A 2F7AA 1D3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5G A;  1QUL A;  5ICQ A;  1FCK A;  1USY E;  5EHS A;  5IKB A;  1JEV A;  3C4M A;  4KQP A;  1OLA A;  3FUZ A;  1M5C A;  3CFL A;  5KDT B;  1UTH B;  1ZBM A;  1B3L A;  1MG1 A;  5DVF A;  4MF3 A;  4R6Y A;  3IJX B;  3C9H A;  1KWH A;  2ALU A;  5IAI A;  1PDA A;  3DM0 A;  4OFO A;  4F19 A;  4LUB A;  5L9M A;  1NNT A;  4QFK A;  3TYH A;  4HW8 A;  3CIJ A;  1LFI A;  1LAX A;  1B2H A;  3HHG A;  2REG A;  4RJZ A;  4KCC A;  5I2K B;  2M8C A;  4F2Q A;  1N3W A;  3KBR A;  2WKY A;  4YB7 A;  4AB6 A;  3CG3 A;  5A5X A;  4ZZE A;  2O51 A;  3CFX A;  3PU5 A;  3TCH A;  1GGG A;  4QFO A;  2HXW A;  1O63 A;  2AYS A;  2H99 A;  1ZU0 A;  2PT2 A;  4G68 B;  4FOR A;  4OEU A;  1NNK A;  1FQD A;  1QKA A;  4C0R A;  3K1P A;  1FQF A;  5CMB A;  4NWD A;  4KYD A;  1S9T A;  4MBP A;  1II5 A;  1MQI A;  3VE1 B;  3K6V A;  1MQG A;  1YAE A;  4BDQ A;  3F11 A;  3TQW A;  2XD2 A;  2XXU A;  2PVU A;  3SEW A;  4JXI A;  4XKR A;  1N04 A;  4ZEK A;  4LP2 B;  3VVE A;  3IJO B;  1GR2 A;  3ZSF A;  1AL3 A;  2XXW A;  2D21 A;  2QPQ A;  5HBC A;  1DMB A;  1MQJ A;  3IO4 A;  4QFN A;  4L17 A;  3RNN A;  4U4X A;  2H9B A;  2DSF A;  4H65 A;  4POX A;  2H98 A;  5CRY A;  2OZZ A;  4Q30 B;  3SEY A;  3LC8 A;  3VXB A;  3N6U A;  4I8C A;  2Y7R A;  2GHB A;  2NUV A;  5M2V A;  4RK2 A;  4U22 A;  2Q89 A;  3C33 A;  2G29 A;  2ZYO A;  2HQ0 A;  1AIV A;  4YIC A;  4ELR A;  1URD A;  2QS4 A;  3MZ9 A;  1OQH A;  1S50 A;  1HSJ A;  1B40 A;  3BBR A;  1M5D A;  4MFI A;  1XVX A;  3LSW A;  3TZA A;  1F9B A;  5L9O A;  3C31 A;  4M4G A;  4PQJ A;  4YKP A;  2XD3 A;  1XS5 A;  1USY H;  2DVC A;  2F34 A;  2H25 A;  2I6E A;  1H43 A;  1SI1 A;  3IR1 A;  1SQY A;  2F6G A;  4HTG A;  4NF5 B;  3TCG A;  4H5F A;  2QRY A;  1Y3Q A;  1UTB A;  4GXS B;  3QYT A;  1FTO A;  1MY3 A;  1R9L A;  4OYV A;  3RGY A;  5I2N A;  1B5H A;  3W9W A;  4GD5 A;  4U1Z A;  3MPK A;  1WDN A;  5CM6 A;  3JV9 A;  3UGW A;  2XXT A;  4GIZ A;  4I1D A;  5K2Y A;  4Q0C A;  4NE4 A;  4DIG A;  3PUY E;  4IO5 A;  5KCJ A;  4FIM A;  2DWI A;  3CSB A;  4DCY A;  5DT6 A;  3KSJ A;  2O7U A;  4JWY A;  1OMP A;  1PBP A;  3K1N A;  3EF7 A;  3U94 A;  3H06 B;  4F3G A;  4TLM B;  3Q26 A;  1Y1Z A;  4LA9 A;  2F5X A;  3T96 B;  3IOR A;  1JW1 A;  1OLC A;  2DE3 A;  2AL4 A;  1B7Z A;  3R6U A;  4EF1 A;  4BDM A;  4YMB A;  4IO3 A;  3R7X A;  4H67 A;  4GL0 A;  1A8F A;  5EYF A;  1JET A;  3H3G A;  2O84 X;  3S9N C;  2A5S A;  1TWY A;  4BDO A;  3CI8 A;  4OMB A;  1NNP A;  1US5 A;  2VD3 A;  3HHF A;  3N26 A;  1B6H A;  3PD9 A;  2DWA A;  2V3T A;  4ESW A;  1EZP A;  1VR5 A;  1B52 A;  3GBB A;  5DVI A;  3KZG A;  5A5X B;  3FD3 A;  2RC9 A;  3RQT A;  5CC2 A;  3V8X B;  3MBP A;  4QFL A;  4F1V A;  4ZZA A;  3TFL A;  1MQH A;  2DS9 A;  2NVU B;  3G3G A;  4X48 A;  3CVG A;  3U72 A;  4F31 B;  1N3X A;  1B3E A;  3OXN A;  1R6Z A;  1OQG A;  2O1M A;  1B0H A;  1URS A;  1DTG A;  1MY2 A;  3PUX E;  1JVX A;  3FV2 A;  3RN8 A;  1LGB C;  3ECR A;  3QK6 A;  3E9X A;  4ZEI A;  1B7U A;  2R71 A;  4OES A;  2RC7 A;  2ONR A;  2DE2 A;  4Q8R A;  1EZO A;  1MXV A;  3G3H A;  3H6U A;  4OHN A;  3H6V A;  4BDN A;  4ZDM A;  1MY0 A;  4K3F A;  3FJG A;  4YAH X;  1MDQ A;  2I58 A;  1SBP A;  1SW1 A;  3I3V A;  2I3V A;  4P11 A;  4U23 A;  4PFU A;  3VVF A;  2XXV A;  2ZMB A;  3S9L C;  3T9U A;  3OOA A;  5JEI A;  3FXR A;  3M3K A;  3V89 B;  4DLD A;  2O68 A;  3MWB A;  2Y7P A;  1UQW A;  2CZL A;  2F6P A;  2OLB A;  4GFR A;  2UVJ A;  3MC2 A;  5DYH A;  2BJJ X;  4POW A;  3TCF A;  4YKI A;  1NNF A;  1MPB A;  4IY6 A;  3A09 A;  3FAS A;  3IOT A;  2UXA A;  3U93 A;  2PT1 A;  1H3D A;  4XKP A;  4N6P A;  2I4B A;  3EN3 A;  2D3I A;  1LLS A;  4MH5 A;  4Z0I A;  4ISU A;  1UTB B;  1B0L A;  1QUI A;  3IB2 A;  3H4Z A;  4X1B A;  1MXW A;  3SKP A;  2NWJ A;  3MZB A;  1LB8 A;  2DXR A;  4ELP A;  2PMS A;  2UVH A;  3GLB A;  5JTY B;  4PP0 A;  1ZLQ A;  1EH3 A;  1SVX B;  4LVQ A;  4KFQ A;  3ODB A;  5KCJ B;  3O2A A;  3MVY A;  3TAJ A;  3H7M A;  4R74 A;  3MUQ A;  2E0S A;  3E3K A;  3HCQ A;  1Y1M A;  3FVG A;  1DTZ A;  3G3F A;  4R73 A;  1SYI A;  4H0W A;  5ITO A;  1J1N A;  1JQF A;  2YPN A;  1VFE A;  4OWD A;  5ITP A;  4YB6 A;  3FXU A;  3Q27 A;  5J1D A;  4I9D A;  3TTN A;  3V83 A;  3FJ7 A;  4KR5 A;  3RUM A;  4DXC A;  4U2R A;  2CMO A;  2RC8 A;  4KHZ E;  3PV0 E;  3R26 A;  4JBZ A;  4YKK A;  1EZ9 A;  1JW4 A;  3H03 A;  3CRB A;  3RLF E;  3U8Q A;  4G2Z A;  3KEI A;  4Z7E A;  3TMG A;  3O6H A;  4PET A;  4PFY A;  3B7D A;  2A5T A;  4EQ9 A;  4G68 C;  2H4I A;  3M3F A;  1JW5 A;  2ZNU A;  1MXY A;  4EF2 A;  4XIG Q;  1TT1 A;  3RT8 A;  3MVZ A;  1B05 A;  1N76 A;  3K6W A;  1YPN A;  4FE8 A;  5AA2 A;  1NFT A;  3MPL A;  3KFM A;  2AL5 A;  3OEN A;  4HCW A;  2YLN A;  2HZK A;  1FQC A;  2PX1 A;  3JZJ A;  4GF8 A;  5EHM A;  4KCD A;  3IX1 A;  4P0I A;  4JB7 A;  4YU0 A;  3S9M C;  3D4C A;  3I6V A;  4KYS A;  2E1S A;  3QUJ A;  1QUJ A;  3D4G A;  1B1H A;  4C1T A;  3ZKK A;  2X7Q A;  3OEL A;  3AXF A;  1GV8 A;  1LCF A;  1DPP A;  4F3P A;  5TP9 A;  2VD2 A;  3MZ1 A;  1IXG A;  1GTK A;  1B1X A;  5H8Q A;  5KZT A;  3T9X B;  1ATG A;  4IY5 A;  2O69 A;  4H8I A;  3SEX A;  1CE2 A;  1B46 A;  4O3C A;  3K4U A;  2Y7K A;  4JWX A;  2THI A;  3QSL A;  3DP4 A;  5ISU A;  4DXU A;  5FTI A;  3TOD A;  1IZ1 A;  4MLV A;  4RA1 A;  5CMK A;  3L6G A;  1SI0 A;  1PEB A;  1VFD A;  2QJE A;  5K2X A;  2FYI A;  2ZXT A;  2DYX A;  1MS7 A;  1S7Y A;  1LAF E;  1ZJL A;  3TKD A;  2DQV A;  2AIX A;  1US4 A;  3TEP A;  2Q2C A;  5AA3 A;  1Y9U A;  5FHM A;  3L6H A;  1WOD A;  4NF4 A;  3KN7 A;  4OET A;  2GHA A;  3K02 A;  3CFZ A;  2ONK E;  4F2O A;  1H45 A;  4XXU A;  4R6H A;  4TLL B;  3RY3 A;  4IGT A;  2UYE A;  3U92 A;  3E13 X;  4IO6 A;  2O7I A;  2ESN A;  4FAJ A;  2OBG A;  5I56 A;  3UA8 A;  1A7L A;  1IXH A;  5AA2 D;  4EXK A;  1I6A A;  3HPI A;  2XXP A;  3ILU B;  1B5J A;  3H6W A;  1Y4T A;  1SYH A;  4YKJ A;  5B70 A;  5I84 A;  2H5Y A;  3HV1 A;  1A54 A;  5JTY A;  3VXC A;  3EPE A;  5BWJ A;  1HSE A;  1H44 A;  2UYF A;  2OCU A;  2XXX A;  1ANF A;  4YZZ A;  1N7W A;  5ELV A;  3OEM A;  4O3B A;  3GZG A;  3PGF A;  3K6X A;  1A40 A;  4ZED A;  1B4Z A;  2I3W A;  3TTK A;  4EUO A;  2IA4 A;  1BIY A;  4LAT A;  1ZTY A;  2Y7I A;  5L9S A;  3T93 B;  4F22 A;  5I57 A;  3PMX A;  2B3B A;  4EQ7 A;  3HO7 A;  1SW5 A;  3KSX A;  5CBR A;  1MRP A;  4GL8 A;  1MXU A;  2V84 A;  5FHO A;  4KYE A;  2QMX A;  4TQU Q;  4RPO A;  4RPN A;  1B3F A;  3VLU A;  2XXH A;  3PPP A;  3KN3 A;  4R9G A;  3V5A A;  3LR1 A;  3JYR A;  3PD8 A;  2V3U A;  4PFT A;  1FTM A;  1LFG A;  3Q25 A;  5H8N A;  2QS3 A;  3G3K A;  4WED A;  1BP5 A;  3SEV A;  4G4P A;  2V25 A;  3KJT A;  2A5T B;  3IOU A;  3RPW A;  3T22 A;  3DP6 A;  4ESX A;  2HFB A;  3VLW A;  1LST A;  2Q9T A;  3KOS A;  2OK2 A;  1Y20 A;  4KI0 E;  4DZ1 A;  3TDJ A;  3MW0 A;  5AA2 B;  2Z8E A;  1IQ7 A;  3OO8 A;  3W9V A;  5CBS A;  1H76 A;  4U1O A;  3TUS A;  4H6D A;  1P1O A;  2XXI A;  3C34 A;  1P1U A;  1MH4 A;  3O29 A;  2I0B A;  5FHN A;  3ZS6 A;  4JDF A;  1I6B A;  4OFL A;  4F29 A;  3OSQ A;  1MDP 1;  5AA4 A;  1MY4 A;  3K1M A;  3T66 A;  4RY1 A;  4ZEB A;  3GXA A;  3Q29 A;  4JSO A;  2GRV A;  4P0G A;  3T9V A;  1L5T A;  5TP9 B;  5CMC A;  2V93 A;  5H8Q B;  4WXJ A;  2QSX A;  1LAG E;  3S4U A;  4H1X A;  4OZ9 A;  1FQB A;  3O6G A;  4GXA A;  3OD7 A;  1MM6 A;  1OVT A;  4OFJ A;  3B6T A;  4F1Y A;  3OO6 A;  3BFU A;  1RYO A;  1JNF A;  1R9Q A;  1P1N A;  1NMU A;  3LUY A;  2Z8D A;  1P1W A;  3C36 A;  4FEC A;  3TTM A;  3VLV A;  1QUK A;  3MP8 A;  4F1U A;  1PB7 A;  4Q5T A;  3TTR A;  3MAM A;  1IEJ A;  1XHY A;  4AB5 A;  1FTJ A;  1B9J A;  4OQO A;  3KG2 A;  4FEB A;  2OJT A;  2UVG A;  3RT6 B;  4HS7 A;  4NF4 B;  4GVO A;  1D9Y A;  4F39 A;  4IO2 A;  3M8U A;  3MP1 A;  4QHQ A;  1LFH A;  1MH3 A;  2RCA A;  4JSD A;  3SET A;  4LON B;  1EU8 A;  1NH7 A;  4N13 A;  5H8H A;  2D5W A;  1HSL A;  4R75 A;  2VGQ A;  5I56 B;  3QUF A;  1JEU A;  3OMB A;  3S2V A;  2ZNT A;  3QXM A;  3FVN A;  4YB5 A;  1TXF A;  4IO7 A;  3EHT A;  3N94 A;  4F18 A;  1IIT A;  1FTL A;  5TU0 A;  4E0W A;  2F8D A;  4QSE A;  3TPA A;  3K00 A;  4DCX A;  2QL3 A;  4OTE A;  1O7T A;  5F1Q A;  2DWJ A;  4XKN A;  2XX7 A;  3SER A;  1MPC A;  1D9V A;  4U4S A;  2F97 A;  2ONS A;  3FVO A;  3IL1 B;  3UIF A;  1B32 A;  1PBQ A;  1MM7 A;  5CMM A;  2IEE A;  5I57 B;  4XTC Q;  2XXR A;  4LZ7 A;  1A8E A;  1LAH E;  3DP8 A;  2O1L A;  3BKI B;  1B4H A;  1BTJ A;  2PBW A;  4X1D A;  4GLI A;  1URG A;  3RTF B;  3PUV E;  2GFE A;  3A3U A;  4C1U A;  1PB9 A;  4NF8 A;  4G8H A;  5I58 A;  1P99 A;  5I59 A;  1IUD A;  3MQ9 A;  1UIV A;  3OSR A;  4BDL A;  3TEL A;  4ELQ A;  1VSO A;  4KD5 A;  4QSD A;  2QMW A;  3KOT A;  4NMY A;  2X7P A;  3IB0 A;  5H8N B;  1POT A;  1XOC A;  3OEK A;  1B7H A;  4UAC A;  4O3A A;  4N07 A;  4U21 A;  4OEN A;  3IB1 A;  3A3C A;  4QSC A;  2RCB A;  3C35 A;  2X26 A;  3HST A;  2OWS A;  3PPQ A;  3E4R A;  4OER A;  2HAV A;  3O6I A;  3MVW A;  4GQO A;  1Y3P A;  2G93 A;  4ZEC A;  2YJP A;  4ECF A;  4R2F A;  5AE4 A;  2OWT A;  1NKX A;  1SD3 A;  4ZE9 A;  3K0V A;  1Z7N E;  2I0C A;  3WAF A;  3MVX A;  1MXZ A;  3DEL B;  5F7V A;  3QIM A;  2PYY A;  4I62 A;  4R6K A;  1POY 1;  5H8F A;  1SW4 A;  1NL5 A;  2ZYM A;  1I69 A;  1WVJ A;  3B6W A;  5AA4 B;  4ZS9 A;  4LQ5 A;  5HM4 B;  2R6G E;  2XX9 A;  3UN6 A;  2I49 A;  4OEV A;  1PC3 A;  5H8S A;  1LBB A;  1TFA A;  3N6T A;  3EHS A;  3THI A;  3IO6 A;  3FJM A;  4OVJ A;  3VV5 A;  1SDX A;  1YCJ A;  4NED A;  3UOR A;  2UVI A;  2ABH A;  2F78 A;  4IB2 A;  1Q1K A;  2F35 A;  2QS2 A;  4WEP A;  3PPN A;  1B5I A;  3IAZ A;  4WKM A;  1XC1 A;  3Q28 A;  4XKQ A;  2V3Q A;  4H8J A;  4F3S A;  4RNS A;  5BUU A;  3UK4 A;  4G8N A;  2ZYK A;  2VOZ A;  3VVD A;  3KJ7 A;  3OO9 A;  1MXX A;  1Q35 A;  2ZYN A;  2Z22 A;  1N7X A;  5B7D A;  1GVC A;  1LCT A;  3S9E A;  3HN0 A;  3FGS A;  4ZEF A;  3G3J A;  1B58 A;  5H8H B;  3EQ1 A;  3PPR A;  3FXQ A;  5TPA A;  2QS1 A;  2VP1 A;  3MP6 A;  1RKM A;  2RKM A;  3O9P A;  4RK9 A;  1XT8 A;  1Y3N A;  2DOJ A;  4QRZ A;  3PUZ E;  4NF6 A;  5DEX A;  2FA7 A;  2P1S A;  3OO7 A;  3TQL A;  4EDP A;  4G77 A;  3W15 C;  4THI A;  2KLF A;  2NXO A;  4NWC A;  3FZV A;  4F3B A;  2P2A A;  1AH5 A;  1N84 A;  1T0K A;  4PFW A;  1A55 A;  5ICT A;  2Q8J A;  2ANJ A;  3WAE A;  3FAT A;  3IOW A;  2I48 A;  5CI5 A;  3FVK A;  3EHU A;  2GH9 A;  4UA8 A;  1FW0 A;  1M5E A;  1SW2 A;  5KDT A;  3PMV A;  1UTH A;  1DOT A;  4IGR A;  3RTW B;  2Z23 A;  3C32 A;  1IXC A;  2Z8F A;  3CR9 A;  4IO4 A;  1QW0 A;  4PE5 B;  4RYA A;  4NF8 B;  5I58 B;  5I59 B;  2B3F A;  3PPO A;  2HEU A;  2XHD A;  4JWO A;  3P7I A;  3VFJ A;  2I4C A;  1MPD A;  2HAU A;  4OXV A;  5HPQ A;  3BFT A;  3O66 A;  5I2K A;  4EXL A;  2Q88 A;  1Z7M E;  3B6Q A;  1RYX A;  2DE4 A;  3LSL A;  1I6Q A;  4DE8 A;  3KN8 A;  4AQ4 A;  3FV1 A;  4ELO A;  3CG1 A;  5AA1 A;  4GRK A;  2F7C A;  2DVZ A;  3UP9 A;  2Y84 A;  4G68 A;  3N5L A;  1FQE A;  4QFP A;  1DSN A;  4HCY A;  1BLF A;  5JK4 A;  3O97 A;  1JVY A;  2ZNS A;  1UIU A;  5H8F B;  2VHA A;  1ELJ A;  2P0S A;  1O64 A;  1DPE A;  1B51 A;  1BKA A;  4DXB A;  2F7B A;  3CSG A;  1QJM A;  3VDF A;  4R9F A;  4NTL A;  1AOV A;  3T9H B;  2HCA A;  3I5O A;  2DP8 A;  3FIR A;  5FTH A;  2W7Y A;  3ILT B;  4LZ8 A;  3SDF A;  2DWH A;  3ZKL A;  3K01 A;  1B3H A;  3USD A;  1OIB A;  4KPT A;  3LSF B;  3G3I A;  3M3L A;  3LSX A;  3KGC A;  3QAX A;  4GOT A;  1FTK A;  1FQA A;  4YMA A;  1QKB A;  2XX8 A;  1OVB A;  1ZKB A;  4ONY A;  4MLQ A;  3H6T A;  3ONM A;  4QF9 A;  4E0X A;  3PUW E;  4M1V A;  1LBC A;  2F36 A;  1LB9 A;  4RXL A;  4ND9 A;  3LBS A;  1ZMG A;  1B3G A;  3PMW A;  1Y4C A;  3DLN A;  1IXI A;  4LZ5 A;  3GBA A;  4FJP A;  5LOM A;  2XXQ A;  1MQD A;  3G7W A;  3TTL A;  1N0T A;  1QVS A;  3K6U A;  3SEU A;  4BDR A;  3MJN A;  5DTB A;  3O28 A;  5DVJ A;  1YTV A;  2B65 A;  4TOZ A;  2RF1 A;  4FED A;  2O6A A;  1XVY A;  4NF5 A;  3SES A;  3IOV A;  1VE4 A;  4X9T A;  2Q2A A;  3IK6 B;  5TPA B;  4ZE8 A;  4FAT A;  3U1O A;  2FNC A;  1CB6 A;  2HZL A;  1R1N A;  2Y7W A;  1AMF A;  4R2B A;  4BLA A;  2DXY A;  5I2N B;  2XXY A;  2LAO A;  2R9J A;  1TFD A;  1M5F A;  1A99 A;  1MY1 A;  2RIN A;  3K2D A;  4GWO A;  2REJ A;  4EQB A;  4G8M A;  4NF6 B;  4DDD A;  5DEX B;  1D4N A;  1IIW A;  1P1Q A;  1M5B A;  5L8D A;  4R72 A;  1PB8 A;  2NOO A;  1ZIU A;  4LQ2 A;  1NH8 A;  2F7A A;  1D3K A; 
#chains in the Genus database with same CATH topology
 4H5G A;  1QUL A;  5ICQ A;  1FCK A;  1USY E;  5EHS A;  5IKB A;  1JEV A;  3C4M A;  4KQP A;  1OLA A;  3FUZ A;  1M5C A;  3CFL A;  5KDT B;  2FIE A;  1UTH B;  1ZBM A;  1B3L A;  4FBP A;  1MG1 A;  5DVF A;  4MF3 A;  4R6Y A;  3IJX B;  3FBP A;  3C9H A;  1KWH A;  2ALU A;  5EQ7 A;  1PDA A;  5IAI A;  1KA1 A;  3DM0 A;  4OFO A;  4F19 A;  4LUB A;  5L9M A;  1NNT A;  4QFK A;  3TYH A;  4HW8 A;  3CIJ A;  1LFI A;  1LAX A;  1B2H A;  3HHG A;  2REG A;  4NQ8 A;  4RJZ A;  4KCC A;  5I2K B;  1DBZ A;  2M8C A;  2B4L A;  4F2Q A;  5ET6 A;  2XA5 A;  1N3W A;  3KBR A;  1RDZ A;  2WKY A;  4YB7 A;  4AB6 A;  3CG3 A;  5A5X A;  4ZZE A;  2O51 A;  3CFX A;  3PU5 A;  4MIJ A;  3TCH A;  1GGG A;  4QFO A;  2HXW A;  2XWV A;  5IZ1 A;  1O63 A;  2AYS A;  2H99 A;  3BIG A;  1ZU0 A;  2PT2 A;  4G68 B;  4FOR A;  4OEU A;  1NNK A;  1FQD A;  1QKA A;  4C0R A;  3K1P A;  1FQF A;  5CMB A;  4NWD A;  4KYD A;  1S9T A;  4MBP A;  1II5 A;  1MQI A;  3VE1 B;  4MJO A;  3K6V A;  1MQG A;  1YAE A;  4BDQ A;  3F11 A;  3TQW A;  2XD2 A;  2XXU A;  2PVU A;  1BK4 A;  3SEW A;  4JXI A;  4XKR A;  1N04 A;  4ZEK A;  4LP2 B;  3VVE A;  3IJO B;  1GR2 A;  3ZSF A;  1AL3 A;  2XXW A;  1AWB A;  2D21 A;  2QPQ A;  5HBC A;  1DMB A;  1MQJ A;  3IO4 A;  4QFN A;  4L17 A;  3RNN A;  4U4X A;  2H9B A;  2DSF A;  3E78 A;  4H65 A;  4POX A;  2H98 A;  5CRY A;  1FBP A;  2OZZ A;  4Q30 B;  3SEY A;  3LC8 A;  3VXB A;  3N6U A;  4I8C A;  4OVS A;  2Y7R A;  5ET5 A;  2GHB A;  2NUV A;  5M2V A;  4RK2 A;  4U22 A;  2Q89 A;  3C33 A;  2HPG A;  2G29 A;  2ZYO A;  2HQ0 A;  1AIV A;  4YIC A;  4ELR A;  1URD A;  3IFA A;  2QS4 A;  3MZ9 A;  1OQH A;  1S50 A;  1HSJ A;  1B40 A;  3BBR A;  1M5D A;  4MFI A;  4MNI A;  1XVX A;  3LSW A;  3TZA A;  1F9B A;  5L9O A;  3C31 A;  4M4G A;  4PQJ A;  4YKP A;  2XD3 A;  1XS5 A;  1USY H;  2DVC A;  1FPF A;  2F34 A;  2H25 A;  1FBF A;  2I6E A;  1H43 A;  1SI1 A;  3IR1 A;  1SQY A;  2F6G A;  4HTG A;  4NF5 B;  3TCG A;  4H5F A;  2QRY A;  1Y3Q A;  1UTB A;  4GXS B;  3QYT A;  1FTO A;  1MY3 A;  1R9L A;  2FBP A;  4NX1 A;  4OYV A;  1KA0 A;  1FSA A;  3RGY A;  1IME A;  4AS4 A;  5I2N A;  1B5H A;  3W9W A;  4GD5 A;  4U1Z A;  5EQ8 A;  3MPK A;  1WDN A;  5CM6 A;  3JV9 A;  3UGW A;  5FBP A;  2PFZ A;  1NV2 A;  2XXT A;  4GIZ A;  4I1D A;  5K2Y A;  3KBZ A;  1G0H A;  4Q0C A;  2XWO A;  2HXR A;  4NE4 A;  4DIG A;  3PUY E;  4IO5 A;  5KCJ A;  4FIM A;  2DWI A;  3CSB A;  4DCY A;  5DT6 A;  3KSJ A;  2O7U A;  4JWY A;  1OMP A;  1PBP A;  4N6K A;  3K1N A;  4N6D A;  3EF7 A;  1RDY A;  3U94 A;  3H06 B;  4P56 A;  2WEF A;  4F3G A;  2FIX A;  4TLM B;  3Q26 A;  1Y1Z A;  4LA9 A;  2F5X A;  3T96 B;  3IOR A;  1JW1 A;  1OLC A;  3ISP A;  2DE3 A;  4MX6 A;  2AL4 A;  1B7Z A;  3R6U A;  4EF1 A;  4BDM A;  4YMB A;  4IO3 A;  4P1L A;  3R7X A;  4H67 A;  2QVV A;  4GL0 A;  4IR8 A;  1A8F A;  5EYF A;  1JET A;  3H3G A;  2O84 X;  3S9N C;  1LBY A;  2A5S A;  1TWY A;  4BDO A;  3CI8 A;  4OMB A;  1NNP A;  1US5 A;  2VD3 A;  3HHF A;  3N26 A;  1B6H A;  3PD9 A;  2DWA A;  2V3T A;  4ESW A;  1EZP A;  1VR5 A;  1B52 A;  3GBB A;  5DVI A;  3KZG A;  5A5X B;  2QVR A;  3FD3 A;  2RC9 A;  3B8B A;  3RQT A;  5CC2 A;  5I3S A;  3V8X B;  3MBP A;  4QFL A;  4F1V A;  4ZZA A;  3TFL A;  3LV0 A;  1MQH A;  2DS9 A;  2NVU B;  3G3G A;  4GX4 A;  4X48 A;  3CVG A;  3U72 A;  4F31 B;  1N3X A;  1B3E A;  3OXN A;  1R6Z A;  1OQG A;  2O1M A;  1B0H A;  1URS A;  1DTG A;  2CEX A;  1MY2 A;  3PUX E;  1FPL A;  1JVX A;  3FV2 A;  3RN8 A;  1LGB C;  4DI3 D;  1FPE A;  1K9Y A;  4MHF A;  3ECR A;  3QK6 A;  3E9X A;  4ZEI A;  1B7U A;  2R71 A;  4OES A;  2RC7 A;  1FBG A;  2ONR A;  2DE2 A;  3BIH A;  4Q8R A;  1NV7 A;  1EZO A;  3ROJ A;  1MXV A;  3G3H A;  5T3J A;  3H6U A;  4OHN A;  3H6V A;  4BDN A;  4ZDM A;  1NV5 A;  1MY0 A;  3D1R A;  4K3F A;  2V4C A;  3FJG A;  4YAH X;  1MDQ A;  2I58 A;  1SBP A;  1SW1 A;  3I3V A;  2I3V A;  4P11 A;  4U23 A;  4PFU A;  3VVF A;  4GX3 A;  5ESY A;  2XXV A;  1IMA A;  2ZMB A;  3S9L C;  3T9U A;  3OOA A;  5JEI A;  3FXR A;  3M3K A;  3V89 B;  5A5L A;  2ZZW A;  4DLD A;  2O68 A;  3MWB A;  2Y7P A;  1UQW A;  2CZL A;  4PGP A;  2F6P A;  2OLB A;  4GFR A;  2UVJ A;  3MC2 A;  5DYH A;  2BJJ X;  4POW A;  3TCF A;  4YKI A;  1NNF A;  1MPB A;  4IY6 A;  3A09 A;  3QMF A;  3FAS A;  4PFR A;  4PF8 A;  3IOT A;  2UXA A;  3U93 A;  5I7I A;  2PT1 A;  1H3D A;  4XKP A;  1FPI A;  4N6P A;  2I4B A;  3EN3 A;  2D3I A;  1LLS A;  4MH5 A;  4Z0I A;  3EKI A;  4ISU A;  2ZZV A;  1UTB B;  1B0L A;  4OA4 A;  1QUI A;  3IB2 A;  3H4Z A;  1FBD A;  4X1B A;  1MXW A;  3SKP A;  2NWJ A;  3MZB A;  1LB8 A;  2DXR A;  4ELP A;  2PMS A;  2UVH A;  3GLB A;  5JTY B;  4PP0 A;  1ZLQ A;  1EH3 A;  1SVX B;  4LVQ A;  4KFQ A;  3ODB A;  5KCJ B;  3O2A A;  3MVY A;  3TAJ A;  3H7M A;  4R74 A;  3MUQ A;  1FPJ A;  2E0S A;  1FBH A;  4GWW A;  3E3K A;  3HCQ A;  1Y1M A;  3FVG A;  1DTZ A;  3G3F A;  4R73 A;  1SYI A;  4H0W A;  5ITO A;  1J1N A;  1JQF A;  2YPN A;  3LUZ A;  1VFE A;  4OWD A;  1DK4 A;  2CZI A;  5ITP A;  4YB6 A;  3FXU A;  3Q27 A;  5J1D A;  4O7M A;  4I9D A;  3TTN A;  3V83 A;  3FJ7 A;  4KR5 A;  3KC0 A;  3RUM A;  4DXC A;  4U2R A;  2P3N A;  2CMO A;  2RC8 A;  4KHZ E;  3PV0 E;  4OVR A;  3R26 A;  4JBZ A;  4YKK A;  1EZ9 A;  1JW4 A;  3H03 A;  3CRB A;  3RLF E;  3U8Q A;  1IMC A;  4G2Z A;  3KEI A;  4Z7E A;  3TMG A;  3O6H A;  4PET A;  4PAI A;  4PFY A;  3B7D A;  2A5T A;  4EQ9 A;  4G68 C;  2H4I A;  3M3F A;  1JW5 A;  2ZNU A;  1MXY A;  4EF2 A;  4UAB A;  4XIG Q;  1TT1 A;  2R8T A;  3RT8 A;  3MVZ A;  1B05 A;  1N76 A;  3K6W A;  4I3Y A;  1YPN A;  4FE8 A;  5AA2 A;  1NFT A;  3MPL A;  3KFM A;  2AL5 A;  3OEN A;  4HCW A;  2YLN A;  2HZK A;  1NUX A;  1FQC A;  2PX1 A;  3JZJ A;  4GF8 A;  5EHM A;  1INP A;  4KCD A;  3IX1 A;  4P0I A;  4JB7 A;  4YU0 A;  3S9M C;  3D4C A;  3RYD A;  3I6V A;  4KYS A;  2E1S A;  3QUJ A;  1QUJ A;  3D4G A;  1LBZ A;  1B1H A;  4C1T A;  3ZKK A;  2X7Q A;  3OEL A;  3AXF A;  1GV8 A;  1LCF A;  1DPP A;  4F3P A;  5TP9 A;  2VD2 A;  3MZ1 A;  1IXG A;  1GTK A;  1B1X A;  5H8Q A;  5KZT A;  3T9X B;  1ATG A;  4IY5 A;  2O69 A;  4H8I A;  1VDW A;  3SEX A;  1CE2 A;  1B46 A;  4O3C A;  3K4U A;  4P47 A;  2Y7K A;  4JWX A;  2THI A;  3QSL A;  3DP4 A;  5ISU A;  4DXU A;  5FTI A;  3TOD A;  1IZ1 A;  4MLV A;  2QVU A;  4RA1 A;  5IM2 A;  3L6G A;  5CMK A;  1SI0 A;  1PEB A;  1VFD A;  2WBD A;  2QJE A;  5K2X A;  2FYI A;  2ZXT A;  2DYX A;  1MS7 A;  4GWS A;  1S7Y A;  1LAF E;  1ZJL A;  3TKD A;  2DQV A;  2AIX A;  1US4 A;  5IZZ A;  3TEP A;  2Q2C A;  5AA3 A;  1Y9U A;  3NOH A;  5FHM A;  5I5P A;  3L6H A;  1WOD A;  4NF4 A;  4XF5 A;  3KN7 A;  4OET A;  2GHA A;  1LBW A;  4QXD A;  3K02 A;  3CFZ A;  2ONK E;  4F2O A;  2P3V A;  1H45 A;  4XXU A;  4R6H A;  4TLL B;  3RY3 A;  4IGT A;  2UYE A;  1LBV A;  3U92 A;  3E13 X;  4IO6 A;  2B4M A;  1YZ0 A;  2O7I A;  2ESN A;  4FAJ A;  2OBG A;  5I56 A;  3UA8 A;  1A7L A;  1IXH A;  5AA2 D;  4EXK A;  3T0J A;  1I6A A;  3HPI A;  2XXP A;  3ILU B;  1B5J A;  3H6W A;  1Y4T A;  1SYH A;  4YKJ A;  5B70 A;  5I84 A;  2H5Y A;  3HV1 A;  1A54 A;  5JTY A;  2OX3 A;  3VXC A;  3EPE A;  3MYU A;  5BWJ A;  1HSE A;  1NUW A;  1H44 A;  2UYF A;  2OCU A;  4PAF A;  2XXX A;  1ANF A;  4NN3 A;  4YZZ A;  1N7W A;  5ELV A;  3OEM A;  4O3B A;  3GZG A;  3PGF A;  3K6X A;  1A40 A;  3RPL A;  4ZED A;  1B4Z A;  2I3W A;  3TTK A;  4EUO A;  2IA4 A;  1BIY A;  4LAT A;  4N17 A;  4PTK A;  1ZTY A;  2Y7I A;  5L9S A;  3T93 B;  3CHG A;  4F22 A;  1NV3 A;  5I57 A;  3PMX A;  2B3B A;  4EQ7 A;  4PFI A;  3HO7 A;  1SW5 A;  3KSX A;  5CBR A;  4HXV A;  1RDX A;  1MRP A;  4GL8 A;  1MXU A;  1Q9D A;  2V84 A;  5FHO A;  4KYE A;  2QMX A;  4PC9 A;  4TQU Q;  4N91 A;  4RPO A;  4P8B A;  4RPN A;  1B3F A;  3VLU A;  2XXH A;  3PPP A;  3KN3 A;  4R9G A;  3V5A A;  3LR1 A;  3JYR A;  3PD8 A;  2ZZX A;  2V3U A;  4PFT A;  4PBH A;  1FTM A;  1LFG A;  3Q25 A;  4GBW A;  1SPI A;  2XXK A;  5H8N A;  2QS3 A;  3G3K A;  4WED A;  1BP5 A;  3SEV A;  4G4P A;  2V25 A;  3KJT A;  5IZ3 B;  4MNC A;  2A5T B;  3IOU A;  3RPW A;  3T22 A;  1NV1 A;  3DP6 A;  4ESX A;  2HFB A;  3VLW A;  1LST A;  2Q9T A;  4GX6 A;  3KOS A;  2OK2 A;  1Y20 A;  4KI0 E;  2QFL A;  4DZ1 A;  3TDJ A;  3MW0 A;  4AS5 A;  5AA2 B;  2Z8E A;  1IQ7 A;  3OO8 A;  4HE0 A;  3W9V A;  5CBS A;  1H76 A;  4U1O A;  5EQ9 A;  3GYY A;  3TUS A;  4H6D A;  1P1O A;  2XXI A;  3C34 A;  1P1U A;  1MH4 A;  2BJI A;  2I0B A;  3O29 A;  5FHN A;  3ZS6 A;  4JDF A;  1I6B A;  4OFL A;  4NHB A;  4F29 A;  3OSQ A;  1MDP 1;  5AA4 A;  1MY4 A;  3IFC A;  3K1M A;  3T66 A;  4RY1 A;  4ZEB A;  1CNQ A;  3GXA A;  3Q29 A;  4JSO A;  2GRV A;  4P0G A;  3T9V A;  1L5T A;  5TP9 B;  5CMC A;  1FBE A;  1G0I A;  2V93 A;  2WYK A;  4N8G A;  5H8Q B;  2PFY A;  4WXJ A;  2QSX A;  1LAG E;  3S4U A;  4H1X A;  4OZ9 A;  1FQB A;  3O6G A;  4GXA A;  3OD7 A;  1MM6 A;  1OVT A;  4OFJ A;  3B6T A;  4F1Y A;  3OO6 A;  3BFU A;  1RYO A;  1JNF A;  2GQ1 A;  4GWY A;  1R9Q A;  1P1N A;  1NMU A;  3LUY A;  2Z8D A;  1P1W A;  3C36 A;  4FEC A;  3TTM A;  3VLV A;  1LBX A;  1QUK A;  3MP8 A;  4F1U A;  1EYK A;  1PB7 A;  4P3L A;  4Q5T A;  3TTR A;  3MAM A;  1IEJ A;  1XHY A;  4AB5 A;  4QBA A;  1FTJ A;  1B9J A;  4OQO A;  4PFB A;  3KG2 A;  4X8R A;  4FEB A;  2OJT A;  4N4U A;  4LN5 A;  2UVG A;  2XWI A;  3RT6 B;  4HS7 A;  4HE1 A;  4NF4 B;  4GVO A;  1D9Y A;  4F39 A;  4IO2 A;  3M8U A;  3MP1 A;  4QHQ A;  1LFH A;  1MH3 A;  2RCA A;  4JSD A;  3SET A;  4LON B;  1EU8 A;  1NH7 A;  4N13 A;  2MKZ A;  2D5W A;  5H8H A;  1HSL A;  4R75 A;  2VGQ A;  5I56 B;  3QUF A;  1JEU A;  3OMB A;  3S2V A;  2DDK A;  2ZNT A;  3QXM A;  3FVN A;  4YB5 A;  1TXF A;  4IO7 A;  3EHT A;  3N94 A;  4F18 A;  1IIT A;  2Q74 A;  1FTL A;  2FHY A;  5DW8 A;  5TU0 A;  4E0W A;  2F8D A;  4GWZ A;  4QSE A;  3TPA A;  4OVQ A;  3K00 A;  4DCX A;  2QL3 A;  3KC1 A;  4OTE A;  4GWX A;  1O7T A;  5F1Q A;  2DWJ A;  4JVD A;  3RPL B;  3PTY A;  4XKN A;  2XX7 A;  1FPK A;  3SER A;  1MPC A;  1D9V A;  2HHM A;  4U4S A;  2F97 A;  2ONS A;  3FVO A;  3IL1 B;  2CEY A;  3UIF A;  1B32 A;  1PBQ A;  1NV0 A;  1MM7 A;  5CMM A;  2IEE A;  5I57 B;  4XTC Q;  2FVZ A;  2XXR A;  4LZ7 A;  1A8E A;  1LAH E;  3DP8 A;  4PF6 A;  2O1L A;  5LDZ A;  3BKI B;  1B4H A;  1BTJ A;  2PBW A;  4X1D A;  4GLI A;  1URG A;  3PUV E;  2GFE A;  3RTF B;  4XEQ A;  4NGU A;  3A3U A;  4C1U A;  1PB9 A;  4NF8 A;  3SZP A;  4G8H A;  5I58 A;  1P99 A;  5I59 A;  1IUD A;  3MQ9 A;  1UIV A;  3OSR A;  4I3E A;  4BDL A;  4NF0 A;  3TEL A;  4ELQ A;  1VSO A;  4KD5 A;  2WBB A;  4QSD A;  2QMW A;  5IZ3 A;  3KOT A;  4NMY A;  2X7P A;  3IB0 A;  5H8N B;  1POT A;  1XOC A;  3OEK A;  1NV4 A;  1B7H A;  4UAC A;  4O3A A;  4N07 A;  4U21 A;  4OEN A;  4H46 A;  4PDD A;  3IB1 A;  3A3C A;  5F24 A;  4QSC A;  2RCB A;  3C35 A;  2X26 A;  3HST A;  2OWS A;  3PPQ A;  4NAP A;  3E4R A;  1QGX A;  4OER A;  2CZH A;  2HAV A;  2JJK A;  4P9K A;  3O6I A;  4DI4 B;  3MVW A;  4GQO A;  1Y3P A;  2G93 A;  4ZEC A;  2YJP A;  4N8Y A;  4ECF A;  4R2F A;  5AE4 A;  1YXI A;  2OWT A;  1NKX A;  1SD3 A;  4ZE9 A;  3K0V A;  1NUY A;  1Z7N E;  2I0C A;  3WAF A;  3MVX A;  1MXZ A;  3DEL B;  5F7V A;  2VPN A;  3QIM A;  4NG7 A;  2PYY A;  4I62 A;  4R6K A;  1POY 1;  5H8F A;  1SW4 A;  1NL5 A;  2ZYM A;  1I69 A;  1WVJ A;  3B6W A;  5AA4 B;  4ZS9 A;  4LQ5 A;  2WX9 A;  5HM4 B;  2R6G E;  2XX9 A;  3UN6 A;  2I49 A;  4OEV A;  1FPG A;  1PC3 A;  2KQZ A;  5H8S A;  1LBB A;  1TFA A;  3N6T A;  3EHS A;  3THI A;  3IO6 A;  3FJM A;  4OVJ A;  4MMP A;  3VV5 A;  1SDX A;  4PGN A;  1YCJ A;  4NED A;  3UOR A;  2UVI A;  4O94 A;  2ABH A;  3MST A;  2F78 A;  4IB2 A;  1LEV A;  1Q1K A;  2F35 A;  2QS2 A;  4WEP A;  3PPN A;  1B5I A;  2CZK A;  4PDH A;  3IAZ A;  4WKM A;  1XC1 A;  3Q28 A;  4XKQ A;  4MNP A;  2V3Q A;  4H8J A;  4F3S A;  4RNS A;  5BUU A;  3UK4 A;  4G8N A;  2ZYK A;  2VOZ A;  3VVD A;  5ET7 A;  3KJ7 A;  3OO9 A;  1MXX A;  4PBQ A;  4PE3 A;  1Q35 A;  2ZYN A;  2Z22 A;  1N7X A;  4MEV A;  3T1B A;  5B7D A;  1GVC A;  4GWU A;  1LCT A;  3S9E A;  3HN0 A;  3FGS A;  4ZEF A;  3G3J A;  1B58 A;  5H8H B;  4PAK A;  3EQ1 A;  3PPR A;  3FXQ A;  5TPA A;  2QS1 A;  2VP1 A;  3MP6 A;  1RKM A;  2RKM A;  3O9P A;  4RK9 A;  1XT8 A;  1Y3N A;  2DOJ A;  4QRZ A;  5EQA A;  3PUZ E;  4NF6 A;  5DEX A;  2FA7 A;  2P1S A;  3OO7 A;  3TQL A;  4EDP A;  1FPB A;  4G77 A;  3W15 C;  4THI A;  2KLF A;  2NXO A;  4NWC A;  3FZV A;  4F3B A;  3B50 A;  2P2A A;  2XWK A;  1AH5 A;  4XFE A;  1N84 A;  1T0K A;  4PFW A;  1A55 A;  4G61 A;  5ICT A;  2Q8J A;  2ANJ A;  3WAE A;  3FAT A;  3IOW A;  2OWZ A;  2I48 A;  5CI5 A;  3FVK A;  3EHU A;  1FJ9 A;  2GH9 A;  4UA8 A;  1FW0 A;  1XI6 A;  1M5E A;  1SW2 A;  5KDT A;  1NI9 A;  3PMV A;  1UTH A;  1DOT A;  4IGR A;  3RTW B;  2Z23 A;  1FBC A;  3C32 A;  1IXC A;  2Z8F A;  3CR9 A;  4JVI A;  4IO4 A;  1QW0 A;  4PE5 B;  4RYA A;  4NF8 B;  5I58 B;  5I59 B;  4P1E A;  2VPO A;  2B3F A;  3FXB A;  2Y5K A;  3PPO A;  4X04 A;  2HEU A;  2XHD A;  4JWO A;  3P7I A;  3VFJ A;  1EYI A;  2I4C A;  1MPD A;  2HAU A;  4OXV A;  5EYH A;  5HPQ A;  3BFT A;  3O66 A;  5I2K A;  4EXL A;  3A29 A;  1YYZ A;  2Q88 A;  1Z7M E;  3B6Q A;  1RYX A;  2DE4 A;  3LSL A;  1I6Q A;  4DE8 A;  3KN8 A;  4AQ4 A;  3FV1 A;  4ELO A;  5IGA A;  3CG1 A;  5AA1 A;  4GRK A;  2F7C A;  4H45 A;  2DVZ A;  3UP9 A;  2Y84 A;  4G68 A;  1IMB A;  4GBV A;  1NUZ A;  3N5L A;  1FQE A;  4QFP A;  2KR0 A;  1DSN A;  3E79 A;  4HCY A;  1BLF A;  5JK4 A;  3O97 A;  1JVY A;  2ZNS A;  4MAG A;  1UIU A;  5H8F B;  2VHA A;  2F3B A;  2PCR A;  1ELJ A;  2P0S A;  1O64 A;  1DPE A;  4O8M A;  1B51 A;  4MCO A;  1BKA A;  4DXB A;  2F7B A;  3CSG A;  5ET8 A;  1IMF A;  1QJM A;  3VDF A;  4OVP A;  3U65 A;  4R9F A;  4NTL A;  1AOV A;  3T9H B;  2HCA A;  3I5O A;  2DP8 A;  3FIR A;  4KXP A;  5FTH A;  2W7Y A;  3ILT B;  4LZ8 A;  3SDF A;  2DWH A;  3ZKL A;  3K01 A;  1B3H A;  3USD A;  1OIB A;  1JP4 A;  4KPT A;  3LSF B;  3G3I A;  3M3L A;  3LSX A;  3KGC A;  3QAX A;  1FJ6 A;  2WYP A;  4GOT A;  1DCU A;  1FTK A;  1FQA A;  4YMA A;  1QKB A;  2XX8 A;  1EYJ A;  1OVB A;  1ZKB A;  4MLQ A;  4ONY A;  3H6T A;  3ONM A;  4QF9 A;  4E0X A;  3PUW E;  4M1V A;  4N15 A;  1LBC A;  2F36 A;  1LB9 A;  5J16 A;  4RXL A;  4ND9 A;  3LBS A;  1ZMG A;  1B3G A;  3HFU A;  3PMW A;  1D9Q A;  1Y4C A;  3DLN A;  1IXI A;  4JVC A;  4LZ5 A;  3GBA A;  4FJP A;  4OVT A;  2VT5 A;  5LOM A;  2XXQ A;  1MQD A;  3G7W A;  1IMD A;  2F3D A;  3TTL A;  1N0T A;  1QVS A;  3K6U A;  3SEU A;  4BDR A;  3MJN A;  1FPD A;  5DTB A;  3O28 A;  5DVJ A;  1YTV A;  2B65 A;  4TOZ A;  2RF1 A;  4FED A;  4PCD A;  2L5V A;  2O6A A;  1XVY A;  4N81 A;  4NF5 A;  3SES A;  3IOV A;  5LTC A;  5EYG A;  1K9Z A;  1VE4 A;  4X9T A;  2Q2A A;  3IK6 B;  5TPA B;  4ZE8 A;  4FAT A;  1FRP A;  3U1O A;  1FTA A;  2FNC A;  1CB6 A;  2HZL A;  1R1N A;  2Y7W A;  1AMF A;  4R2B A;  4BLA A;  2DXY A;  4HE2 A;  4I40 A;  5I2N B;  2XXY A;  2LAO A;  2R9J A;  1TFD A;  1M5F A;  1A99 A;  1MY1 A;  2RIN A;  4OAN A;  3K2D A;  1KZ8 A;  4GWO A;  2REJ A;  4EQB A;  4G8M A;  4NF6 B;  4DDD A;  5DEX B;  1D4N A;  1IIW A;  1P1Q A;  2Y5L A;  1M5B A;  5L8D A;  4R72 A;  1PB8 A;  2NOO A;  2Q8M A;  1ZIU A;  4O7I A;  4LQ2 A;  1NV6 A;  1NH8 A;  2F7A A;  1D3K A; 
#chains in the Genus database with same CATH homology
 4H5G A;  1QUL A;  5ICQ A;  1FCK A;  1USY E;  5EHS A;  5IKB A;  1JEV A;  3C4M A;  4KQP A;  1OLA A;  3FUZ A;  1M5C A;  3CFL A;  5KDT B;  1UTH B;  1ZBM A;  1B3L A;  1MG1 A;  5DVF A;  4MF3 A;  4R6Y A;  3IJX B;  3C9H A;  1KWH A;  2ALU A;  5IAI A;  1PDA A;  3DM0 A;  4OFO A;  4F19 A;  4LUB A;  5L9M A;  1NNT A;  4QFK A;  3TYH A;  4HW8 A;  3CIJ A;  1LFI A;  1LAX A;  1B2H A;  3HHG A;  2REG A;  4RJZ A;  4KCC A;  5I2K B;  2M8C A;  4F2Q A;  1N3W A;  3KBR A;  2WKY A;  4YB7 A;  4AB6 A;  3CG3 A;  5A5X A;  4ZZE A;  2O51 A;  3CFX A;  3PU5 A;  3TCH A;  1GGG A;  4QFO A;  2HXW A;  1O63 A;  2AYS A;  2H99 A;  1ZU0 A;  2PT2 A;  4G68 B;  4FOR A;  4OEU A;  1NNK A;  1FQD A;  1QKA A;  4C0R A;  3K1P A;  1FQF A;  5CMB A;  4NWD A;  4KYD A;  1S9T A;  4MBP A;  1II5 A;  1MQI A;  3VE1 B;  3K6V A;  1MQG A;  1YAE A;  4BDQ A;  3F11 A;  3TQW A;  2XD2 A;  2XXU A;  2PVU A;  3SEW A;  4JXI A;  4XKR A;  1N04 A;  4ZEK A;  4LP2 B;  3VVE A;  3IJO B;  1GR2 A;  3ZSF A;  1AL3 A;  2XXW A;  2D21 A;  2QPQ A;  5HBC A;  1DMB A;  1MQJ A;  3IO4 A;  4QFN A;  4L17 A;  3RNN A;  4U4X A;  2H9B A;  2DSF A;  4H65 A;  4POX A;  2H98 A;  5CRY A;  2OZZ A;  4Q30 B;  3SEY A;  3LC8 A;  3VXB A;  3N6U A;  4I8C A;  2Y7R A;  2GHB A;  2NUV A;  5M2V A;  4RK2 A;  4U22 A;  2Q89 A;  3C33 A;  2G29 A;  2ZYO A;  2HQ0 A;  1AIV A;  4YIC A;  4ELR A;  1URD A;  2QS4 A;  3MZ9 A;  1OQH A;  1S50 A;  1HSJ A;  1B40 A;  3BBR A;  1M5D A;  4MFI A;  1XVX A;  3LSW A;  3TZA A;  1F9B A;  5L9O A;  3C31 A;  4M4G A;  4PQJ A;  4YKP A;  2XD3 A;  1XS5 A;  1USY H;  2DVC A;  2F34 A;  2H25 A;  2I6E A;  1H43 A;  1SI1 A;  3IR1 A;  1SQY A;  2F6G A;  4HTG A;  4NF5 B;  3TCG A;  4H5F A;  2QRY A;  1Y3Q A;  1UTB A;  4GXS B;  3QYT A;  1FTO A;  1MY3 A;  1R9L A;  4OYV A;  3RGY A;  5I2N A;  1B5H A;  3W9W A;  4GD5 A;  4U1Z A;  3MPK A;  1WDN A;  5CM6 A;  3JV9 A;  3UGW A;  2XXT A;  4GIZ A;  4I1D A;  5K2Y A;  4Q0C A;  4NE4 A;  4DIG A;  3PUY E;  4IO5 A;  5KCJ A;  4FIM A;  2DWI A;  3CSB A;  4DCY A;  5DT6 A;  3KSJ A;  2O7U A;  4JWY A;  1OMP A;  1PBP A;  3K1N A;  3EF7 A;  3U94 A;  3H06 B;  4F3G A;  4TLM B;  3Q26 A;  1Y1Z A;  4LA9 A;  2F5X A;  3T96 B;  3IOR A;  1JW1 A;  1OLC A;  2DE3 A;  2AL4 A;  1B7Z A;  3R6U A;  4EF1 A;  4BDM A;  4YMB A;  4IO3 A;  3R7X A;  4H67 A;  4GL0 A;  1A8F A;  5EYF A;  1JET A;  3H3G A;  2O84 X;  3S9N C;  2A5S A;  1TWY A;  4BDO A;  3CI8 A;  4OMB A;  1NNP A;  1US5 A;  2VD3 A;  3HHF A;  3N26 A;  1B6H A;  3PD9 A;  2DWA A;  2V3T A;  4ESW A;  1EZP A;  1VR5 A;  1B52 A;  3GBB A;  5DVI A;  3KZG A;  5A5X B;  3FD3 A;  2RC9 A;  3RQT A;  5CC2 A;  3V8X B;  3MBP A;  4QFL A;  4F1V A;  4ZZA A;  3TFL A;  1MQH A;  2DS9 A;  2NVU B;  3G3G A;  4X48 A;  3CVG A;  3U72 A;  4F31 B;  1N3X A;  1B3E A;  3OXN A;  1R6Z A;  1OQG A;  2O1M A;  1B0H A;  1URS A;  1DTG A;  1MY2 A;  3PUX E;  1JVX A;  3FV2 A;  3RN8 A;  1LGB C;  3ECR A;  3QK6 A;  3E9X A;  4ZEI A;  1B7U A;  2R71 A;  4OES A;  2RC7 A;  2ONR A;  2DE2 A;  4Q8R A;  1EZO A;  1MXV A;  3G3H A;  3H6U A;  4OHN A;  3H6V A;  4BDN A;  4ZDM A;  1MY0 A;  4K3F A;  3FJG A;  4YAH X;  1MDQ A;  2I58 A;  1SBP A;  1SW1 A;  3I3V A;  2I3V A;  4P11 A;  4U23 A;  4PFU A;  3VVF A;  2XXV A;  2ZMB A;  3S9L C;  3T9U A;  3OOA A;  5JEI A;  3FXR A;  3M3K A;  3V89 B;  4DLD A;  2O68 A;  3MWB A;  2Y7P A;  1UQW A;  2CZL A;  2F6P A;  2OLB A;  4GFR A;  2UVJ A;  3MC2 A;  5DYH A;  2BJJ X;  4POW A;  3TCF A;  4YKI A;  1NNF A;  1MPB A;  4IY6 A;  3A09 A;  3FAS A;  3IOT A;  2UXA A;  3U93 A;  2PT1 A;  1H3D A;  4XKP A;  4N6P A;  2I4B A;  3EN3 A;  2D3I A;  1LLS A;  4MH5 A;  4Z0I A;  4ISU A;  1UTB B;  1B0L A;  1QUI A;  3IB2 A;  3H4Z A;  4X1B A;  1MXW A;  3SKP A;  2NWJ A;  3MZB A;  1LB8 A;  2DXR A;  4ELP A;  2PMS A;  2UVH A;  3GLB A;  5JTY B;  4PP0 A;  1ZLQ A;  1EH3 A;  1SVX B;  4LVQ A;  4KFQ A;  3ODB A;  5KCJ B;  3O2A A;  3MVY A;  3TAJ A;  3H7M A;  4R74 A;  3MUQ A;  2E0S A;  3E3K A;  3HCQ A;  1Y1M A;  3FVG A;  1DTZ A;  3G3F A;  4R73 A;  1SYI A;  4H0W A;  5ITO A;  1J1N A;  1JQF A;  2YPN A;  1VFE A;  4OWD A;  5ITP A;  4YB6 A;  3FXU A;  3Q27 A;  5J1D A;  4I9D A;  3TTN A;  3V83 A;  3FJ7 A;  4KR5 A;  3RUM A;  4DXC A;  4U2R A;  2CMO A;  2RC8 A;  4KHZ E;  3PV0 E;  3R26 A;  4JBZ A;  4YKK A;  1EZ9 A;  1JW4 A;  3H03 A;  3CRB A;  3RLF E;  3U8Q A;  4G2Z A;  3KEI A;  4Z7E A;  3TMG A;  3O6H A;  4PET A;  4PFY A;  3B7D A;  2A5T A;  4EQ9 A;  4G68 C;  2H4I A;  3M3F A;  1JW5 A;  2ZNU A;  1MXY A;  4EF2 A;  4XIG Q;  1TT1 A;  3RT8 A;  3MVZ A;  1B05 A;  1N76 A;  3K6W A;  1YPN A;  4FE8 A;  5AA2 A;  1NFT A;  3MPL A;  3KFM A;  2AL5 A;  3OEN A;  4HCW A;  2YLN A;  2HZK A;  1FQC A;  2PX1 A;  3JZJ A;  4GF8 A;  5EHM A;  4KCD A;  3IX1 A;  4P0I A;  4JB7 A;  4YU0 A;  3S9M C;  3D4C A;  3I6V A;  4KYS A;  2E1S A;  3QUJ A;  1QUJ A;  3D4G A;  1B1H A;  4C1T A;  3ZKK A;  2X7Q A;  3OEL A;  3AXF A;  1GV8 A;  1LCF A;  1DPP A;  4F3P A;  5TP9 A;  2VD2 A;  3MZ1 A;  1IXG A;  1GTK A;  1B1X A;  5H8Q A;  5KZT A;  3T9X B;  1ATG A;  4IY5 A;  2O69 A;  4H8I A;  3SEX A;  1CE2 A;  1B46 A;  4O3C A;  3K4U A;  2Y7K A;  4JWX A;  2THI A;  3QSL A;  3DP4 A;  5ISU A;  4DXU A;  5FTI A;  3TOD A;  1IZ1 A;  4MLV A;  4RA1 A;  5CMK A;  3L6G A;  1SI0 A;  1PEB A;  1VFD A;  2QJE A;  5K2X A;  2FYI A;  2ZXT A;  2DYX A;  1MS7 A;  1S7Y A;  1LAF E;  1ZJL A;  3TKD A;  2DQV A;  2AIX A;  1US4 A;  3TEP A;  2Q2C A;  5AA3 A;  1Y9U A;  5FHM A;  3L6H A;  1WOD A;  4NF4 A;  3KN7 A;  4OET A;  2GHA A;  3K02 A;  3CFZ A;  2ONK E;  4F2O A;  1H45 A;  4XXU A;  4R6H A;  4TLL B;  3RY3 A;  4IGT A;  2UYE A;  3U92 A;  3E13 X;  4IO6 A;  2O7I A;  2ESN A;  4FAJ A;  2OBG A;  5I56 A;  3UA8 A;  1A7L A;  1IXH A;  5AA2 D;  4EXK A;  1I6A A;  3HPI A;  2XXP A;  3ILU B;  1B5J A;  3H6W A;  1Y4T A;  1SYH A;  4YKJ A;  5B70 A;  5I84 A;  2H5Y A;  3HV1 A;  1A54 A;  5JTY A;  3VXC A;  3EPE A;  5BWJ A;  1HSE A;  1H44 A;  2UYF A;  2OCU A;  2XXX A;  1ANF A;  4YZZ A;  1N7W A;  5ELV A;  3OEM A;  4O3B A;  3GZG A;  3PGF A;  3K6X A;  1A40 A;  4ZED A;  1B4Z A;  2I3W A;  3TTK A;  4EUO A;  2IA4 A;  1BIY A;  4LAT A;  1ZTY A;  2Y7I A;  5L9S A;  3T93 B;  4F22 A;  5I57 A;  3PMX A;  2B3B A;  4EQ7 A;  3HO7 A;  1SW5 A;  3KSX A;  5CBR A;  1MRP A;  4GL8 A;  1MXU A;  2V84 A;  5FHO A;  4KYE A;  2QMX A;  4TQU Q;  4RPO A;  4RPN A;  1B3F A;  3VLU A;  2XXH A;  3PPP A;  3KN3 A;  4R9G A;  3V5A A;  3LR1 A;  3JYR A;  3PD8 A;  2V3U A;  4PFT A;  1FTM A;  1LFG A;  3Q25 A;  5H8N A;  2QS3 A;  3G3K A;  4WED A;  1BP5 A;  3SEV A;  4G4P A;  2V25 A;  3KJT A;  2A5T B;  3IOU A;  3RPW A;  3T22 A;  3DP6 A;  4ESX A;  2HFB A;  3VLW A;  1LST A;  2Q9T A;  3KOS A;  2OK2 A;  1Y20 A;  4KI0 E;  4DZ1 A;  3TDJ A;  3MW0 A;  5AA2 B;  2Z8E A;  1IQ7 A;  3OO8 A;  3W9V A;  5CBS A;  1H76 A;  4U1O A;  3TUS A;  4H6D A;  1P1O A;  2XXI A;  3C34 A;  1P1U A;  1MH4 A;  3O29 A;  2I0B A;  5FHN A;  3ZS6 A;  4JDF A;  1I6B A;  4OFL A;  4F29 A;  3OSQ A;  1MDP 1;  5AA4 A;  1MY4 A;  3K1M A;  3T66 A;  4RY1 A;  4ZEB A;  3GXA A;  3Q29 A;  4JSO A;  2GRV A;  4P0G A;  3T9V A;  1L5T A;  5TP9 B;  5CMC A;  2V93 A;  5H8Q B;  4WXJ A;  2QSX A;  1LAG E;  3S4U A;  4H1X A;  4OZ9 A;  1FQB A;  3O6G A;  4GXA A;  3OD7 A;  1MM6 A;  1OVT A;  4OFJ A;  3B6T A;  4F1Y A;  3OO6 A;  3BFU A;  1RYO A;  1JNF A;  1R9Q A;  1P1N A;  1NMU A;  3LUY A;  2Z8D A;  1P1W A;  3C36 A;  4FEC A;  3TTM A;  3VLV A;  1QUK A;  3MP8 A;  4F1U A;  1PB7 A;  4Q5T A;  3TTR A;  3MAM A;  1IEJ A;  1XHY A;  4AB5 A;  1FTJ A;  1B9J A;  4OQO A;  3KG2 A;  4FEB A;  2OJT A;  2UVG A;  3RT6 B;  4HS7 A;  4NF4 B;  4GVO A;  1D9Y A;  4F39 A;  4IO2 A;  3M8U A;  3MP1 A;  4QHQ A;  1LFH A;  1MH3 A;  2RCA A;  4JSD A;  3SET A;  4LON B;  1EU8 A;  1NH7 A;  4N13 A;  5H8H A;  2D5W A;  1HSL A;  4R75 A;  2VGQ A;  5I56 B;  3QUF A;  1JEU A;  3OMB A;  3S2V A;  2ZNT A;  3QXM A;  3FVN A;  4YB5 A;  1TXF A;  4IO7 A;  3EHT A;  3N94 A;  4F18 A;  1IIT A;  1FTL A;  5TU0 A;  4E0W A;  2F8D A;  4QSE A;  3TPA A;  3K00 A;  4DCX A;  2QL3 A;  4OTE A;  1O7T A;  5F1Q A;  2DWJ A;  4XKN A;  2XX7 A;  3SER A;  1MPC A;  1D9V A;  4U4S A;  2F97 A;  2ONS A;  3FVO A;  3IL1 B;  3UIF A;  1B32 A;  1PBQ A;  1MM7 A;  5CMM A;  2IEE A;  5I57 B;  4XTC Q;  2XXR A;  4LZ7 A;  1A8E A;  1LAH E;  3DP8 A;  2O1L A;  3BKI B;  1B4H A;  1BTJ A;  2PBW A;  4X1D A;  4GLI A;  1URG A;  3RTF B;  3PUV E;  2GFE A;  3A3U A;  4C1U A;  1PB9 A;  4NF8 A;  4G8H A;  5I58 A;  1P99 A;  5I59 A;  1IUD A;  3MQ9 A;  1UIV A;  3OSR A;  4BDL A;  3TEL A;  4ELQ A;  1VSO A;  4KD5 A;  4QSD A;  2QMW A;  3KOT A;  4NMY A;  2X7P A;  3IB0 A;  5H8N B;  1POT A;  1XOC A;  3OEK A;  1B7H A;  4UAC A;  4O3A A;  4N07 A;  4U21 A;  4OEN A;  3IB1 A;  3A3C A;  4QSC A;  2RCB A;  3C35 A;  2X26 A;  3HST A;  2OWS A;  3PPQ A;  3E4R A;  4OER A;  2HAV A;  3O6I A;  3MVW A;  4GQO A;  1Y3P A;  2G93 A;  4ZEC A;  2YJP A;  4ECF A;  4R2F A;  5AE4 A;  2OWT A;  1NKX A;  1SD3 A;  4ZE9 A;  3K0V A;  1Z7N E;  2I0C A;  3WAF A;  3MVX A;  1MXZ A;  3DEL B;  5F7V A;  3QIM A;  2PYY A;  4I62 A;  4R6K A;  1POY 1;  5H8F A;  1SW4 A;  1NL5 A;  2ZYM A;  1I69 A;  1WVJ A;  3B6W A;  5AA4 B;  4ZS9 A;  4LQ5 A;  5HM4 B;  2R6G E;  2XX9 A;  3UN6 A;  2I49 A;  4OEV A;  1PC3 A;  5H8S A;  1LBB A;  1TFA A;  3N6T A;  3EHS A;  3THI A;  3IO6 A;  3FJM A;  4OVJ A;  3VV5 A;  1SDX A;  1YCJ A;  4NED A;  3UOR A;  2UVI A;  2ABH A;  2F78 A;  4IB2 A;  1Q1K A;  2F35 A;  2QS2 A;  4WEP A;  3PPN A;  1B5I A;  3IAZ A;  4WKM A;  1XC1 A;  3Q28 A;  4XKQ A;  2V3Q A;  4H8J A;  4F3S A;  4RNS A;  5BUU A;  3UK4 A;  4G8N A;  2ZYK A;  2VOZ A;  3VVD A;  3KJ7 A;  3OO9 A;  1MXX A;  1Q35 A;  2ZYN A;  2Z22 A;  1N7X A;  5B7D A;  1GVC A;  1LCT A;  3S9E A;  3HN0 A;  3FGS A;  4ZEF A;  3G3J A;  1B58 A;  5H8H B;  3EQ1 A;  3PPR A;  3FXQ A;  5TPA A;  2QS1 A;  2VP1 A;  3MP6 A;  1RKM A;  2RKM A;  3O9P A;  4RK9 A;  1XT8 A;  1Y3N A;  2DOJ A;  4QRZ A;  3PUZ E;  4NF6 A;  5DEX A;  2FA7 A;  2P1S A;  3OO7 A;  3TQL A;  4EDP A;  4G77 A;  3W15 C;  4THI A;  2KLF A;  2NXO A;  4NWC A;  3FZV A;  4F3B A;  2P2A A;  1AH5 A;  1N84 A;  1T0K A;  4PFW A;  1A55 A;  5ICT A;  2Q8J A;  2ANJ A;  3WAE A;  3FAT A;  3IOW A;  2I48 A;  5CI5 A;  3FVK A;  3EHU A;  2GH9 A;  4UA8 A;  1FW0 A;  1M5E A;  1SW2 A;  5KDT A;  3PMV A;  1UTH A;  1DOT A;  4IGR A;  3RTW B;  2Z23 A;  3C32 A;  1IXC A;  2Z8F A;  3CR9 A;  4IO4 A;  1QW0 A;  4PE5 B;  4RYA A;  4NF8 B;  5I58 B;  5I59 B;  2B3F A;  3PPO A;  2HEU A;  2XHD A;  4JWO A;  3P7I A;  3VFJ A;  2I4C A;  1MPD A;  2HAU A;  4OXV A;  5HPQ A;  3BFT A;  3O66 A;  5I2K A;  4EXL A;  2Q88 A;  1Z7M E;  3B6Q A;  1RYX A;  2DE4 A;  3LSL A;  1I6Q A;  4DE8 A;  3KN8 A;  4AQ4 A;  3FV1 A;  4ELO A;  3CG1 A;  5AA1 A;  4GRK A;  2F7C A;  2DVZ A;  3UP9 A;  2Y84 A;  4G68 A;  3N5L A;  1FQE A;  4QFP A;  1DSN A;  4HCY A;  1BLF A;  5JK4 A;  3O97 A;  1JVY A;  2ZNS A;  1UIU A;  5H8F B;  2VHA A;  1ELJ A;  2P0S A;  1O64 A;  1DPE A;  1B51 A;  1BKA A;  4DXB A;  2F7B A;  3CSG A;  1QJM A;  3VDF A;  4R9F A;  4NTL A;  1AOV A;  3T9H B;  2HCA A;  3I5O A;  2DP8 A;  3FIR A;  5FTH A;  2W7Y A;  3ILT B;  4LZ8 A;  3SDF A;  2DWH A;  3ZKL A;  3K01 A;  1B3H A;  3USD A;  1OIB A;  4KPT A;  3LSF B;  3G3I A;  3M3L A;  3LSX A;  3KGC A;  3QAX A;  4GOT A;  1FTK A;  1FQA A;  4YMA A;  1QKB A;  2XX8 A;  1OVB A;  1ZKB A;  4ONY A;  4MLQ A;  3H6T A;  3ONM A;  4QF9 A;  4E0X A;  3PUW E;  4M1V A;  1LBC A;  2F36 A;  1LB9 A;  4RXL A;  4ND9 A;  3LBS A;  1ZMG A;  1B3G A;  3PMW A;  1Y4C A;  3DLN A;  1IXI A;  4LZ5 A;  3GBA A;  4FJP A;  5LOM A;  2XXQ A;  1MQD A;  3G7W A;  3TTL A;  1N0T A;  1QVS A;  3K6U A;  3SEU A;  4BDR A;  3MJN A;  5DTB A;  3O28 A;  5DVJ A;  1YTV A;  2B65 A;  4TOZ A;  2RF1 A;  4FED A;  2O6A A;  1XVY A;  4NF5 A;  3SES A;  3IOV A;  1VE4 A;  4X9T A;  2Q2A A;  3IK6 B;  5TPA B;  4ZE8 A;  4FAT A;  3U1O A;  2FNC A;  1CB6 A;  2HZL A;  1R1N A;  2Y7W A;  1AMF A;  4R2B A;  4BLA A;  2DXY A;  5I2N B;  2XXY A;  2LAO A;  2R9J A;  1TFD A;  1M5F A;  1A99 A;  1MY1 A;  2RIN A;  3K2D A;  4GWO A;  2REJ A;  4EQB A;  4G8M A;  4NF6 B;  4DDD A;  5DEX B;  1D4N A;  1IIW A;  1P1Q A;  1M5B A;  5L8D A;  4R72 A;  1PB8 A;  2NOO A;  1ZIU A;  4LQ2 A;  1NH8 A;  2F7A A;  1D3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...