1OVUA

Crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form i)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords four-helix bundle model di-Co(II)-DF1-L13A (form I)
publication title Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 20
structure length 48
sequence length 48
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ovuA00
1JM0A 2QRXA 4ZNCA 4JBZA 1BDDA 1LP1A 4CPGA 4MN4C 3S1KA 4HJGH 4K35A 1EDLA 2I8DA 2B89A 5K5GB 2HR3A 5DJTB 1NVOA 1EDIA 5DJUB 4NPFX 4WWIA 5EFWB 3PH0A 2P58A 2KZJA 2OTKE 2LXBA 2B87B 2Q1KA 1H0TB 1X0TA 4ASWA 4ASVA 3FXEA 1JMBA 4NPEA 4ZMDA 4KJMA 1OVUA 4GOEA 2KIKA 1DEEG 1S3JA 1ZW0A 2R44A 2SPZA 1Y47A 3ZDMA 2B88A 1LP1B 1EDKA 2M5AA 4BXLA 1EC5A 5CBNA 1MFTA 4IOIH 2WMMA 1OVRA 2LR2A 2B87A 1EDJA 1H0TA 4GOFA 1OVVA 3FXDA 2K3RA 2KUBA 2UWJE 5CBOA 3MZWB 2QVAA 4GODA 1ZXGA 2KS1B 1BDCA 4HB1A 2RKLA 2KI7B 2JWDA 4EYYQ 2KZIA 2ZAEB 3RGUA 1FC2C 1U7MA 4NPDA 4K3AA 2LXCB 4HKZH 5C39A 1U7JA 3QWOC 1LT1A 3MHVA 1Q2NA 1SS1A 2M0BA 2M5AB
chains in the Genus database with same CATH superfamily
1IO4A 1OX3A 3D70A 1Z56A 2GUVA 3Q5RA 1KQSO 1RF1C 2YXQB 4U3FJ 2I8DA 1FU1A 1OW8A 4AYCA 1WT6A 1XTGB 1DD3A 4OH8B 5AVUB 4WY4D 1SQVJ 3V4WA 2GM4A 1PGOA 2XDJA 2AEMA 3G9RA 3KHUA 3L70E 1NU1K 3H1JJ 5CCGD 1PPJE 4C7RA 2WPQA 3CL3D 3CXHD 2IYPA 3VMXA 1R8EA 1QVGO 1BCCG 3B5NB 1HVVA 1CZQA 3II6A 3RK2C 1N7SC 2ZT9B 1VPCA 3BATA 4AQRD 3SFEC 3K5BA 2FYUE 4W7YA 2YMYA 3L71D 3TGUJ 1YI2P 2RH0A 2QA4P 4WB4A 2IBZG 2MKVA 2Y9YA 1BGYJ 3HUSA 1PP9J 2N1TB 1JEKA 1EZVD 1YTZI 1URQC 4I1LA 2Q6QA 2HYNA 1M57D 1FZCA 1FAVA 3F5HA 1AQ5A 3H25A 2E43A 1KZUB 2QJYC 3HRNA 3RL0B 3IR9A 3RK2D 1N7SD 1KFNA 1P84E 3CLQA 3BRTB 1BCCE 4H13B 3OW2O 4LLHA 4L75A 4ZKUA 2NPSB 3A2AA 2QRXA 3H6PA 1OMIA 1NAYA 5DJTB 4U7JA 1NOHA 1URQD 5TISE 4RO0A 5KLVK 2V7QJ 2IBZE 1L2PA 3B8EB 3TF5A 2OTJP 2ZVNB 3L70D 2Q9IA 3N4XA 1E79H 4JYCA 4WY4A 2Q3IA 3WUVA 4YPCA 1AQTA 2V7QH 2JJLA 1M1JA 1RE3C 2E74C 1OVUA 2G3AA 2A45H 2BCCG 1LP1B 1CI6B 1MUUA 2LR2A 3EFFK 1N73B 4W80A 1NTMG 2CK3H 2K3RA 4KHXA 2KS1B 1NWQA 2IX7C 4EOTA 2RKLA 2JDIH 4L76A 2FY8A 1PGPA 2AXCA 1KQLA 4M3LA 2ZAEB 1EQ7A 3C9IA 2E74D 2OQQA 1FOSF 2A06E 1EXJA 1P84D 1DD4A 2ZYGA 3OA7A 1EXIA 1BCCD 2YO3A 3KZIE 1NTKJ 4QMAA 5CCHC 2ZXXA 3H1IJ 4JPZB 4ZKPA 1AVYA 2BCCE 2JEEA 1L4AC 4PV1B 2PGDA 1NTME 2R5DA 2IBZD 3W67A 5B66E 2P58A 3H1HG 1RE4A 3PRJA 2DW3A 2E42A 4L74A 3GF3A 1KILE 5AW7B 1VF5C 5E79H 2D2CB 2K37A 3KYQA 5CCHD 2KIKA 2Z5HA 1SQPG 4D6TG 3CWBG 4Y99C 1IFIA 1KTMA 1UIIA 1L4AD 4IOIH 2OGUA 3P32A 4IL6E 2QJKB 1S9KE 1Q81Q 1GU4A 4OGQB 1OVVA 3EQ2A 3LIDA 2VRSA 3B5NA 3KXDA 3O6QB 1N86A 3FWNA 3GF7A 2E5TA 2KNCA 1T2KD 1G1JA 3H1HE 1VF5D 2Z5IA 3JC22 5H2FE 4H44C 2A06D 3V2RA 4KT0J 1KILC 3L37A 4DZOA 3L73J 1SQPE 3U1AA 3VMZA 4D6TE 3CWBE 1SQBJ 2E75B 1SFCB 2HR3A 1LTGC 1JUNA 1YIJP 3H1LJ 5AW4B 1G1IA 2H88C 1LNQA 5KAIE 3MIWA 4PJ0E 2B87B 3G3ZA 2Q1KA 4H44D 1WRGA 4R4LA 2KXPB 1KILD 1GL2C 2NRGA 3ZDMA 1L0LG 4AUWA 3NMDA 2IFMA 3SFDC 1JY3N 1FDIA 1JO5A 1CW5A 1USEA 1S9KD 3MUDC 1SQXD 2Y9ZA 3T97B 3JCUH 3FXDA 5KJ7A 5APTA 2PFXA 2ITAA 2PP6A 5KLVJ 1ZXGA 2H89C 4H0LC 1LT9C 1X9VA 3A0HE 4EYYQ 1Y8AA 3VP8A 1QX8A 4O9BA 3FX0A 3H1HD 1K04A 1GL2D 3RK3B 1N73A 1DEBA 5C39A 2QSIA 2K9JB 2IZ0A 1FZFA 5B5EH 1RHZB 4Y28J 2KS1A 1JM0A 3CCMP 3B71A 2AXTH 4IL6X 1YHQP 3AE4C 3TYYA 1L0LE 5AW3B 4D6TD 5AVQB 2WSCJ 3CWBD 2OYHB 3IFMA 3AEBC 5BU8B 1YQ4C 3SWKA 4JYBA 3L71G 5EFWB 2K1AA 2RN0A 5AW9B 5AVVB 3CC7P 3N7NA 1JTHA 3L75G 3HUSC 3V5BA 4EDFA 2J58A 1T3UA 2WZ7A 2XNDH 3GHGB 1OW6A 5KLIC 2XU6A 1BE3D 1IK9A 1S3JA 3USSA 3H1KJ 4WVZA 4XA4A 3CPWO 3AE7C 3PTZA 5AVXB 2E76B 3BVHA 1R5SA 3S4RA 1QL1A 1P84I 4GODA 3NXSA 3CI9A 1FJKA 1S5LH 1HF9A 1YYCA 1NGMB 3CX5H 3L71E 1BSHA 3C1LA 3R4YA 3HE4B 1IFNA 1JY3P 3L75E 2IDBA 2KSJA 2W6BA 3VOPA 3C8VA 2IBZI 3AE6C 1JOCA 2R32A 1MZ9A 3L70J 3E1RA 1VQKP 2OTLP 2KK7A 1QGKB 1VQ5P 1G2CB 3Q1MA 1VDFA 2FYNC 3V2PA 2Y0DA 1OFCX 1SQQG 1KQFB 1J2JB 1N2DC 3AEDC 2IPPA 2FYUJ 1DX7A 1SQPK 2OTKE 4TLFA 2BEQD 3W68A 1X8YA 1SFCA 4LC1A 1LT9A 3D6YA 1A02J 1NH4A 3CC4P 3M9BA 2SPZA 1IK7A 4U3FG 1VQ7P 2B87A 2H7HA 3VMYA 1LWUA 2IYOA 1ZV8A 4PD4H 3M9QA 2ZVOB 3BCCJ 3CCRP 1SQQE 1KB9H 1JCDA 2HODB 1SQBK 4DJGA 5APVA 1FZAA 4NPDA 4K3AA 3L75D 3TNUB 2ZYDA 2FKWB 1OXZA 2WSSH 1RE4C 1ZP0C 3CD6P 1NYHA 2J59M 2M5AB 1OZHA 2CPSA 1SVFA 4BRYB 4U3FE 2FXOA 1KYOH 3LIEA 4IFMA 1ZR2A 3HD7A 3PLNA 1L0NK 2WT7B 2K9JA 1PZQA 1LTSC 3L36A 2ZJSE 1T6AA 1IFJA 2FXPA 4XFJA 1L0LK 3CX5D 3B5NC 5CMZA 2OYHA 5GTHH 1FDMA 4RESB 2W83C 3L74D 1NAFA 1EC5A 3OJAB 3TDKA 2A06G 3L35A 2N1TC 1W2EA 3HTKB 3GHGA 2P2UA 2HG5D 2QVAA 2AEFA 3B5ND 1SQQD 2P67A 2BCCJ 2YXRB 3A3YB 2P1JA 1PFIA 5APYA 2LXCB 4H13C 1L4AB 3RL0g 5KAFH 2LKMA 3MHVA 1NTMJ 3GW6A 1HBWA 1PL5A 2WTYA 2HFED 1S4XA 2N1TD 4MN4C 2OYIA 4UB6H 3I5CA 1R5LA 4U3FD 1K05A 4WWIA 2C9NY 2XKMA 1SQVD 3RL0D 3MGNA 1T8ZA 1D7MA 1SQXG 3RBZA 2HLOA 4GIFA 4H13D 5KJ7C 2QG4A 3HE5A 1OIPA 4ASWA 3L72G 3NTNA 2NPSD 1A02F 1NTKG 1PIXA 2FYZA 1DEEG 3E1IA 2Y0CA 2Y0EA 3TK1A 3GMAA 3G6EP 1N73C 5CJ4A 1YTZT 2Z4EA 2WMMA 5KKZC 3TGUD 1T2KC 4N78E 1FJPA 1TU3F 1KYOD 3IAOA 1PP9D 1NTZG 2I1KA 5AVYB 5AW5B 3Q2YA 5KJ7D 1AVOA 1SQPJ 3CWBJ 1RQVA 1FC2C 3M9HA 1SQXE 1GW3A 3L72E 3AE8C 1SS1A 2P7JA 2WPVB 3GG2A 2QEXP 1NTKE 2FYUK 1VQLP 3H1IE 3AE9C 4ZNCA 4PV1C 4K35A 1H8AA 1BE3G 1K8AQ 1RY3A 1T3JA 4RKUJ 1MFZA 3FWLA 3V2QA 5E79E 2N1TA 1GMJA 1NU1G 2KP8A 1NTZE 4JF7A 4BRYA 1S72P 3P7KA 4IFFA 3WU2H 2GUSA 3VTPC 2KSEA 3Q5PA 4C7NB 3MTUE 4ZMDA 3EFGA 2JR8A 3CCUP 2O01J 4I7ZB 2YIUB 4GT1A 2OARA 4PV1D 4BXLA 1VQPP 2QJKC 2NPSA 1YJNP 4OGQC 4H0LB 4UB8H 1EDJA 1W5CE 3AE5C 4I2LC 5AVWB 4N78D 3V2NA 1BE3E 1L0NJ 1VQ4P 1J1DC 1X22A 1L0LJ 1NU1E 4LGDE 1DH3A 2WWWA 1J1EB 3HTKA 1M1KQ 5CHXA 1Q2NA 4B86A 3L72D 1CSBA 1Q82Q 1NTKD 2WPRA 4OGQD 2E75C 1SFCC 1IC2A 1LP1A 3H1ID 3CX5I 1CI6A 2C9LY 1GK6A 3A0BH 4Z1MH 2POHA 1E5WA 5DJUB 2V4HA 4NPFX 5KLIB 1FZCB 1WMKA 3PH0A 3RK3E 1LWUC 2KYVA 2LXBA 1NTZD 2YO2A 1LTJB 2KB7P 1H89A 3VP9A 2WSEJ 3CCLP 5AVZB 3JCUE 3CC2P 2E75D 1SFCD 3M06A 4WBAA 1EDKA 1IFPA 3L71J 3CXHH 1K73Q 1MFTA 1KC8Q 1U57A 2WSCH 3L75J 3O8ZA 4OVNF 4GDOA 3A5TA 2O3JA 1NTMK 5CBOA 2RMZA 1W2BO 2XZRA 1FZBA 2AXTE 3RK3C 3HD7C 3M0DC 1NU1D 4WY4B 4DOJA 1U7MA 1RH5B 1M1JB 1VQ6P 3H1KG 2FYNB 3I56P 1VL2A 1GTWA 2KOGA 4JBZA 2FFDB 2OYHC 5AVSB 4CPGA 1KB9I 2I1JA 1VQMP 3L73D 5GTIE 1SQXK 1ZLLA 3L74G 4A7PA 1RF1B 2KLVA 2WSFJ 2W6AA 3H1LD 3O6QA 3RK3D 3HD7D 4RJTA 1Q90D 5APXA 3VYIA 3GHGC 1AJYA 4L73A 1KYOI 1NKNA 2YNYA 3H1KE 3RK2B 1SQQJ 1N7SB 2E5YA 1UIXA 3MP7B 3E7KA 4R4MA 5CBNA 3CX5E 3PJSK 2QJPC 2JWAA 5TJHA 4GOFA 2O1JA 1VQ9P 4C7NA 2KUBA 1K9MQ 1FZEA 3MZWB 3L74E 3WUUA 2O01N 5KLVD 1USDA 1BDCA 2OYIC 3PHLA 1LTBC 1URQB 2KZIA 1XTCC 5APQA 2IFNA 4I6MC 2J5UA 2ZYAA 5APSA 1FBMA 2QIWA 2QM7A 1KORA 3OAKA 1RF0A 5AW1B 1SQVG 2QJYB 2E76D 5AW8B 1BCCJ 2M0BA 2QM8A 4EI2A 2PAJA 3H1JG 1M8OB 5BVZA 1OW7A 1NKZB 1FS0E 2A45I 4OWFA 4XE5B 3IN6A 3P8CE 1JMMA 1P84H 1YJ9P 3BCCG 1QEXA 1PV3A 4DCKA 1JY2O 2WVRA 3T97A 4IFDK 1FOSE 2KNCB 3TGUG 3U59A 1ZRTE 2M3EA 1M7LA 3BRVB 1S2EA 3G71P 1BGYG 1PP9G 5TISH 1KD1Q 2L91A 1BSNA 3M0DA 3H32B 4PD4E 1SQVE 1Y47A 3H1KD 2C0XA 1YQ3C 2E74B 5AVRB 3H1JE 1KB9E 1KMIZ 3F89A 1LTJA 1HJBA 5CJ0A 1LTAC 2ZT9C 3BCCE 4HYTB 4HB1A 5AW0B 2W6JH 2XV5A 3JSVC 3TGUE 4YTPC 1GU5A 1S1CX 4N6JA 3Q5SA 4W7ZA 3KPEA 1KYOE 1BGYE 1U7JA 1PP9E 3ABVC 1NJIQ 2A45G 1S5LX 2W8ZA 4YXDC 1BDDA 2P10A 1PPJD 3RL0C 2ZXEB 1YBKA 2ZT9D 3P8CD 1HGZA 3P8MC 1GK4A 3KZIH 5CCGA 2NPSC 5GTHE 1GW4A 2FYUD 2PRRA 1ZRTD 3D71A 2FFDA 1H0TB 4ASVA 5KKZB 3FXEA 1N7LA 1JY2N 3HE4A 1RF1A 3M91A 5B66H 3PP5A 1VF5B 2B9BA 4PD4D 5KTBA 2GA1A 5BU5A 2B88A 2Q7CA 4Y99B 3H1JD 1KB9D 1SQXJ 4JQ0D 2AEJA 1G2CA 3L72J 3NFQA 2JP3A 3H1IG 5KAFE 1LTIC 3BCCD 3A7OA 1JTHB 3AE1C 3Q3DA 4IL6H 1GZLA 1N7SA 3BASA 2R3SA 3H1HJ 4UB6E 1GDTA 1BGYD 4H44B 2YKQA 5AW2B 1NTZJ 2WQYC 1KILB 1M56D 3AECC 3SWFA 1URQA 4D6TJ 5H2FH 1IFDA 1JY3O 1EDLA 2B89A 1HUCA 4HH2A 3CMAP 1EDIA 1AV1A 1IJDB 2C0WA 1SQQK 4N3YB 1HJ0A 1AFOA 2JO1A 1FE6A 1NHLA 1HWTC 1X0TA 3CCVP 2HODA 1KQGB 1JMBA 1BE3J 3TNUA 2XNXA 5KAIH 2YMKA 1ZW0A 2R44A 1GL2B 4PJ0H 2M5AA 1M90Q 3CCSP 1NU1J 1IZNB 1IFMA 1LGHB 1J1DB 1YJWP 2WPSA 2WITA 2D2CC 2HPCB 1KV4A 1JY2P 1VQNP 3WMM0 1SQVK 3H32A 1HH0A 2WT7A 3AE2C 3L73G 1KN7A 1HTLC 1RE3A 1SQBG 1YITP 1GD2E 3CXHI 1H88A 2BCCD 3RGUA 1LT9B 1MV8A 3FGAD 3H1LG 2K9YA 2NZ2A 3G4SP 2O01H 3M0AA 3QWOC 1LT1A 1SP4A 2YKOA 1NTMD 3AE3C 3B4SA 2Q5UA 3A0HH 3AEGC 3AEAC 2D2CD 1LWUB 3S1KA 4HJGH 4C46A 2M3BA 1L0NG 1QL2A 1ZOYC 3WU2E 1NVOA 1EZVI 1JNMA 2CPBA 3LW5J 2G8YA 3WUTA 3L73E 2IZ1A 1QVFO 1SQBE 5CCHA 3CCEP 1ZMEC 3HUSB 3QH9A 4UB8E 4I7ZC 3RBXA 5KLVG 2YIUC 4KJMA 1L4AA 3H1LE 3SSUA 4GOEA 4YXWH 3LW5H 2N9BA 2K88A 3CMEP 2R3CA 3AEFC 2YKPA 1OVRA 1RF0C 2L5GB 1H0TA 3HD7B 3VMAA 3V4QA 3AEEC 1ZR4A 5AW6B 2W27A 1L0NE 2KLUA 3VN0A 3UIAA 2JWDA 2FXMA 3GLMA 1SQPD 1J1EC 2MJZA 1JCCA 5M1BA 2H8PD 1Q86Q 4HKZH 2O1KA 2WSEH 4DT0A 3A0BE 3KQGA 3S9OA 4H0LD 5KLVE 1PGQA 3EWKA 3CCQP 2QE7H 2ZFCA 5GTIH 1Y9BA 5B5EE 5L8RJ 3U1CA 2M8RA 3ITKA 1Q7YQ 3L4FA 1EZVG 2W90A 5K5GB 5APUA 1FZCC 5AVTB 4TT3H 1RQUA 4PD4I 1VQ8P 2KZJA 1JB0J 1AA0A 1LTJC 1QLED 1KILA 4BWNA 3CXHE 1HGVA 1SQBD 2JKVA 1PGJA 3SWYA 2QJPB 4NPEA 1N8RQ 3V6IA 3L74J 1LTTC 1NTKK 1OWAA 3KDPB 2OYIB 3D6ZA 4GKGA 3CCJP 3IF4A 3TSIA 2WSFH 1EZVE 1DIPA 2UWJE 1FZGA 3L70G 3R2PA 1LJ2A 1L0ND 1NO4A 1PPJG 2Q3EA 2E76C 2OYOA 1NTZK 1ZN5A 2KI7B 1GL2A 4WY4C 1S5LE 3HE5B 1FDOA 1M1JC 1L0LD 1KFMA 2R5BA 5CCGC 1SLQA 3I55P 2FBWC 2BASA 5APWA 2N9YB 1X79B 4EIJA 2HPCA 2H43A 2FYUG 3MD0A 1VQOP 2BEZF 3MUDA 2FFDC 1MKMA
chains in the Genus database with same CATH topology
1JM0A 2QRXA 4ZNCA 4JBZA 1BDDA 1LP1A 4CPGA 4MN4C 3S1KA 4HJGH 4K35A 1EDLA 2I8DA 2B89A 5K5GB 2HR3A 5DJTB 1NVOA 1EDIA 5DJUB 4NPFX 4WWIA 5EFWB 3PH0A 2P58A 2KZJA 2OTKE 2LXBA 2B87B 2Q1KA 1H0TB 1X0TA 4ASWA 4ASVA 3FXEA 1JMBA 4NPEA 4ZMDA 4KJMA 1OVUA 4GOEA 2KIKA 1DEEG 1S3JA 1ZW0A 2R44A 2SPZA 1Y47A 3ZDMA 2B88A 1LP1B 1EDKA 2M5AA 4BXLA 1EC5A 5CBNA 1MFTA 4IOIH 2WMMA 1OVRA 2LR2A 2B87A 1EDJA 1H0TA 4GOFA 1OVVA 3FXDA 2K3RA 2KUBA 2UWJE 5CBOA 3MZWB 2QVAA 4GODA 1ZXGA 2KS1B 1BDCA 4HB1A 2RKLA 2KI7B 2JWDA 4EYYQ 2KZIA 2ZAEB 3RGUA 1FC2C 1U7MA 4NPDA 4K3AA 2LXCB 4HKZH 5C39A 1U7JA 3QWOC 1LT1A 3MHVA 1Q2NA 1SS1A 2M0BA 2M5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM0 A;  2QRX A;  4ZNC A;  4JBZ A;  1BDD A;  1LP1 A;  4CPG A;  4MN4 C;  3S1K A;  4HJG H;  4K35 A;  1EDL A;  2I8D A;  2B89 A;  5K5G B;  2HR3 A;  5DJT B;  1NVO A;  1EDI A;  5DJU B;  4NPF X;  4WWI A;  5EFW B;  3PH0 A;  2P58 A;  2KZJ A;  2OTK E;  2LXB A;  2B87 B;  2Q1K A;  1H0T B;  1X0T A;  4ASW A;  4ASV A;  3FXE A;  1JMB A;  4NPE A;  4ZMD A;  4KJM A;  1OVU A;  4GOE A;  2KIK A;  1DEE G;  1S3J A;  1ZW0 A;  2R44 A;  2SPZ A;  1Y47 A;  3ZDM A;  2B88 A;  1LP1 B;  1EDK A;  2M5A A;  4BXL A;  1EC5 A;  5CBN A;  1MFT A;  4IOI H;  2WMM A;  1OVR A;  2LR2 A;  2B87 A;  1EDJ A;  1H0T A;  4GOF A;  1OVV A;  3FXD A;  2K3R A;  2KUB A;  2UWJ E;  5CBO A;  3MZW B;  2QVA A;  4GOD A;  1ZXG A;  2KS1 B;  1BDC A;  4HB1 A;  2RKL A;  2KI7 B;  2JWD A;  4EYY Q;  2KZI A;  2ZAE B;  3RGU A;  1FC2 C;  1U7M A;  4NPD A;  4K3A A;  2LXC B;  4HKZ H;  5C39 A;  1U7J A;  3QWO C;  1LT1 A;  3MHV A;  1Q2N A;  1SS1 A;  2M0B A;  2M5A B; 
#chains in the Genus database with same CATH topology
 1IO4 A;  1OX3 A;  3D70 A;  1Z56 A;  2GUV A;  3Q5R A;  1KQS O;  1RF1 C;  2YXQ B;  4U3F J;  2I8D A;  1FU1 A;  1OW8 A;  4AYC A;  1WT6 A;  1XTG B;  1DD3 A;  4OH8 B;  5AVU B;  4WY4 D;  1SQV J;  3V4W A;  2GM4 A;  1PGO A;  2XDJ A;  2AEM A;  3G9R A;  3KHU A;  3L70 E;  1NU1 K;  3H1J J;  5CCG D;  1PPJ E;  4C7R A;  2WPQ A;  3CL3 D;  3CXH D;  2IYP A;  3VMX A;  1R8E A;  1QVG O;  1BCC G;  3B5N B;  1HVV A;  1CZQ A;  3II6 A;  3RK2 C;  1N7S C;  2ZT9 B;  1VPC A;  3BAT A;  4AQR D;  3SFE C;  3K5B A;  2FYU E;  4W7Y A;  2YMY A;  3L71 D;  3TGU J;  1YI2 P;  2RH0 A;  2QA4 P;  4WB4 A;  2IBZ G;  2MKV A;  2Y9Y A;  1BGY J;  3HUS A;  1PP9 J;  2N1T B;  1JEK A;  1EZV D;  1YTZ I;  1URQ C;  4I1L A;  2Q6Q A;  2HYN A;  1M57 D;  1FZC A;  1FAV A;  3F5H A;  1AQ5 A;  3H25 A;  2E43 A;  1KZU B;  2QJY C;  3HRN A;  3RL0 B;  3IR9 A;  3RK2 D;  1N7S D;  1KFN A;  1P84 E;  3CLQ A;  3BRT B;  1BCC E;  4H13 B;  3OW2 O;  4LLH A;  4L75 A;  4ZKU A;  2NPS B;  3A2A A;  2QRX A;  3H6P A;  1OMI A;  1NAY A;  5DJT B;  4U7J A;  1NOH A;  1URQ D;  5TIS E;  4RO0 A;  5KLV K;  2V7Q J;  2IBZ E;  1L2P A;  3B8E B;  3TF5 A;  2OTJ P;  2ZVN B;  3L70 D;  2Q9I A;  3N4X A;  1E79 H;  4JYC A;  4WY4 A;  2Q3I A;  3WUV A;  4YPC A;  1AQT A;  2V7Q H;  2JJL A;  1M1J A;  1RE3 C;  2E74 C;  1OVU A;  2G3A A;  2A45 H;  2BCC G;  1LP1 B;  1CI6 B;  1MUU A;  2LR2 A;  3EFF K;  1N73 B;  4W80 A;  1NTM G;  2CK3 H;  2K3R A;  4KHX A;  2KS1 B;  1NWQ A;  2IX7 C;  4EOT A;  2RKL A;  2JDI H;  4L76 A;  2FY8 A;  1PGP A;  2AXC A;  1KQL A;  4M3L A;  2ZAE B;  1EQ7 A;  3C9I A;  2E74 D;  2OQQ A;  1FOS F;  2A06 E;  1EXJ A;  1P84 D;  1DD4 A;  2ZYG A;  3OA7 A;  1EXI A;  1BCC D;  2YO3 A;  3KZI E;  1NTK J;  4QMA A;  5CCH C;  2ZXX A;  3H1I J;  4JPZ B;  4ZKP A;  1AVY A;  2BCC E;  2JEE A;  1L4A C;  4PV1 B;  2PGD A;  1NTM E;  2R5D A;  2IBZ D;  3W67 A;  5B66 E;  2P58 A;  3H1H G;  1RE4 A;  3PRJ A;  2DW3 A;  2E42 A;  4L74 A;  3GF3 A;  1KIL E;  5AW7 B;  1VF5 C;  5E79 H;  2D2C B;  2K37 A;  3KYQ A;  5CCH D;  2KIK A;  2Z5H A;  1SQP G;  4D6T G;  3CWB G;  4Y99 C;  1IFI A;  1KTM A;  1UII A;  1L4A D;  4IOI H;  2OGU A;  3P32 A;  4IL6 E;  2QJK B;  1S9K E;  1Q81 Q;  1GU4 A;  4OGQ B;  1OVV A;  3EQ2 A;  3LID A;  2VRS A;  3B5N A;  3KXD A;  3O6Q B;  1N86 A;  3FWN A;  3GF7 A;  2E5T A;  2KNC A;  1T2K D;  1G1J A;  3H1H E;  1VF5 D;  2Z5I A;  3JC2 2;  5H2F E;  4H44 C;  2A06 D;  3V2R A;  4KT0 J;  1KIL C;  3L37 A;  4DZO A;  3L73 J;  1SQP E;  3U1A A;  3VMZ A;  4D6T E;  3CWB E;  1SQB J;  2E75 B;  1SFC B;  2HR3 A;  1LTG C;  1JUN A;  1YIJ P;  3H1L J;  5AW4 B;  1G1I A;  2H88 C;  1LNQ A;  5KAI E;  3MIW A;  4PJ0 E;  2B87 B;  3G3Z A;  2Q1K A;  4H44 D;  1WRG A;  4R4L A;  2KXP B;  1KIL D;  1GL2 C;  2NRG A;  3ZDM A;  1L0L G;  4AUW A;  3NMD A;  2IFM A;  3SFD C;  1JY3 N;  1FDI A;  1JO5 A;  1CW5 A;  1USE A;  1S9K D;  3MUD C;  1SQX D;  2Y9Z A;  3T97 B;  3JCU H;  3FXD A;  5KJ7 A;  5APT A;  2PFX A;  2ITA A;  2PP6 A;  5KLV J;  1ZXG A;  2H89 C;  4H0L C;  1LT9 C;  1X9V A;  3A0H E;  4EYY Q;  1Y8A A;  3VP8 A;  1QX8 A;  4O9B A;  3FX0 A;  3H1H D;  1K04 A;  1GL2 D;  3RK3 B;  1N73 A;  1DEB A;  5C39 A;  2QSI A;  2K9J B;  2IZ0 A;  1FZF A;  5B5E H;  1RHZ B;  4Y28 J;  2KS1 A;  1JM0 A;  3CCM P;  3B71 A;  2AXT H;  4IL6 X;  1YHQ P;  3AE4 C;  3TYY A;  1L0L E;  5AW3 B;  4D6T D;  5AVQ B;  2WSC J;  3CWB D;  2OYH B;  3IFM A;  3AEB C;  5BU8 B;  1YQ4 C;  3SWK A;  4JYB A;  3L71 G;  5EFW B;  2K1A A;  2RN0 A;  5AW9 B;  5AVV B;  3CC7 P;  3N7N A;  1JTH A;  3L75 G;  3HUS C;  3V5B A;  4EDF A;  2J58 A;  1T3U A;  2WZ7 A;  2XND H;  3GHG B;  1OW6 A;  5KLI C;  2XU6 A;  1BE3 D;  1IK9 A;  1S3J A;  3USS A;  3H1K J;  4WVZ A;  4XA4 A;  3CPW O;  3AE7 C;  3PTZ A;  5AVX B;  2E76 B;  3BVH A;  1R5S A;  3S4R A;  1QL1 A;  1P84 I;  4GOD A;  3NXS A;  3CI9 A;  1FJK A;  1S5L H;  1HF9 A;  1YYC A;  1NGM B;  3CX5 H;  3L71 E;  1BSH A;  3C1L A;  3R4Y A;  3HE4 B;  1IFN A;  1JY3 P;  3L75 E;  2IDB A;  2KSJ A;  2W6B A;  3VOP A;  3C8V A;  2IBZ I;  3AE6 C;  1JOC A;  2R32 A;  1MZ9 A;  3L70 J;  3E1R A;  1VQK P;  2OTL P;  2KK7 A;  1QGK B;  1VQ5 P;  1G2C B;  3Q1M A;  1VDF A;  2FYN C;  3V2P A;  2Y0D A;  1OFC X;  1SQQ G;  1KQF B;  1J2J B;  1N2D C;  3AED C;  2IPP A;  2FYU J;  1DX7 A;  1SQP K;  2OTK E;  4TLF A;  2BEQ D;  3W68 A;  1X8Y A;  1SFC A;  4LC1 A;  1LT9 A;  3D6Y A;  1A02 J;  1NH4 A;  3CC4 P;  3M9B A;  2SPZ A;  1IK7 A;  4U3F G;  1VQ7 P;  2B87 A;  2H7H A;  3VMY A;  1LWU A;  2IYO A;  1ZV8 A;  4PD4 H;  3M9Q A;  2ZVO B;  3BCC J;  3CCR P;  1SQQ E;  1KB9 H;  1JCD A;  2HOD B;  1SQB K;  4DJG A;  5APV A;  1FZA A;  4NPD A;  4K3A A;  3L75 D;  3TNU B;  2ZYD A;  2FKW B;  1OXZ A;  2WSS H;  1RE4 C;  1ZP0 C;  3CD6 P;  1NYH A;  2J59 M;  2M5A B;  1OZH A;  2CPS A;  1SVF A;  4BRY B;  4U3F E;  2FXO A;  1KYO H;  3LIE A;  4IFM A;  1ZR2 A;  3HD7 A;  3PLN A;  1L0N K;  2WT7 B;  2K9J A;  1PZQ A;  1LTS C;  3L36 A;  2ZJS E;  1T6A A;  1IFJ A;  2FXP A;  4XFJ A;  1L0L K;  3CX5 D;  3B5N C;  5CMZ A;  2OYH A;  5GTH H;  1FDM A;  4RES B;  2W83 C;  3L74 D;  1NAF A;  1EC5 A;  3OJA B;  3TDK A;  2A06 G;  3L35 A;  2N1T C;  1W2E A;  3HTK B;  3GHG A;  2P2U A;  2HG5 D;  2QVA A;  2AEF A;  3B5N D;  1SQQ D;  2P67 A;  2BCC J;  2YXR B;  3A3Y B;  2P1J A;  1PFI A;  5APY A;  2LXC B;  4H13 C;  1L4A B;  3RL0 g;  5KAF H;  2LKM A;  3MHV A;  1NTM J;  3GW6 A;  1HBW A;  1PL5 A;  2WTY A;  2HFE D;  1S4X A;  2N1T D;  4MN4 C;  2OYI A;  4UB6 H;  3I5C A;  1R5L A;  4U3F D;  1K05 A;  4WWI A;  2C9N Y;  2XKM A;  1SQV D;  3RL0 D;  3MGN A;  1T8Z A;  1D7M A;  1SQX G;  3RBZ A;  2HLO A;  4GIF A;  4H13 D;  5KJ7 C;  2QG4 A;  3HE5 A;  1OIP A;  4ASW A;  3L72 G;  3NTN A;  2NPS D;  1A02 F;  1NTK G;  1PIX A;  2FYZ A;  1DEE G;  3E1I A;  2Y0C A;  2Y0E A;  3TK1 A;  3GMA A;  3G6E P;  1N73 C;  5CJ4 A;  1YTZ T;  2Z4E A;  2WMM A;  5KKZ C;  3TGU D;  1T2K C;  4N78 E;  1FJP A;  1TU3 F;  1KYO D;  3IAO A;  1PP9 D;  1NTZ G;  2I1K A;  5AVY B;  5AW5 B;  3Q2Y A;  5KJ7 D;  1AVO A;  1SQP J;  3CWB J;  1RQV A;  1FC2 C;  3M9H A;  1SQX E;  1GW3 A;  3L72 E;  3AE8 C;  1SS1 A;  2P7J A;  2WPV B;  3GG2 A;  2QEX P;  1NTK E;  2FYU K;  1VQL P;  3H1I E;  3AE9 C;  4ZNC A;  4PV1 C;  4K35 A;  1H8A A;  1BE3 G;  1K8A Q;  1RY3 A;  1T3J A;  4RKU J;  1MFZ A;  3FWL A;  3V2Q A;  5E79 E;  2N1T A;  1GMJ A;  1NU1 G;  2KP8 A;  1NTZ E;  4JF7 A;  4BRY A;  1S72 P;  3P7K A;  4IFF A;  3WU2 H;  2GUS A;  3VTP C;  2KSE A;  3Q5P A;  4C7N B;  3MTU E;  4ZMD A;  3EFG A;  2JR8 A;  3CCU P;  2O01 J;  4I7Z B;  2YIU B;  4GT1 A;  2OAR A;  4PV1 D;  4BXL A;  1VQP P;  2QJK C;  2NPS A;  1YJN P;  4OGQ C;  4H0L B;  4UB8 H;  1EDJ A;  1W5C E;  3AE5 C;  4I2L C;  5AVW B;  4N78 D;  3V2N A;  1BE3 E;  1L0N J;  1VQ4 P;  1J1D C;  1X22 A;  1L0L J;  1NU1 E;  4LGD E;  1DH3 A;  2WWW A;  1J1E B;  3HTK A;  1M1K Q;  5CHX A;  1Q2N A;  4B86 A;  3L72 D;  1CSB A;  1Q82 Q;  1NTK D;  2WPR A;  4OGQ D;  2E75 C;  1SFC C;  1IC2 A;  1LP1 A;  3H1I D;  3CX5 I;  1CI6 A;  2C9L Y;  1GK6 A;  3A0B H;  4Z1M H;  2POH A;  1E5W A;  5DJU B;  2V4H A;  4NPF X;  5KLI B;  1FZC B;  1WMK A;  3PH0 A;  3RK3 E;  1LWU C;  2KYV A;  2LXB A;  1NTZ D;  2YO2 A;  1LTJ B;  2KB7 P;  1H89 A;  3VP9 A;  2WSE J;  3CCL P;  5AVZ B;  3JCU E;  3CC2 P;  2E75 D;  1SFC D;  3M06 A;  4WBA A;  1EDK A;  1IFP A;  3L71 J;  3CXH H;  1K73 Q;  1MFT A;  1KC8 Q;  1U57 A;  2WSC H;  3L75 J;  3O8Z A;  4OVN F;  4GDO A;  3A5T A;  2O3J A;  1NTM K;  5CBO A;  2RMZ A;  1W2B O;  2XZR A;  1FZB A;  2AXT E;  3RK3 C;  3HD7 C;  3M0D C;  1NU1 D;  4WY4 B;  4DOJ A;  1U7M A;  1RH5 B;  1M1J B;  1VQ6 P;  3H1K G;  2FYN B;  3I56 P;  1VL2 A;  1GTW A;  2KOG A;  4JBZ A;  2FFD B;  2OYH C;  5AVS B;  4CPG A;  1KB9 I;  2I1J A;  1VQM P;  3L73 D;  5GTI E;  1SQX K;  1ZLL A;  3L74 G;  4A7P A;  1RF1 B;  2KLV A;  2WSF J;  2W6A A;  3H1L D;  3O6Q A;  3RK3 D;  3HD7 D;  4RJT A;  1Q90 D;  5APX A;  3VYI A;  3GHG C;  1AJY A;  4L73 A;  1KYO I;  1NKN A;  2YNY A;  3H1K E;  3RK2 B;  1SQQ J;  1N7S B;  2E5Y A;  1UIX A;  3MP7 B;  3E7K A;  4R4M A;  5CBN A;  3CX5 E;  3PJS K;  2QJP C;  2JWA A;  5TJH A;  4GOF A;  2O1J A;  1VQ9 P;  4C7N A;  2KUB A;  1K9M Q;  1FZE A;  3MZW B;  3L74 E;  3WUU A;  2O01 N;  5KLV D;  1USD A;  1BDC A;  2OYI C;  3PHL A;  1LTB C;  1URQ B;  2KZI A;  1XTC C;  5APQ A;  2IFN A;  4I6M C;  2J5U A;  2ZYA A;  5APS A;  1FBM A;  2QIW A;  2QM7 A;  1KOR A;  3OAK A;  1RF0 A;  5AW1 B;  1SQV G;  2QJY B;  2E76 D;  5AW8 B;  1BCC J;  2M0B A;  2QM8 A;  4EI2 A;  2PAJ A;  3H1J G;  1M8O B;  5BVZ A;  1OW7 A;  1NKZ B;  1FS0 E;  2A45 I;  4OWF A;  4XE5 B;  3IN6 A;  3P8C E;  1JMM A;  1P84 H;  1YJ9 P;  3BCC G;  1QEX A;  1PV3 A;  4DCK A;  1JY2 O;  2WVR A;  3T97 A;  4IFD K;  1FOS E;  2KNC B;  3TGU G;  3U59 A;  1ZRT E;  2M3E A;  1M7L A;  3BRV B;  1S2E A;  3G71 P;  1BGY G;  1PP9 G;  5TIS H;  1KD1 Q;  2L91 A;  1BSN A;  3M0D A;  3H32 B;  4PD4 E;  1SQV E;  1Y47 A;  3H1K D;  2C0X A;  1YQ3 C;  2E74 B;  5AVR B;  3H1J E;  1KB9 E;  1KMI Z;  3F89 A;  1LTJ A;  1HJB A;  5CJ0 A;  1LTA C;  2ZT9 C;  3BCC E;  4HYT B;  4HB1 A;  5AW0 B;  2W6J H;  2XV5 A;  3JSV C;  3TGU E;  4YTP C;  1GU5 A;  1S1C X;  4N6J A;  3Q5S A;  4W7Z A;  3KPE A;  1KYO E;  1BGY E;  1U7J A;  1PP9 E;  3ABV C;  1NJI Q;  2A45 G;  1S5L X;  2W8Z A;  4YXD C;  1BDD A;  2P10 A;  1PPJ D;  3RL0 C;  2ZXE B;  1YBK A;  2ZT9 D;  3P8C D;  1HGZ A;  3P8M C;  1GK4 A;  3KZI H;  5CCG A;  2NPS C;  5GTH E;  1GW4 A;  2FYU D;  2PRR A;  1ZRT D;  3D71 A;  2FFD A;  1H0T B;  4ASV A;  5KKZ B;  3FXE A;  1N7L A;  1JY2 N;  3HE4 A;  1RF1 A;  3M91 A;  5B66 H;  3PP5 A;  1VF5 B;  2B9B A;  4PD4 D;  5KTB A;  2GA1 A;  5BU5 A;  2B88 A;  2Q7C A;  4Y99 B;  3H1J D;  1KB9 D;  1SQX J;  4JQ0 D;  2AEJ A;  1G2C A;  3L72 J;  3NFQ A;  2JP3 A;  3H1I G;  5KAF E;  1LTI C;  3BCC D;  3A7O A;  1JTH B;  3AE1 C;  3Q3D A;  4IL6 H;  1GZL A;  1N7S A;  3BAS A;  2R3S A;  3H1H J;  4UB6 E;  1GDT A;  1BGY D;  4H44 B;  2YKQ A;  5AW2 B;  1NTZ J;  2WQY C;  1KIL B;  1M56 D;  3AEC C;  3SWF A;  1URQ A;  4D6T J;  5H2F H;  1IFD A;  1JY3 O;  1EDL A;  2B89 A;  1HUC A;  4HH2 A;  3CMA P;  1EDI A;  1AV1 A;  1IJD B;  2C0W A;  1SQQ K;  4N3Y B;  1HJ0 A;  1AFO A;  2JO1 A;  1FE6 A;  1NHL A;  1HWT C;  1X0T A;  3CCV P;  2HOD A;  1KQG B;  1JMB A;  1BE3 J;  3TNU A;  2XNX A;  5KAI H;  2YMK A;  1ZW0 A;  2R44 A;  1GL2 B;  4PJ0 H;  2M5A A;  1M90 Q;  3CCS P;  1NU1 J;  1IZN B;  1IFM A;  1LGH B;  1J1D B;  1YJW P;  2WPS A;  2WIT A;  2D2C C;  2HPC B;  1KV4 A;  1JY2 P;  1VQN P;  3WMM 0;  1SQV K;  3H32 A;  1HH0 A;  2WT7 A;  3AE2 C;  3L73 G;  1KN7 A;  1HTL C;  1RE3 A;  1SQB G;  1YIT P;  1GD2 E;  3CXH I;  1H88 A;  2BCC D;  3RGU A;  1LT9 B;  1MV8 A;  3FGA D;  3H1L G;  2K9Y A;  2NZ2 A;  3G4S P;  2O01 H;  3M0A A;  3QWO C;  1LT1 A;  1SP4 A;  2YKO A;  1NTM D;  3AE3 C;  3B4S A;  2Q5U A;  3A0H H;  3AEG C;  3AEA C;  2D2C D;  1LWU B;  3S1K A;  4HJG H;  4C46 A;  2M3B A;  1L0N G;  1QL2 A;  1ZOY C;  3WU2 E;  1NVO A;  1EZV I;  1JNM A;  2CPB A;  3LW5 J;  2G8Y A;  3WUT A;  3L73 E;  2IZ1 A;  1QVF O;  1SQB E;  5CCH A;  3CCE P;  1ZME C;  3HUS B;  3QH9 A;  4UB8 E;  4I7Z C;  3RBX A;  5KLV G;  2YIU C;  4KJM A;  1L4A A;  3H1L E;  3SSU A;  4GOE A;  4YXW H;  3LW5 H;  2N9B A;  2K88 A;  3CME P;  2R3C A;  3AEF C;  2YKP A;  1OVR A;  1RF0 C;  2L5G B;  1H0T A;  3HD7 B;  3VMA A;  3V4Q A;  3AEE C;  1ZR4 A;  5AW6 B;  2W27 A;  1L0N E;  2KLU A;  3VN0 A;  3UIA A;  2JWD A;  2FXM A;  3GLM A;  1SQP D;  1J1E C;  2MJZ A;  1JCC A;  5M1B A;  2H8P D;  1Q86 Q;  4HKZ H;  2O1K A;  2WSE H;  4DT0 A;  3A0B E;  3KQG A;  3S9O A;  4H0L D;  5KLV E;  1PGQ A;  3EWK A;  3CCQ P;  2QE7 H;  2ZFC A;  5GTI H;  1Y9B A;  5B5E E;  5L8R J;  3U1C A;  2M8R A;  3ITK A;  1Q7Y Q;  3L4F A;  1EZV G;  2W90 A;  5K5G B;  5APU A;  1FZC C;  5AVT B;  4TT3 H;  1RQU A;  4PD4 I;  1VQ8 P;  2KZJ A;  1JB0 J;  1AA0 A;  1LTJ C;  1QLE D;  1KIL A;  4BWN A;  3CXH E;  1HGV A;  1SQB D;  2JKV A;  1PGJ A;  3SWY A;  2QJP B;  4NPE A;  1N8R Q;  3V6I A;  3L74 J;  1LTT C;  1NTK K;  1OWA A;  3KDP B;  2OYI B;  3D6Z A;  4GKG A;  3CCJ P;  3IF4 A;  3TSI A;  2WSF H;  1EZV E;  1DIP A;  2UWJ E;  1FZG A;  3L70 G;  3R2P A;  1LJ2 A;  1L0N D;  1NO4 A;  1PPJ G;  2Q3E A;  2E76 C;  2OYO A;  1NTZ K;  1ZN5 A;  2KI7 B;  1GL2 A;  4WY4 C;  1S5L E;  3HE5 B;  1FDO A;  1M1J C;  1L0L D;  1KFM A;  2R5B A;  5CCG C;  1SLQ A;  3I55 P;  2FBW C;  2BAS A;  5APW A;  2N9Y B;  1X79 B;  4EIJ A;  2HPC A;  2H43 A;  2FYU G;  3MD0 A;  1VQO P;  2BEZ F;  3MUD A;  2FFD C;  1MKM A; 
#chains in the Genus database with same CATH homology
 1JM0 A;  2QRX A;  4ZNC A;  4JBZ A;  1BDD A;  1LP1 A;  4CPG A;  4MN4 C;  3S1K A;  4HJG H;  4K35 A;  1EDL A;  2I8D A;  2B89 A;  5K5G B;  2HR3 A;  5DJT B;  1NVO A;  1EDI A;  5DJU B;  4NPF X;  4WWI A;  5EFW B;  3PH0 A;  2P58 A;  2KZJ A;  2OTK E;  2LXB A;  2B87 B;  2Q1K A;  1H0T B;  1X0T A;  4ASW A;  4ASV A;  3FXE A;  1JMB A;  4NPE A;  4ZMD A;  4KJM A;  1OVU A;  4GOE A;  2KIK A;  1DEE G;  1S3J A;  1ZW0 A;  2R44 A;  2SPZ A;  1Y47 A;  3ZDM A;  2B88 A;  1LP1 B;  1EDK A;  2M5A A;  4BXL A;  1EC5 A;  5CBN A;  1MFT A;  4IOI H;  2WMM A;  1OVR A;  2LR2 A;  2B87 A;  1EDJ A;  1H0T A;  4GOF A;  1OVV A;  3FXD A;  2K3R A;  2KUB A;  2UWJ E;  5CBO A;  3MZW B;  2QVA A;  4GOD A;  1ZXG A;  2KS1 B;  1BDC A;  4HB1 A;  2RKL A;  2KI7 B;  2JWD A;  4EYY Q;  2KZI A;  2ZAE B;  3RGU A;  1FC2 C;  1U7M A;  4NPD A;  4K3A A;  2LXC B;  4HKZ H;  5C39 A;  1U7J A;  3QWO C;  1LT1 A;  3MHV A;  1Q2N A;  1SS1 A;  2M0B A;  2M5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...