1OVZA

Crystal structure of human fcari
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
193
structure length
193
Chain Sequence
b'PMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTAID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin alpha Fc receptor
publication title Insights into IgA-mediated immune responses from the crystal structures of human Fc-alpha-RI and its complex with IgA1-Fc
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ovzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ovzA01
5EBWA 1J8HB 3MRCB 3MRQA 2NY6B 4OCRH 6CGTA 3L1OL 1S7QB 1X5HA 4XC3H 2AXGB 1KJ3H 2C7UA 3EAKA 2HT3C 1HHGA 2BNQD 3V7AG 1KEGL 3L5WB 4GAGH 2PETA 2DQHH 1FAKT 3R0NA 3VI4E 5J56B 1MHCB 1K5NA 4PRPE 4JPVL 2CIKA 3MRDB 2X40A 2LE9A 4F80A 4UNUA 1MH5A 3TO2B 3WD5H 4DCQB 1A6AB 4MX7B 2GAZB 4O2EA 3EFFB 3OJ2C 4U3HA 4L8SB 1CCZA 4ODVH 1MAML 1MQKL 1RJZA 3H42L 3PHOA 1DDHB 3PG2A 3D2UB 4P46A 2ATKB 3OJMB 1F6LL 3LCYA 5F8RC 2X4OA 1RIHL 2R39A 5ISZE 4OF6A 1I8LA 2PXYA 4XCCH 1EO8H 2R1XA 1GIGL 1XR8B 1AP2A 3FT4A 1J0HA 1GPOH 5DLMH 1ORQB 1YN7B 5JXED 1KJMB 5J6GB 3VRLE 4AH2A 5IFJB 1F3JA 2NTFA 5EU3A 2VLJD 1WBXA 4PJDE 5HTSA 3EDJA 3SGEI 1I1AA 3CLFH 1I3GH 4NKDB 2Q7YB 2IPKA 4ZAKC 1EEYA 5JW4N 3PQYB 2OR9H 2FBOJ 4OUUB 3KJ4C 4D0DA 4ODHH 3O6LL 3CH8A 1A22B 1N6QL 1ZGLP 1JF5A 4JR9H 4F37K 2ESVB 3LOWA 1T1WB 5HVFB 1N4XH 4X9BA 5I15L 4L8CB 3TT1H 1HIML 4PY8J 3MACL 1R5VA 4M1GH 1NGYA 1HXMA 4OF8A 2HWZH 1NSNH 2VDKH 3IXTB 2V5MA 4L9LC 5GHWH 4Z78A 2XZQL 4KKAC 3SGDH 4CKVX 1RK1B 4Y5YC 3NACL 1ND0B 1A6ZA 4L4JA 1F42A 1K8DB 2E3VA 4NO0B 2D7MA 5BO1L 1KV3A 3UTZA 1KB5B 2RFXB 2IPUK 4WFHE 5MHSE 3QIWA 2LU7A 3RP1A 2VAJA 4L4TD 3C5ZB 3ZTNL 5DJAB 3D1MC 3P9MA 4ELMF 1WK0A 1NAMH 3C60D 3LH2L 4TTDD 3MXVH 3D39B 4KUZH 3L9RA 1NEZB 5AUMA 5A40E 3K4DA 1BD2D 3WDJA 4XNYH 3NZ8B 3EYOA 2VXVH 1QKZL 1U42A 5KBNC 4RGNB 1J7VR 2CKBB 1DEEB 2XN9B 5J0BA 5EOCL 3HC4L 1SJVA 3PP3H 1UACH 4RNRA 1ZANL 1GOHA 5TE4L 1AI1H 4JPWH 2YPKB 1IC7L 4HWBH 2XPGA 3LKRA 1RZKL 4UILH 1NC2D 2H2PD 3RWIA 4PJCA 1MFAL 3VFUA 4OF3A 3FB6A 3MJ9A 4NN5C 1QA9A 4F15B 1L7IL 1DBJH 4TPRL 4N0CC 4BZ2L 3NVQA 4PJHA 3CFCH 4JHZA 4KROB 4LU5H 3S37H 5GSRB 5EU6D 3ZYOA 5T1KB 3QDHA 4KVNL 4JDTH 3G04A 3JV6A 3OG6B 2VLKA 1C5BH 2AV1A 3CFBA 3GSVB 1WBYA 1AGBA 3WUWA 3QPQC 4ELMB 2F53E 3QJFA 3LKQB 3HAEH 1T83C 3CZFA 43C9B 4M43L 4PJBA 1OGAE 1CLYH 2A6DB 5ADOL 3MJ9L 3VFPB 3B5TA 3QXAA 3D25B 3LB6C 2IBZX 3QCTL 5EU7E 5I1EH 1PG7W 4YHOH 2P8PB 3IXAB 5EU5A 2UUDH 4PJIE 3Q3GB 4X7DC 3HI1B 5A16A 3CMOH 2MJWA 2H41A 1PZUB 4PIRF 4WV1B 1J9CT 2NZIA 4NQUA 4JJHA 2D7OA 4WUUE 5FM4A 4CAGA 4YDJA 1PQZA 1N5AB 1EGJA 1G7JA 1ZXQA 1YECL 3GMMB 4I18C 2H26B 4PTUA 1FZOB 4P5MB 5E2TH 4DK6A 4R90L 2FLRT 4YPJA 2GSGB 3ARRA 35C8H 1RULH 1XCQA 1I8MB 2FYYA 4M9OA 1XGPA 3MLUL 2GT9A 3PNWB 1PBYA 2IQAB 2YC1A 3JTTA 1NGQH 4WWKB 1Q9WB 1XF2B 3JWDH 1MHEA 5CGMA 3T1FB 1BM3L 5GRVK 1NMBH 5D9SB 4W4OC 1IC4H 5T3XD 5IWLC 3D3VD 4NUJB 2OL3A 2YMXL 2VLRA 3C8KA 5I1DA 3BH8B 4GRMA 4J3VA 5C08D 1KPUA 4WENB 3T2NH 1NMAL 1EHLH 2OR7A 3MROB 1J05A 4K8RH 1VHPA 4BZYA 1A7PH 4NSKB 3HPJA 1MEXL 5DR5H 3ROOB 2AK1L 1S78D 4O00A 4L9DA 5DJCB 4YHMH 5E6IA 3MRIB 3VH8B 5EBLB 3MV8E 4UOW0 3MLXL 4RAVB 2QHRL 4LVHB 2XG4A 5M94B 3FO1A 3ARBB 1VCAA 2R23A 1BHGA 5HPMA 4GMSH 5HGAB 3B3IA 4M7ZC 4TSBH 4MXVE 5E8OB 4MVBC 3RIAF 3KR3H 5DHVA 1T2QL 5B38A 2GHWB 1BFOA 2VQ1A 5DJDA 2IPUG 1WEJL 5I17B 5CINH 3ZTJH 5IHUH 2VLME 3VWJB 3CSPA 4BYHA 5ANME 3BJ91 1NPUA 1YEDA 4XMLH 3QUML 4JFDD 1XIWD 3H0TB 3ULVF 2PW1A 5CMAA 4P5TC 5M95B 3H7BB 1LO4H 1GRWA 3HI6H 4NGHH 5I75C 4XB7A 1MJJA 3ULUF 3RGVB 1EJOL 3KXFB 3SPVA 2J5LB 3L3JB 1F8TL 4JRYB 5HDLA 4P2QD 3UDWC 4YHLH 1ONQB 4EDWH 3GDBA 4NQDD 1RURH 1B4JL 5DD5L 4Y2DA 4P4KA 3KYAA 1S9YA 3TH4T 1WITA 4YZFE 4PLKC 4OCNC 3T4AA 2ADIB 1PYWA 2A74A 2G9HA 3DSFL 5EZIH 4HPOH 2Y25A 4UV7L 1MRCL 3MV01 3WO4C 3WFBH 2LAGB 5D1QD 3VFMB 4TYUA 1J5OH 5ELIA 1HOCB 1GAFH 1HZHH 4XZUB 1JNNL 1QPPA 1U8KA 3DROB 2FLBT 2NY4D 4K94H 2DQDH 4FZ8L 3K0WA 4MAYA 2QTEA 4H88L 1J8HA 2CK0L 3MRCA 3EJZC 1C7SA 4ODUA 3I9GL 1V7NH 4J6RH 3FO2B 4AJ0A 2X9XA 1ZLSL 2X70B 5D71H 5F89B 3L5WA 2IH1B 4JY6B 4Y1AD 3PHSA 4MNQB 1MHCA 2BY0A 4Y8DC 3P73B 1SJHA 7CGTA 1MIEL 2R29L 3MRDA 4OAWB 5FA4B 1DVFB 3TO2A 3BE1L 4WI6A 4DCQA 3QUZC 4XCEB 1MLCB 2VKWA 3QHZH 5C0AD 1A6AA 4MX7A 4MD4B 2BRRL 3BKML 3CXHK 4NHUB 4PJEE 3FQXB 1V3MA 1BJMA 1NFIB 5E70A 4L8SA 1FNAA 1Q0YL 4H20H 5HD8C 2HRPL 3D2UA 1F02I 43CAB 2ATKA 4UBDC 1BFVH 5FO7B 2E6PA 5CEZL 2I9TB 1I8KB 3JBG7 1IBGL 1XR9B 5MI0B 2A77L 1SM3L 4LARL 4ZXBB 4X4XB 3G6JF 3T0WA 2GTWB 1XR8A 4PY8I 3WFDL 2O93L 2HT2D 1FQ9C 1ORQA 3V6ZB 1T3FB 2D7TH 1KJMA 5E99L 3RI5F 5J6GA 5H37H 5IFJA 3NAAH 1EHXA 3OGCA 3B8YA 1UVQB 4KGLA 4LCCC 4L3EE 2Q7YA 4P5KA 5CJXC 4AENB 4I9WE 5I73B 1J0IA 3PQYA 5T33H 4LEOB 1IGCH 3X3FH 3GUTB 3S88L 4JFFE 3O3AB 4Y16B 2R8SL 4W70A 4X9FA 4ZS7L 3N9GL 4H8WL 5IHZB 3GK8L 5IHLB 1A6PA 1T1WA 4L8CA 1OCWH 4XC1L 4YHZL 1YMMD 5B3NA 4QXGH 5D7SL 5IB1B 1PX3A 1S7RB 5A2JH 4LF3B 2QSVA 5I18H 3W9DA 4NWUH 2BOBA 2BZDA 1BVZA 1C5CH 3CCHB 1JVKA 1AO7E 1Q0XL 4HCRH 5GS2D 4Q7DA 1U3HB 3QDME 3EYUL 2DQIH 1K8DA 4NO0A 1NCDH 1KB5A 5C2BL 3G6JB 5DMGD 4OZGE 3BXNB 4LSUH 3SDAD 3F7VA 1G7HB 3AY4C 3PF2A 4U0RC 3QDAA 4F57L 1KB9J 3RDTB 1QLRB 5IMMA 3B9KD 3C5ZA 3L6FA 4MA7L 5K9KB 1R0AL 1RUQL 5DJAA 4MJID 1UM6H 4UAOB 3KPOB 5DJYB 4OGXH 4GO6B 1FFOB 1JZ4A 3FOLB 4N8VB 3RTQD 1WFNA 2ERJB 4U1JB 4ZDHB 3VD7A 1G7QB 2A1WL 3BP6B 3D39A 5I1GH 5JHDD 3WIFB 3BKYH 5E8EB 1NEZA 5DFWH 2I5YH 2AAVA 1KB5L 2ATPA 5C70A 2BVPA 1UKSA 1A14H 3NZ8A 1MJ7H 5CWSB 2HT4C 5F71A 5ERWA 1LEGB 3VMNA 3BT2H 3RL1B 3K4ZA 4IMKC 3U0PA 2XN9A 3KPRD 3MJ6A 3RY6A 3ET9F 1E6OH 5ESVA 1FE8H 1KTLB 5BOZG 4J8RA 5HVHC 1CD9B 1MLBB 5MEOB 2YPKA 5BS0B 2Y06L 5F9JB 4PJFF 1FRGH 3VXQB 3CVHB 4NO2A 2GSIA 4NHCL 1U3JA 5FYKU 1FPTL 1F6AA 4AIOA 2JIXB 1R3LA 5IJKC 4RMVA 2ZCKL 4HJ0D 2Q86B 4NZDA 4XNQA 4DGVL 2C3HA 2Y6SD 2YUVA 3BPOB 4OCWL 1RU9L 1T5WA 4B53A 3ARFC 5GSRA 3TF7C 3Q1SL 5FUCC 3BRDA 1NL0L 3HMXA 1YA5A 3TBSB 3GSVA 3E6HA 3EYVB 1BAFH 5GRXG 4ELMA 5IMKA 1NBQA 2YRPA 3LKQA 5HPOA 5IVXA 5KJRL 1CICA 5JMRA 2AJVH 1YC8A 43C9A 1R5IB 3L3HA 3ES6A 4QRRD 2A6DA 1OWWA 2XKSA 3C2AL 4Q58C 5FHBH 3WNLA 3IFPB 4LPWA 3D25A 3OXRA 4K71B 2B8OT 4FN0A 3PWPE 4XVSH 2UVFA 5F9OH 4MD0B 4JGUA 2P8PA 3IXAA 5FA3A 3Q3GA 5D7LD 1DANU 3HI1A 4XX1G 5I19L 4C56E 3HMXL 4GW1B 4QCIB 4WV1A 2VUOA 4E42B 2O5YH 5CBEB 5EUOF 3IVKB 4S1RH 4OGYH 1T03L 4ALAH 4JCMA 2X09A 1DUZB 1N5AA 4TSAL 5KSBE 1ZKAA 4PJFB 1ACYL 3DHMA 5EWIL 2ZSWB 1FZOA 1I9JL 1QPXA 3HE6C 1ZSDA 2AK4B 4LCWD 1QSVA 4PS4L 2GSGA 4YDKH 2IH3B 2A73B 3NGBC 1I8MA 5IF0B 3P30L 1PD6A 1CD1B 3PNWA 2AEQH 2IQAA 5IK3B 1AQDA 1FYTB 4I4WB 4WDIB 3FAXA 1OSPL 1WBZB 1Q9WA 4WWKA 3RVVC 5JQ6L 1XF2A 5INCB 5BQ7A 4G6AC 2MOVA 4HKZA 4X4ZA 1EFQA 4QXUH 1IGYB 4NUGL 5ITBH 4NUJA 4W6YB 2JTDA 3BH8A 4NQED 2A6IB 2ENYA 3RJQB 1P5VA 1CD0A 2CJUH 5F9WC 4GBXB 2EE2A 1G1CA 4NJ9L 4LIQH 2IEPA 3BD4A 1A5FH 3H9SD 4NSKA 3MLYL 2W9DL 1NAMB 4K7PH 4E0RB 5DJCA 3IDUA 1G6RA 5FOBB 3MBED 2FEEI 5EBLA 2IMNA 1KCVL 3GSOB 4KDWA 4CMHC 1H3PH 3DXAB 2DYPB 4JRXE 1YEGH 2X4NB 4S1QL 4HKXB 1QLEL 3TA3B 2KH2B 2OQJB 5LQBL 3ZKMD 4KZDH 5DFVD 1NGPH 3BGMA 5I17A 3GJEA 3GMOB 3VWJA 4HIXH 5BRZB 4U1LB 3RVXD 3AXLB 2P5EB 3RIAK 5B39B 3V0WL 4MMXC 3AC0A 3AM8C 1G6RL 2VYRE 3H0TA 4Q0XL 2RQ8A 2DB8A 3NFPB 5GGUB 4EN3C 3BSZH 3TJEL 4DWHA 4N0YL 3FOMA 3DMMD 3RWJB 1YYML 3VJ6B 3RGVA 3KXFA 4QHKJ 1TJHH 3O8XB 4PRBB 4TQEH 3L3JA 3GMNB 4KQ4L 4HEPG 1PKQE 1S7XB 3ILQD 3Q6FB 4X6CE 2KDGA 3LN5B 1ONQA 3ARDD 3OAYH 1T2XA 1P7HL 4I48B 1J0JA 1RUMH 3BEVB 5LCVH 4QF1B 4FQ2H 3QUXB 2ADIA 2O5XH 2AXFB 4JFZH 3HAEB 2P46B 3G5VB 1OVZA 2ARJB 3MREB 1MNUL 2BNRE 3O2VH 3VFMA 1HOCA 2ZUXA 5A2FA 3DROA 4YBQD 3VXUD 3NA4A 1D7FA 5E95B 2WV3A 1NCAH 5F1KC 4ZFOA 1R3JB 4PJ7F 5SV3A 4ZUWB 2JB6B 4A6YH 3FO2A 4Y4HA 3OJVC 1W0WB 3V9FA 3MCKB 4RISL 2IH1A 4JY6A 1KTKE 4AY0A 4MNQA 4NN6C 1TJIL 3P73A 5D2NB 2IGFH 2NZ9C 3I2CH 3GSNH 4OAWA 5FA4A 3VXME 1MY5A 1F4WL 3MUZ1 1DVFA 3RVTD 4XCEA 1IKNA 1F45A 1MLCA 3QIBC 2WBWB 1G0XA 2NY1C 4MD4A 4L4VE 4NHUA 2FHFA 3FQXA 4ZFOL 4LOUC 3I75B 4QNPF 2FEDC 4IRZH 4IS6B 4V1DD 1F4XH 4X99B 5C3LD 4OZHF 4Y4KD 3VGGA 4CVUA 43CAA 1HQ4A 4DN3H 5FO7A 3V4UL 3ALXA 1YQ2A 4ODXB 2DQEL 2I9TA 1I8KA 4G8GE 5IBUB 4PJGE 3VH8G 2X4PA 4R4FH 2AQ3A 4X4XA 5TJWK 4ZXBA 3UBXG 1FBIL 4LHQB 5BCAA 2GTWA 3MUHL 1I7RB 1PZ5B 5JR1L 1QYGH 1N3NB 1RJCA 3V6ZA 2R0ZL 4CUCA 1T3FA 2BCKB 1SVCP 2VH5H 2K7QA 3U7WL 3DYMA 4MHHI 4OQTH 4IOFC 5TFSH 5IMOB 4HUUB 1UVQA 4BH8B 4PRHB 1IAKB 4PJ7B 3DX6B 5KVFH 1JHKH 2AP2A 3RY4A 4EVNB 1MPAH 3GSUB 2YS4A 3AS1A 3GMQB 3RKDD 1AGCB 4PV8A 3TVMC 3GUTA 2UZYB 2AKRB 4BELD 3O3AA 4Y16A 2ZUSA 1X5XA 1LNUA 3RWGB 1BLNB 4OZIF 3G08B 5DD0H 1B3JA 5IHZA 4LP5A 4PJ5B 4EBQL 1I9RH 2F5BH 5T3ZH 1AO7B 4HGMA 4KRPC 4N5EC 5IB1A 3DI2B 3O2DH 3PWVB 1WTGT 5DI8B 5IKCB 2C1OB 4LF3A 1CXIA 3V52L 1BECA 4M93C 5IM7B 4I5BA 3U82B 1MCWM 1VGKA 4OV5B 1FL6B 4K07A 1U3HA 2AXHA 4EQ3A 2NR6C 1QUNA 2NCMA 2DKMA 4WFGD 1J1OL 3BXNA 4O2FB 1G7HA 3RDTA 5TF1H 1G9NC 5K9KA 4YXLL 3KPOA 1N6UA 1FFOA 3FOLA 1KIRB 4F33B 1P2CB 4L1HA 3IU4L 1IEAB 1G7QA 3BP6A 3WIFA 3W5MA 3MA9H 4XAKE 1CGSL 1A3RL 1PSKH 2Q1EA 3Q48A 4BSJA 3FFCD 4YEEA 3UPAA 2YPLD 1KBGH 4OZIB 3I6KB 4LHUG 3DRTB 2EXWD 3S3PA 1MJUL 2EXYC 3LS4L 3QIUC 4HF5H 3SKJH 4DKDC 4X9HA 1IKFH 3MLPA 4U6HB 1KTLA 3ZYJA 3CSYB 5MEOA 1MLBA 1YNKH 1S7VB 1RFDL 4DTGH 3KYOB 1P84K 1DQDH 4LSQL 4BSWA 8FABA 3VFNB 2JIXA 2HA1A 4OCRL 1G7MB 4M4RA 4XWGH 2Q86A 1H15A 4R2GC 4PRID 5ACMA 2A9MH 2F53A 5J1AB 1EZVX 5FM5O 4KV5E 4QHMB 5KVEH 4HWEL 3DV4B 3RY5A 5CZXC 5GQBA 3TBSA 1KCLA 3QHTC 3EYVA 1Z9LA 2QLVB 5CSGA 5I6XB 3I02B 2N7BA 1OL0A 1Z5LA 2BK8A 1MIMH 5HHXL 2D0FA 4G6KL 1BF2A 2BHYA 1R5IA 4J3OC 4XBGB 4KZEH 2DAVA 4WW2C 5TE7L 4KKBC 4KKNA 2HLFC 4XBEH 1FHGA 1OQXA 3KJ6L 4MD0A 5GS0H 4P46D 5C0RH 5KVDL 4G9FE 4JCLA 5KSBB 5DVNA 1M6OA 3LKOB 4G7YL 4GW1A 2APWA 3AS2A 5IHBA 1BZ7B 4XP9H 2PXYD 4E42A 5IVNA 1UQSB 3IVKA 3HR5A 1JZ6A 4PRNB 1DUZA 4APQB 1DBAL 4OI7A 4JFEE 4QTHB 4PJFA 5FF6B 4DKFH 4QRQB 2ZSWA 4UIKH 1N7ML 4O4YH 1MJ8H 5AWNL 1UYWL 5I1IL 2AK4A 5AD0B 3QH3B 2FIRT 2IH3A 1I1AD 2A73A 2F54E 4JFYA 4K23H 1TLKA 3SBWC 1QLFB 5IK3A 1CD1A 2DICA 5T1KA 3RWGA 1FYTA 4WDIA 3PP3K 3IKCA 2J8OA 3JV4B 5EUKB 3C09C 4PJ9C 1IGYA 1T89A 3K74B 4EI6B 5DD3H 1A7NL 2A6IA 3GRWL 2X4TB 1EFXB 1N4XL 1B0GB 3CFKB 4M1GL 2XQYG 2HWZL 1UKTA 4FXGB 1JHLL 1NAMA 1X5YA 4E0RA 4FRWA 4QHKI 5GIRA 5GHWL 3SE4C 2QADC 1HN1A 3RHWF 3DXAA 2DYPA 2IFFL 2X4NA 4HKXA 3I6LE 4FQXC 4K9EL 4LVNC 5ANMA 3MRLB 2X4QB 1FLTX 2OQJA 2UY6A 5FUOL 3QIWD 1SY6H 3BDBA 3V6OC 3QFJE 3VU2A 4NZJA 4G5ZH 5F3HA 1C12B 5BRZA 5I71C 4U1LA 3W39B 3AXLA 2P5EA 5GGSY 2UUDK 5B39A 1NAML 5TQ2H 4NC2B 3IDIB 4LDOB 4Q9BA 2OZ4L 4HWBA 5GGUA 2W9EL 2A6KA 5ADPH 3DVGB 4GXUN 3MNZA 3EKCA 3VJ6A 1GGCH 3O8XA 4PRBA 2A2QT 4WFFD 1S7XA 3Q6FA 3KPMB 4C59B 2XFXB 5I1JH 1HNGA 3VFSA 1LEIB 5I0DA 5AAWA 4ZAKB 4IMLB 5BVPL 1R3IH 4D9RD 3BEVA 3BP7B 3LVEA 4AL8H 4QF1A 3SDXB 3BDXA 3WDHA 3QUXA 3KJ4B 1AI1L 5CILL 4G80B 3DX9B 4HWBL 3T4YB 3HAEA 4Z6AT 3G5VA 4QHNB 3MREA 2GCYB 5F7YC 1V7ML 3HUJE 32C2B 4MB5A 3SE3A 2Z8VC 1DBJL 4QRSB 1MWAL 3N1MC 3WUZA 4WNQB 4P2OD 3NIGF 3T0EC 1CLZH 2AERT 1R3JA 3S8WA 3VG0H 3D9AL 4ZUWA 1FC2D 2JB6A 2FX8H 2VLKD 3MODL 4GKOA 1CFQB 2VDOH 1W0WA 4Y5YB 1C1EL 3MCKA 2NY0D 4JGJA 2XIDA 2VSCA 5D2NA 3F58H 1RIUL 3BPNB 4MNGE 3QWOA 3ZL4H 1LDPH 5KANI 4G42B 3UX9B 4I0KA 2J6EL 3QEQE 4PJGB 4OD3H 3I75A 4FFYH 3F65A 4DAGH 1GYAA 5IROC 4IS6A 5FDYA 1YQVH 4X99A 1MUJB 2AJXH 5FHAL 5GS1C 2HMID 4ONOA 3QNZB 4WUKH 2DMBA 1F2XK 4UU9B 1LP9F 1PZ5A 2ZCLL 2QL1A 3E2HC 2IALB 1MCPH 2O61B 3RZCA 4ZOAA 2ZNXA 3NMEA 1MAJA 1P4BH 2BCKA 1RULL 2P24B 5C07E 4BFIB 4PRHA 4JFFA 1IAKA 4PJ7A 3DX6A 1GSMA 2I27N 4EVNA 3GSUA 3GM0A 4NN5B 2VLRD 3GMQA 1AGCA 3WMSA 4GG6E 4G6JH 4OD1H 4G3YL 2BNQE 2AKRA 4DUXA 2F5AL 1FIGH 1JGVH 1IGIH 3CFJB 1BLNA 2XZAH 3G08A 4HG4J 4XCFL 1JHTB 3MRNB 4PJ5A 2FSEB 2A83B 5E6ID 1AO7A 5FKAA 4M00A 3K2UH 4H0GA 3ZT7A 2MTPA 4HUMB 3PWVA 4UNTA 1KCRL 5DI8A 4OZGA 5IKCA 2C1OA 3WNKA 1CFVL 1QFUL 4HUKB 3E3QC 2EYSB 5F6HI 5LBSH 4ODSH 2J12B 4OV5A 1FL6A 1S7TB 1XT5A 4YXHH 1W0VB 1WUNT 2L4OA 3LQAC 1JFQL 5IHUL 2FL5B 4BH7B 2HJFA 4MA8L 3UTSE 2YKLL 1T7ZA 3ZSSA 4P2RB 1D5XB 1EJ6A 2VITA 4GRWF 1X6LA 1YY9D 1UM5H 4OIIL 3BIAX 2BDNH 5C0FB 3VXTB 5H8DA 1KIRA 2VLJE 4I18B 1FL5B 1P2CA 4F33A 4ZTOH 2ZUTA 1IEAA 1RZFL 3QISA 2M2DA 1FLRL 3BMWA 2QSCH 3SOBH 1MFNA 3QQ3B 4Y2DD 4P4KD 4A6YB 1BMGA 4BQ8A 5KW9L 5C1MB 1D6VL 3I6KA 2ZUYA 4QRTB 2J8HA 2C5DC 3WKML 3ALWA 3WLWC 4U6HA 3G5YB 3I84A 3GSNB 5L6YL 3CSYA 4DW2H 1INDH 1YYLH 3KYOA 2E9WA 4W81A 4OM0L 4MAYD 3KLHD 2Y5EA 3VFNA 1J8HD 1PLGL 2R69H 3SE9L 3IYLW 2NY6D 1G7MA 1V7NL 1HHIB 4J6RL 3WHE0 4TVSa 4QHMA 4GOSA 1Y0LA 2UWEE 3DV4A 3WSQH 2DBJA 4M7ZB 1OP5H 2DJUA 4L4TE 4PREB 3I02A 3PWPA 1AQKL 3FT3A 3NCFB 4YXKL 2AVGA 3ZE1E 3T08A 3LPFA 3UJIH 1L9NA 1CE6B 4XBGA 1FG9C 4C56A 2OTWB 4HXBH 1TTUA 1D9KC 1CZ8H 4R4BB 1UH3A 4P5TB 2PW2A 5I75B 3GNMH 1NAKH 3D2UD 4M7JH 5H2BB 5KSBA 3MLRH 4JQVA 3L3DB 3STLB 4C4KT 1OAYL 1ZT4B 1D5ZB 1BZ7A 5DC4B 3O4LE 1S5IL 1UQSA 5C6WH 4FS0A 1UH2A 4PRNA 4APQA 3C08L 2D7TL 5KTEL 1T1YA 1RVFL 3MO1A 4QRQA 5DJ2A 3KS0J 1G9NH 3NABH 4FG6C 1INQB 3WO4B 2J8UF 3WNOA 4DVRH 5IP4A 4CJ1A 1MI5B 4HCRA 3PQYD 5CJ5A 2F58L 2C3XA 1IGCL 5EUKA 3X3FL 2ZCHL 1SBSH 2ICWB 4R26H 2V2WB 3S3SA 4K3EH 4EI6A 1FNEB 3QQ4B 3JTSB 4IOIB 4D0CA 3SY0B 1XGTB 4QOKB 2MKWA 2X4TA 5MP6H 1EFXA 2ZSVA 4KHTH 4QXGL 1E4XH 1NCWL 1B0GA 1X6NA 3CFKA 2BX5A 1NKRA 2IANE 4FXGA 5M7QA 3MUGB 4F58L 4JFXA 3TBTA 4OCYH 5AZ2L 3WIHH 1XF1A 1TCRB 1ZTXH 3FQNB 3QUZB 4M6AA 4NQCB 4F7EB 1VFOA 3CMGA 1WLHA 4NO0D 5L88L 1F97A 4XH2A 3HNVH 3W11C 3BZ4B 4M6OH 4PP1D 4HX1B 2ED7A 4LSUL 3RHWK 3BPCB 3LRHA 4HIIA 1KF9B 1IAMA 3C5ZD 4K3DH 1BBJA 4QHUB 3EJYC 1C12A 4R8WH 1CLOH 3W39A 4LFHD 1XGYL 4OGXL 3SJVE 3TN0C 3IDIA 4X6CA 3DWTA 2DRUA 4KDTC 2Q8AL 4AEEA 3BWAA 2J8UB 3DVGA 5ESAB 3B83A 3D39D 4HW6A 3U1SL 2XV6B 1KLFA 5F88B 2I5YL 5E00B 2P8LA 4YBLB 2LAAA 1IZJA 1JNLH 2E7BA 1A14L 3KPMA 3MOAL 3IDXH 2XFXA 2VISA 2D0HA 5T3XE 4LCCB 2ADFH 2VE6B 1LEIA 4ZAKA 3BHBB 4IMLA 1BWWA 1RSFA 2XN9D 1FE8L 3SDXA 3VXOB 3DX9A 1YN6B 1DSFH 4X80L 3T4YA 4LHJB 4QHNA 2W91A 4PJDF 4LSSH 2L7JA 4XCNB 3UTQB 2GCYA 2YEZB 32C2A 3EJJX 5FCUH 4LSRL 3HNSH 4QRSA 3H9HB 2V2TA 4XNXL 2EDJA 3HNTH 1CFNB 4KROD 4JY4B 4L9LA 3W9EB 1E6JH 1U2CA 1UWGH 1F4YH 1LK3H 4UOJA 1KELL 4Y5YA 1O7SA 3H3PL 2HTKD 1J11A 2BSTB 3SKOB 1YNTB 4L4VA 4M7KL 2P44B 3B9EA 1CICD 4TULH 3RU8L 1VFMA 5D8JH 3BWUC 2Q20A 4LPXA 4ZQKA 5C0NC 4G42A 5FO9B 1NC4B 1Y6NR 3VFTB 2ZUUA 4Z7UE 4PJGA 5DVKA 3VFRB 4P2QE 1HQRB 3A67H 1VB9A 4UTBL 4JY5L 1HDMB 2BXZA 4NQDE 1PEZA 2CD0A 3TZVC 5EOTB 3QNZA 4M5YL 1LHZA 4D3CL 2G2RB 4HBQA 5MENB 2JE8A 1H3WM 2EDRA 5C92A 3MGOA 1CIUA 2IALA 4J4PC 2C4FU 1BZ9B 2FATH 1TTGA 2CMRH 3OAYK 4OLUH 5F97E 3L3IB 5BV7L 4IBLT 3DURB 4GG6B 3S3JA 3V95A 4LPVA 5HVHB 4LRNL 4E5XA 2P24A 4WWKD 2K1MA 5B21A 4S2SB 2B2XL 2GJ6B 4M62H 5I76B 1IQWH 3O6KH 3VFOB 2HG5B 2YD8A 4FTVB 3QB7C 1XF5A 3B43A 2XQBH 2WBKA 2B20A 1KCSL 1MRDL 1RZ8B 4CRPA 1I1YB 3TBYB 1I7ZB 3CFJA 1CGXA 2F8OA 4WTZG 5DJ0B 1IAIM 2BXYA 2BSED 3LV3A 1JHTA 3MRNA 4W6WB 5CFHA 4UDTB 1UEYA 1RUAL 2I60L 3HC0B 4RGOL 1KB9K 1H3UA 5F93C 1YJDL 5GGTL 1Z3GL 4FQQB 1SJEB 1EK3A 1T83A 3K1DA 5DQ9B 5E03A 4JKMA 4FQHA 4BQ9A 1A6WL 5JW4Q 5L8LB 1VEPA 2BP3A 2VXTL 1S7TA 1CR9H 3BDYL 3EYFB 5J12C 5ESQB 1NDMB 1IJ9A 1JUFB 2FL5A 3VWJD 4JO4L 3TC9A 4OGAD 1KT2B 4P2RA 1D5XA 5DHXB 1FGNL 5FYLE 3HFMH 2D4DA 3VXTA 5BJTB 3RGVD 3KXFD 4I18A 2VDQH 4TQEL 3U4BL 5D6CB 4JRYD 4PJ8B 3HE6B 4Y8AA 1HKLH 4WHYG 4YNYA 3LQMA 1RMFL 4LGRB 4HK3N 2QQLL 5F1OB 3NGBB 4NT6A 1UCBL 1HHHB 4A6YA 1AXTL 2G60H 5FK9B 3G6DH 1Y18B 2DDQL 4X7EC 4QRTA 4W4OA 2UZIH 5IEKA 5IWLA 5AG9A 5SWQB 1EEZB 4JHBA 4JN2B 3G5YA 1PW3A 1UB5A 1YMME 3RL2B 5F9WB 3LPWA 4GW5B 1OLLA 2W07A 2XZCH 1I3RB 3VD4A 1VDGA 2CRIA 3ARGA 1LK2A 1EX0A 2HVJB 2OMNA 1JV5A 2FGZA 4OD2B 2Z35A 3EHBC 4NQXB 3PWUA 3K46A 4Z0XB 4A6YL 1HHIA 4CMHB 1KEMH 4NBYB 4Y4HD 2BSRB 4X7TB 4UT7H 4MNQD 4U3XA 1TJGH 3ULVD 2IGFL 3I2CL 2EICA 3JXAA 4PREA 3CPLB 4MJIE 3ZKSD 1DVFD 4JZOB 5ABDE 3ULUD 4P3DB 3UJTH 5BW7C 3LKPB 2XRAH 3HMWH 1CE6A 2H2SC 3DVIA 2OTWA 3BIKB 1FNFA 1IILE 3AAZB 4RIRB 4XXCC 3K80A 3QHFL 4R4BA 4JG0L 1OGTB 3O4LB 4EN3B 3ZHDA 4P5TA 5GGRY 5H2BA 1KN2L 3MYJB 5TQ0L 3L3DA 4HS6A 3STLA 1ZT4A 4U7KA 3OKNB 4ZXBD 1D5ZA 3UDWA 2G5BB 3NN8B 2IAMC 1AY1H 2VZOA 5DK0B 1QACA 3LQAH 3LEVH 4XWOD 2EDFA 3UYRH 2ICCA 3O9WC 2DIBA 1R3HB 2VC2H 1A4KB 1J0ZA 3O2DA 1INQA 3WFCL 4OLZH 2DQGH 3QJHB 5KVFL 2DQFB 1JHKL 3QI9C 3FRUB 1H5BC 4ZUVB 3L3OB 5TPWH 4HMEA 1UGNA 1CVSC 3AVEA 5LKNA 2ICWA 4GKNB 1U8JB 5EDXA 4MHHG 1WAAE 4Y16D 2YBRA 4LBEA 3QQ4A 2E9IA 4OF0A 3SY0A 4LMQE 4QOKA 1I9RL 3MOBH 2GEEA 5KN5A 1FFQA 1OF2A 1WGOA 1U92B 5C6TL 5FYJH 5IEHB 3T0EE 1A6VL 4NN6B 3I50L 4DKEL 4QRRE 4X6EB 4OLXL 4JPKH 3CX5J 2NX5E 2PTTB 4LLDB 4Z7WF 1TCRA 5DDHA 5C3TA 3FQNA 1IGTB 3QUZA 1U3HD 3M1BB 4JHAL 2G75A 3QIBB 4NIKB 4BSVB 1HINL 2NY1B 5D7LE 1U36A 3MV9B 4Z18A 3BESR 5K59E 2VDNL 2Q87A 3BZ4A 3SJVB 4HX1A 5C0DA 2VDML 4PJXF 1DLFH 1Q8MA 1FAIL 2OTPA 3M45A 4LQFL 3S98A 3BPCA 4IHOB 3UO1L 5JHLH 3RDTD 4MCYB 5TF1L 3W81A 5EZJB 1V5JA 2IF7A 1IGFL 5F7LB 1ZAGA 4M61B 3LEXB 3UZQA 2OYPA 2NY3C 4HD9A 4LCWE 2J8UA 4JEGB 5ESAA 2HAZA 5E8NB 3QPXL 3RWFB 5F88A 5E00A 1YEJH 1YEIH 2EC8A 2P47B 4KQ3L 5HJ3B 1WSST 4KVCH 4Q9QL 1HE7A 5HI3D 4IIQC 2L7UA 2H2PC 3OSKA 2VE6A 4NQEE 1JCKA 5CJXA 2DTML 1FV1B 4HSQA 4YE4H 3TJHC 3AREC 1WICA 3TVMB 1A9EB 2XTJC 1ROWA 3GIZL 2PYEE 3IAPA 3OKEB 1VFUA 4QWWD 1YN6A 4EOWL 1ZMYA 2PKDA 1QFWH 1T7YA 4OJFH 1U3YA 4Z7WB 4XCNA 4XMPH 1YUHB 2JIXD 1JYWA 4JREC 5AYQA 4KRPB 4XWGL 3H9HA 3TNNA 3KHQA 2W0KA 2VQUA 4YX2L 4KK5C 1N0LA 4PJXB 4WI2A 1CFNA 2WW8A 4M93B 5T1LB 4MNGA 3GJFH 2BSSB 3MPCA 1JK8A 5KSVA 1WCQA 5ALBL 3O0RH 3LRSB 2KPNA 2BSTA 4Z7UB 1YNTA 2R2CA 2H6PA 2DWDB 1MIML 5E8PB 3Q6GL 4UDUB 1X5GA 3AY4A 1E4KC 1TQBC 5JW4M 5DD6A 1W72H 5MEPB 5SX5H 2AABH 5FO9A 4NRYB 1NC4A 1Q94B 4JQIH 1L7TH 3VFTA 5GS0L 4Q9CA 5IB2B 4BUGA 3KYKH 1HK6A 1MREH 1A02N 4YEFA 2EKSB 3EO0A 1HDMA 3R06B 1ITBB 1I7TB 5EOTA 3VXNB 3O81A 4TUJB 5E9DE 3SQOH 2V9TA 4JM2A 4XPGH 1RD6A 5MENA 5CD5C 2P49B 3BN9D 5DURD 1UENA 5T1DH 2H3NB 3L3IA 4IMKA 2AK4D 4Y19B 5DYOA 5FEBA 1N2RA 4GG6A 1ZS8B 2XZZA 1KIUA 4YGVB 3RVUD 4O5LH 5IFAH 3VXUE 1AXIB 2GW5A 5T1KD 3IJHB 1FYTD 3TBWB 3BOVA 4S2SA 3CGTA 1L0QA 5CJQL 2YD7A 3VXPB 3NA9L 4EXPX 2E7HA 3ZHKA 5I8EB 2BOCB 2HG5A 2VXUH 4FTVA 3KGRA 3LMJH 2FD6H 4FFZL 3MNWA 4R2GB 5KZCB 3PP4L 5D4QA 1I1YA 4JFPB 1I7ZA 3TBYA 5DJ0A 3K8MA 4XMKL 3ARFA 1JTPA 1CDGA 1JGDB 1C8PA 4PBXA 1I85A 4KI5E 3HC0A 1JYNA 5CKGA 3HRPA 4X8XA 4FQQA 2JB5H 3DXAD 1SJEA 2DYPD 3L7EB 3X12B 5DQ9A 4V1DE 4WW2B 3UTSA 5AEAA 5F72S 4XHJD 3WHE1 3EYFA 3P11L 4M8VA 5ESQA 1NDMA 1JUFA 5BRZD 2B4CC 2P5ED 1KT2A 5L9DL 3V7AE 1Y6KR 4UV4H 3QEHB 5LWYH 3O8XD 4LLVA 1JTTA 1PG7X 2EDDA 5D6CA 4WU7B 4U7SA 4L8DA 4PG2A 2YD9A 1AJ7H 1E4JA 3SDCC 5JW3H 2HVKA 3M07A 5D1QC 1G9MC 1QD0A 2BJML 1HHHA 3RQ3A 5FK9A 1Y18A 2P45B 3C09B 4ZFFB 4PJ9B 3W82A 3QUXD 1KJ2L 5SWQA 1CG9B 1EEZA 5CEXB 4DZBB 1PEWA 4S1SL 4ETYA 4TSCL 3NH7L 1F3DJ 3RL2A 4GW5A 1CQKA 3B5HA 2GJJA 3DI3B 1I3RA 2A38A 1T04B 3RAJH 4OQ1A 4MXQC 2HVJA 4XVTH 3ME0A 3LKNB 4PG9B 1MF2H 4OD2A 1OWRM 4TOYH 4NQXA 3WS3B 1BQHG 2QADB 4Z0XA 2FX8L 3BQUC 3MXWH 1GL4B 4WFGE 1DFBH 3GBML 4FQXB 4X7TA 1UB6B 4LVNB 1KSRA 1DLHB 3WV0A 2FX9L 4BK4A 3DETC 3CPLA 1D5IH 3OPZL 4KMTH 2QR0B 4JZOA 1GC1L 4XVJH 4P3DA 3L5JA 1ADQH 3LKPA 2APTA 3HPLB 3LPGA 3TH3T 1AGFB 3AM8A 3BIKA 4KRLB 3AAZA 4HPYH 4RIRA 1S9VA 1OGTA 3HZVB 3O4LA 3PJSB 3IJSB 2YPVH 2HT2C 5KANG 3FFCE 3V4PH 3JWOC 2YPLE 3OKNA 3QUKB 1KJVB 1NANI 3NN8A 1IEBB 3OAUH 4K8RD 1MCPL 5DK0A 3O45A 3RBSA 3RZCD 1ERNA 4X8JB 3B2VH 3QCUL 1U93B 3OG4B 5J8OA 2IMMA 2IWGA 1N59B 1R3HA 3NBNA 2I9LB 2DN7A 1A4KA 5EC2B 1YEHH 3HCVB 4JFFD 4KKCD 4PRHD 4YHKH 2EDTA 2DQFA 2YD1A 5DRZA 3FO0H 4RZCB 3FRUA 1CGUA 1BGXH 4HDIA 4LKCB 4ZUVA 3L3OA 4PRIE 5GGVY 1JI1A 4P48A 4PB9L 4GKNA 1U8JA 1J1XH 2VAAB 1NCBH 4X7SH 5T1MB 2IANA 4ORGB 3G5XB 2XZAL 2NX5B 1SYVB 1FFNB 4FQCH 3FMGL 1CDCA 4PJ5D 4TVPH 1ZGLM 1XF4B 1AO7D 2C4XA 4K3JH 2GY7B 1U92A 3OZ9L 5IEHA 3CUPB 5B3JE 5HDBE 3VE0B 2QQNH 4X6EA 1HH9B 2PTTA 4S1DC 3IAGC 4LLDA 2OJZH 2FZ3B 1DZBA 3UJJH 1FJ1A 1MHPH 2Q8BL 3OF6A 2P5WE 4ODSL 1IGTA 1ODAA 4P4RB 4OSUH 3NZHL 4PRDB 3FONB 4BSVA 1T7XA 1KLGB 3MV9A 4BQBA 3SJVA 4N5UA 4U1HB 2R9HC 3MA7B 4IHOA 3U9PH 1AGEB 4WCYH 2CUIA 3MLWL 5IVZB 4MCYA 2MKLC 2DQCH 5JOFB 5GS1B 5EZJA 4MLSA 3CFEB 3BEWA 5I30L 1UM5L 1CI5A 1QSFB 2R56L 4I0PB 5TE6H 4M61A 3LEXA 3H8NA 4DGIL 3INUL 4ZS6D 2BC4B 3E2HB 2YUWA 4KHXH 4LQ1A 2H1PH 1WCBA 5GZND 5E8NA 4MQXD 2WUBH 3UTTB 5JIIA 1FVCB 2AXJA 3RWFA 2D31B 3WXVL 1U8QB 5HJ3A 1FH5L 2XA8L 2PYEB 1AR1D 1A64A 5ICZB 4G6MH 2EZ0C 5J3HD 1MCIA 4PGCB 2MCPL 5EO0B 4OLWH 5C0JA 3C5SB 4K3HA 1CDHA 3EYSH 4GS7C 5HI4C 4UMGA 4FNLH 3TVMA 1A9EA 3A6BL 1JIBA 5DWUL 5HHPB 4DW2L 2APFA 1OM3H 2YUXA 3OKEA 1WQVT 4RDQF 3WJLC 1C16B 1NH6A 5T3XL 2EH8H 3IETB 3V6FB 1YYLL 5A2LH 2FX7H 4Z7WA 2VIRB 1QRKA 1Y6MR 1YUHA 4KUCD 1NCCH 3TCLB 4ZFGH 2CXGA 5DEFB 4JHWH 2CDGB 3CDYA 4JG1L 3P0YH 4PJXA 3KPPB 3ZE0E 3GI9H 4NPYA 3EO9L 5T1LA 3FFDB 3IDJB 3B2UD 4FFWD 1UWEL 4Z7NE 3CVIL 4IDLA 4WHDA 3RFZC 3PWPD 3LRSA 1WWBX 4U6VH 4POZD 3CSGA 2NQCA 4Z7UA 2DWDA 2BFVH 2GY5A 5E8PA 3C6SB 1UZ6F 1MCJA 4UDUA 5DRNB 2NYYC 3GGWB 3FHQA 4C56D 5CJOH 1M7DB 1Q9KB 1ZHLA 2V2XB 5MEPA 2J2ZA 4N9OB 1MSPA 5E9DB 2J4WH 1L4IA 1NKOA 1NLDH 5TDOB 3QDGE 4P9MH 5LXGH 4PP2B 5IB2A 4PTTB 4AG4H 2EKSA 3VFGL 4TRPH 3R06A 3QEGH 4TUJA 3VD3A 4M5ZH 5DJXB 5E56A 4APQD 1NLBL 3WLBB 2DM3A 5GSVB 1HHJB 3MC0A 3ESVF 2BVTA 4MS8D 4NJAL 1VPOL 3QIUA 5BMFL 5HI5D 4U31A 4LVEA 3IDMA 2H3NA 4HG4K 3L3GA 3GMLB 4Y19A 1QO3A 1FZKB 1N8ZA 2VZSA 2FECL 4H26B 1ZS8A 4HC1A 1CF8H 4YGVA 1FO0L 3WIHA 4JM4H 2E8ZA 3IJHA 4TVPE 4Q9RH 5E2VL 4PJHE 8CGTA 1SBSL 1PY4A 3VXPA 2BNUB 4K3EL 3QDJB 4L3AA 3UPRB 1MFCL 3IKKA 1GGYA 4HKBB 4XRCB 2VLKE 4AIXA 3PV6B 1M05B 3MBXL 2QKIB 4Q2ZB 4BFBD 1EFXD 5MP6L 4FABH 2HT3D 1QBML 3QULB 4M3KB 5KSAC 1X4YA 4Z8FH 2AGJH 3ZKMC 4HC1L 4OCYL 4DN4H 3T1WA 4MJ6B 4U1IB 4XNUL 2NY7H 3FN0H 3QXWA 1UC6A 1S7UB 2X05A 3X12A 1OARL 4Z76B 5DT1L 4FHBD 4G9DB 4WW2A 3HNVL 1CE1H 1D9KB 4M6OL 4LSVL 3VI3F 1UWXH 4Z7VF 2OM5A 3GI8L 2WMPA 3QO1A 1K3ZA 3GKWH 2VO5A 4M1DH 2HKFH 3TV3L 3VGBA 1KLUA 3ULSB 4ENEC 3GO1H 2Q7NA 3QP3A 3RGHA 3P3YA 1WISA 3ARDC 5JO5B 1UA6L 3AU1A 2VOTA 5EBMB 5F8QC 2FIKB 4Z7QF 1NFDF 3QEHA 5D7IF 1WC7B 4ERSL 4FQJL 4HH9A 5JNYA 2OP4L 1F3RB 1LO5A 2WUCH 5E08H 3MRGB 4WU7A 1JPGB 2VLRE 5FYLL 3SBWA 1HI6B 4ZAKD 3GJFB 2WINB 5HHOB 4ZFFA 5E24E 4PJ9A 4O02H 4KKLC 1RUPH 4MQ7B 1JRHH 3U46B 5IIEB 1VKXB 2X1WL 5HYJE 1CG9A 1OQOA 3DIFB 4LSTH 5CEXA 1UH4A 4DZBA 4LSPL 4GQ9L 2FGWH 1CL7L 2P42B 3DUSA 3ZE2E 4BKLB 1QHPA 4TUKL 1W72B 2R4RL 2ICES 3QNYB 3WFZA 1T04A 2K7PA 3UZVB 3ROLB 3LKNA 4Z7VB 3PXHA 2B39A 4JN1H 1E6JL 1UM4H 4PG9A 4TTGA 4PUBL 5GGSB 1AIFB 4P0DA 3SE4A 3BGAA 1F4YL 4XPHH 3WS3A 1NUGA 5FOJA 4KKAD 1X4XA 5IFHH 4FQXA 3MJ7A 3SQBA 1UB6A 2CGRH 5EIQA 3MLVL 3MR9B 4L4VD 3BJLA 2EDYA 5F7HA 5E2UL 4ZUUB 3V6OA 3HC3H 1NFDB 1RZJC 2QR0A 5D7IB 1UJ3C 2GITA 5SX4H 3NIDF 3HPLA 3ORJA 1AGFA 5ENWB 4X6BB 3TN0B 3OKOA 3HZVA 1ZT1A 2D7QA 3IJSA 4OLVL 3MRRB 4YH6A 1OAUH 2JF1A 3QXTA 2CPCA 1OTUC 4EI5C 3CC5B 3SDYL 1C5DA 1KJVA 1IEBA 3QXVA 5B4MC 4YHNB 4OLUL 2E27L 2FNBA 4XP4L 7FABL 1U93A 2B4CH 4HS8H 5JUEH 5C2UB 3FRPG 1N59A 2VDPH 5JQHC 1HSBA 2I9LA 4JO2H 5J6HB 4NFDA 4GBXC 4J12A 2Q76A 1P7QA 2ZOKA 5EC2A 1H8NA 3L95B 3E0GA 4M62L 3QUYC 4RZCA 1J8HE 4RX4D 3O6KL 3V8OA 4LKCA 3NIFE 1OPGL 4DVBB 4N0CD 3LHPH 5D2LF 3BUTA 2VAAA 3T0EA 2Q3ZA 5T1MA 4ORGA 4MD5A 3G5XA 5DZNA 4A2MA 2NX5A 1G9MH 3M8OL 5AZEH 4OF5A 5IV2B 3R1GL 4GKSB 1CFTB 3QPQD 3CXDH 5DC9B 2PUQT 1MCKA 3S5LB 3VE0A 3T04D 1HH9A 1MRFL 3EO1B 5SX4I 2FZ3A 4NZUH 5ALCL 4N0FA 1T6VN 1SYSB 4P4RA 3LB6D 4NNYB 5DQDH 1VA9A 4KK8C 1LO2L 3FONA 5I1KH 5MERB 5IBTL 4C83B 1OAKH 4FXKB 5IROA 4PGEB 4HQQH 4GSDL 1AGEA 3TZVB 1OAQL 1X5JA 3DYPA 4P2RD 5FYKH 2A9NL 5JOFA 5GS1A 3KG5A 1MVFA 4PYGA 4J2XA 3ECBB 2WBJA 1QSFA 1BBDL 3P0VH 4CVXB 2BC4A 3D0LB 4ONGL 4MSWB 4OM1L 3DUUB 3O11B 3PQYE 1U8QA 3C8DA 2E7CA 4HT1L 4KDVA 5D2LB 2PYEA 1TZIB 5D93C 1XF3A 1AKJA 4LASH 1MCNA 1FORL 2ARWA 4NZRL 4PGCA 2UZXB 4ISVB 5EO0A 2ESVE 3MBEA 3C5SA 3UC0H 3GHEH 4QKXB 3JWOH 4XX1E 2CLVB 3E6FB 5HHPA 3MLZH 3E8UH 1C16A 2ZJSL 3FZUC 3TWCH 3IETA 2XZCL 3V6FA 2ZKHL 4Z5RB 4X9GA 2ZNWA 3DTXB 3ARGD 3EGSB 4IDJL 1DQLL 1DBKH 3LS5L 2AEPH 4L5FL 4UT6L 3TCLA 5DEFA 1B2WL 5GJSH 4P3CH 3TYFB 4GXVH 4F9PC 1NGZA 1T22B 3B9VA 3IDJA 1WFUA 4MVBD 4H5SA 2DLFH 2NXYD 4U33A 5HDQH 4OFDA 5J12B 1ZEAL 3QDGB 2EIDA 5I1HH 3BKJH 4BJLA 2VR4A 2XRAL 3C6SA 5DRNA 3GGWA 4XP5L 1KN4L 5EOQL 2EDQA 3CK0H 5DZLA 3QCVH 3KHOA 3D39E 4U7MA 4UINL 4P5TD 3KPSE 1YNLL 5E9DA 4QY8B 2R1YB 3OKMB 2P1YA 5TDOA 1DBML 1DR9A 1H3TA 4PTTA 4MXWH 2NTSP 4XCYB 5EPMB 1Z6JT 3TYGL 5DTFB 4P2YA 4RGNE 2DKSA 4N8CH 4LLWA 1CK0H 4IM8A 4C58B 1CBVL 5DJXA 2XN9E 3KPQB 1WV7T 3QZWA 4AMKH 3T3MF 3WLBA 2R0WH 4UT9L 3CDGA 5T3ZD 4PBVC 1N0XH 4PLKD 2VC2L 3P2TA 4OLZL 4H26A 3IU3A 1MI5D 3DRQB 4N1CA 1S3KL 3OR6B 1A1OB 5IOPB 3TPKA 1OAZH 2ZOLB 4HXAL 1II4E 3UPRA 4HKBA 4XRCA 3EJZD 1PG7L 1M05A 4QOKD 1K6QH 4UB0L 4ELME 2GJZB 5HYSA 2GK0B 4V1DA 3BAEH 1IE5A 4MJ6A 3GJFK 4RMSA 4P59L 4CADB 1J1PL 1S7UA 3BP4A 3QUZD 1SEQH 1P6FA 3N85L 4ZUSB 4G9DA 4ZPTB 4MLIA 3DUHA 1D9KA 1JZ8A 3NTCL 2EC9U 2PO6C 4M6MH 5HD8D 1O0VA 4CVZB 1VFBA 4RRPG 5SX5K 4HIHB 3U6RB 4UBDD 3ULSA 1FL3B 4F3FB 1RIVH 4WW1B 4MAUH 1A0QL 4G8IB 4M1CC 4BZ1H 1G7LB 1WZ1L 3MFFB 1YPZF 4PLJC 5EBMA 3O6ML 2FIKA 1RZGB 4DQOL 3U0WL 3O9WB 3SGJC 3P0GB 1MFDL 1CU4H 4OCXL 2GTZB 3ZSTA 3MRGA 2MWCA 5EORH 3WEXB 5HYJB 5ACZA 1BP3B 3QI9B 1QBLH 4G7VL 1WZLA 5EN2B 2R0KL 1H5BB 3S35H 1HI6A 3B6SB 4WI8A 5F96L 3VD5A 2WINA 3MNVB 5HHOA 1S9KC 5IT2L 4NC1E 1IQDB 2CO6B 4MQ7A 5IIEA 1VKXA 3DIFA 2Y7QB 4YGAB 2ZUQC 1VADB 1WWCA 1DBBL 5A43C 4Z0BL 4BKLA 2VB5A 5C09B 4UQ3A 5DUPH 5I6XC 5HHMB 4XGZB 5FO8A 3QG7H 1CXKA 4X5XA 3QNYA 4NFCA 4XP1L 2J88L 1GH7A 2OK0L 5GS0D 4XXDA 3ROLA 4Z7VA 1YMHB 1Z9OA 3L5HA 1CGTA 4WEBH 5GGSA 1AIFA 1FGVH 3X3GL 2ID5A 4ORZC 5C9KA 4NKIH 3MR9A 4XTRC 2DTSA 2R2EB 5IW6B 1YPZB 4ZUUA 4JO1H 4DFHA 3OXSB 4J3WA 5D7IA 3P40A 4KRNA 3DVFA 3WN5C 3VRIB 4GMTL 4JQIL 1NC4D 2MNUA 1E4WH 3V0AC 1BD2B 4M48L 2YPLA 5ENWA 1MCQA 4JRYE 3TN0A 3KYKL 5TF0A 2R2BB 2JELH 2NY3B 4CNIB 4KDTA 3MRRA 4PRAB 2ORBH 4LPUA 1OD7A 1YEKL 3SGEH 3H9ZA 3AB0C 1MCFA 5MEND 2HT4D 5CAYB 3LIZL 4IIQB 2F9BT 3VGDA 3DGGA 4LCIL 5TDNB 3S34L 3FQWB 3AREB 4LRIC 4WY7H 4PRIA 2XTJB 4JKPL 1GHFH 1ZVSB 2KQNA 4IRSA 1PFCA 3L95A 4MDJB 1HHKB 5EU6B 4I2XB 1RHFA 4XPFL 2ZG2A 4M7LH 2VXUL 1KPRB 4FTVD 5CBAB 2LVCA 4JREB 2FD6L 1YEEL 4DVBA 1OY3B 1IAII 2ZUWA 5T5FL 3CVHH 3ZKQD 5DMIL 1LO3L 4MNQE 4U05A 4GXUM 3FB5B 3ULVE 3ARFD 4NDMA 2VDLL 4Y89A 4ZO8A 1ZHBB 3REVB 2OX5A 3GHBL 1JGLH 4HBCH 4Q97A 5I8KH 4GKSA 2P5WA 3ULUE 1CFTA 3C5JB 2BVYA 1K85A 3ZDYF 2Z4QB 3PDGA 4WU5A 3EO1A 1TQBB 3CDCA 3UTSD 1H9VA 3U7YL 3T0XA 1SYSA 4NNYA 4U1NB 1DQML 3T2PA 2HN7B 3LEYL 3MLTB 5D6DC 1T1XA 5HGBB 5MERA 4KAQH 4C83A 3D18B 2B0SL 3JUZA 1F5WA 4P57B 3IF1B 1HEZB 1MCRA 4PJAF 5DRXB 1A3LH 3ECBA 2EDLA 5HGDB 4Y2DC 4KJQC 5I1AB 1TTFA 2N4IA 3WIIH 5JIPA 5H94A 3PGDA 4CVXA 2DBLH 4XAWL 4J4PA 2X41A 1RZJH 3ARUA 3D0LA 3NCCB 4R97C 3BO8B 3HE6D 4ZPVA 5CUSL 1TQCC 3O11A 3DX7A 3I3DA 3WL9B 5D2LA 1TZIA 1NCTA 5HYFA 3STZA 3EOAB 3RVVD 3MV7B 2XACC 2BMKB 4G6AD 4ISVA 1JZ5A 3KLHC 2HKHH 5IR1A 4F2MB 2EYRB 1FZMA 5EOCJ 4OTXH 5AG8A 3O3UN 2CLVA 3U0TB 5DUML 3E6FA 4CL7A 3QSKB 5GGVH 4O9HL 4I13B 1ADQA 4Z5RA 3DTXA 3BPNC 3MJGX 3ILPB 3U79A 5E4EC 3VGAC 2Y36H 1EMTH 2IBBA 4AQ1B 4EXKA 1DL7L 3MXWL 4IOSD 4DGYL 3G6JE 3TYFA 5I8OH 4F7MB 2RBLA 4NZTH 4JFDB 1WIOA 1T22A 1XIWB 1EEQA 2QQKH 3KDMB 3EW3B 4PJAB 5ILTL 3E1F1 4KPHH 4OT1H 4FP8L 2FH6A 3KPSB 4KMTL 5F7MC 1ORSA 1CYGA 3QDGA 4PGDB 1ZLVH 5KS9F 1ADQL 2BHZA 3MQIA 3UCRA 3P4NB 3D5OF 5IGXH 5JOPD 1XH3B 3O4LD 5D96C 4KY1L 1T20B 1F58H 2R1YA 3OKMA 4QY8A 1T2JA 4H8WC 1Z0MA 1CDJA 1M71B 4CW1B 4XCYA 5EPMA 2AQ2A 1T7WA 1DANT 3KYNB 5D72L 4ONFH 4BFEA 3S5LG 2QBWA 3H7LA 3OAUL 3SDCB 2EH7H 4YWGL 5J06A 1KENH 3OX8B 5D1QB 3KPQA 3VGHA 3S4SG 5GJTH 1QZ1A 5IG7B 2R4SL 4P2OA 2O5ZL 5BS0E 1SQ2N 2BVEA 1EEUA 1H0DB 4N0UB 3UPCA 4YHKL 4NFBA 5F7EL 3MX0A 2ICEA 4ZOBA 3S9DB 5I9QC 4LCYB 4J3TA 4N1EA 2YZ8A 5I1CL 2EYTA 3OR6A 1KNOB 2H9GB 1A1OA 4GG8A 4Y1AB 2ZG1A 1KEGH 5IOPA 1P6AB 3RA7H 2ZOLA 2IAND 1EVUA 4RFOL 4JPVH 2DQTL 4YIQB 3WFEL 3F5WA 5DD1L 1I1FB 2VL5B 2BVUA 3BQUB 2GJZA 3ARYA 3FKUS 3S36X 3O3EB 1ZHNB 5KS9B 4K3JL 5C0AB 4OI8A 1AFVL 4WI7A 4OZFG 5E8DL 1CXLA 2GK0A 2JLLA 5GGRB 4XNMA 2NZ9D 1MAMH 1MQKH 4WIQA 4YQXL 1RAMA 2E9JA 2GUOB 1KIQB 1A6UL 4CADA 3OF6D 1AXSB 1RIHH 4OSUL 2Y5TB 3FTGB 2NY1D 4ZPTA 1A7QL 3MV9D 5CGYC 3BPLC 4MA1C 4LOUD 1MCSA 3SJVD 4XXCA 2FEDD 2J3SA 2VUYA 1GIGH 4R96A 1FNSL 4CVZA 1MCOL 1MCHA 3NCYS 3A6CH 4HIHA 3W2DL 5DJ6A 1FL3A 4F3FA 4F7PB 4MA3B 1TZGH 2IBZY 4WW1A 4G8IA 4PJFE 5TE6L 3FB7B 1RJYB 2KZWA 2VXSL 1G7LA 5FUZL 2IAMA 3MFFA 2AK4E 4X7CC 3GSWB 1RZGA 2WUBL 3P4OB 4HMCA 3O9WA 1EGJL 4U1KB 5CCKL 2N7AA 1FYTE 4HFUL 2GTZA 2W0LA 1NDGA 4IOFD 1QTYT 1TETH 3O6LH 3MRHB 1Z9MA 3WEXA 5HYJA 2Y23A 3QI9A 3RVWC 5HSFA 4OLWL 3X14B 1JWUB 5I15H 1U8IB 1TVDA 1Q1JL 3MNVA 3M17B 3O3DA 1AD9B 4X0KB 3UBXB 5IB4B 4XNZC 3TVMD 1HIMH 2Z31C 1R5WB 4DFIA 1JYXA 1IQDA 4O58L 5BXFA 1UG9A 5IQ9B 4X6DF 4IRJC 4MJ4A 2YK1L 2Y7QA 4Y5VA 1IRAY 2OL3L 2KL6A 3HG1E 4O51A 1XZ0B 1WZKA 1XGUB 2XZQH 1BIIB 5C09A 3DXAE 3NACH 1WFOA 5LGHL 4KRPD 4N5ED 3CU1A 1G1YA 4Z95H 5BO1H 1DE4A 1MVUB 4MGXA 1YMHA 1CT8B 4NP4H 2LTQC 5EUOE 2W0FB 1X5IA 3TNMB 5T1LD 1A7OL 3ZTNH 5IESL 2H8PB 4PY7B 2NR6D 3P4LA 5EB9A 5BRZE 2P5EE 4RAHA 3LH2H 2BFVL 3VXSB 2R2EA 3TBVB 2EECA 2ENSA 4RCAA 5JHDB 1UWXK 1R24B 3OXSA 5KVGL 1KXVC 3GSXB 5LVEA 4ZUTB 2N1KA 4KTEL 4NQSA 3VRIA 2J4WL 1B90A 1NLDL 4P9ML 5LXGL 3HA0A 1J8KA 1FZJB 2HFGL 3J7HA 1QKZH 5GRVL 2YXMA 4NBXB 1P1ZB 5SWSE 3HC4H 1OOAA 5HYQB 1A3QA 5TE4H 4FQIH 4X6DB 1T0MB 1IC7H 2CH8A 4DOHB 2DQJL 4NO5B 2EXYD 3QIUD 1MFAH 5TDNA 4NQVB 1G0YR 2ADJB 3FQWA 4GS7B 3CFDB 4M8QB 4Y19D 5I66B 1S7QA 1L7IH 4R4NC 4TPRH 2AXGA 1IZKA 5HVWA 3DLQR 4E41B 3O3BB 5C0BB 4OFIA 5DXWA 3WJJA 4MDJA 5B22A 4OCSL 4I3GA 3HTLX 4XB8A 3T8XB 5IB5B 5CZVL 3ARSA 1KPRA 2UVEA 5CBAA 4B5EA 1V05A 3IDYC 5AYUL 4R2GD 4LHUB 5KZCD 2FB4H 2GAZA 5DRWB 4F9LA 2DLHA 3KNBB 3FB5A 4G43B 5D2NE 3OAZK 3EFFA 3REVA 5ADOH 3MJ9H 5D7JC 4QRPE 5CZXD 4GAYB 4U4BA 1DDHA 3IDGB 2Q3AA 3C5JA 2D9CA 3FN0L 2CR3A 2Z4QA 3RWEB 4AM0B 1FDLH 5DVOA 3JSSA 9CGTA 6FABH 4KKBD 2JCCF 2ZPKL 4U1NA 1YN7A 3MLTA 5FYLD 1BOYA 2D7NA 5HGBA 3S37X 4YBLC 4QXWA 1YECH 3D18A 2OTUB 2XY1A 4RMRA 3BVNB 4P57A 2NY5L 4R90H 2F15A 4M7LT 4HHAB 4NKDA 5DRXA 4H1LG 4AEIL 3MLUH 5I1AA 3IFNL 4OUUA 5L8JB 1BM3H 4NBZB 4ODWB 4PRHE 4PJ7E 4LLYB 3BO8A 2YMXH 4X4ME 2ESVA 5DF0A 5J4MA 3KWWB 5EA0L 2C9AA 4JVPA 1NMAH 1V3LA 3EOAA 3GEWB 2E6JA 2W59A 4AYFA 2BMKA 2F19H 3HE7C 4PJ9D 3IXTA 3H9SB 4RBPK 2AS5M 3GB7B 1G7IB 3WXWL 4F2MA 2EYRA 4LSTL 4PJ5E 3U0TA 3UYOD 3MLXH 2QHRH 1RK1A 1I1CA 1ND0A 1XGQB 5DVLA 2RFXA 4QNPE 1AHWC 4EZMA 5GGQL 5ICXB 5E94B 5KSAB 2VQTA 2HFTA 2YN5A 3Q5TA 2JCCB 4OZHE 5D5MF 4I3RL 3DO7B 2VWEE 4JN1L 1T2QH 4JB9L 4NO3B 1UM4L 4OCLC 2QADD 1LMKA 1WEJH 3KPNB 4NNXB 1QSZA 4FQXD 3WHXB 5FGBC 2CGRL 4F7MA 3QUMH 4M6NL 1UCTA 5ICYB 1Z2KA 2FJFB 4CMMB 1A1NB 3MCLL 2HLAB 3ZDZF 2F8XC 3HC3L 4LLQB 3KPSA 3ARXA 1T5XB 3WS6C 5K9OB 2M8XA 1ZE3C 1EJOH 4RWYL 1OT2A 3SO3C 4PGDA 1EHAA 1T0PB 3DYOA 1MCWW 5IUSA 1SHMA 3PGFL 3ARDB 3RIFF 2CKBA 2FBJL 1QNZL 1DEEA 4FQ1L 1B4JH 1QFOA 1M71A 4CW1A 2VXQH 1I4FB 1RI8A 1T80A 4OZIE 3KYNA 2NW3B 4U6XB 4P99A 4UV7H 1MRCH 3SDCA 4L8BB 1U0QA 3DGCR 1BWMA 3RUGF 4JKWA 4HS8L 1JNNH 5DO2C 5EFIB 4D9QD 3QRGL 4FZ8H 3TFKC 4H88H 4X6FB 1P7QD 2CKBL 5D5MB 2X4RB 1KFAL 1U58B 2CK0H 5I8CB 3KPLB 1QRNE 5C0CB 1EPFA 3I9GH 3IJYB 3U48A 1BREA 1KNOA 2H9GA 4D9LL 4OF7A 5T5NG 2X10A 3T0ED 5GS3A 1MIEH 2R29H 3VFPA 2NX5D 4LEXH 1B0RB 4GAJL 3IDNB 2WK2A 2VL5A 2Z91B 5K9JL 3BD5A 3BFOA 3HB3C 3LZFL 3O3EA 1ZHNA 1WF5A 5KS9A 1MFBL 3MLSH 2BRRH 3BKMH 4Y7MA 2Z8RA 5GGRA 2DLGA 4B0MM 1Q0YH 2HRPH 2GUOA 3CAFA 4NZUL 4XBPB 1A7RL 4WI9A 3QWRA 5CEZH 1UJ3B 2IG2L 4WHYH 2Y5TA 1IBGH 3FTGA 4QGYA 5DHYB 2A77H 1SM3H 5I1KL 3GMMA 2H26A 3D69B 1L9MA 4P5MA 1CS6A 4PJ8C 5EO9B 4FQLL 1I9IL 3WFDH 4FFVC 5GZOC 2DD8H 3FQTB 5HXMA 3RUGB 4UTAL 5E99H 4F7PA 4EI5B 1SEBB 2WBJD 1T66C 3FL7A 1OP3H 1QSFD 3FB7A 1RJYA 3T1FA 15C8L 3P0VL 1N5YL 5D9SA 3HHRB 3U2SB 3THML 5F9AC 3P4OA 2FO4B 3EOYG 4WWID 1UXWB 4HIJB 3OHXB 4JVWA 2C3WA 1BOGB 4PB0L 3S88H 2PYED 3MROA 2R1WB 1AKJD 1CVRA 2R8SH 3ROOA 4UUJB 4ZS7H 3QUYB 1S7SB 3RWDB 3HG1B 3VMPA 4YJZL 4H8WH 5JPMB 4H0HB 3MRIA 3X14A 3UC0L 3VH8A 1JWUA 4XC1H 4YHZH 4OB5L 4X0KA 3M17A 1AD9A 3JWOL 4RAVA 2VMFA 5IB4A 1LDSA 3UBXA 1R5WA 3MLZL 1HH6B 5IQ9A 3ARBA 1Z0NA 3MUJA 2AJSL 3TWCL 3CJJA 2GIYA 1VGEL 5E0QA 4JFOB 5HGAA 1XZ0A 5E8OA 4PV9B 4N9GB 5EUOB 2IPTL 5J57B 1HCFX 1XGUA 1BIIA 1Q0XH 1DBKL 3EYUH 5EU7C 2AJYL 1SMAA 5C2BH 3DV6B 2XTLA 4P3CL 1MVUA 2BERA 1CT8A 4JO3L 4XT1C 3NCYP 3TNMA 4EUPB 4F57H 3H7BA 4MA7H 1R0AH 1P7KB 1RUQH 2H8PA 4PY7A 5HDQL 5HDOA 1CDUA 4JRYA 4KK6D 3VXSA 5CGTA 3TBVA 1RUKL 2A1WH 1R24A 3QCVL 4ZUTA 2KBGA 3ZKND 5SWSB 3FB8B 5E9DD 2CUHA 4I1NB 5EU4B 1CGVA 1MCEA 3A6OA 1E28B 1A9BB 1P1ZA 3BZDA 1KG0B 1JF1B 4HH8A 5HYQA 1ETZB 3SDXE 4XZUA 5D93B 4YDIL 2Y06H 3VWKC 2EEAA 4YUEL 5A2KH 1N0XL 4NO5A 5FYJD 4NHCH 4K9EC 1T89C 2NW2B 4NQVA 1TZHB 4HWZB 3WLWD 2ADJA 3CFDA 4M8QA 1X44A 3MRQB 1XFPA 1UXSB 4CDGC 2ZCKH 4E41A 3O3BA 2X70A 4DGVH 5F89A 5C0BA 3WJLA 3N0PB 4OCWH 4ZOCA 1UJTA 5F44A 3L5XL 3Q1SH 2EE6A 3TO4C 1K5NB 1NL0H 3QDJD 5IB5A 4QRPB 4KI5D 2VABB 4LHUA 2ZP0T 3TT3L 4ACPA 4UI2A 5KJRH 1AE6L 4XI5D 3KNBA 4G43A 3MFGB 1NFIA 4X83A 4QGTA 2LV4A 2CXKA 3C2AH 4QXTB 2BVOB 4GAYA 3PHOB 4FMKA 2YA2A 5IB3B 5C8JB 1ED3B 3NFSL 5GRJL 1DP0A 3RWEA 1XR9A 2B5IC 5CSBA 2X4OB 4AZ8A 4AM0A 5I19H 3ULVL 5E5RB 4HFWB 4GRWH 4HWNA 4I77L 4I8DA 1D9KD 2R1XB 5BZDB 2DS4A 3ULUL 4M6ML 1T03H 4WHTB 2QJDA 3FT4B 1Q38A 4TSAH 4FQPA 2R0LL 2DM7A 1CGYA 3QQ9C 1ACYH 4AH2B 2OTUA 5EWIH 3BIBX 3BVNA 1F3JB 1I9JH 1U6AL 1C08B 3ARVA 1P4IL 4LIQE 1DQJB 1K9TA 4HHAA 4PS4H 3RI5K 3H9YA 1BX2B 1X3DA 4AENA 2FR4B 3P30H 4LEOA 2VKXA 2WANA 2DJ4A 1OSPH 5JQ6H 3NIGE 1JPTL 1DQQB 2P43B 2HJKB 4ODWA 4LLYA 4NUGH 1TVBB 4D0DB 2AW2A 4FG6D 3JV0A 3SN6N 1QBLL 1KULA 2XQYK 2CIIB 5DEZA 3BKCL 1HXYB 5HHOD 1B88A 3OJDB 4HJJL 1S7RA 3C6LC 4NJ9H 4FZEL 2AI0L 1G7IA 3N06B 4OZHB 2B1AL 5FXCH 1KCVH 3CCHA 4Z78B 4PJCF 4ZNCD 3Q0HA 1XGQA 4S1QH 1QLEH 3G6JA 2EEBA 1ZOXA 5KSAA 4G8FB 3RRQA 4N90D 5LQBH 5ID0B 1CXHA 4R0LC 1K8IB 1F13A 4NO3A 3Q5YA 2XWJB 1QLRA 4LAQH 5J11C 3VDBA 2V7NB 3KPNA 4NNXA 5DJYA 1LP9E 5L7XL 3WHXA 4N8VA 4NKIL 3V0WH 4NNPL 5ICYA 2FJFA 4U1JA 4ZDHA 1TCMA 1WFTA 3W11D 4CMMA 2L0DA 2HLAA 4B7IA 2PO6B 4P2RE 1HYRC 5EZLB 3TJEH 4PJBF 5SWZB 1GGIL 5E8EA 4LLQA 1T5XA 1YYMH 5K9OA 5CD3B 4XPBL 3EJYD 4KQ4H 4YO0B 2IQ9L 4K7PX 1JTOA 5CWSA 3VXRE 3TN0D 3EYOB 3S36L 1LEGA 4G6FB 3RL1A 3RZCC 2ORBL 1WJ3A 5HHVH 5GRUL 3O2WL 1BFTA 1I4FA 3EFDL 4RNRB 3RIFK 5BS0A 4CN6A 1BVLB 5F9JA 3VXQA 4LPTA 2NW3A 3CVHA 4U6XA 2YWYA 2XXMB 5JDSB 1QRNB 1MNUH 3U4EB 4KK9C 4XC3L 2JJWA 1KJ3L 3PXJA 5EFIA 4IRSD 4HULB 3QWQB 4GJTB 4GAGL 2QSQA 5D5MA 2DQHL 2ZUQB 3BD3A 3QEUB 5I8CA 5C0CA 3G04B 2NXZC 1D3CA 2V9RA 3CFBB 3HN3A 3IJYA 1WBYB 3KVQA 4RISH 4MMZC 3WD5L 3QJFB 1TJIH 3CVHL 3DSNA 3EIFA 5KVMC 3IFPA 4UOW1 4GRWE 4ODVL 1B0RA 2VDRH 2Z91A 2DF3A 1EERB 2DI9A 2P5WD 1JGUH 3EDKA 4XPAH 3PUCA 3PDDA 5ECJE 2JJSC 4UQ2B 1EZVY 2VNCA 4QCIA 5JIKA 1B4RA 1RJLB 4XCCL 5CBEA 1EO8L 4XBPA 5JDJA 2BY2A 3LN4B 5C0ND 3V4UH 1JF6A 1UJ3A 3WN5B 1GPOL 4YDJB 5DLML 5DHYA 2AQ1A 1PQZB 1ZLVK 2C26A 1FBIH 3D69A 5EO9A 5JR1H 1QQDB 5CEYB 3TZVD 3FQTA 3CLFL 1I3GL 4EI5A 3BX7C 5IF0A 3NPSC 1XCQB 1SEBA 1TENA 3U7WH 4I4WA 5T3ZE 3AB0B 1G7PB 1WBZA 2OR9L 3JTTB 1AR1C 5INCA 3U2SA 5HHQB 4J4PD 4ODHL 3AFLA 3VA6A 3DHJA 4Q6IC 4JR9L 2FO4A 5I1DB 2H32H 4GRMB 1MI5E 1BOGA 1U95B 3TT1L 1L0YA 4GBXA 2R1WA 3U4AA 5L0QC 3JWNC 3D85B 1J05B 3DNKA 1NSNL 1ZGLB 4UUJA 3TH2T 3QUYA 3RWDA 2VDKL 3HG1A 4HLZG 5JPMA 4U2ZA 2YD6A 5FOBA 4EBQH 3QUMB 4QOKE 3GSOA 2E6QA 1BVKB 1HH6A 2BVQB 3FO1B 3TA3A 2WQRA 1IGMH 1YC7A 2R23B 3F62A 4JFOA 5EUOA 1U8LB 4Y5XC 2VQ1B 3GMOA 4NQCE 3VGFA 1P53A 2QHLA 3DV6A 1J1OH 3QXDB 2UY7A 3NFPA 2PW1B 3STBA 2ZUVA 1P7KA 3MXVL 4YXLH 3RWJA 4KUZL 1MJJB 3GMNA 4WI3A 3QDGD 1PDKA 5D7KD 4XNYL 5F7DB 3IU4H 2VXVL 3LN5A 1K4CB 2XA3A 2J8UE 1CGSH 1A3RH 4I48A 4ZODA 1Q9LB 2CK2A 4RFNB 5SWSA 3FB8A 4Y2DB 1JP5A 2CDEB 5EU4A 1UACL 1EBAA 1S9YB 4HAFA 2VN7A 1E28A 4JPWL 4V2CB 1WIUA 1A9BA 1MJUH 2AXFA 2WWMC 3LS4H 4R97B 4UILL 1KG0A 1TQCB 2ARJA 1JF1A 4WEMB 5K9QI 3GSRB 1EBPA 2VR9A 1ETZA 1A6TB 1KIPB 4F7TB 1RFDH 4TVPD 3PWNB 3CFCL 4LSQH 3T3PF 4LU5L 3S37L 4NN7C 1TZHA 4HWZA 2C4FT 3MJ8B 4JDTL 4MB4A 1UXSA 1C5BL 4ODUB 2VJXA 4WO4C 4HWEH 1IC1A 3RA7L 1JBJA 1SJHB 4QRPA 1CLYL 4OZ4B 3QQNA 2DKUA 5E4EB 2VABA 3VGAB 3EHBD 1FN4B 1NBVH 5I1EL 2B7DT 5HHXH 4G6KH 3IAQA 4YHOL 2E9BA 4F9PA 3FAWA 3CMOL 5TE7H 4QXTA 2BVOA 2HFEB 2EO1A 2CLRB 5IB3A 5HHNB 3KJ6H 5C8JA 4ODXA 5A3IC 1ED3A 5KVDH 3IT8D 4JDVB 4I0PC 4ZSOB 1W0YT 4G7YH 4HFWA 2H2SD 1LE5B 1I7RA 4LPYA 2HTLC 5BZDA 3H3KA 5E2TL 1JNJA 4WHTA 5D96B 1N3NA 3F6LA 1KGCD 35C8L 3QR2A 3A6CL 1DBAH 1QP1A 4NQTA 1MCCA 4D94A 1TZGL 5MENE 1NGQL 5IMOA 1N7MH 4HUUA 4BH8A 4Z7OF 1C08A 3JWDL 3OGCB 1NMBL 5AWNH 1UYWH 5I1IH 1DQJA 2LU4A 1IC4L 4X4MA 3EZ8A 2IAMD 1M4KA 1BX2A 3KAAA 4P5KB 2FR4A 5DK2B 4EUPG 3VW3H 3O9WD 2WZPD 4LCUB 3T2NL 5DEGB 1DQQA 1EHLL 1IM9B 2HJKA 3RX7A 2GJ6E 3U30C 1OAXH 1TVBA 4K8RL 1TETL 1A7PL 1A7NH 5DR5L 2AEIT 5FGRA 5HYJD 3TGXA 3QI9D 4XHQA 3GRWH 3SGKC 4POYA 4FTVE 4YHPB 4YHML 5I9QB 1FNHA 2CIIA 1HXYA 4V2BA 3OJDA 5DMJB 3AMKA 3W0WE 2V5YA 1JHLH 5FUCE 1U91B 4OZHA 5IM7A 4GMSL 3B9DA 3SDDC 4TSBL 5JZ7C 3W9DB 1A2YB 2BOBB 3KR3L 2IFGA 4QTIH 4MNHB 5C09D 2IFFH 4LL9A 5HHMD 4K9EH 1LP9B 4Z95L 4J3UA 5CINL 4G8FA 4O2FA 1EA9C 1XEDA 5ID0A 5FUOH 3ESUF 1K8IA 4YR6B 4XMLL 4NP4L 4GRLC 3F7VB 2XWJA 1A7BA 5IMMB 3L6FB 2V7NA 1LO4L 3ZKXC 3HI6L 4NGHL 1GGUA 5BV7C 4WI5A 3QNXB 1IMHC 4P49A 5IVXF 3BPLB 4MA1B 3VXRB 4JFHD 2OZ4H 2PO6A 3PL6C 2W9EH 5EZLA 5SWZA 4YHLL 5L2KB 2A6JB 4EDWL 3T77B 2DI7A 1RURL 5CD3A 2COQA 5D1XC 4YO0A 4BQ6A 3CZJA 2ATPB 2BVPB 2X9WA 4QYOB 3ZDXF 4OZIA 3DRTA 2NY3D 3CFIC 2EKJA 4HPOL 5ERWB 5EZIL 5BVPH 3U0PB 3UAJC 3VRJB 2NNAB 1EXUB 3SGJA 3WFBL 5ESVB 5E1AB 1J5OL 1GAFL 2OI9C 1S7VA 4J8RB 1BVLA 1HZHL 1YJDC 4FQIL 5CILH 3F7QA 4K94L 4WFED 2DQDL 1G9EA 4NO2B 2GSIB 5JDSA 1QRNA 5I74C 5KAQF 1F6AB 1V7MH 1R3LB 4PFEA 3TJHD 3U4EA 3ARED 4XNZB 2Z31B 2XTJD 1EHNA 5J1AA 4XNQB 1MWAH 3BYYA 5D71L 3F7RA 4U1MB 4IRJB 3MRFB 1T5WB 3QEUA 3SGDI 3N1FC 4I0CC 4MWFB 3D9AH 4GRWB 3MODH 3E6HB 1C1EH 2EO9A 5IMKB 1GCFA 2XOTA 4U3CA 2FB4L 5IVXB 3QHZL 4KK5D 1CICB 4OUOA 1DN0B 1RIUH 3TIDB 2LTQB 3L3HB 3ES6B 1INEH 4HJGB 4H20L 3OXRB 3GM8A 2J6EH 1BFVL 1MAKA 5E2WH 4NM8H 5FA3B 3LKOA 4UQ2A 1FDLL 5JOPE 1RJLA 6FABL 5FHAH 3LN4A 3WN5A 4QTHA 1ZHKB 5FF6A 3NAAL 1G6VK 1QQDA 2ZCLH 5EIIB 5CEYA 4EIGB 4OBSA 5AD0A 4PD4J 3QH3A 1ZSDB 4MCZB 2YUZA 4P23C 1QLFA 1T21B 1G7PA 2QQQA 5T33L 4LLMB 1AQDB 3JV4A 2PR4H 3LRGA 3RX5A 4QHLB 5BQ7B 5CD5D 5HHQA 3F12B 4HKZB 1IM3B 2ESVD 3V79C 3BUYB 4LRIA 3V5KB 4QEGA 4G3YH 1OCWL 1U95A 5BOPA 2F5AH 2RJMA 3D85A 2D7PA 3MV7D 1ZGLA 2F19L 4XCFH 2X4SB 3ARGC 3QUMA 4EQ2A 1G6RB 5L2JB 5I18L 4NWUL 1H3VA 1BVKA 1C5CL 4HCRL 3IDYB 1HWHB 2BVQA 4HUWB 2DIJA 4LDLB 1KCRH 2DQIL 3DO3A 1NCDL 3MRLA 2X4QA 4LGSB 1CFVH 1QFUH 5D7JB 1WWWX 3VI4F 1U8LA 1T6WA 2FO1A 2PF6A 5FB8B 2NXYC 4XVUC 2V7HB 2IADB 2EDKA 3BGMB 5FKPB 1UM6L 1KC5H 3VGEA 1JFQH 3GJEB 1P5UA 3MV9E 1U2HA 3IFOB 4MA8H 2UV3A 2YKLH 4KJWC 3QXDA 1A47A 5I1GL 4WTZA 2ITCB 3BKYL 5J13C 4OIIH 5D6DA 2OXGA 3KPSD 1I3VA 3FOMB 1TMCB 4JFQB 1J87A 1L0XA 3WUWG 1ZT7B 1MJ7L 5F7DA 1K4CA 1RZFH 4RGND 1FLRH 3BT2L 1Q9LA 1CGWA 4Y4FC 3BP7A 1E0OB 1E6OL 3VCLB 2CDEA 4Q6YA 4C55A 5KW9H 1OP3K 3OKLB 1D6VH 1B6DA 2VXQL 3VRLF 4C54A 4G80A 3BGFC 5GRYA 3WKMH 1FRGL 3VD9A 1U8NB 1OHQA 1YY8B 4B7LA 3GSRA 3SDCD 5L6YH 1A6TA 2R15A 3KLDA 1KIPA 4F7TA 3P77B 3PWNA 4WNQA 4L3CB 1BJ1J 3HE7B 2P7TB 4OM0H 1IGJB 4Z7WE 4ZFOB 1CDBA 3MJ8A 1PLGH 4PRPB 3SE9H 3IRPX 1CFQA 2WIMA 4Y4HB 3JVGC 1BAFL 3ZO0A 4H25B 1AHWB 4PJXE 3IFLH 1LEKB 2FEEL 2AJVL 4LAJH 3MGAA 4MXQD 5HYEA 4OZ4A 5FHBL 2X1QA 2X1PA 4LEXL 1FN4A 1AQKH 2EDBA 4CDHA 4YXKH 3BQUD 4XVSL 5F9OL 5FYKD 3MLSL 3JV5A 4ODBD 5ISZB 4YDLC 2CRZA 2HFEA 1MUJA 1OTTC 2CLRA 3DETD 5HHNA 2O5YL 4S1RL 2WLYA 4OGYL 1HQ4B 2DOCA 3LSOB 1FP5A 3QWRD 3HKFA 4ALAL 3SO3B 4JDVA 2H32B 4ZSOA 4UU9A 1OAYH 1I8IB 4MZ2A 5IBLC 2BY3A 2X4PB 1LE5A 3EYQC 1BQHB 4PJDB 1S5IH 2O61A 4PR5B 3RWCB 1YEFH 4KJPC 4YDKL 2DD8L 3O6FC 3JUYA 3C08H 5D1ZC 3UROR 5KTEH 5E4IA 1RVFH 2AEQL 1N64H 5B38G 4BFIA 3MMEB 4R7DB 5GXBB 3U83A 4QXUL 4HK3J 4RX4A 5ITBL 4Y19E 4J23A 2Y4SA 5DK2A 1KXTB 2F58H 4LCUA 2CJUL 4PV8B 5DEGA 1JPSH 2ZCHH 1IM9A 2YA0A 3W0WB 2CLZB 4LIQL 4GKZB 1LNUB 1A5FL 3HS0B 4K7PL 2FSEA 4YHPA 2A83A 2CQVA 4K3GA 1NCWH 1H3PL 2F8VA 4NRZB 1UEMA 4X9IA 1G0DA 5JLZB 1YEGL 3ARBD 5GS0C 4F58H 4BM7A 4G8EB 2Y1VA 4RA3A 1U91A 5AZ2H 2EYSA 1K2DB 4I5BB 1A2YA 4KZDL 5JA9A 4MNHA 1VGKB 2D4FA 1KOAA 3UTPE 3OKDB 1W0VA 1NGPL 1LP9A 5L88H 1T1ZB 4HIXL 4BH7A 4AEFA 4YR6A 3KS0H 1DUYB 4S1DD 5EC1B 4KH2A 3OV6A 4FXLA 3BSZL 1ZLWK 5IW1B 1F6FB 5C0FA 3QNXA 1TJHL 1XGYH 1FL5A 2LVEA 3VXRA 4PJIF 2OMBA 2Q8AH 3VXSD 2R9HD 2NY2C 5L2KA 2A6JA 3T77A 1CFBA 3U1SH 3QQ3A 1DCLA 5D70H 3VMOA