1OW5A

Nmr structure of the saccharomyces cerevisiae sam (sterile alpha motif) domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
PFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase STE11
publication title The solution structure of the S.cerevisiae Ste11 MAPKKK SAM domain and its partnership with Ste50.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 15
structure length 60
sequence length 60
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ow5A00
2KIVA 5KNIA 3KKAA 1PK3A 3BS7A 1DXSA 2EAPA 1SXDA 2Y9UA 4NL9A 2D3DA 1V85A 2DL0A 2JV3A 4MHVA 3BQ7A 1F0MA 2KMDA 1LKYB 3SENA 1Z1VA 5F3XB 2B6GA 4RQMA 4PZOA 2F8KA 2E8PA 3KKAC 1UQVA 2E8OA 3K1RB 3BS5A 5JTIA 1B4FA 1RG6A 4NL9C 2QB0A 2DKXA 2DKZA 1SV0A 5L1MA 1B0XA 2K4PA 2EANA 1KW4A 1SXEA 2FE9A 2KSOA 1SV4A 2QB1A 4RQNA 4IS7A 1V38A 3BS5B 2ESEA 4NJ8A 1X40A 3HILA 2QARA 3SEIA 1X66A 2KE7A 2QB0B 2EAOA 5JU5A 2F3NA 2LPEA 5JRTA 3TACB 1WWUA 3TADA 3IDWA 1WWVA 1PK1A 2KSOB 2ES6A 1OW5A 1SGGA 1OXJA 5J8YA 1JI7A 2GLEA 2QARB 1UCVA 2K60A 2QKQA 2EAMA 1SV0C 3TADC 2L5YA 2KG5A 2Y9TA 3H8MA 1LKYA 4PZNA 2E8NA 1COKA 1X9XA 5J8YC 1PK1B 2D8CA 2LMRA 2F44A 2YTUA 2E8MA
chains in the Genus database with same CATH superfamily
2HHWA 4P0PB 2W8LA 2KJ9A 3AU2A 5ALEA 2V4RA 3KZIU 4QIWF 4JK1A 3JPQA 1JX4A 2HSZA 3BDPA 1SB3C 4NL9A 2ZJ5A 2W9CA 1F0MA 3KHHA 5J0SA 2I5HA 2KMDA 3SENA 3CYMA 5KG2A 5KFZA 2K4EA 3JPSA 5J2AA 1WCLA 1Y88A 1NZBA 8ICGA 1ZQFA 4GIBA 5DG7A 2LKYA 3N7PD 3PV8A 7ICIA 4RPYA 4G3IA 3KD3A 3SYZA 3OSPA 2WF6A 4YMMA 2RDJA 5IIMA 5J2DA 9ICOA 1J2NA 3LWLA 1XSPA 4F93B 3MDCA 4QZBA 2R18A 1Z3EB 2QB1A 2W04A 3TFRA 3TI0A 2BDUA 2ZJAA 5J0OA 1CRXA 4B9SA 5IIKA 5EOZA 2QB0B 2ZUCA 1WYGA 4Q8FA 4DOAA 4UB1A 1Q3UA 2BCSA 1DK3A 4TUQA 4RQ2A 3TADA 2DPIA 4JWMA 1ZD5A 1K1QA 3MC1A 2HHVA 3C21A 4LZGA 4C8NA 3B0YA 3C5FA 3AQFA 4CF3A 4C4TA 5BPCA 3THVA 1OUQA 7ICHA 2XY5A 2OCEA 5GTHU 1M6YA 2KVCA 4M0AA 9ICQA 2K8CB 3PNCA 1ZQLA 2BPFA 5EE0A 1KTQA 2KFNA 2VA8A 2KNJA 5KFIA 1COKA 2EZZA 2ALZA 4J9PA 3OJSA 4HAIA 1SZPA 3HT3A 3GIMA 9ICEA 1L3SA 4DL5A 3IRUA 1NJXA 2A19A 3HKZC 4PHEA 2DQNB 4KMOB 5J2BA 1J97A 1L3TA 2ZIXA 5DDYA 4QZAA 8ICQA 3H0MB 2BCUA 5KFAA 3RJFA 4ED2A 4J9LA 2ZXIA 4I29A 2C2RA 5KG5A 3UXOA 1K5OA 2G09A 4UAZA 1D9DA 4EBDA 4CRXA 2DKXA 5ALJA 2HVIA 4NY8A 1U47A 2Y1JA 2YX8A 4UBCA 1HUOA 2ISPA 3KBBA 5KG7A 4QZHA 1KBUA 4O3PA 4F4YA 4RQNA 3A0HU 3M7DA 8ICTA 3SV4A 5ALPA 3UMBA 3MR2A 1QSLA 5KFHA 2PI5A 3IM1A 4F4ZA 3RJIA 4UAUA 4CF5A 4KTQA 2KN7A 4ED8A 1NZPA 1WWUA 4DFJA 1ZQZA 4US9A 4F5OA 5HP4A 2UVWA 1SGGA 2A1JB 1JALA 3NUQA 4IQTA 5ALYA 4LZDA 2NRTA 2Y0SC 3O0FA 3D2NA 3FYHA 3NRZA 5DB6A 2WAQF 9ICUA 5J2HA 4QZCA 4MFFA 4HYKA 3MR3A 4TURA 2JH1A 5KG0A 5KFRA 2PXIA 3QZ8A 4RUAA 4EBCA 2ZTEA 5ALMA 2F44A 3F2DA 3GV8B 2NO5A 1U45A 2W43A 1L8OA 2XC9A 4F92B 2HOFA 1Q3VA 9ICGA 2BGWA 3Q8RB 3WK8A 4LJXA 4B9NA 3BQ7A 1A76A 3M6KA 4UAWA 3WKEA 4CGZA 1IM4A 3K1ZA 4RT3A 5HR7A 3QU5A 4RQMA 4NM2A 2K4HA 2G0AA 3PSFA 3V7KA 1X42A 2M9NA 4TUPA 2BKEA 3I1YA 2BHNA 2ODGA 4NWIA 2O6KA 9ICAA 2NRVA 3ORYA 1YZ7A 1NNLA 5EE3A 4Y2VA 3RB4A 3V72A 3JPRA 4CDGA 4U7CA 1SXEA 5B5EU 1RXVA 3V6HA 5KFTA 2AQ4A 2RHFA 1BPYA 2KE7A 4QZIA 5JU5A 2K4IA 4IRCA 4C8KA 4DQSA 2H3QA 1A0PA 2YB4A 3F53A 3L4PA 4DSEA 4KLHA 2XO7A 4ED6A 3HRDD 5KFVA 2ZXHA 4J9NA 2K89A 3LWMA 5DQHA 4GXIA 3BZCA 9ICSA 2KHVA 1RXWA 2RRDA 1SL0A 2H3FA 4ECVA 4ECTA 1WUDA 2FPLA 2RLTA 1TAQA 3PW7A 2IA6A 2BR0A 2P35A 3I28A 3RAQA 3NVWA 3RB6A 3C29A 5CB1A 5AM2A 5ALKA 1XC9A 2FDRA 1L6NA 5CRXA 3UMGA 2V4QA 3U26A 1NK4A 5AI5A 4K4HA 5IIJA 5BOMA 2H3IA 5HMLA 2HHTA 4MEYA 5ALVA 4RZRA 3ZD8A 4R64A 9ICBA 1RQLA 3ONNA 5HMMA 5J0RA 2YMPA 1SZHA 5AKLA 9ICMA 1U48A 1KFSA 2JHDA 2JZBB 3BS5A 3UQ0A 2YMMA 1N5XA 4O9MA 4R65A 3QU4A 2LI6A 3WK7A 4DO9A 4KLFA 4ICAA 4FS1A 2DFLA 2EH9A 2BCQA 2R8JA 2JEFA 5AKHA 4YMNA 2ZJ8A 1HIWA 1XNSA 1ZQ1C 2Y1IA 4NJ8A 4E0DA 2ZIUA 2G08A 4M9JA 1KKXA 2ZG6A 4F50A 2JMGA 4Y2JA 4IR9A 1XO1A 3SAGA 8ICPA 1L7OA 1PUZA 2VJ5A 3IG5A 4FZMA 1PZNA 3VCBA 4YQWA 2W7OA 2IHNA 3GV5B 2ES6A 1PVRA 5AK6A 4M9GA 5KT3A 3FAHA 4QNLA 2E5SA 1DGSA 4C8LA 2DGZA 4Z6FA 7ICGA 2IOHA 3H40A 7ICEA 1QH9A 2XIDA 2KG5A 4DQQA 4UATA 3BZKA 1UHUA 4J9KA 3C1YA 1S0VA 4ECZA 3BS7A 3WKAA 1IXRA 2KKPA 3GZFA 1TAUA 1V9PA 3WK5A 4Y2YA 5KFOA 4PH5A 4XQ8A 3WK4A 3RJHA 4QWAA 4M47A 2OM6A 4UB6U 2R8IA 3ZDBA 2Z7JA 3QUCA 3H0LB 5AKXA 2KKVA 1URJA 2CN1A 5DQGA 1KL9A 3H7IA 1X9SA 3M8SA 8ICAA 2AGPA 3RTVA 2FE9A 1BPXA 3RR8A 4QIWC 3G6XA 5ALWA 3QYPA 2KP7A 2AQ0A 2YMLA 4QW8A 3ZI4A 1RDFA 8ICZA 3OJUA 4Y2PA 5AI9A 3WU2U 3UXPA 2P66A 4DL7A 1JN3A 4BDPA 1RM6C 5JRTA 1BVSA 3TACB 5ALXA 2PI4A 7ICFA 3HJEA 4FBUA 2EZXA 4PHAA 1X6IA 1OW5A 2BCRA 4UB5A 4BJQA 4DQPA 4J9OA 2QARB 1NKBA 3N28A 1Z00A 2K60A 4C4RA 2OYYA 2HHXA 4M6WB 1RYSA 4UB3A 3EPGA 3AMZA 2PMZC 3IHQB 3CP8A 5ALSA 9ICJA 2G5IB 4KLQA 2HOQA 3NRWA 3I76A 1ZRNA 2LMRA 3MABA 2YTUA 4RQ1A 4MF8A 4EYHB 1T3NA 3NVYA 5DQIA 2ZIWB 4BWJA 2VIXA 2RQ5A 2ZUBA 4JB3A 4UB2A 4EYIB 5ALQA 4O0IA 5J2JA 2KZ3A 2NO4A 4AP9A 5AKZA 5DBAA 3V7LA 5CP2A 3T5HA 1D9FA 9ICIA 4F4WA 1K1SA 3OHAA 3KHGA 4PHDA 2XY6A 1VLBA 3N7SC 4O3RA 7ICVA 3GIKA 3AUOA 4CNQA 5KG1A 1X6JA 5AKIA 2LYHA 5K4LA 4I2EA 7ICUA 5CHGA 1YT3A 2F1HA 5L1MA 4B9UA 4BXOB 5DDMA 4B6JA 2PFPA 2DBYA 3RF9A 4PPXA 5KFKA 5AKKA 5ALOA 3A0BU 4ELTA 4XRHA 3M9MB 3PO4A 2HMXA 4B9TA 3GIIA 1KLNA 4DLEA 2NRWA 3M6ZA 4B9MA 3N7RC 2CXYA 3BQ1A 3LVVA 2WHEA 1C20A 4UB8U 5KFCA 4BUGA 1ZQSA 2JR5A 9ICFA 2MU2A 4UAYA 3QU2A 4P0PA 3EYZA 3H8SA 3FDSA 4EEYA 4DF8A 1ZQHA 3QEAZ 1BNPA 4RQ8A 4EZ6A 3KTQA 1LVHA 4Q45A 5ALUA 2BCVA 2PFQA 3H8MA 8ICFA 4O3OA 4AYBC 1EXNA 2BQUA 2IMWP 3G6YA 4RQ7A 2G07A 1NK7A 4GLXA 2WF5A 4P4MA 2F1IA 4KLEA 2JH7A 2AH5A 4KLMA 3WK6A 5KT4A 1MC8A 3SD7A 2W9BB 2OXOA 2Y9UA 2DL0A 4USAA 5G5GA 5IIOA 3MR6A 5KFWA 4C0ZA 2R8HA 1Z1VA 3GDXA 1BPEA 3QXGA 4DSKA 1NJYA 5ALFA 5KTQA 4KITB 4QW9A 1ZQOA 5AKYA 4OJPA 2CPRA 2QB0A 2LHTA 1HEKA 4EX7A 4TQRA 4UB4A 4OD0A 4YCXA 2LYAA 1ZQAA 3PSPA 5ALZA 4F2SA 5D4BA 2EANA 1ZQQA 4MFAA 1CI4A 2MUTB 4RQ0A 4KX3A 4C4SA 4ECRA 2DWQA 2CRXA 1V38A 3PMLA 2ASLA 2J6SA 5J2IA 2KHQA 3ISCA 4M9HA 1PVQA 5F9NA 3SEIA 5DLFA 2B21A 1TE2A 3HPOA 5ALNA 3IP4B 4EX6A 1N60A 2F76X 4RQ3A 3T3FA 1N2XA 4KLTA 5EE1A 8ICWA 1ZD4A 5CEHA 3RJEA 2ZUDA 3TAQA 2KSOB 7ICRA 1J2MA 5CJ7A 4J9RA 3HP6A 1JI7A 1L7PA 4F8RA 5AHXA 3RJGA 3H4DA 1UCVA 3OTQA 4RQ4A 4MEXA 1NK0A 3CNHA 3C1ZA 3N97B 1DOQA 2KEYA 5AM5A 1PVPA 2PFOA 3FC4A 4IL6U 5J8YC 1PK1B 1N61A 3NASA 2A3VA 5AIBA 4YVZA 3G6VA 4I2BA 2GO7A 2WTFA 3T79A 2E8MA 1KEJA 3MDAA 1X9WA 5A0LA 3OGUA 3IG8A 4JV0A 3L5KA 4DQIA 2D3DA 3MR5A 4MHVA 3F2BA 2F1JA 1DRGA 1NJWA 3E2EA 1LKYB 4EZ9A 5KFXA 2OWOA 3ALRA 5F3XB 4YD1A 3PX4A 3S6JA 4O3QA 4OJ5A 5KFUA 4X5VA 3KKAC 4QZ8A 1QCKA 5KFJA 3AM9A 1LB2B 1F5SA 1N5WA 5J0QA 2JEIA 4OCZA 4RQ5A 5L1JA 4C7YA 3NVVA 1RPLA 4JV1A 1ZXIA 1BPZA 3BQTA 2FMSA 2JEGA 4DOBA 2LBOA 1RZTA 3HKZF 4PGQA 4NLKA 5KG4A 2C28A 2A1JA 3Q8QB 1ZQJA 4ED3A 2YMQA 1D8BA 1TAMA 3E58A 8ICRA 5J0XA 8ICVA 1NJZA 3PY8A 2AHOB 8ICJA 1QQ7A 4MFCA 5KL8B 2ASJA 1RQNA 7ICJA 5L1KA 1ZQNA 1ZQRA 1WWVA 2HBKA 5KFSA 2DPJA 5ALDA 8ICYA 4M9NA 1RYUA 4F3OA 2GLEA 2V9WA 4O5KA 3UXNA 3QE9Y 2P6UA 5KFPA 8ICMA 4DSJA 2KTQA 1KFTA 1MQ2A 7ICSA 2FI1A 3HW8A 4KLOA 3JPOA 2KOBA 2WF9A 3ZDAA 4ELUA 3PX6A 5DGBA 1ZQGA 3ED5A 4BX9C 4RPXA 1ZQXA 1QQ5A 5DG9A 4YMOA 4F91B 4YD2A 3LYSA 1S76D 3UMCA 2ZIVB 4DFDA 2FPMA 3F5AA 1ZQEA 2C2EA 2JV3A 1Z4NA 5KFBA 7ICMA 1BPBA 2W54A 1V97A 4NLBA 3V6KA 5AM1A 5KFMA 3JPPA 2QLTA 4RQ6A 5AM4A 3PW4A 5F9LA 4DL6A 4DWIA 4O3SA 1B43A 3QNMA 1RYRA 5DB9A 1NKEA 2XGQA 3M1YA 2XICA 4F71A 1JXEA 1X2IA 2GH1A 1SKWA 4NLGA 2HHUA 4DEZA 5AM3A 3RBEA 2W03A 4I2HA 2VANA 1SV4A 3M9OB 5HNKA 3RAXA 4XUSA 5AICA 4C80A 3RFAA 1S9FA 3WKDA 4UBBA 3QUBA 2AGOA 1X66A 4ECUA 5E79U 1S5LU 1ZD3A 1T94A 7ICTA 2KK0A 4R8UB 4FE3A 4I28A 2H5XA 5D46A 1TFRA 2WB1C 9ICXA 1Z19A 5KT5A 3PW2A 5EWEA 4YXJA 3FM9A 4OJLA 4PL1A 2HBJA 4FZNA 3M8RA 3RH4A 1UA1A 3RJJA 1L3VA 3C5GA 5ALTA 5ALRA 2AXTU 2H3VA 1A77A 1NK8A 4F4XA 1JIHA 1X9XA 4BWMA 4DCCA 1XS9D 3RB3A 2JZBA 5J0WA 1ZOLA 4J9SA 1SKRA 1DGJA 2VKQA 3ZD9A 2W3SA 4F4KA 5IIIA 8ICLA 8ICUA 4I2FA 2J6TA 1SXDA 4P0QB 1ZQPA 3UQ2A 5DLGA 4GXKA 2XGPA 1ZETA 5HHHA 3AEVA 4DFKA 3TARA 1Q8KA 1SL1A 2K8AA 1B4FA 5KFGA 4Y2UA 9ICNA 9ICCA 4ED7A 2HHSA 4OO1J 2W11A 2E3TA 5DGAA 3WKBA 3K75D 3TQ1A 1JRPA 4EEKA 5AI4A 4Q8EA 3KFUF 1S10A 3QU7A 4FBTA 4XA5A 5J2KA 5KAIU 4GC6A 1C7YA 2YB1A 2F8LA 2BZFA 2LPEA 4ECWA 3TFSA 4K4GA 1SKSA 8ICEA 4PGYA 4I2IA 2W8KA 3H8JA 2JEJA 5T14A 9ICWA 4FO6A 7ICQA 4JWNA 2Q0ZX 1JUDA 2UVUA 4I2JA 5AIAA 2EAMA 1FEZA 4FZLA 3ICXA 3Q8SB 2KJ8A 9ICHA 2G5HB 2L5YA 1NKCA 1WCNA 1UA0A 4R63A 4Y2QA 5KT2A 3B9JA 5DKWA 4Y2RA 7ICNA 3ETLA 2ZTCA 3PR4A 5AKJA 1DXSA 1KRPA 3RH6A 1DK2A 4I2AA 5ALLA 2Q4TA 5J2FA 3MGIA 2XI9A 3PO5A 5DG8A 2WFAA 5ALIA 3KZXA 5KFEA 3SI8A 4M9LA 3KHLA 1BNOA 2F8KA 3LDAA 3SMVA 1FIQA 4P4OA 5EWFA 3K1RB 1MSWD 5JTIA 2B0CA 1LV5A 3PX0A 3RR7A 3SV3A 1TV9A 3F5EA 3JPTA 4JMUA 3AL0B 2J6UA 2W9CB 1B0XA 1IG6A 1QLNA 4RPZA 3IN5A 4TQSA 5EWGA 3Q8MA 3RBDA 4KN4A 5KG6A 4BGDA 4WJ3B 1NK5A 4EELA 3HILA 2P6RA 5TZVA 1ZQBA 2QARA 3QUTA 3PMNA 1U49A 4DFPA 5GTIU 4ZH4A 3MGVA 1MQ3A 3V7JA 2HDOA 4M6WA 1XSNA 3T5LA 4Z6DA 1T4GA 5KFLA 1ZJNA 2HBLA 4C8MA 4NLNA 3H4BA 3IV6A 3ISBA 1UT8A 1OXJA 1CEZA 2XY7A 1TVAA 3NTUA 3C2KA 4RT2A 2ZIWA 5KG3A 3E0FA 2W9AA 5BOLA 3MBYA 2HVHA 4LVSA 1O08A 1HUZA 9ICRA 2GOLA 4A8EA 1S97A 4DQRA 1TKDA 2ASDA 1ZQKA 5DB7A 2LM1A 4OJOA 2LYBA 3H0RB 5L1IA 1PK3A 4DL3A 1XSLA 4YR2A 3ZDCA 3MFHA 7ICLA 3B0XA 4UQGA 1QQ6A 3EW9A 1ZYQA 1MN8A 3CW2C 2R8GA 4KMUA 2OH2A 4QJFB 4BXOA 3VC8A 1Z1BA 3K4GA 2B6GA 4KLSA 3RRHA 4GFJA 1KN5A 2W55A 4YP3A 4Q44A 4NL9C 3F2CA 2PMZF 5KFNA 3WKCA 4ECXA 5JUMA 4IQWA 4DLGA 8ICXA 5J0PA 2ZIXB 1KQQA 2FLNA 4ZOHC 1KW4A 1ZQMA 3QEBZ 1COOA 2WAQC 2KICA 1VJ5A 2NV3A 3DV9A 2XCAA 3M9NB 1L5UA 5KT6A 2OEHA 4ACOA 4PJ0U 5C0YA 4PL2A 3C2LA 5KAFU 1L3UA 4CCHA 2EAOA 4DSIA 4RNMA 1ZQVA 4O5EA 1SL2A 3AQEA 4UW9A 1UPHA 2EQYA 2F2AB 3TANA 2XCPA 2I1QA 9ICKA 2FPKA 4I2GA 4YG2A 2HI0A 5J8YA 4QZFA 1S77D 4Z6CA 2W9BA 5AK3A 4NLCA 3TADC 2BPGA 2FJ6A 4I2DA 3C28A 8ICBA 1Q46A 4GC7A 2DUYA 4PZNA 3SAHA 4J9MA 5AI8A 4EBEA 1O03A 1MA7A 4DOCA 5L9XA 3RRGA 4KLIA 4ECYA 1QSYA 1S0OA 5J2CA 4J9QA 2KIVA 5KNIA 3KKAA 2MSNA 3SQIA 2MAXA 2F77X 1ZQWA 3TKAA 4G9BA 4DL2A 3QUQA 4PGXA 2BQRA 1L8LA 5EE9A 4US8A 3QZ7A 4DL4A 5FP0A 2LM4A 2MUTA 4R66A 1JXLA 4PZOA 1XU4A 3BQ0A 1X9MA 4ED1A 4QZDA 5J2GA 2RDIA 2NRZA 3C23A 2JRZA 3NVZA 4AYBF 1XWLA 1QTMA 4QWBA 1ZJMA 1SV0A 2D6FC 4DSLA 2VJ4A 4YN4A 5ALGA 1KDHA 1D8LA 2KSOA 5KFQA 3D2QA 2AU0A 4PHPA 2MA1A 4IS7A 5DBCA 3GQCA 5J29A 2I9GA 4ECSA 4P4PA 4QWDA 1X40A 2N1RA 1JROA 5AI6A 5HR6A 4B9VA 5CR0A 1AQ6A 2ATLA 5ALHA 5KFDA 2XVTA 2ZTDA 2IBKA 1PK1A 3NGDA 2M0NA 2PFNA 5IINA 1IIPA 2VA3A 8ICKA 2KV2A 2QKQA 1SV0C 2UVRA 1TK5A 4U6PA 3ZDDA 3KOOA 3EUB2 3LK9A 4NXZA 5AM0A 1LKYA 2E8NA 2HBMA 5J2EA 3T5KA 4F5NA 3SR6A 2FMQA 1L7MA 3GV7B 3RJKA 2WF7A 4I2CA 2EAPA 8ICNA 4M04A 4NLZA 3PSIA 3D6JA 1ZQCA 1FO4A 1N48A 5TISU 7ICKA 4K4IA 3AN1A 2DF4B 2E1EA 1N56A 2K8BB 1N62A 4F2RA 4Y2TA 3OSNA 4Z6EA 4DSFA 8ICOA 4TUSA 4JUZA 4ED0A 1RG6A 1A6SA 5J0TA 1CUKA 4YR3A 4O3NA 5DB8A 2E1FA 4Q43A 4M2YA 8ICCA 4F5RA 4ELVA 1ZQIA 5B66U 5HHIA 4CE6A 3H8WA 2A1AA 3J81j 2G06A 3V6JA 5L1LA 4QZ9A 2Y0SF 4F5PA 2BPCA 3BS5B 8ICIA 4F5QA 1D8YA 2MRLA 2HCFA 3R9KA 2YQEA 2NYVA 1S0NA 2JXJA 4EENA 3EZ5A 4IRDA 3PZPA 3GILA 4MF2A 4QWCA 4J03A 3GIJA 2UVVA 5KFYA 4UAVA 2ZIUB 4B9LA 2ZIVA 4IC9A 3PVXA 1ZD2P 1P7DA 4IR1A 1NOMA 5AKGA 4ECQA 2R8KA 2FMPA 2GWSA 1ZQUA 1QSSA 2AJQA 2VA2A 5CWRA 3BJYA 1SIJA 1SWWA 2D8CA 1GO3F 3TAPA 5CA7A 4OJ6A 3RB0A 3C2MA 2JGAA 2C2DA 4JV2A 2W9MA 4YR0A 8ICHA 4F72A 5C5JA 4UARA 5G5HA 2KZZA 3OHBA 2HW3A 1TK0A 2E8PA 2W3RA 3ZDEA 2OHFA 2E8OA 1BPDA 5H2FU 5J0YA 1TK8A 5KL1B 2ISOA 2KFZA 3NS1A 1S0MA 2WF8A 4GXJA 4KLUA 3T5JA 4R8UA 4RNOA 4NM1A 3SZ2A 9ICVA 1Z4OA 1T3QA 2K4PA 5DBBA 4Y2XA 3Q8PB 1KSPA 3QU9A 3JPNA 4KLLA 3EWAA 1IV8A 3CRXA 5AKEA 9ICTA 2EZYA 1JMSA 3D2SA 2AGQA 2F3NA 4C8OA 4DFMA 1ZQDA 4KLDA 1AROP 2RP5A 3IDWA 3KHRA 2KJ5A 5D49A 5AI0A 4KLJA 2FLLA 3SAFA 4I27A 3BQ2A 1B22A 1ECWA 4P0QA 5J0UA 3GFKB 4NV0A 2Y9TA 1H38A 2IHMA 4FFDA 9ICPA 2YN4A 2IOFA 1N63A 2KD1A 4QZEA 2WB1F 2HHQA 3ISDA 7ICOA 1Z00B 2KVSA 1NI3A 2KIWA 4YFKA 2KZMA 4IRKA 1S8OA 1NK9A 4KLGA 3UM9A 1V85A 1T7PA 4RU9A 3DDHA 1YZ6A 3MFIA 4O5CA 3MGHA 4CF4A 2PKEA 1VDVA 1UQVA 1ZRMA 3PR5B 3Q8LA 3N4MB 4QWEA 3HX0A 1FFUA 1ZQYA 2H3ZA 2YY6A 1NK6A 2DKZA 5AK4A 1FFVA 3HWTA 3PW5A 3ETRA 3Q8KA 4RUCA 1U9LA 1WG8A 1F44A 4RNNA 1XO0A 2FLPA 1L7NA 3WK9A 3QX7A 4DF4A 1ZQTA 2ESEA 3AU6A 4IQVA 4Y2SA 3UPQA 2W7PA 3DEEA 3EPIA 1SWVA 2C22A 4DS4A 3RH5A 4QZGA 3OPXA 4C7ZA 3L3FX 4UASA 4DS5A 1KFDA 7ICPA 3PW0A 5KT7A 3PSTA 4FS2A 1BGXT 4YXMA 1UT5A 4O3MA 3GU3A 4IQUA 2EDUA 3LVWA 2NRXA 4P2HA 4KN7A 1ED1A 2I6XA 2IOFK 9ICLA 2HOIA 5KFFA 2BDPA 1U4BA 1HJPA 1T8EA 5IILA 8ICSA 4KX5A 2BQ3A 5AK5A
chains in the Genus database with same CATH topology
2KIVA 5KNIA 3KKAA 1PK3A 3BS7A 1DXSA 2EAPA 1SXDA 2Y9UA 4NL9A 2D3DA 1V85A 2DL0A 2JV3A 4MHVA 3BQ7A 1F0MA 2KMDA 1LKYB 3SENA 1Z1VA 5F3XB 2B6GA 4RQMA 4PZOA 2F8KA 2E8PA 3KKAC 1UQVA 2E8OA 3K1RB 3BS5A 5JTIA 1B4FA 1RG6A 4NL9C 2QB0A 2DKXA 2DKZA 1SV0A 5L1MA 1B0XA 2K4PA 2EANA 1KW4A 1SXEA 2FE9A 2KSOA 1SV4A 2QB1A 4RQNA 4IS7A 1V38A 3BS5B 2ESEA 4NJ8A 1X40A 3HILA 2QARA 3SEIA 1X66A 2KE7A 2QB0B 2EAOA 5JU5A 2F3NA 2LPEA 5JRTA 3TACB 1WWUA 3TADA 3IDWA 1WWVA 1PK1A 2KSOB 2ES6A 1OW5A 1SGGA 1OXJA 5J8YA 1JI7A 2GLEA 2QARB 1UCVA 2K60A 2QKQA 2EAMA 1SV0C 3TADC 2L5YA 2KG5A 2Y9TA 3H8MA 1LKYA 4PZNA 2E8NA 1COKA 1X9XA 5J8YC 1PK1B 2D8CA 2LMRA 2F44A 2YTUA 2E8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIV A;  5KNI A;  3KKA A;  1PK3 A;  3BS7 A;  1DXS A;  2EAP A;  1SXD A;  2Y9U A;  4NL9 A;  2D3D A;  1V85 A;  2DL0 A;  2JV3 A;  4MHV A;  3BQ7 A;  1F0M A;  2KMD A;  1LKY B;  3SEN A;  1Z1V A;  5F3X B;  2B6G A;  4RQM A;  4PZO A;  2F8K A;  2E8P A;  3KKA C;  1UQV A;  2E8O A;  3K1R B;  3BS5 A;  5JTI A;  1B4F A;  1RG6 A;  4NL9 C;  2QB0 A;  2DKX A;  2DKZ A;  1SV0 A;  5L1M A;  1B0X A;  2K4P A;  2EAN A;  1KW4 A;  1SXE A;  2FE9 A;  2KSO A;  1SV4 A;  2QB1 A;  4RQN A;  4IS7 A;  1V38 A;  3BS5 B;  2ESE A;  4NJ8 A;  1X40 A;  3HIL A;  2QAR A;  3SEI A;  1X66 A;  2KE7 A;  2QB0 B;  2EAO A;  5JU5 A;  2F3N A;  2LPE A;  5JRT A;  3TAC B;  1WWU A;  3TAD A;  3IDW A;  1WWV A;  1PK1 A;  2KSO B;  2ES6 A;  1OW5 A;  1SGG A;  1OXJ A;  5J8Y A;  1JI7 A;  2GLE A;  2QAR B;  1UCV A;  2K60 A;  2QKQ A;  2EAM A;  1SV0 C;  3TAD C;  2L5Y A;  2KG5 A;  2Y9T A;  3H8M A;  1LKY A;  4PZN A;  2E8N A;  1COK A;  1X9X A;  5J8Y C;  1PK1 B;  2D8C A;  2LMR A;  2F44 A;  2YTU A;  2E8M A; 
#chains in the Genus database with same CATH topology
 2HHW A;  4P0P B;  2W8L A;  2KJ9 A;  3AU2 A;  5ALE A;  2V4R A;  3KZI U;  4QIW F;  4JK1 A;  3JPQ A;  1JX4 A;  2HSZ A;  3BDP A;  1SB3 C;  4NL9 A;  2ZJ5 A;  2W9C A;  1F0M A;  3KHH A;  5J0S A;  2I5H A;  2KMD A;  3SEN A;  3CYM A;  5KG2 A;  5KFZ A;  2K4E A;  3JPS A;  5J2A A;  1WCL A;  1Y88 A;  1NZB A;  8ICG A;  1ZQF A;  4GIB A;  5DG7 A;  2LKY A;  3N7P D;  3PV8 A;  7ICI A;  4RPY A;  4G3I A;  3KD3 A;  3SYZ A;  3OSP A;  2WF6 A;  4YMM A;  2RDJ A;  5IIM A;  5J2D A;  9ICO A;  1J2N A;  3LWL A;  1XSP A;  4F93 B;  3MDC A;  4QZB A;  2R18 A;  1Z3E B;  2QB1 A;  2W04 A;  3TFR A;  3TI0 A;  2BDU A;  2ZJA A;  5J0O A;  1CRX A;  4B9S A;  5IIK A;  5EOZ A;  2QB0 B;  2ZUC A;  1WYG A;  4Q8F A;  4DOA A;  4UB1 A;  1Q3U A;  2BCS A;  1DK3 A;  4TUQ A;  4RQ2 A;  3TAD A;  2DPI A;  4JWM A;  1ZD5 A;  1K1Q A;  3MC1 A;  2HHV A;  3C21 A;  4LZG A;  4C8N A;  3B0Y A;  3C5F A;  3AQF A;  4CF3 A;  4C4T A;  5BPC A;  3THV A;  1OUQ A;  7ICH A;  2XY5 A;  2OCE A;  5GTH U;  1M6Y A;  2KVC A;  4M0A A;  9ICQ A;  2K8C B;  3PNC A;  1ZQL A;  2BPF A;  5EE0 A;  1KTQ A;  2KFN A;  2VA8 A;  2KNJ A;  5KFI A;  1COK A;  2EZZ A;  2ALZ A;  4J9P A;  3OJS A;  4HAI A;  1SZP A;  3HT3 A;  3GIM A;  9ICE A;  1L3S A;  4DL5 A;  3IRU A;  1NJX A;  2A19 A;  3HKZ C;  4PHE A;  2DQN B;  4KMO B;  5J2B A;  1J97 A;  1L3T A;  2ZIX A;  5DDY A;  4QZA A;  8ICQ A;  3H0M B;  2BCU A;  5KFA A;  3RJF A;  4ED2 A;  4J9L A;  2ZXI A;  4I29 A;  2C2R A;  5KG5 A;  3UXO A;  1K5O A;  2G09 A;  4UAZ A;  1D9D A;  4EBD A;  4CRX A;  2DKX A;  5ALJ A;  2HVI A;  4NY8 A;  1U47 A;  2Y1J A;  2YX8 A;  4UBC A;  1HUO A;  2ISP A;  3KBB A;  5KG7 A;  4QZH A;  1KBU A;  4O3P A;  4F4Y A;  4RQN A;  3A0H U;  3M7D A;  8ICT A;  3SV4 A;  5ALP A;  3UMB A;  3MR2 A;  1QSL A;  5KFH A;  2PI5 A;  3IM1 A;  4F4Z A;  3RJI A;  4UAU A;  4CF5 A;  4KTQ A;  2KN7 A;  4ED8 A;  1NZP A;  1WWU A;  4DFJ A;  1ZQZ A;  4US9 A;  4F5O A;  5HP4 A;  2UVW A;  1SGG A;  2A1J B;  1JAL A;  3NUQ A;  4IQT A;  5ALY A;  4LZD A;  2NRT A;  2Y0S C;  3O0F A;  3D2N A;  3FYH A;  3NRZ A;  5DB6 A;  2WAQ F;  9ICU A;  5J2H A;  4QZC A;  4MFF A;  4HYK A;  3MR3 A;  4TUR A;  2JH1 A;  5KG0 A;  5KFR A;  2PXI A;  3QZ8 A;  4RUA A;  4EBC A;  2ZTE A;  5ALM A;  2F44 A;  3F2D A;  3GV8 B;  2NO5 A;  1U45 A;  2W43 A;  1L8O A;  2XC9 A;  4F92 B;  2HOF A;  1Q3V A;  9ICG A;  2BGW A;  3Q8R B;  3WK8 A;  4LJX A;  4B9N A;  3BQ7 A;  1A76 A;  3M6K A;  4UAW A;  3WKE A;  4CGZ A;  1IM4 A;  3K1Z A;  4RT3 A;  5HR7 A;  3QU5 A;  4RQM A;  4NM2 A;  2K4H A;  2G0A A;  3PSF A;  3V7K A;  1X42 A;  2M9N A;  4TUP A;  2BKE A;  3I1Y A;  2BHN A;  2ODG A;  4NWI A;  2O6K A;  9ICA A;  2NRV A;  3ORY A;  1YZ7 A;  1NNL A;  5EE3 A;  4Y2V A;  3RB4 A;  3V72 A;  3JPR A;  4CDG A;  4U7C A;  1SXE A;  5B5E U;  1RXV A;  3V6H A;  5KFT A;  2AQ4 A;  2RHF A;  1BPY A;  2KE7 A;  4QZI A;  5JU5 A;  2K4I A;  4IRC A;  4C8K A;  4DQS A;  2H3Q A;  1A0P A;  2YB4 A;  3F53 A;  3L4P A;  4DSE A;  4KLH A;  2XO7 A;  4ED6 A;  3HRD D;  5KFV A;  2ZXH A;  4J9N A;  2K89 A;  3LWM A;  5DQH A;  4GXI A;  3BZC A;  9ICS A;  2KHV A;  1RXW A;  2RRD A;  1SL0 A;  2H3F A;  4ECV A;  4ECT A;  1WUD A;  2FPL A;  2RLT A;  1TAQ A;  3PW7 A;  2IA6 A;  2BR0 A;  2P35 A;  3I28 A;  3RAQ A;  3NVW A;  3RB6 A;  3C29 A;  5CB1 A;  5AM2 A;  5ALK A;  1XC9 A;  2FDR A;  1L6N A;  5CRX A;  3UMG A;  2V4Q A;  3U26 A;  1NK4 A;  5AI5 A;  4K4H A;  5IIJ A;  5BOM A;  2H3I A;  5HML A;  2HHT A;  4MEY A;  5ALV A;  4RZR A;  3ZD8 A;  4R64 A;  9ICB A;  1RQL A;  3ONN A;  5HMM A;  5J0R A;  2YMP A;  1SZH A;  5AKL A;  9ICM A;  1U48 A;  1KFS A;  2JHD A;  2JZB B;  3BS5 A;  3UQ0 A;  2YMM A;  1N5X A;  4O9M A;  4R65 A;  3QU4 A;  2LI6 A;  3WK7 A;  4DO9 A;  4KLF A;  4ICA A;  4FS1 A;  2DFL A;  2EH9 A;  2BCQ A;  2R8J A;  2JEF A;  5AKH A;  4YMN A;  2ZJ8 A;  1HIW A;  1XNS A;  1ZQ1 C;  2Y1I A;  4NJ8 A;  4E0D A;  2ZIU A;  2G08 A;  4M9J A;  1KKX A;  2ZG6 A;  4F50 A;  2JMG A;  4Y2J A;  4IR9 A;  1XO1 A;  3SAG A;  8ICP A;  1L7O A;  1PUZ A;  2VJ5 A;  3IG5 A;  4FZM A;  1PZN A;  3VCB A;  4YQW A;  2W7O A;  2IHN A;  3GV5 B;  2ES6 A;  1PVR A;  5AK6 A;  4M9G A;  5KT3 A;  3FAH A;  4QNL A;  2E5S A;  1DGS A;  4C8L A;  2DGZ A;  4Z6F A;  7ICG A;  2IOH A;  3H40 A;  7ICE A;  1QH9 A;  2XID A;  2KG5 A;  4DQQ A;  4UAT A;  3BZK A;  1UHU A;  4J9K A;  3C1Y A;  1S0V A;  4ECZ A;  3BS7 A;  3WKA A;  1IXR A;  2KKP A;  3GZF A;  1TAU A;  1V9P A;  3WK5 A;  4Y2Y A;  5KFO A;  4PH5 A;  4XQ8 A;  3WK4 A;  3RJH A;  4QWA A;  4M47 A;  2OM6 A;  4UB6 U;  2R8I A;  3ZDB A;  2Z7J A;  3QUC A;  3H0L B;  5AKX A;  2KKV A;  1URJ A;  2CN1 A;  5DQG A;  1KL9 A;  3H7I A;  1X9S A;  3M8S A;  8ICA A;  2AGP A;  3RTV A;  2FE9 A;  1BPX A;  3RR8 A;  4QIW C;  3G6X A;  5ALW A;  3QYP A;  2KP7 A;  2AQ0 A;  2YML A;  4QW8 A;  3ZI4 A;  1RDF A;  8ICZ A;  3OJU A;  4Y2P A;  5AI9 A;  3WU2 U;  3UXP A;  2P66 A;  4DL7 A;  1JN3 A;  4BDP A;  1RM6 C;  5JRT A;  1BVS A;  3TAC B;  5ALX A;  2PI4 A;  7ICF A;  3HJE A;  4FBU A;  2EZX A;  4PHA A;  1X6I A;  1OW5 A;  2BCR A;  4UB5 A;  4BJQ A;  4DQP A;  4J9O A;  2QAR B;  1NKB A;  3N28 A;  1Z00 A;  2K60 A;  4C4R A;  2OYY A;  2HHX A;  4M6W B;  1RYS A;  4UB3 A;  3EPG A;  3AMZ A;  2PMZ C;  3IHQ B;  3CP8 A;  5ALS A;  9ICJ A;  2G5I B;  4KLQ A;  2HOQ A;  3NRW A;  3I76 A;  1ZRN A;  2LMR A;  3MAB A;  2YTU A;  4RQ1 A;  4MF8 A;  4EYH B;  1T3N A;  3NVY A;  5DQI A;  2ZIW B;  4BWJ A;  2VIX A;  2RQ5 A;  2ZUB A;  4JB3 A;  4UB2 A;  4EYI B;  5ALQ A;  4O0I A;  5J2J A;  2KZ3 A;  2NO4 A;  4AP9 A;  5AKZ A;  5DBA A;  3V7L A;  5CP2 A;  3T5H A;  1D9F A;  9ICI A;  4F4W A;  1K1S A;  3OHA A;  3KHG A;  4PHD A;  2XY6 A;  1VLB A;  3N7S C;  4O3R A;  7ICV A;  3GIK A;  3AUO A;  4CNQ A;  5KG1 A;  1X6J A;  5AKI A;  2LYH A;  5K4L A;  4I2E A;  7ICU A;  5CHG A;  1YT3 A;  2F1H A;  5L1M A;  4B9U A;  4BXO B;  5DDM A;  4B6J A;  2PFP A;  2DBY A;  3RF9 A;  4PPX A;  5KFK A;  5AKK A;  5ALO A;  3A0B U;  4ELT A;  4XRH A;  3M9M B;  3PO4 A;  2HMX A;  4B9T A;  3GII A;  1KLN A;  4DLE A;  2NRW A;  3M6Z A;  4B9M A;  3N7R C;  2CXY A;  3BQ1 A;  3LVV A;  2WHE A;  1C20 A;  4UB8 U;  5KFC A;  4BUG A;  1ZQS A;  2JR5 A;  9ICF A;  2MU2 A;  4UAY A;  3QU2 A;  4P0P A;  3EYZ A;  3H8S A;  3FDS A;  4EEY A;  4DF8 A;  1ZQH A;  3QEA Z;  1BNP A;  4RQ8 A;  4EZ6 A;  3KTQ A;  1LVH A;  4Q45 A;  5ALU A;  2BCV A;  2PFQ A;  3H8M A;  8ICF A;  4O3O A;  4AYB C;  1EXN A;  2BQU A;  2IMW P;  3G6Y A;  4RQ7 A;  2G07 A;  1NK7 A;  4GLX A;  2WF5 A;  4P4M A;  2F1I A;  4KLE A;  2JH7 A;  2AH5 A;  4KLM A;  3WK6 A;  5KT4 A;  1MC8 A;  3SD7 A;  2W9B B;  2OXO A;  2Y9U A;  2DL0 A;  4USA A;  5G5G A;  5IIO A;  3MR6 A;  5KFW A;  4C0Z A;  2R8H A;  1Z1V A;  3GDX A;  1BPE A;  3QXG A;  4DSK A;  1NJY A;  5ALF A;  5KTQ A;  4KIT B;  4QW9 A;  1ZQO A;  5AKY A;  4OJP A;  2CPR A;  2QB0 A;  2LHT A;  1HEK A;  4EX7 A;  4TQR A;  4UB4 A;  4OD0 A;  4YCX A;  2LYA A;  1ZQA A;  3PSP A;  5ALZ A;  4F2S A;  5D4B A;  2EAN A;  1ZQQ A;  4MFA A;  1CI4 A;  2MUT B;  4RQ0 A;  4KX3 A;  4C4S A;  4ECR A;  2DWQ A;  2CRX A;  1V38 A;  3PML A;  2ASL A;  2J6S A;  5J2I A;  2KHQ A;  3ISC A;  4M9H A;  1PVQ A;  5F9N A;  3SEI A;  5DLF A;  2B21 A;  1TE2 A;  3HPO A;  5ALN A;  3IP4 B;  4EX6 A;  1N60 A;  2F76 X;  4RQ3 A;  3T3F A;  1N2X A;  4KLT A;  5EE1 A;  8ICW A;  1ZD4 A;  5CEH A;  3RJE A;  2ZUD A;  3TAQ A;  2KSO B;  7ICR A;  1J2M A;  5CJ7 A;  4J9R A;  3HP6 A;  1JI7 A;  1L7P A;  4F8R A;  5AHX A;  3RJG A;  3H4D A;  1UCV A;  3OTQ A;  4RQ4 A;  4MEX A;  1NK0 A;  3CNH A;  3C1Z A;  3N97 B;  1DOQ A;  2KEY A;  5AM5 A;  1PVP A;  2PFO A;  3FC4 A;  4IL6 U;  5J8Y C;  1PK1 B;  1N61 A;  3NAS A;  2A3V A;  5AIB A;  4YVZ A;  3G6V A;  4I2B A;  2GO7 A;  2WTF A;  3T79 A;  2E8M A;  1KEJ A;  3MDA A;  1X9W A;  5A0L A;  3OGU A;  3IG8 A;  4JV0 A;  3L5K A;  4DQI A;  2D3D A;  3MR5 A;  4MHV A;  3F2B A;  2F1J A;  1DRG A;  1NJW A;  3E2E A;  1LKY B;  4EZ9 A;  5KFX A;  2OWO A;  3ALR A;  5F3X B;  4YD1 A;  3PX4 A;  3S6J A;  4O3Q A;  4OJ5 A;  5KFU A;  4X5V A;  3KKA C;  4QZ8 A;  1QCK A;  5KFJ A;  3AM9 A;  1LB2 B;  1F5S A;  1N5W A;  5J0Q A;  2JEI A;  4OCZ A;  4RQ5 A;  5L1J A;  4C7Y A;  3NVV A;  1RPL A;  4JV1 A;  1ZXI A;  1BPZ A;  3BQT A;  2FMS A;  2JEG A;  4DOB A;  2LBO A;  1RZT A;  3HKZ F;  4PGQ A;  4NLK A;  5KG4 A;  2C28 A;  2A1J A;  3Q8Q B;  1ZQJ A;  4ED3 A;  2YMQ A;  1D8B A;  1TAM A;  3E58 A;  8ICR A;  5J0X A;  8ICV A;  1NJZ A;  3PY8 A;  2AHO B;  8ICJ A;  1QQ7 A;  4MFC A;  5KL8 B;  2ASJ A;  1RQN A;  7ICJ A;  5L1K A;  1ZQN A;  1ZQR A;  1WWV A;  2HBK A;  5KFS A;  2DPJ A;  5ALD A;  8ICY A;  4M9N A;  1RYU A;  4F3O A;  2GLE A;  2V9W A;  4O5K A;  3UXN A;  3QE9 Y;  2P6U A;  5KFP A;  8ICM A;  4DSJ A;  2KTQ A;  1KFT A;  1MQ2 A;  7ICS A;  2FI1 A;  3HW8 A;  4KLO A;  3JPO A;  2KOB A;  2WF9 A;  3ZDA A;  4ELU A;  3PX6 A;  5DGB A;  1ZQG A;  3ED5 A;  4BX9 C;  4RPX A;  1ZQX A;  1QQ5 A;  5DG9 A;  4YMO A;  4F91 B;  4YD2 A;  3LYS A;  1S76 D;  3UMC A;  2ZIV B;  4DFD A;  2FPM A;  3F5A A;  1ZQE A;  2C2E A;  2JV3 A;  1Z4N A;  5KFB A;  7ICM A;  1BPB A;  2W54 A;  1V97 A;  4NLB A;  3V6K A;  5AM1 A;  5KFM A;  3JPP A;  2QLT A;  4RQ6 A;  5AM4 A;  3PW4 A;  5F9L A;  4DL6 A;  4DWI A;  4O3S A;  1B43 A;  3QNM A;  1RYR A;  5DB9 A;  1NKE A;  2XGQ A;  3M1Y A;  2XIC A;  4F71 A;  1JXE A;  1X2I A;  2GH1 A;  1SKW A;  4NLG A;  2HHU A;  4DEZ A;  5AM3 A;  3RBE A;  2W03 A;  4I2H A;  2VAN A;  1SV4 A;  3M9O B;  5HNK A;  3RAX A;  4XUS A;  5AIC A;  4C80 A;  3RFA A;  1S9F A;  3WKD A;  4UBB A;  3QUB A;  2AGO A;  1X66 A;  4ECU A;  5E79 U;  1S5L U;  1ZD3 A;  1T94 A;  7ICT A;  2KK0 A;  4R8U B;  4FE3 A;  4I28 A;  2H5X A;  5D46 A;  1TFR A;  2WB1 C;  9ICX A;  1Z19 A;  5KT5 A;  3PW2 A;  5EWE A;  4YXJ A;  3FM9 A;  4OJL A;  4PL1 A;  2HBJ A;  4FZN A;  3M8R A;  3RH4 A;  1UA1 A;  3RJJ A;  1L3V A;  3C5G A;  5ALT A;  5ALR A;  2AXT U;  2H3V A;  1A77 A;  1NK8 A;  4F4X A;  1JIH A;  1X9X A;  4BWM A;  4DCC A;  1XS9 D;  3RB3 A;  2JZB A;  5J0W A;  1ZOL A;  4J9S A;  1SKR A;  1DGJ A;  2VKQ A;  3ZD9 A;  2W3S A;  4F4K A;  5III A;  8ICL A;  8ICU A;  4I2F A;  2J6T A;  1SXD A;  4P0Q B;  1ZQP A;  3UQ2 A;  5DLG A;  4GXK A;  2XGP A;  1ZET A;  5HHH A;  3AEV A;  4DFK A;  3TAR A;  1Q8K A;  1SL1 A;  2K8A A;  1B4F A;  5KFG A;  4Y2U A;  9ICN A;  9ICC A;  4ED7 A;  2HHS A;  4OO1 J;  2W11 A;  2E3T A;  5DGA A;  3WKB A;  3K75 D;  3TQ1 A;  1JRP A;  4EEK A;  5AI4 A;  4Q8E A;  3KFU F;  1S10 A;  3QU7 A;  4FBT A;  4XA5 A;  5J2K A;  5KAI U;  4GC6 A;  1C7Y A;  2YB1 A;  2F8L A;  2BZF A;  2LPE A;  4ECW A;  3TFS A;  4K4G A;  1SKS A;  8ICE A;  4PGY A;  4I2I A;  2W8K A;  3H8J A;  2JEJ A;  5T14 A;  9ICW A;  4FO6 A;  7ICQ A;  4JWN A;  2Q0Z X;  1JUD A;  2UVU A;  4I2J A;  5AIA A;  2EAM A;  1FEZ A;  4FZL A;  3ICX A;  3Q8S B;  2KJ8 A;  9ICH A;  2G5H B;  2L5Y A;  1NKC A;  1WCN A;  1UA0 A;  4R63 A;  4Y2Q A;  5KT2 A;  3B9J A;  5DKW A;  4Y2R A;  7ICN A;  3ETL A;  2ZTC A;  3PR4 A;  5AKJ A;  1DXS A;  1KRP A;  3RH6 A;  1DK2 A;  4I2A A;  5ALL A;  2Q4T A;  5J2F A;  3MGI A;  2XI9 A;  3PO5 A;  5DG8 A;  2WFA A;  5ALI A;  3KZX A;  5KFE A;  3SI8 A;  4M9L A;  3KHL A;  1BNO A;  2F8K A;  3LDA A;  3SMV A;  1FIQ A;  4P4O A;  5EWF A;  3K1R B;  1MSW D;  5JTI A;  2B0C A;  1LV5 A;  3PX0 A;  3RR7 A;  3SV3 A;  1TV9 A;  3F5E A;  3JPT A;  4JMU A;  3AL0 B;  2J6U A;  2W9C B;  1B0X A;  1IG6 A;  1QLN A;  4RPZ A;  3IN5 A;  4TQS A;  5EWG A;  3Q8M A;  3RBD A;  4KN4 A;  5KG6 A;  4BGD A;  4WJ3 B;  1NK5 A;  4EEL A;  3HIL A;  2P6R A;  5TZV A;  1ZQB A;  2QAR A;  3QUT A;  3PMN A;  1U49 A;  4DFP A;  5GTI U;  4ZH4 A;  3MGV A;  1MQ3 A;  3V7J A;  2HDO A;  4M6W A;  1XSN A;  3T5L A;  4Z6D A;  1T4G A;  5KFL A;  1ZJN A;  2HBL A;  4C8M A;  4NLN A;  3H4B A;  3IV6 A;  3ISB A;  1UT8 A;  1OXJ A;  1CEZ A;  2XY7 A;  1TVA A;  3NTU A;  3C2K A;  4RT2 A;  2ZIW A;  5KG3 A;  3E0F A;  2W9A A;  5BOL A;  3MBY A;  2HVH A;  4LVS A;  1O08 A;  1HUZ A;  9ICR A;  2GOL A;  4A8E A;  1S97 A;  4DQR A;  1TKD A;  2ASD A;  1ZQK A;  5DB7 A;  2LM1 A;  4OJO A;  2LYB A;  3H0R B;  5L1I A;  1PK3 A;  4DL3 A;  1XSL A;  4YR2 A;  3ZDC A;  3MFH A;  7ICL A;  3B0X A;  4UQG A;  1QQ6 A;  3EW9 A;  1ZYQ A;  1MN8 A;  3CW2 C;  2R8G A;  4KMU A;  2OH2 A;  4QJF B;  4BXO A;  3VC8 A;  1Z1B A;  3K4G A;  2B6G A;  4KLS A;  3RRH A;  4GFJ A;  1KN5 A;  2W55 A;  4YP3 A;  4Q44 A;  4NL9 C;  3F2C A;  2PMZ F;  5KFN A;  3WKC A;  4ECX A;  5JUM A;  4IQW A;  4DLG A;  8ICX A;  5J0P A;  2ZIX B;  1KQQ A;  2FLN A;  4ZOH C;  1KW4 A;  1ZQM A;  3QEB Z;  1COO A;  2WAQ C;  2KIC A;  1VJ5 A;  2NV3 A;  3DV9 A;  2XCA A;  3M9N B;  1L5U A;  5KT6 A;  2OEH A;  4ACO A;  4PJ0 U;  5C0Y A;  4PL2 A;  3C2L A;  5KAF U;  1L3U A;  4CCH A;  2EAO A;  4DSI A;  4RNM A;  1ZQV A;  4O5E A;  1SL2 A;  3AQE A;  4UW9 A;  1UPH A;  2EQY A;  2F2A B;  3TAN A;  2XCP A;  2I1Q A;  9ICK A;  2FPK A;  4I2G A;  4YG2 A;  2HI0 A;  5J8Y A;  4QZF A;  1S77 D;  4Z6C A;  2W9B A;  5AK3 A;  4NLC A;  3TAD C;  2BPG A;  2FJ6 A;  4I2D A;  3C28 A;  8ICB A;  1Q46 A;  4GC7 A;  2DUY A;  4PZN A;  3SAH A;  4J9M A;  5AI8 A;  4EBE A;  1O03 A;  1MA7 A;  4DOC A;  5L9X A;  3RRG A;  4KLI A;  4ECY A;  1QSY A;  1S0O A;  5J2C A;  4J9Q A;  2KIV A;  5KNI A;  3KKA A;  2MSN A;  3SQI A;  2MAX A;  2F77 X;  1ZQW A;  3TKA A;  4G9B A;  4DL2 A;  3QUQ A;  4PGX A;  2BQR A;  1L8L A;  5EE9 A;  4US8 A;  3QZ7 A;  4DL4 A;  5FP0 A;  2LM4 A;  2MUT A;  4R66 A;  1JXL A;  4PZO A;  1XU4 A;  3BQ0 A;  1X9M A;  4ED1 A;  4QZD A;  5J2G A;  2RDI A;  2NRZ A;  3C23 A;  2JRZ A;  3NVZ A;  4AYB F;  1XWL A;  1QTM A;  4QWB A;  1ZJM A;  1SV0 A;  2D6F C;  4DSL A;  2VJ4 A;  4YN4 A;  5ALG A;  1KDH A;  1D8L A;  2KSO A;  5KFQ A;  3D2Q A;  2AU0 A;  4PHP A;  2MA1 A;  4IS7 A;  5DBC A;  3GQC A;  5J29 A;  2I9G A;  4ECS A;  4P4P A;  4QWD A;  1X40 A;  2N1R A;  1JRO A;  5AI6 A;  5HR6 A;  4B9V A;  5CR0 A;  1AQ6 A;  2ATL A;  5ALH A;  5KFD A;  2XVT A;  2ZTD A;  2IBK A;  1PK1 A;  3NGD A;  2M0N A;  2PFN A;  5IIN A;  1IIP A;  2VA3 A;  8ICK A;  2KV2 A;  2QKQ A;  1SV0 C;  2UVR A;  1TK5 A;  4U6P A;  3ZDD A;  3KOO A;  3EUB 2;  3LK9 A;  4NXZ A;  5AM0 A;  1LKY A;  2E8N A;  2HBM A;  5J2E A;  3T5K A;  4F5N A;  3SR6 A;  2FMQ A;  1L7M A;  3GV7 B;  3RJK A;  2WF7 A;  4I2C A;  2EAP A;  8ICN A;  4M04 A;  4NLZ A;  3PSI A;  3D6J A;  1ZQC A;  1FO4 A;  1N48 A;  5TIS U;  7ICK A;  4K4I A;  3AN1 A;  2DF4 B;  2E1E A;  1N56 A;  2K8B B;  1N62 A;  4F2R A;  4Y2T A;  3OSN A;  4Z6E A;  4DSF A;  8ICO A;  4TUS A;  4JUZ A;  4ED0 A;  1RG6 A;  1A6S A;  5J0T A;  1CUK A;  4YR3 A;  4O3N A;  5DB8 A;  2E1F A;  4Q43 A;  4M2Y A;  8ICC A;  4F5R A;  4ELV A;  1ZQI A;  5B66 U;  5HHI A;  4CE6 A;  3H8W A;  2A1A A;  3J81 j;  2G06 A;  3V6J A;  5L1L A;  4QZ9 A;  2Y0S F;  4F5P A;  2BPC A;  3BS5 B;  8ICI A;  4F5Q A;  1D8Y A;  2MRL A;  2HCF A;  3R9K A;  2YQE A;  2NYV A;  1S0N A;  2JXJ A;  4EEN A;  3EZ5 A;  4IRD A;  3PZP A;  3GIL A;  4MF2 A;  4QWC A;  4J03 A;  3GIJ A;  2UVV A;  5KFY A;  4UAV A;  2ZIU B;  4B9L A;  2ZIV A;  4IC9 A;  3PVX A;  1ZD2 P;  1P7D A;  4IR1 A;  1NOM A;  5AKG A;  4ECQ A;  2R8K A;  2FMP A;  2GWS A;  1ZQU A;  1QSS A;  2AJQ A;  2VA2 A;  5CWR A;  3BJY A;  1SIJ A;  1SWW A;  2D8C A;  1GO3 F;  3TAP A;  5CA7 A;  4OJ6 A;  3RB0 A;  3C2M A;  2JGA A;  2C2D A;  4JV2 A;  2W9M A;  4YR0 A;  8ICH A;  4F72 A;  5C5J A;  4UAR A;  5G5H A;  2KZZ A;  3OHB A;  2HW3 A;  1TK0 A;  2E8P A;  2W3R A;  3ZDE A;  2OHF A;  2E8O A;  1BPD A;  5H2F U;  5J0Y A;  1TK8 A;  5KL1 B;  2ISO A;  2KFZ A;  3NS1 A;  1S0M A;  2WF8 A;  4GXJ A;  4KLU A;  3T5J A;  4R8U A;  4RNO A;  4NM1 A;  3SZ2 A;  9ICV A;  1Z4O A;  1T3Q A;  2K4P A;  5DBB A;  4Y2X A;  3Q8P B;  1KSP A;  3QU9 A;  3JPN A;  4KLL A;  3EWA A;  1IV8 A;  3CRX A;  5AKE A;  9ICT A;  2EZY A;  1JMS A;  3D2S A;  2AGQ A;  2F3N A;  4C8O A;  4DFM A;  1ZQD A;  4KLD A;  1ARO P;  2RP5 A;  3IDW A;  3KHR A;  2KJ5 A;  5D49 A;  5AI0 A;  4KLJ A;  2FLL A;  3SAF A;  4I27 A;  3BQ2 A;  1B22 A;  1ECW A;  4P0Q A;  5J0U A;  3GFK B;  4NV0 A;  2Y9T A;  1H38 A;  2IHM A;  4FFD A;  9ICP A;  2YN4 A;  2IOF A;  1N63 A;  2KD1 A;  4QZE A;  2WB1 F;  2HHQ A;  3ISD A;  7ICO A;  1Z00 B;  2KVS A;  1NI3 A;  2KIW A;  4YFK A;  2KZM A;  4IRK A;  1S8O A;  1NK9 A;  4KLG A;  3UM9 A;  1V85 A;  1T7P A;  4RU9 A;  3DDH A;  1YZ6 A;  3MFI A;  4O5C A;  3MGH A;  4CF4 A;  2PKE A;  1VDV A;  1UQV A;  1ZRM A;  3PR5 B;  3Q8L A;  3N4M B;  4QWE A;  3HX0 A;  1FFU A;  1ZQY A;  2H3Z A;  2YY6 A;  1NK6 A;  2DKZ A;  5AK4 A;  1FFV A;  3HWT A;  3PW5 A;  3ETR A;  3Q8K A;  4RUC A;  1U9L A;  1WG8 A;  1F44 A;  4RNN A;  1XO0 A;  2FLP A;  1L7N A;  3WK9 A;  3QX7 A;  4DF4 A;  1ZQT A;  2ESE A;  3AU6 A;  4IQV A;  4Y2S A;  3UPQ A;  2W7P A;  3DEE A;  3EPI A;  1SWV A;  2C22 A;  4DS4 A;  3RH5 A;  4QZG A;  3OPX A;  4C7Z A;  3L3F X;  4UAS A;  4DS5 A;  1KFD A;  7ICP A;  3PW0 A;  5KT7 A;  3PST A;  4FS2 A;  1BGX T;  4YXM A;  1UT5 A;  4O3M A;  3GU3 A;  4IQU A;  2EDU A;  3LVW A;  2NRX A;  4P2H A;  4KN7 A;  1ED1 A;  2I6X A;  2IOF K;  9ICL A;  2HOI A;  5KFF A;  2BDP A;  1U4B A;  1HJP A;  1T8E A;  5IIL A;  8ICS A;  4KX5 A;  2BQ3 A;  5AK5 A; 
#chains in the Genus database with same CATH homology
 2KIV A;  5KNI A;  3KKA A;  1PK3 A;  3BS7 A;  1DXS A;  2EAP A;  1SXD A;  2Y9U A;  4NL9 A;  2D3D A;  1V85 A;  2DL0 A;  2JV3 A;  4MHV A;  3BQ7 A;  1F0M A;  2KMD A;  1LKY B;  3SEN A;  1Z1V A;  5F3X B;  2B6G A;  4RQM A;  4PZO A;  2F8K A;  2E8P A;  3KKA C;  1UQV A;  2E8O A;  3K1R B;  3BS5 A;  5JTI A;  1B4F A;  1RG6 A;  4NL9 C;  2QB0 A;  2DKX A;  2DKZ A;  1SV0 A;  5L1M A;  1B0X A;  2K4P A;  2EAN A;  1KW4 A;  1SXE A;  2FE9 A;  2KSO A;  1SV4 A;  2QB1 A;  4RQN A;  4IS7 A;  1V38 A;  3BS5 B;  2ESE A;  4NJ8 A;  1X40 A;  3HIL A;  2QAR A;  3SEI A;  1X66 A;  2KE7 A;  2QB0 B;  2EAO A;  5JU5 A;  2F3N A;  2LPE A;  5JRT A;  3TAC B;  1WWU A;  3TAD A;  3IDW A;  1WWV A;  1PK1 A;  2KSO B;  2ES6 A;  1OW5 A;  1SGG A;  1OXJ A;  5J8Y A;  1JI7 A;  2GLE A;  2QAR B;  1UCV A;  2K60 A;  2QKQ A;  2EAM A;  1SV0 C;  3TAD C;  2L5Y A;  2KG5 A;  2Y9T A;  3H8M A;  1LKY A;  4PZN A;  2E8N A;  1COK A;  1X9X A;  5J8Y C;  1PK1 B;  2D8C A;  2LMR A;  2F44 A;  2YTU A;  2E8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...