1OW5A

Nmr structure of the saccharomyces cerevisiae sam (sterile alpha motif) domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
b'PFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase STE11
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title The solution structure of the S.cerevisiae Ste11 MAPKKK SAM domain and its partnership with Ste50.
pubmed doi rcsb
total genus 15
structure length 60
sequence length 60
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ow5A00
3BQ7A 4RQNA 3SEIA 5L1MA 2KSOA 2KG5A 1X66A 1SV0A 1SXEA 1COKA 3K1RB 2E8NA 5KNIA 2ESEA 2QKQA 1LKYA 1B0XA 2DL0A 5JTIA 2K60A 1V85A 1SV4A 1X40A 4RQMA 2Y9UA 2F44A 3BS5A 5J8YA 1DXSA 3KKAC 3TADA 2L5YA 2EAOA 1UCVA 1OW5A 2KE7A 2E8PA 1F0MA 2F3NA 5JU5A 2KSOB 4MHVA 1WWVA 2K4PA 2E8MA 2GLEA 2D3DA 2E8OA 3SENA 5JRTA 2B6GA 2F8KA 2QB0A 1V38A 1SXDA 2DKZA 1WWUA 4NJ8A 1SV0C 1KW4A 3TADC 2FE9A 3HILA 3KKAA 1UQVA 4PZNA 2DKXA 2JV3A 1X9XA 2KIVA 2QB0B 3IDWA 2D8CA 1JI7A 3H8MA 1B4FA 3BS5B 1SGGA 2QARA 4IS7A 1Z1VA 4NL9C 5J8YC 2Y9TA 2EAMA 2LPEA 1OXJA 2LMRA 2YTUA 1LKYB 5F3XB 2QB1A 1PK1A 2EANA 1PK3A 2QARB 4NL9A 3TACB 1PK1B 2KMDA 4PZOA 3BS7A 2EAPA 2ES6A 1RG6A
chains in the Genus database with same CATH superfamily
3MFHA 2NRZA 3QUBA 1L7MA 4US9A 3RH6A 3RJIA 2Y0SF 4C7YA 1L7PA 4KN7A 4DQPA 3QE9Y 4B9NA 2E5SA 2QKQA 2LBOA 4LZGA 4BUGA 2VIXA 4R65A 9ICXA 3WK8A 1L8OA 4UASA 1ZXIA 2V4RA 1KN5A 1HIWA 2G09A 5AK3A 5ALRA 1CRXA 2IHNA 2F2AB 1BNOA 2EAOA 2HBKA 8ICYA 3C29A 4M6WB 4Z6CA 3VC8A 5B5EU 4O3RA 2VANA 1N5XA 4GXKA 1MA7A 4I2FA 8ICRA 4QIWC 1Z00A 2OWOA 3UMBA 2A1AA 4KLJA 1SV0C 4QWCA 2FMSA 2FMQA 5KFXA 3KKAA 3FYHA 1XSNA 5ALHA 3GQCA 4YXMA 3FDSA 3RJJA 4TUSA 9ICVA 5TISU 2M0NA 5IIOA 5J0UA 2RDIA 5HMMA 2G08A 1B4FA 9ICHA 2DF4B 2IMWP 3RR8A 3GIJA 3QX7A 3C23A 3WKAA 3D2QA 4M9LA 9ICUA 5KFGA 3Q8MA 1UT8A 3PSFA 1U4BA 3K1ZA 2KMDA 4IQWA 4PZOA 3PSPA 3MR5A 2M9NA 3N4MB 2KIWA 3NTUA 3RJHA 4ECTA 3OGUA 4JV0A 2FPKA 3LK9A 3H4BA 2JR5A 2KVSA 4B6JA 2OH2A 7ICKA 2W04A 5ALMA 1BPXA 1D9FA 3K1RB 4ED6A 4RQ6A 4O5CA 4M9JA 2E8NA 2KZMA 5ALXA 2VJ5A 5ALGA 1XNSA 1KLNA 2N1RA 3BQTA 4DOCA 3THVA 4RQ0A 2ZIXB 4LVSA 7ICGA 5F9NA 9ICIA 2EZYA 3QXGA 3TI0A 5J2CA 4EBEA 3ZD9A 5KFWA 5KFFA 1O03A 1UCVA 4FBTA 2XGQA 4UB3A 9ICWA 1F0MA 3BZKA 4DQIA 1ED1A 2XCAA 4JWMA 4MHVA 5T14A 2PI5A 8ICFA 2BPGA 4Q8FA 1JX4A 2C28A 2HMXA 1BPBA 4C4SA 4O3SA 2QB0A 4FBUA 1N48A 2W8LA 1ZQKA 4UATA 2Y1IA 3WK9A 1TVAA 4M0AA 1YZ6A 1D9DA 4ED1A 2IOFA 3GZFA 2JV3A 3QUCA 1ZQQA 5J2JA 5KFLA 5J2HA 1L7NA 5CEHA 3EWAA 4BWMA 4JV2A 8ICGA 3SAGA 4B9TA 4EBCA 4QZBA 4TQRA 2JEGA 1KQQA 2LMRA 3TQ1A 3ZDCA 1KTQA 2J6TA 5J0XA 3HKZF 2AGQA 9ICEA 5L1JA 4MEXA 3Q8PB 4TUPA 3RB6A 1ZQBA 4QZCA 5L9XA 5KT4A 3HP6A 5ALLA 2RLTA 5CWRA 1RDFA 1DRGA 1KFDA 4DSKA 4DQRA 4YQWA 3QUTA 1NKBA 1ZQYA 5AKEA 1T3QA 4G9BA 2DPIA 3OSPA 1FIQA 3B0XA 2Y1JA 4DL4A 4J9RA 3AQEA 1TAUA 2BCSA 5AKGA 5AKJA 1F44A 1JXEA 3Q8SB 2BGWA 1OW5A 1N61A 3M6ZA 2UVVA 5FP0A 4UB2A 1N63A 1C20A 2P35A 4NLNA 1JROA 2CN1A 2K4PA 3L5KA 3HW8A 1T4GA 1U48A 4KTQA 2KICA 5EWGA 4OJOA 7ICHA 2E1FA 4K4GA 2BDUA 4PGYA 1U9LA 3MBYA 2QB0B 5EE0A 5G5HA 3UQ0A 3RJKA 1NI3A 4PGQA 4GXIA 4QWBA 2PFOA 3KHGA 4NLKA 2VKQA 2FPLA 3JPPA 3V7LA 3QU2A 1URJA 9ICAA 1S77D 4RQ2A 5IIIA 4GC6A 3QZ7A 2G0AA 2HHUA 5J0OA 4DOBA 3ICXA 1KEJA 5J0WA 4F8RA 1A6SA 2G06A 5L1LA 1SL2A 4KMOB 1CEZA 9ICBA 1SZHA 5AI9A 2W9AA 1PUZA 1ZQJA 3KHLA 3GDXA 4O0IA 5AI6A 5AKHA 4ED0A 3MGVA 3KTQA 5DQGA 3ISDA 1SWWA 2WF6A 5KFMA 4DFPA 4ELUA 5KFDA 3RTVA 2ZJ8A 2ISOA 2BPFA 7ICLA 4F4XA 5AI4A 8ICMA 3H7IA 4WJ3B 2L5YA 4ECSA 1FEZA 4FE3A 9ICRA 9ICFA 4YXJA 5DGBA 3WKBA 7ICRA 2E8MA 4HAIA 2JZBA 8ICJA 2PFNA 4UQGA 2WFAA 2VA2A 4ED7A 1ECWA 4YR0A 4GLXA 2KEYA 3N7PD 3N7SC 1S10A 2XICA 2C2DA 1ZJMA 4DF8A 2MSNA 4J9OA 4JK1A 1XSLA 4ECUA 3SV3A 1J2MA 4FO6A 3RJFA 4YMNA 8ICEA 2RHFA 4FZMA 4FZNA 4ECVA 1K5OA 3RB3A 4F91B 4PHEA 2G07A 3IDWA 1GO3F 2EZXA 2D8CA 4MEYA 5K4LA 1JUDA 1N5WA 3RAQA 2LYBA 2LI6A 1Z4NA 4IR9A 4F71A 2ZIVB 4R66A 2HVHA 2EAMA 3JPTA 4F5QA 1SKSA 2YTUA 2HOQA 9ICCA 2XY6A 4ZOHC 4YMOA 2I5HA 4LJXA 5AM0A 2W9CA 2ISPA 3RJGA 5ALQA 1KFTA 2ZIVA 1LVHA 4DQQA 2ZTEA 4UARA 2KKPA 2W7OA 4F72A 1BPZA 3BJYA 4DLGA 4YFKA 4UAWA 1JMSA 3F2DA 2VJ4A 3BQ1A 2OCEA 3CYMA 3A0HU 4DSLA 1L8LA 1J2NA 3IV6A 2DBYA 2FMPA 1T94A 5ALEA 4BXOB 4EENA 5KFEA 2DL0A 1RXVA 7ICEA 5EWEA 2AQ4A 4KLMA 2PKEA 3C1YA 2P6UA 3ETLA 4C7ZA 1MC8A 4UB1A 2RDJA 3SAFA 3PVXA 1H38A 3PNCA 4DFJA 3NRZA 1XU4A 8ICWA 1QSSA 5AK4A 2F1HA 3T5KA 1ZQNA 5AM1A 4I2IA 3H8WA 2D6FC 4TURA 1NOMA 4DSFA 3JPSA 2YMQA 4EX6A 2H5XA 2K8BB 4RZRA 4BX9C 3N7RC 2BKEA 1S0VA 4U7CA 3QU9A 4EZ6A 1VLBA 2EH9A 2JGAA 2OXOA 4QW9A 4O3NA 2P66A 4UAVA 1ZQWA 4NJ8A 4Y2SA 2KV2A 1DK3A 1S0MA 5CHGA 3C21A 1KBUA 3ONNA 1DK2A 3V6JA 4US8A 1Q3VA 1QSYA 3QZ8A 4F5PA 1D8YA 1HJPA 1B22A 3BDPA 3IG8A 4B9VA 3PW5A 4DL5A 2DPJA 3D2SA 4ECZA 4B9MA 1T8EA 2QB1A 4DFDA 3EYZA 2H3FA 3SAHA 3ISBA 4Q44A 3DDHA 4JB3A 3NRWA 4DL3A 4EELA 4C8LA 3BQ7A 5E79U 2YB1A 3JPNA 4JV1A 2IBKA 4UAZA 4HYKA 1L7OA 4CGZA 5KG0A 3BQ0A 2ASDA 3MABA 3MR2A 3F53A 5KFHA 3PMLA 4KLIA 2BQUA 3EPIA 4J9NA 3FC4A 4F2RA 3V6KA 2BDPA 4FZLA 4ECWA 5KFKA 3M1YA 4FS1A 4I29A 3KKAC 3WKCA 3H0LB 3OPXA 3KBBA 1X9MA 3WK6A 3PX0A 2WF8A 2UVWA 1XWLA 4ED3A 3PSTA 1QSLA 2EZZA 4YVZA 2JRZA 1NK6A 5AKZA 4MFFA 4Q45A 3PW4A 3ZDBA 5AM4A 1V38A 5J2DA 4QZGA 1SXDA 2LM1A 2FE9A 2KK0A 1TFRA 4YG2A 2IA6A 1YZ7A 2FLLA 3ZD8A 3OTQA 3NASA 2KIVA 2F1IA 3DV9A 1NK5A 4MF8A 2Q4TA 2QARA 1SB3C 2XVTA 4O3MA 2MUTA 4XUSA 4O3QA 1RXWA 2HHTA 4RPXA 2ZXIA 4BJQA 1X9SA 2KHVA 4AYBC 4DF4A 1KFSA 1PK1A 9ICQA 4QZ8A 5J2GA 2AHOB 2WB1F 1PK3A 2HOFA 5JUMA 3SD7A 3WU2U 1UPHA 3H40A 3QEBZ 4QZ9A 5DLGA 5ALWA 2ZJ5A 5J0PA 4RNOA 8ICHA 4DL7A 4I2HA 3IG5A 3SMVA 4GC7A 1N2XA 5TZVA 5EWFA 4B9LA 3RRGA 1Q8KA 4U6PA 5DQHA 3MFIA 8ICSA 5DB6A 1VDVA 3RAXA 5KG3A 2NRXA 1QH9A 4FFDA 4F5RA 2K89A 2AJQA 2ZTCA 2ALZA 5J2IA 2ZIXA 3BZCA 1ZQZA 4RU9A 3MR6A 4DLEA 3D6JA 1PVQA 2YMMA 4RT2A 2DFLA 4PPXA 4UBCA 3NGDA 2A1JB 1UT5A 1SL1A 2ZUDA 3RH4A 9ICLA 2EQYA 4RNMA 2DKZA 1WWUA 3V7KA 5KT2A 3PO4A 3H0RB 5AHXA 2R8HA 2ZIWA 4O5EA 5KFOA 2UVRA 2YX8A 2KJ8A 4PZNA 5KTQA 5ALTA 4Y2JA 4ED8A 2NRWA 5AM3A 1SKWA 4ECYA 5DG9A 3VCBA 2AH5A 1JALA 1Z3EB 4Q8EA 4NL9C 5J0YA 4FS2A 3MDAA 7ICIA 1IG6A 1ZQDA 3T5HA 1QQ5A 4ELTA 1NK7A 2VA8A 2EANA 4OJLA 2QARB 3PZPA 2DUYA 5C5JA 1QLNA 2OYYA 1RG6A 8ICKA 1Z19A 5IIKA 5KFJA 1X9WA 2F77X 2J6UA 4M6WA 3C5FA 1RYUA 2MRLA 4DSEA 5HP4A 1COKA 2Y0SC 4RPZA 1RZTA 3F5AA 4CCHA 3NVYA 5DBCA 4J9LA 1Q3UA 1LKYA 2G5HB 2XY7A 2JMGA 1L3UA 5DDMA 4DWIA 2KZZA 5KT7A 1K1SA 1SIJA 3BS5A 3WKDA 5J8YA 2XGPA 1DXSA 5DKWA 5CR0A 1BPDA 3I1YA 4DS4A 9ICPA 5AIAA 5J0SA 2W3SA 1LB2B 1NJZA 3C2MA 4C8MA 4I27A 5JU5A 4P4MA 1QCKA 3JPOA 1ZQFA 2XI9A 2WB1C 5DB9A 3AQFA 4X5VA 5KG4A 2CRXA 4QWDA 5DB8A 3AMZA 3PY8A 2KFZA 2H3VA 3QU7A 5KG5A 2XC9A 3NVWA 2HBJA 1ZD2P 1RYSA 7ICQA 2C2EA 3OJUA 3H8SA 1UA1A 1X9XA 3M7DA 3I76A 1D8BA 1TV9A 4IRDA 3L3FX 1SGGA 5ALPA 2LM4A 3AL0B 3KZIU 4PGXA 4KLDA 7ICOA 4KX5A 2AXTU 4J9PA 4RQ7A 2Y9TA 2Z7JA 2C2RA 2BQ3A 5F9LA 1BNPA 5CP2A 3GV8B 2R8GA 1T3NA 2WAQF 4CE6A 5KL8B 1U47A 2YB4A 3V6HA 4NL9A 3ISCA 4R63A 2I1QA 1FFVA 4I2GA 4ECQA 1ZOLA 3HJEA 2FDRA 3UQ2A 4ICAA 4RUCA 1ZQ1C 2H3QA 3F2CA 4R8UA 3GIMA 2YY6A 4AP9A 1ZQGA 1X6IA 1TK8A 3O0FA 2PXIA 4DS5A 4XA5A 1SV4A 9ICGA 3WKEA 3UMGA 1PVPA 4Y2RA 2ATLA 1NZBA 1S97A 4ELVA 5ALKA 4USAA 5AI0A 3ZDEA 4R64A 4PHPA 2V4QA 3SYZA 7ICPA 4DOAA 1VJ5A 2KE7A 2E8PA 5KFCA 3AN1A 5L1IA 5IILA 1LV5A 3RBDA 3ED5A 4QWEA 3TFSA 1DGJA 2YQEA 5AKLA 5ALZA 8ICVA 2F8KA 2W03A 4TUQA 3UM9A 3QNMA 2HBLA 1XSPA 2AGOA 5HHIA 2GOLA 4F4KA 5G5GA 4UBBA 1ZRMA 1UQVA 3RB0A 3Q8RB 3SQIA 2DKXA 2ASLA 2B0CA 2WAQC 4MFCA 5DG8A 2PMZF 1WUDA 4F5NA 1BVSA 5D46A 2BHNA 3M9OB 1L6NA 2RP5A 3PX4A 4M04A 2LPEA 4NXZA 3EZ5A 5F3XB 5KL1B 5ALOA 2W8KA 1ZQXA 3TACB 4I2EA 4MF2A 3KHRA 1A76A 5AK5A 4NM1A 3BS7A 3LVVA 3OHBA 3HKZC 3PMNA 5DLFA 5AKXA 5DG7A 4P4PA 3IM1A 4ED2A 4GIBA 2K4EA 3Q8QB 1X66A 1SXEA 4Y2UA 4J9QA 4IQTA 2CXYA 3CW2C 3J81j 3EUB2 1X2IA 4DL2A 8ICAA 5ALYA 4KLUA 4CRXA 2NO5A 3SR6A 4CDGA 5KG7A 1M6YA 1SL0A 4OCZA 4YP3A 1NNLA 2KVCA 1SKRA 1MSWD 2A1JA 2JEFA 4DCCA 3QU5A 4NWIA 5KT5A 2IOHA 4DFKA 1ZD4A 5KFYA 4BGDA 4J9SA 1ZD5A 4RUAA 8ICUA 5J2AA 1MQ3A 2BCRA 4RT3A 3LDAA 1N56A 4Z6FA 4NM2A 1Z4OA 3Q8KA 1RQNA 5KG6A 3GFKB 5JRTA 3MR3A 3C1ZA 4C4TA 5AKYA 2AQ0A 2NYVA 3TADC 3WK5A 5HHHA 5EE1A 4KLOA 3D2NA 1EXNA 4KMUA 2HOIA 4PL1A 1NJYA 8ICIA 1ZQTA 2FJ6A 5ALNA 2ZJAA 4QZIA 9ICMA 4CF4A 4QWAA 2BZFA 1ZQHA 4K4IA 4EYHB 3EPGA 4ECRA 4UAYA 4ACOA 8ICQA 2ZG6A 4C8NA 1LKYB 3ZI4A 8ICTA 3Q8LA 3T3FA 4Y2QA 2HHXA 2I9GA 4P0PB 4Y2TA 5KFAA 1MQ2A 4XRHA 9ICKA 1F5SA 3KD3A 3LWMA 2W55A 5KFNA 2ASJA 4RQNA 1NK4A 1KKXA 1XO1A 1NJWA 5J2BA 1JXLA 2F76X 4XQ8A 3G6XA 4IC9A 3C2KA 2R8JA 4O5KA 2HHVA 3QYPA 3SI8A 9ICOA 1Y88A 4TQSA 2HHQA 5KG1A 2K4IA 4CNQA 4Z6EA 5KFBA 1B0XA 5EE3A 1L5UA 5CRXA 1O08A 1RQLA 4C8OA 3BQ2A 1C7YA 2HI0A 5IINA 3PX6A 2KFNA 4KLLA 4GFJA 1CI4A 2B21A 4RQ3A 2W11A 3I28A 4BDPA 4EEKA 1XS9D 1ZQIA 4UW9A 4B9SA 5CB1A 2KSOB 2ZIUB 2BCVA 2AGPA 1NKEA 2J6SA 2H3IA 7ICMA 3PO5A 2KZ3A 2D3DA 5KFRA 3PV8A 3LYSA 3GILA 5AICA 2LKYA 1QQ6A 1S0OA 3KOOA 4NY8A 3IHQB 1QTMA 5ALIA 5B66U 1KW4A 1ZQAA 4KX3A 1NKCA 1RM6C 4Z6DA 3OJSA 3T5JA 3C2LA 5DB7A 4NLZA 5CJ7A 4P4OA 4P0QA 4Y2PA 4RQ4A 5HR7A 1A77A 4IS7A 2HHSA 5J8YC 2HSZA 4YD2A 4F92B 4PJ0U 4QZFA 3C28A 3TAPA 4I28A 2R8KA 2RRDA 3GV5B 3JPQA 3HX0A 4P0QB 1CUKA 3IP4B 2DGZA 1NJXA 2KTQA 2ES6A 3V72A 2WTFA 4I2BA 3RB4A 5GTIU 3G6VA 2K8AA 3QU4A 2FLPA 2R18A 3MGHA 4CF3A 4BXOA 9ICTA 5GTHU 1ZJNA 3PR4A 2JEJA 3OSNA 4EYIB 4C0ZA 4E0DA 3QUQA 5DDYA 4I2CA 1D8LA 1KL9A 5BPCA 1ZQOA 2MU2A 3ALRA 9ICNA 1V85A 2MA1A 4RQMA 4DFMA 1NK9A 3TAQA 2F44A 2NRTA 1NK8A 1TKDA 4OD0A 4KITB 4IQVA 2NV3A 3G6YA 4DSIA 2PFQA 3T79A 4DO9A 9ICJA 1UHUA 3RFAA 2F3NA 2HVIA 4YD1A 2KKVA 3N97B 2O6KA 3WK7A 2P6RA 5HNKA 3ZDAA 1TAMA 3PR5B 2PFPA 3KHHA 3TFRA 5ALJA 4J9KA 8ICXA 4G3IA 5HMLA 2W9BA 5C0YA 8ICOA 5J2EA 1WG8A 3RBEA 1ZRNA 1BGXT 1TK5A 1JI7A 3AU2A 1NK0A 5KT3A 4F4ZA 4F4YA 1QQ7A 2ZIWB 3H4DA 2E1EA 5J2KA 2EDUA 4KLTA 5DBBA 5J0RA 4J03A 1S76D 2W3RA 5KFPA 3NVZA 4PL2A 2G5IB 1X6JA 2XY5A 4RQ1A 3TKAA 2WHEA 4OJ6A 4KLFA 2W9BB 1S0NA 2H3ZA 5AI8A 1BPYA 1MN8A 3LWLA 1ZQRA 1IM4A 2ODGA 2V9WA 4YN4A 4MFAA 4KN4A 4KLSA 5IIJA 4QZAA 2IHMA 5KNIA 3FAHA 2ESEA 4I2DA 2BPCA 4F93B 3ZDDA 3NS1A 2FI1A 3WK4A 5DGAA 2Y9UA 2A19A 2BR0A 2AU0A 3HPOA 9ICSA 4O3OA 2KNJA 4QZDA 3MC1A 4O9MA 1SZPA 3TADA 2LYAA 4M9GA 1WYGA 1ZQCA 3NVVA 3HT3A 1YT3A 4RQ5A 2FLNA 3NUQA 3F2BA 1L3SA 3UMCA 1NZPA 2GH1A 3UXOA 2ZUCA 1S5LU 3DEEA 3K4GA 7ICFA 4UB6U 2WF7A 2E8OA 2I6XA 4UB8U 3UXNA 5J29A 5AI5A 4OO1J 8ICNA 1RPLA 1HUOA 2YN4A 4M2YA 1V9PA 4KLGA 1V97A 4IR1A 4IQUA 5EE9A 3HILA 1JRPA 1BPEA 3R9KA 1TAQA 4EEYA 5KAIU 3SV4A 3MDCA 3M9MB 7ICTA 7ICNA 2OHFA 1Z1VA 5H2FU 2A3VA 4F3OA 1DOQA 1RYRA 2W7PA 5ALVA 4DL6A 1COOA 4PH5A 4KLEA 4M47A 2KJ5A 2DWQA 3GIKA 1A0PA 3GU3A 8ICLA 2QLTA 3E58A 2W43A 3M9NB 1U45A 1WCLA 3SEIA 5KFUA 1X42A 3EW9A 3M6KA 5BOLA 3L4PA 1PZNA 2BQRA 1L3VA 2FPMA 3C5GA 4RQ8A 2KJ9A 4JWNA 2MAXA 3AEVA 8ICZA 2F1JA 5DBAA 5JTIA 3A0BU 4YR2A 3RH5A 2K60A 4JMUA 2BCUA 1ZQUA 3E0FA 4QJFB 3MGIA 2W9CB 3T5LA 8ICPA 4QIWF 3RJEA 1UA0A 2OEHA 3IN5A 3E2EA 2DQNB 2C22A 4NLGA 2W9MA 1KRPA 3SENA 1S8OA 5ALSA 3M8RA 4I2JA 4K4HA 2E3TA 1ZQPA 4QW8A 3UXPA 3OHAA 1N62A 5DQIA 4DEZA 2JH1A 5AKIA 4UB4A 4YR3A 1IV8A 3ORYA 4F2SA 1SWVA 5ALFA 2GO7A 2PMZC 4LZDA 2NO4A 1U49A 3PSIA 1B43A 4A8EA 2PI4A 3B9JA 3KZXA 2JHDA 4KLQA 2WF9A 5J2FA 1TE2A 3CP8A 4ECXA 1K1QA 4PHDA 3LVWA 1SV0A 3GIIA 1ZD3A 5KFQA 4F50A 4GXJA 4P0PA 4M9NA 3UPQA 1PVRA 2NRVA 2LHTA 1FFUA 4F4WA 3QEAZ 1T7PA 2MUTB 3H8JA 5CA7A 1X40A 4OJPA 2KHQA 4IRKA 2ZUBA 2UVUA 1KDHA 5BOMA 4DQSA 4KLHA 4NLCA 5KG2A 4C80A 3RRHA 2JZBB 3IRUA 2XCPA 2CPRA 2JXJA 5KFZA 4RPYA 3AM9A 1HUZA 1WWVA 5AKKA 5AM5A 5D49A 1Z00B 3B0YA 3AUOA 3ETRA 2Q0ZX 1S9FA 1IXRA 3FM9A 3S6JA 2XIDA 2HDOA 5KT6A 2B6GA 4C8KA 5ALUA 4BWJA 4DSJA 1Q46A 1XC9A 2VA3A 1JN3A 3PW7A 1ZQSA 2OM6A 4P2HA 2R8IA 2HHWA 3V7JA 4I2AA 5J0TA 3F5EA 5L1KA 2ZTDA 2W54A 4Y2VA 4IRCA 5KFVA 1HEKA 3U26A 4Q43A 2HW3A 1ZQVA 4C4RA 3N28A 7ICVA 8ICBA 3TANA 4OJ5A 1ZQLA 2KD1A 3SZ2A 3AU6A 1P7DA 3HWTA 4O3PA 5IIMA 1AROP 4ZH4A 2EAPA 2YMPA 4YMMA 5L1MA 2KSOA 2ZIUA 4AYBF 2KG5A 3PW0A 4EZ9A 5AIBA 4UB5A 1XO0A 4QZEA 1L3TA 4YCXA 3M8SA 5ALDA 3H0MB 4EBDA 1OUQA 4M9HA 1IIPA 2ZXHA 5KFSA 3CNHA 4QNLA 1ZQEA 3RR7A 5D4BA 2F8LA 4UAUA 2GWSA 1WCNA 5A0LA 7ICSA 5KAFU 4JUZA 2BCQA 5EOZA 1Z1BA 4Y2XA 1AQ6A 2HCFA 4Y2YA 4F5OA 5HR6A 1J97A 5AK6A 1ZYQA 1ZETA 3JPRA 2IOFK 3GV7B 7ICJA 2GLEA 4QZHA 2YMLA 4CF5A 4NLBA 2XO7A 5AM2A 3TARA 4RNNA 1KSPA 1DGSA 2KN7A 5J0QA 2K8CB 5KFTA 8ICCA 4PHAA 2KOBA 4R8UB 2JH7A 3K75D 1FO4A 2K4HA 3KFUF 3H8MA 1TK0A 3BS5B 4J9MA 2LYHA 2JEIA 2KP7A 4IL6U 2WF5A 3CRXA 4NV0A 1ZQMA 7ICUA 4B9UA 3HRDD 2RQ5A 1OXJA 3PW2A 2HBMA 3RF9A 1JIHA 4EX7A 1N60A 1PK1B 5KFIA
chains in the Genus database with same CATH topology
3BQ7A 4RQNA 3SEIA 5L1MA 2KSOA 2KG5A 1X66A 1SV0A 1SXEA 1COKA 3K1RB 2E8NA 5KNIA 2ESEA 2QKQA 1LKYA 1B0XA 2DL0A 5JTIA 2K60A 1V85A 1SV4A 1X40A 4RQMA 2Y9UA 2F44A 3BS5A 5J8YA 1DXSA 3KKAC 3TADA 2L5YA 2EAOA 1UCVA 1OW5A 2KE7A 2E8PA 1F0MA 2F3NA 5JU5A 2KSOB 4MHVA 1WWVA 2K4PA 2E8MA 2GLEA 2D3DA 2E8OA 3SENA 5JRTA 2B6GA 2F8KA 2QB0A 1V38A 1SXDA 2DKZA 1WWUA 4NJ8A 1SV0C 1KW4A 3TADC 2FE9A 3HILA 3KKAA 1UQVA 4PZNA 2DKXA 2JV3A 1X9XA 2KIVA 2QB0B 3IDWA 2D8CA 1JI7A 3H8MA 1B4FA 3BS5B 1SGGA 2QARA 4IS7A 1Z1VA 4NL9C 5J8YC 2Y9TA 2EAMA 2LPEA 1OXJA 2LMRA 2YTUA 1LKYB 5F3XB 2QB1A 1PK1A 2EANA 1PK3A 2QARB 4NL9A 3TACB 1PK1B 2KMDA 4PZOA 3BS7A 2EAPA 2ES6A 1RG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ7 A;  4RQN A;  3SEI A;  5L1M A;  2KSO A;  2KG5 A;  1X66 A;  1SV0 A;  1SXE A;  1COK A;  3K1R B;  2E8N A;  5KNI A;  2ESE A;  2QKQ A;  1LKY A;  1B0X A;  2DL0 A;  5JTI A;  2K60 A;  1V85 A;  1SV4 A;  1X40 A;  4RQM A;  2Y9U A;  2F44 A;  3BS5 A;  5J8Y A;  1DXS A;  3KKA C;  3TAD A;  2L5Y A;  2EAO A;  1UCV A;  1OW5 A;  2KE7 A;  2E8P A;  1F0M A;  2F3N A;  5JU5 A;  2KSO B;  4MHV A;  1WWV A;  2K4P A;  2E8M A;  2GLE A;  2D3D A;  2E8O A;  3SEN A;  5JRT A;  2B6G A;  2F8K A;  2QB0 A;  1V38 A;  1SXD A;  2DKZ A;  1WWU A;  4NJ8 A;  1SV0 C;  1KW4 A;  3TAD C;  2FE9 A;  3HIL A;  3KKA A;  1UQV A;  4PZN A;  2DKX A;  2JV3 A;  1X9X A;  2KIV A;  2QB0 B;  3IDW A;  2D8C A;  1JI7 A;  3H8M A;  1B4F A;  3BS5 B;  1SGG A;  2QAR A;  4IS7 A;  1Z1V A;  4NL9 C;  5J8Y C;  2Y9T A;  2EAM A;  2LPE A;  1OXJ A;  2LMR A;  2YTU A;  1LKY B;  5F3X B;  2QB1 A;  1PK1 A;  2EAN A;  1PK3 A;  2QAR B;  4NL9 A;  3TAC B;  1PK1 B;  2KMD A;  4PZO A;  3BS7 A;  2EAP A;  2ES6 A;  1RG6 A; 
#chains in the Genus database with same CATH topology
 3MFH A;  2NRZ A;  3QUB A;  1L7M A;  4US9 A;  3RH6 A;  3RJI A;  2Y0S F;  4C7Y A;  1L7P A;  4KN7 A;  4DQP A;  3QE9 Y;  4B9N A;  2E5S A;  2QKQ A;  2LBO A;  4LZG A;  4BUG A;  2VIX A;  4R65 A;  9ICX A;  3WK8 A;  1L8O A;  4UAS A;  1ZXI A;  2V4R A;  1KN5 A;  1HIW A;  2G09 A;  5AK3 A;  5ALR A;  1CRX A;  2IHN A;  2F2A B;  1BNO A;  2EAO A;  2HBK A;  8ICY A;  3C29 A;  4M6W B;  4Z6C A;  3VC8 A;  5B5E U;  4O3R A;  2VAN A;  1N5X A;  4GXK A;  1MA7 A;  4I2F A;  8ICR A;  4QIW C;  1Z00 A;  2OWO A;  3UMB A;  2A1A A;  4KLJ A;  1SV0 C;  4QWC A;  2FMS A;  2FMQ A;  5KFX A;  3KKA A;  3FYH A;  1XSN A;  5ALH A;  3GQC A;  4YXM A;  3FDS A;  3RJJ A;  4TUS A;  9ICV A;  5TIS U;  2M0N A;  5IIO A;  5J0U A;  2RDI A;  5HMM A;  2G08 A;  1B4F A;  9ICH A;  2DF4 B;  2IMW P;  3RR8 A;  3GIJ A;  3QX7 A;  3C23 A;  3WKA A;  3D2Q A;  4M9L A;  9ICU A;  5KFG A;  3Q8M A;  1UT8 A;  3PSF A;  1U4B A;  3K1Z A;  2KMD A;  4IQW A;  4PZO A;  3PSP A;  3MR5 A;  2M9N A;  3N4M B;  2KIW A;  3NTU A;  3RJH A;  4ECT A;  3OGU A;  4JV0 A;  2FPK A;  3LK9 A;  3H4B A;  2JR5 A;  2KVS A;  4B6J A;  2OH2 A;  7ICK A;  2W04 A;  5ALM A;  1BPX A;  1D9F A;  3K1R B;  4ED6 A;  4RQ6 A;  4O5C A;  4M9J A;  2E8N A;  2KZM A;  5ALX A;  2VJ5 A;  5ALG A;  1XNS A;  1KLN A;  2N1R A;  3BQT A;  4DOC A;  3THV A;  4RQ0 A;  2ZIX B;  4LVS A;  7ICG A;  5F9N A;  9ICI A;  2EZY A;  3QXG A;  3TI0 A;  5J2C A;  4EBE A;  3ZD9 A;  5KFW A;  5KFF A;  1O03 A;  1UCV A;  4FBT A;  2XGQ A;  4UB3 A;  9ICW A;  1F0M A;  3BZK A;  4DQI A;  1ED1 A;  2XCA A;  4JWM A;  4MHV A;  5T14 A;  2PI5 A;  8ICF A;  2BPG A;  4Q8F A;  1JX4 A;  2C28 A;  2HMX A;  1BPB A;  4C4S A;  4O3S A;  2QB0 A;  4FBU A;  1N48 A;  2W8L A;  1ZQK A;  4UAT A;  2Y1I A;  3WK9 A;  1TVA A;  4M0A A;  1YZ6 A;  1D9D A;  4ED1 A;  2IOF A;  3GZF A;  2JV3 A;  3QUC A;  1ZQQ A;  5J2J A;  5KFL A;  5J2H A;  1L7N A;  5CEH A;  3EWA A;  4BWM A;  4JV2 A;  8ICG A;  3SAG A;  4B9T A;  4EBC A;  4QZB A;  4TQR A;  2JEG A;  1KQQ A;  2LMR A;  3TQ1 A;  3ZDC A;  1KTQ A;  2J6T A;  5J0X A;  3HKZ F;  2AGQ A;  9ICE A;  5L1J A;  4MEX A;  3Q8P B;  4TUP A;  3RB6 A;  1ZQB A;  4QZC A;  5L9X A;  5KT4 A;  3HP6 A;  5ALL A;  2RLT A;  5CWR A;  1RDF A;  1DRG A;  1KFD A;  4DSK A;  4DQR A;  4YQW A;  3QUT A;  1NKB A;  1ZQY A;  5AKE A;  1T3Q A;  4G9B A;  2DPI A;  3OSP A;  1FIQ A;  3B0X A;  2Y1J A;  4DL4 A;  4J9R A;  3AQE A;  1TAU A;  2BCS A;  5AKG A;  5AKJ A;  1F44 A;  1JXE A;  3Q8S B;  2BGW A;  1OW5 A;  1N61 A;  3M6Z A;  2UVV A;  5FP0 A;  4UB2 A;  1N63 A;  1C20 A;  2P35 A;  4NLN A;  1JRO A;  2CN1 A;  2K4P A;  3L5K A;  3HW8 A;  1T4G A;  1U48 A;  4KTQ A;  2KIC A;  5EWG A;  4OJO A;  7ICH A;  2E1F A;  4K4G A;  2BDU A;  4PGY A;  1U9L A;  3MBY A;  2QB0 B;  5EE0 A;  5G5H A;  3UQ0 A;  3RJK A;  1NI3 A;  4PGQ A;  4GXI A;  4QWB A;  2PFO A;  3KHG A;  4NLK A;  2VKQ A;  2FPL A;  3JPP A;  3V7L A;  3QU2 A;  1URJ A;  9ICA A;  1S77 D;  4RQ2 A;  5III A;  4GC6 A;  3QZ7 A;  2G0A A;  2HHU A;  5J0O A;  4DOB A;  3ICX A;  1KEJ A;  5J0W A;  4F8R A;  1A6S A;  2G06 A;  5L1L A;  1SL2 A;  4KMO B;  1CEZ A;  9ICB A;  1SZH A;  5AI9 A;  2W9A A;  1PUZ A;  1ZQJ A;  3KHL A;  3GDX A;  4O0I A;  5AI6 A;  5AKH A;  4ED0 A;  3MGV A;  3KTQ A;  5DQG A;  3ISD A;  1SWW A;  2WF6 A;  5KFM A;  4DFP A;  4ELU A;  5KFD A;  3RTV A;  2ZJ8 A;  2ISO A;  2BPF A;  7ICL A;  4F4X A;  5AI4 A;  8ICM A;  3H7I A;  4WJ3 B;  2L5Y A;  4ECS A;  1FEZ A;  4FE3 A;  9ICR A;  9ICF A;  4YXJ A;  5DGB A;  3WKB A;  7ICR A;  2E8M A;  4HAI A;  2JZB A;  8ICJ A;  2PFN A;  4UQG A;  2WFA A;  2VA2 A;  4ED7 A;  1ECW A;  4YR0 A;  4GLX A;  2KEY A;  3N7P D;  3N7S C;  1S10 A;  2XIC A;  2C2D A;  1ZJM A;  4DF8 A;  2MSN A;  4J9O A;  4JK1 A;  1XSL A;  4ECU A;  3SV3 A;  1J2M A;  4FO6 A;  3RJF A;  4YMN A;  8ICE A;  2RHF A;  4FZM A;  4FZN A;  4ECV A;  1K5O A;  3RB3 A;  4F91 B;  4PHE A;  2G07 A;  3IDW A;  1GO3 F;  2EZX A;  2D8C A;  4MEY A;  5K4L A;  1JUD A;  1N5W A;  3RAQ A;  2LYB A;  2LI6 A;  1Z4N A;  4IR9 A;  4F71 A;  2ZIV B;  4R66 A;  2HVH A;  2EAM A;  3JPT A;  4F5Q A;  1SKS A;  2YTU A;  2HOQ A;  9ICC A;  2XY6 A;  4ZOH C;  4YMO A;  2I5H A;  4LJX A;  5AM0 A;  2W9C A;  2ISP A;  3RJG A;  5ALQ A;  1KFT A;  2ZIV A;  1LVH A;  4DQQ A;  2ZTE A;  4UAR A;  2KKP A;  2W7O A;  4F72 A;  1BPZ A;  3BJY A;  4DLG A;  4YFK A;  4UAW A;  1JMS A;  3F2D A;  2VJ4 A;  3BQ1 A;  2OCE A;  3CYM A;  3A0H U;  4DSL A;  1L8L A;  1J2N A;  3IV6 A;  2DBY A;  2FMP A;  1T94 A;  5ALE A;  4BXO B;  4EEN A;  5KFE A;  2DL0 A;  1RXV A;  7ICE A;  5EWE A;  2AQ4 A;  4KLM A;  2PKE A;  3C1Y A;  2P6U A;  3ETL A;  4C7Z A;  1MC8 A;  4UB1 A;  2RDJ A;  3SAF A;  3PVX A;  1H38 A;  3PNC A;  4DFJ A;  3NRZ A;  1XU4 A;  8ICW A;  1QSS A;  5AK4 A;  2F1H A;  3T5K A;  1ZQN A;  5AM1 A;  4I2I A;  3H8W A;  2D6F C;  4TUR A;  1NOM A;  4DSF A;  3JPS A;  2YMQ A;  4EX6 A;  2H5X A;  2K8B B;  4RZR A;  4BX9 C;  3N7R C;  2BKE A;  1S0V A;  4U7C A;  3QU9 A;  4EZ6 A;  1VLB A;  2EH9 A;  2JGA A;  2OXO A;  4QW9 A;  4O3N A;  2P66 A;  4UAV A;  1ZQW A;  4NJ8 A;  4Y2S A;  2KV2 A;  1DK3 A;  1S0M A;  5CHG A;  3C21 A;  1KBU A;  3ONN A;  1DK2 A;  3V6J A;  4US8 A;  1Q3V A;  1QSY A;  3QZ8 A;  4F5P A;  1D8Y A;  1HJP A;  1B22 A;  3BDP A;  3IG8 A;  4B9V A;  3PW5 A;  4DL5 A;  2DPJ A;  3D2S A;  4ECZ A;  4B9M A;  1T8E A;  2QB1 A;  4DFD A;  3EYZ A;  2H3F A;  3SAH A;  3ISB A;  4Q44 A;  3DDH A;  4JB3 A;  3NRW A;  4DL3 A;  4EEL A;  4C8L A;  3BQ7 A;  5E79 U;  2YB1 A;  3JPN A;  4JV1 A;  2IBK A;  4UAZ A;  4HYK A;  1L7O A;  4CGZ A;  5KG0 A;  3BQ0 A;  2ASD A;  3MAB A;  3MR2 A;  3F53 A;  5KFH A;  3PML A;  4KLI A;  2BQU A;  3EPI A;  4J9N A;  3FC4 A;  4F2R A;  3V6K A;  2BDP A;  4FZL A;  4ECW A;  5KFK A;  3M1Y A;  4FS1 A;  4I29 A;  3KKA C;  3WKC A;  3H0L B;  3OPX A;  3KBB A;  1X9M A;  3WK6 A;  3PX0 A;  2WF8 A;  2UVW A;  1XWL A;  4ED3 A;  3PST A;  1QSL A;  2EZZ A;  4YVZ A;  2JRZ A;  1NK6 A;  5AKZ A;  4MFF A;  4Q45 A;  3PW4 A;  3ZDB A;  5AM4 A;  1V38 A;  5J2D A;  4QZG A;  1SXD A;  2LM1 A;  2FE9 A;  2KK0 A;  1TFR A;  4YG2 A;  2IA6 A;  1YZ7 A;  2FLL A;  3ZD8 A;  3OTQ A;  3NAS A;  2KIV A;  2F1I A;  3DV9 A;  1NK5 A;  4MF8 A;  2Q4T A;  2QAR A;  1SB3 C;  2XVT A;  4O3M A;  2MUT A;  4XUS A;  4O3Q A;  1RXW A;  2HHT A;  4RPX A;  2ZXI A;  4BJQ A;  1X9S A;  2KHV A;  4AYB C;  4DF4 A;  1KFS A;  1PK1 A;  9ICQ A;  4QZ8 A;  5J2G A;  2AHO B;  2WB1 F;  1PK3 A;  2HOF A;  5JUM A;  3SD7 A;  3WU2 U;  1UPH A;  3H40 A;  3QEB Z;  4QZ9 A;  5DLG A;  5ALW A;  2ZJ5 A;  5J0P A;  4RNO A;  8ICH A;  4DL7 A;  4I2H A;  3IG5 A;  3SMV A;  4GC7 A;  1N2X A;  5TZV A;  5EWF A;  4B9L A;  3RRG A;  1Q8K A;  4U6P A;  5DQH A;  3MFI A;  8ICS A;  5DB6 A;  1VDV A;  3RAX A;  5KG3 A;  2NRX A;  1QH9 A;  4FFD A;  4F5R A;  2K89 A;  2AJQ A;  2ZTC A;  2ALZ A;  5J2I A;  2ZIX A;  3BZC A;  1ZQZ A;  4RU9 A;  3MR6 A;  4DLE A;  3D6J A;  1PVQ A;  2YMM A;  4RT2 A;  2DFL A;  4PPX A;  4UBC A;  3NGD A;  2A1J B;  1UT5 A;  1SL1 A;  2ZUD A;  3RH4 A;  9ICL A;  2EQY A;  4RNM A;  2DKZ A;  1WWU A;  3V7K A;  5KT2 A;  3PO4 A;  3H0R B;  5AHX A;  2R8H A;  2ZIW A;  4O5E A;  5KFO A;  2UVR A;  2YX8 A;  2KJ8 A;  4PZN A;  5KTQ A;  5ALT A;  4Y2J A;  4ED8 A;  2NRW A;  5AM3 A;  1SKW A;  4ECY A;  5DG9 A;  3VCB A;  2AH5 A;  1JAL A;  1Z3E B;  4Q8E A;  4NL9 C;  5J0Y A;  4FS2 A;  3MDA A;  7ICI A;  1IG6 A;  1ZQD A;  3T5H A;  1QQ5 A;  4ELT A;  1NK7 A;  2VA8 A;  2EAN A;  4OJL A;  2QAR B;  3PZP A;  2DUY A;  5C5J A;  1QLN A;  2OYY A;  1RG6 A;  8ICK A;  1Z19 A;  5IIK A;  5KFJ A;  1X9W A;  2F77 X;  2J6U A;  4M6W A;  3C5F A;  1RYU A;  2MRL A;  4DSE A;  5HP4 A;  1COK A;  2Y0S C;  4RPZ A;  1RZT A;  3F5A A;  4CCH A;  3NVY A;  5DBC A;  4J9L A;  1Q3U A;  1LKY A;  2G5H B;  2XY7 A;  2JMG A;  1L3U A;  5DDM A;  4DWI A;  2KZZ A;  5KT7 A;  1K1S A;  1SIJ A;  3BS5 A;  3WKD A;  5J8Y A;  2XGP A;  1DXS A;  5DKW A;  5CR0 A;  1BPD A;  3I1Y A;  4DS4 A;  9ICP A;  5AIA A;  5J0S A;  2W3S A;  1LB2 B;  1NJZ A;  3C2M A;  4C8M A;  4I27 A;  5JU5 A;  4P4M A;  1QCK A;  3JPO A;  1ZQF A;  2XI9 A;  2WB1 C;  5DB9 A;  3AQF A;  4X5V A;  5KG4 A;  2CRX A;  4QWD A;  5DB8 A;  3AMZ A;  3PY8 A;  2KFZ A;  2H3V A;  3QU7 A;  5KG5 A;  2XC9 A;  3NVW A;  2HBJ A;  1ZD2 P;  1RYS A;  7ICQ A;  2C2E A;  3OJU A;  3H8S A;  1UA1 A;  1X9X A;  3M7D A;  3I76 A;  1D8B A;  1TV9 A;  4IRD A;  3L3F X;  1SGG A;  5ALP A;  2LM4 A;  3AL0 B;  3KZI U;  4PGX A;  4KLD A;  7ICO A;  4KX5 A;  2AXT U;  4J9P A;  4RQ7 A;  2Y9T A;  2Z7J A;  2C2R A;  2BQ3 A;  5F9L A;  1BNP A;  5CP2 A;  3GV8 B;  2R8G A;  1T3N A;  2WAQ F;  4CE6 A;  5KL8 B;  1U47 A;  2YB4 A;  3V6H A;  4NL9 A;  3ISC A;  4R63 A;  2I1Q A;  1FFV A;  4I2G A;  4ECQ A;  1ZOL A;  3HJE A;  2FDR A;  3UQ2 A;  4ICA A;  4RUC A;  1ZQ1 C;  2H3Q A;  3F2C A;  4R8U A;  3GIM A;  2YY6 A;  4AP9 A;  1ZQG A;  1X6I A;  1TK8 A;  3O0F A;  2PXI A;  4DS5 A;  4XA5 A;  1SV4 A;  9ICG A;  3WKE A;  3UMG A;  1PVP A;  4Y2R A;  2ATL A;  1NZB A;  1S97 A;  4ELV A;  5ALK A;  4USA A;  5AI0 A;  3ZDE A;  4R64 A;  4PHP A;  2V4Q A;  3SYZ A;  7ICP A;  4DOA A;  1VJ5 A;  2KE7 A;  2E8P A;  5KFC A;  3AN1 A;  5L1I A;  5IIL A;  1LV5 A;  3RBD A;  3ED5 A;  4QWE A;  3TFS A;  1DGJ A;  2YQE A;  5AKL A;  5ALZ A;  8ICV A;  2F8K A;  2W03 A;  4TUQ A;  3UM9 A;  3QNM A;  2HBL A;  1XSP A;  2AGO A;  5HHI A;  2GOL A;  4F4K A;  5G5G A;  4UBB A;  1ZRM A;  1UQV A;  3RB0 A;  3Q8R B;  3SQI A;  2DKX A;  2ASL A;  2B0C A;  2WAQ C;  4MFC A;  5DG8 A;  2PMZ F;  1WUD A;  4F5N A;  1BVS A;  5D46 A;  2BHN A;  3M9O B;  1L6N A;  2RP5 A;  3PX4 A;  4M04 A;  2LPE A;  4NXZ A;  3EZ5 A;  5F3X B;  5KL1 B;  5ALO A;  2W8K A;  1ZQX A;  3TAC B;  4I2E A;  4MF2 A;  3KHR A;  1A76 A;  5AK5 A;  4NM1 A;  3BS7 A;  3LVV A;  3OHB A;  3HKZ C;  3PMN A;  5DLF A;  5AKX A;  5DG7 A;  4P4P A;  3IM1 A;  4ED2 A;  4GIB A;  2K4E A;  3Q8Q B;  1X66 A;  1SXE A;  4Y2U A;  4J9Q A;  4IQT A;  2CXY A;  3CW2 C;  3J81 j;  3EUB 2;  1X2I A;  4DL2 A;  8ICA A;  5ALY A;  4KLU A;  4CRX A;  2NO5 A;  3SR6 A;  4CDG A;  5KG7 A;  1M6Y A;  1SL0 A;  4OCZ A;  4YP3 A;  1NNL A;  2KVC A;  1SKR A;  1MSW D;  2A1J A;  2JEF A;  4DCC A;  3QU5 A;  4NWI A;  5KT5 A;  2IOH A;  4DFK A;  1ZD4 A;  5KFY A;  4BGD A;  4J9S A;  1ZD5 A;  4RUA A;  8ICU A;  5J2A A;  1MQ3 A;  2BCR A;  4RT3 A;  3LDA A;  1N56 A;  4Z6F A;  4NM2 A;  1Z4O A;  3Q8K A;  1RQN A;  5KG6 A;  3GFK B;  5JRT A;  3MR3 A;  3C1Z A;  4C4T A;  5AKY A;  2AQ0 A;  2NYV A;  3TAD C;  3WK5 A;  5HHH A;  5EE1 A;  4KLO A;  3D2N A;  1EXN A;  4KMU A;  2HOI A;  4PL1 A;  1NJY A;  8ICI A;  1ZQT A;  2FJ6 A;  5ALN A;  2ZJA A;  4QZI A;  9ICM A;  4CF4 A;  4QWA A;  2BZF A;  1ZQH A;  4K4I A;  4EYH B;  3EPG A;  4ECR A;  4UAY A;  4ACO A;  8ICQ A;  2ZG6 A;  4C8N A;  1LKY B;  3ZI4 A;  8ICT A;  3Q8L A;  3T3F A;  4Y2Q A;  2HHX A;  2I9G A;  4P0P B;  4Y2T A;  5KFA A;  1MQ2 A;  4XRH A;  9ICK A;  1F5S A;  3KD3 A;  3LWM A;  2W55 A;  5KFN A;  2ASJ A;  4RQN A;  1NK4 A;  1KKX A;  1XO1 A;  1NJW A;  5J2B A;  1JXL A;  2F76 X;  4XQ8 A;  3G6X A;  4IC9 A;  3C2K A;  2R8J A;  4O5K A;  2HHV A;  3QYP A;  3SI8 A;  9ICO A;  1Y88 A;  4TQS A;  2HHQ A;  5KG1 A;  2K4I A;  4CNQ A;  4Z6E A;  5KFB A;  1B0X A;  5EE3 A;  1L5U A;  5CRX A;  1O08 A;  1RQL A;  4C8O A;  3BQ2 A;  1C7Y A;  2HI0 A;  5IIN A;  3PX6 A;  2KFN A;  4KLL A;  4GFJ A;  1CI4 A;  2B21 A;  4RQ3 A;  2W11 A;  3I28 A;  4BDP A;  4EEK A;  1XS9 D;  1ZQI A;  4UW9 A;  4B9S A;  5CB1 A;  2KSO B;  2ZIU B;  2BCV A;  2AGP A;  1NKE A;  2J6S A;  2H3I A;  7ICM A;  3PO5 A;  2KZ3 A;  2D3D A;  5KFR A;  3PV8 A;  3LYS A;  3GIL A;  5AIC A;  2LKY A;  1QQ6 A;  1S0O A;  3KOO A;  4NY8 A;  3IHQ B;  1QTM A;  5ALI A;  5B66 U;  1KW4 A;  1ZQA A;  4KX3 A;  1NKC A;  1RM6 C;  4Z6D A;  3OJS A;  3T5J A;  3C2L A;  5DB7 A;  4NLZ A;  5CJ7 A;  4P4O A;  4P0Q A;  4Y2P A;  4RQ4 A;  5HR7 A;  1A77 A;  4IS7 A;  2HHS A;  5J8Y C;  2HSZ A;  4YD2 A;  4F92 B;  4PJ0 U;  4QZF A;  3C28 A;  3TAP A;  4I28 A;  2R8K A;  2RRD A;  3GV5 B;  3JPQ A;  3HX0 A;  4P0Q B;  1CUK A;  3IP4 B;  2DGZ A;  1NJX A;  2KTQ A;  2ES6 A;  3V72 A;  2WTF A;  4I2B A;  3RB4 A;  5GTI U;  3G6V A;  2K8A A;  3QU4 A;  2FLP A;  2R18 A;  3MGH A;  4CF3 A;  4BXO A;  9ICT A;  5GTH U;  1ZJN A;  3PR4 A;  2JEJ A;  3OSN A;  4EYI B;  4C0Z A;  4E0D A;  3QUQ A;  5DDY A;  4I2C A;  1D8L A;  1KL9 A;  5BPC A;  1ZQO A;  2MU2 A;  3ALR A;  9ICN A;  1V85 A;  2MA1 A;  4RQM A;  4DFM A;  1NK9 A;  3TAQ A;  2F44 A;  2NRT A;  1NK8 A;  1TKD A;  4OD0 A;  4KIT B;  4IQV A;  2NV3 A;  3G6Y A;  4DSI A;  2PFQ A;  3T79 A;  4DO9 A;  9ICJ A;  1UHU A;  3RFA A;  2F3N A;  2HVI A;  4YD1 A;  2KKV A;  3N97 B;  2O6K A;  3WK7 A;  2P6R A;  5HNK A;  3ZDA A;  1TAM A;  3PR5 B;  2PFP A;  3KHH A;  3TFR A;  5ALJ A;  4J9K A;  8ICX A;  4G3I A;  5HML A;  2W9B A;  5C0Y A;  8ICO A;  5J2E A;  1WG8 A;  3RBE A;  1ZRN A;  1BGX T;  1TK5 A;  1JI7 A;  3AU2 A;  1NK0 A;  5KT3 A;  4F4Z A;  4F4Y A;  1QQ7 A;  2ZIW B;  3H4D A;  2E1E A;  5J2K A;  2EDU A;  4KLT A;  5DBB A;  5J0R A;  4J03 A;  1S76 D;  2W3R A;  5KFP A;  3NVZ A;  4PL2 A;  2G5I B;  1X6J A;  2XY5 A;  4RQ1 A;  3TKA A;  2WHE A;  4OJ6 A;  4KLF A;  2W9B B;  1S0N A;  2H3Z A;  5AI8 A;  1BPY A;  1MN8 A;  3LWL A;  1ZQR A;  1IM4 A;  2ODG A;  2V9W A;  4YN4 A;  4MFA A;  4KN4 A;  4KLS A;  5IIJ A;  4QZA A;  2IHM A;  5KNI A;  3FAH A;  2ESE A;  4I2D A;  2BPC A;  4F93 B;  3ZDD A;  3NS1 A;  2FI1 A;  3WK4 A;  5DGA A;  2Y9U A;  2A19 A;  2BR0 A;  2AU0 A;  3HPO A;  9ICS A;  4O3O A;  2KNJ A;  4QZD A;  3MC1 A;  4O9M A;  1SZP A;  3TAD A;  2LYA A;  4M9G A;  1WYG A;  1ZQC A;  3NVV A;  3HT3 A;  1YT3 A;  4RQ5 A;  2FLN A;  3NUQ A;  3F2B A;  1L3S A;  3UMC A;  1NZP A;  2GH1 A;  3UXO A;  2ZUC A;  1S5L U;  3DEE A;  3K4G A;  7ICF A;  4UB6 U;  2WF7 A;  2E8O A;  2I6X A;  4UB8 U;  3UXN A;  5J29 A;  5AI5 A;  4OO1 J;  8ICN A;  1RPL A;  1HUO A;  2YN4 A;  4M2Y A;  1V9P A;  4KLG A;  1V97 A;  4IR1 A;  4IQU A;  5EE9 A;  3HIL A;  1JRP A;  1BPE A;  3R9K A;  1TAQ A;  4EEY A;  5KAI U;  3SV4 A;  3MDC A;  3M9M B;  7ICT A;  7ICN A;  2OHF A;  1Z1V A;  5H2F U;  2A3V A;  4F3O A;  1DOQ A;  1RYR A;  2W7P A;  5ALV A;  4DL6 A;  1COO A;  4PH5 A;  4KLE A;  4M47 A;  2KJ5 A;  2DWQ A;  3GIK A;  1A0P A;  3GU3 A;  8ICL A;  2QLT A;  3E58 A;  2W43 A;  3M9N B;  1U45 A;  1WCL A;  3SEI A;  5KFU A;  1X42 A;  3EW9 A;  3M6K A;  5BOL A;  3L4P A;  1PZN A;  2BQR A;  1L3V A;  2FPM A;  3C5G A;  4RQ8 A;  2KJ9 A;  4JWN A;  2MAX A;  3AEV A;  8ICZ A;  2F1J A;  5DBA A;  5JTI A;  3A0B U;  4YR2 A;  3RH5 A;  2K60 A;  4JMU A;  2BCU A;  1ZQU A;  3E0F A;  4QJF B;  3MGI A;  2W9C B;  3T5L A;  8ICP A;  4QIW F;  3RJE A;  1UA0 A;  2OEH A;  3IN5 A;  3E2E A;  2DQN B;  2C22 A;  4NLG A;  2W9M A;  1KRP A;  3SEN A;  1S8O A;  5ALS A;  3M8R A;  4I2J A;  4K4H A;  2E3T A;  1ZQP A;  4QW8 A;  3UXP A;  3OHA A;  1N62 A;  5DQI A;  4DEZ A;  2JH1 A;  5AKI A;  4UB4 A;  4YR3 A;  1IV8 A;  3ORY A;  4F2S A;  1SWV A;  5ALF A;  2GO7 A;  2PMZ C;  4LZD A;  2NO4 A;  1U49 A;  3PSI A;  1B43 A;  4A8E A;  2PI4 A;  3B9J A;  3KZX A;  2JHD A;  4KLQ A;  2WF9 A;  5J2F A;  1TE2 A;  3CP8 A;  4ECX A;  1K1Q A;  4PHD A;  3LVW A;  1SV0 A;  3GII A;  1ZD3 A;  5KFQ A;  4F50 A;  4GXJ A;  4P0P A;  4M9N A;  3UPQ A;  1PVR A;  2NRV A;  2LHT A;  1FFU A;  4F4W A;  3QEA Z;  1T7P A;  2MUT B;  3H8J A;  5CA7 A;  1X40 A;  4OJP A;  2KHQ A;  4IRK A;  2ZUB A;  2UVU A;  1KDH A;  5BOM A;  4DQS A;  4KLH A;  4NLC A;  5KG2 A;  4C80 A;  3RRH A;  2JZB B;  3IRU A;  2XCP A;  2CPR A;  2JXJ A;  5KFZ A;  4RPY A;  3AM9 A;  1HUZ A;  1WWV A;  5AKK A;  5AM5 A;  5D49 A;  1Z00 B;  3B0Y A;  3AUO A;  3ETR A;  2Q0Z X;  1S9F A;  1IXR A;  3FM9 A;  3S6J A;  2XID A;  2HDO A;  5KT6 A;  2B6G A;  4C8K A;  5ALU A;  4BWJ A;  4DSJ A;  1Q46 A;  1XC9 A;  2VA3 A;  1JN3 A;  3PW7 A;  1ZQS A;  2OM6 A;  4P2H A;  2R8I A;  2HHW A;  3V7J A;  4I2A A;  5J0T A;  3F5E A;  5L1K A;  2ZTD A;  2W54 A;  4Y2V A;  4IRC A;  5KFV A;  1HEK A;  3U26 A;  4Q43 A;  2HW3 A;  1ZQV A;  4C4R A;  3N28 A;  7ICV A;  8ICB A;  3TAN A;  4OJ5 A;  1ZQL A;  2KD1 A;  3SZ2 A;  3AU6 A;  1P7D A;  3HWT A;  4O3P A;  5IIM A;  1ARO P;  4ZH4 A;  2EAP A;  2YMP A;  4YMM A;  5L1M A;  2KSO A;  2ZIU A;  4AYB F;  2KG5 A;  3PW0 A;  4EZ9 A;  5AIB A;  4UB5 A;  1XO0 A;  4QZE A;  1L3T A;  4YCX A;  3M8S A;  5ALD A;  3H0M B;  4EBD A;  1OUQ A;  4M9H A;  1IIP A;  2ZXH A;  5KFS A;  3CNH A;  4QNL A;  1ZQE A;  3RR7 A;  5D4B A;  2F8L A;  4UAU A;  2GWS A;  1WCN A;  5A0L A;  7ICS A;  5KAF U;  4JUZ A;  2BCQ A;  5EOZ A;  1Z1B A;  4Y2X A;  1AQ6 A;  2HCF A;  4Y2Y A;  4F5O A;  5HR6 A;  1J97 A;  5AK6 A;  1ZYQ A;  1ZET A;  3JPR A;  2IOF K;  3GV7 B;  7ICJ A;  2GLE A;  4QZH A;  2YML A;  4CF5 A;  4NLB A;  2XO7 A;  5AM2 A;  3TAR A;  4RNN A;  1KSP A;  1DGS A;  2KN7 A;  5J0Q A;  2K8C B;  5KFT A;  8ICC A;  4PHA A;  2KOB A;  4R8U B;  2JH7 A;  3K75 D;  1FO4 A;  2K4H A;  3KFU F;  3H8M A;  1TK0 A;  3BS5 B;  4J9M A;  2LYH A;  2JEI A;  2KP7 A;  4IL6 U;  2WF5 A;  3CRX A;  4NV0 A;  1ZQM A;  7ICU A;  4B9U A;  3HRD D;  2RQ5 A;  1OXJ A;  3PW2 A;  2HBM A;  3RF9 A;  1JIH A;  4EX7 A;  1N60 A;  1PK1 B;  5KFI A; 
#chains in the Genus database with same CATH homology
 3BQ7 A;  4RQN A;  3SEI A;  5L1M A;  2KSO A;  2KG5 A;  1X66 A;  1SV0 A;  1SXE A;  1COK A;  3K1R B;  2E8N A;  5KNI A;  2ESE A;  2QKQ A;  1LKY A;  1B0X A;  2DL0 A;  5JTI A;  2K60 A;  1V85 A;  1SV4 A;  1X40 A;  4RQM A;  2Y9U A;  2F44 A;  3BS5 A;  5J8Y A;  1DXS A;  3KKA C;  3TAD A;  2L5Y A;  2EAO A;  1UCV A;  1OW5 A;  2KE7 A;  2E8P A;  1F0M A;  2F3N A;  5JU5 A;  2KSO B;  4MHV A;  1WWV A;  2K4P A;  2E8M A;  2GLE A;  2D3D A;  2E8O A;  3SEN A;  5JRT A;  2B6G A;  2F8K A;  2QB0 A;  1V38 A;  1SXD A;  2DKZ A;  1WWU A;  4NJ8 A;  1SV0 C;  1KW4 A;  3TAD C;  2FE9 A;  3HIL A;  3KKA A;  1UQV A;  4PZN A;  2DKX A;  2JV3 A;  1X9X A;  2KIV A;  2QB0 B;  3IDW A;  2D8C A;  1JI7 A;  3H8M A;  1B4F A;  3BS5 B;  1SGG A;  2QAR A;  4IS7 A;  1Z1V A;  4NL9 C;  5J8Y C;  2Y9T A;  2EAM A;  2LPE A;  1OXJ A;  2LMR A;  2YTU A;  1LKY B;  5F3X B;  2QB1 A;  1PK1 A;  2EAN A;  1PK3 A;  2QAR B;  4NL9 A;  3TAC B;  1PK1 B;  2KMD A;  4PZO A;  3BS7 A;  2EAP A;  2ES6 A;  1RG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...