1OW5A

Nmr structure of the saccharomyces cerevisiae sam (sterile alpha motif) domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
PFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase STE11
publication title The solution structure of the S.cerevisiae Ste11 MAPKKK SAM domain and its partnership with Ste50.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 15
structure length 60
sequence length 60
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ow5A00
3BS5B 2E8MA 5JRTA 3BQ7A 3KKAA 3HILA 1UCVA 2LPEA 2KE7A 2QB0A 5KNIA 1F0MA 2EAMA 3KKAC 3TADC 5JTIA 2ES6A 2KSOA 1SV0A 1B0XA 2F3NA 2JV3A 2QB0B 5J8YA 1WWVA 2YTUA 2KSOB 2DL0A 4MHVA 5J8YC 4RQMA 2Y9TA 2F8KA 1COKA 4RQNA 1PK1B 2QARA 1WWUA 1JI7A 4NJ8A 2FE9A 2ESEA 2D3DA 2E8PA 2QARB 2EAOA 2Y9UA 2B6GA 2K4PA 1X40A 2L5YA 2KG5A 1SXDA 3K1RB 2E8NA 1SV0C 2DKZA 2EANA 3BS7A 4PZNA 4NL9A 3SEIA 2QB1A 1KW4A 1OW5A 2K60A 2KIVA 5JU5A 2GLEA 1OXJA 1X66A 4IS7A 3H8MA 1X9XA 2E8OA 1UQVA 3SENA 1Z1VA 2QKQA 1SV4A 3TADA 2DKXA 4PZOA 2EAPA 3TACB 2D8CA 2KMDA 4NL9C 1PK3A 1B4FA 5F3XB 1LKYA 1V38A 1SGGA 2LMRA 1LKYB 3BS5A 1RG6A 1PK1A 1V85A 1SXEA 2F44A 3IDWA 1DXSA 5L1MA
chains in the Genus database with same CATH superfamily
2HI0A 2E8MA 2GWSA 3GILA 1JROA 2K8CB 3O0FA 2R8IA 1X2IA 3DV9A 3HILA 1F44A 4GFJA 4NLBA 2OM6A 2FPKA 3IG8A 4UB1A 2R8JA 9ICUA 9ICWA 1ZQRA 2F3NA 4Y2VA 4TQRA 4R8UB 4KLQA 4O3NA 5DGBA 2WF6A 4YR2A 2DL0A 2KTQA 1RYRA 3RRGA 4CF4A 5KFHA 4R64A 2J6UA 2KKPA 2ZIUB 4FZMA 4RQNA 3TKAA 2HOFA 5ALVA 3KFUF 4K4GA 1X40A 4F4KA 1IG6A 4UARA 5J2CA 4FE3A 2E8NA 5E79U 5J2AA 4JMUA 2FI1A 2HMXA 4FZNA 4RQ0A 3M8RA 9ICJA 5EOZA 1S97A 3C29A 3ED5A 2KIVA 2W3RA 3G6YA 4DS4A 4EZ6A 2VA2A 1DOQA 1XWLA 5HHIA 5AKJA 5AI8A 2HBLA 4F5NA 4DSFA 1QH9A 3ICXA 4DOCA 2BKEA 3OSPA 1T94A 8ICIA 2JHDA 2B0CA 4DQPA 3QZ7A 4ECZA 3PNCA 5HR7A 4OO1J 2IHNA 4OJ5A 3TQ1A 3KBBA 4UAYA 4PH5A 4FS2A 5ALQA 5ALMA 1PK1A 3M7DA 4KN7A 4PGQA 4QJFB 4O5CA 3QU4A 1S9FA 1BPEA 5ALDA 4I2HA 4KN4A 4DWIA 4I2AA 7ICJA 4Z6FA 4R8UA 4BX9C 2V4RA 2MA1A 3N7SC 1XO0A 4YD1A 5F9NA 3QYPA 3L5KA 4UB3A 4K4IA 9ICPA 2ZIUA 2HSZA 1NI3A 5AHXA 2O6KA 1SWWA 3OGUA 4YN4A 1ZOLA 2HDOA 2WB1C 4KMOB 4Z6DA 5KFBA 4I27A 5AM0A 4DOAA 3D2QA 1A6SA 5J0RA 5CJ7A 2Y9UA 3RB3A 4UW9A 3H4DA 2L5YA 4R63A 7ICMA 1Q46A 1D8YA 1QLNA 2BQUA 1FFVA 4JV0A 3MFHA 5KFOA 4I29A 3A0BU 4M2YA 1SB3C 4FO6A 3H4BA 2F1IA 7ICIA 1OXJA 5DB9A 1UPHA 2AH5A 5ALKA 3M1YA 4X5VA 3V6JA 2OWOA 1EXNA 2W9CB 4ELVA 1RPLA 4EEKA 3WK9A 5AI4A 4ECYA 3OHBA 4HAIA 1OUQA 2DGZA 5A0LA 3RJFA 3ISCA 3LWMA 3TANA 3K4GA 4DLGA 1GO3F 2XY6A 1QTMA 2A19A 4IRCA 2C22A 2VANA 4YR3A 1RG6A 1S8OA 1T3QA 4NV0A 3BJYA 4IRKA 5D4BA 3U26A 4UBBA 1QQ5A 2W7OA 3RRHA 1TV9A 4G9BA 1KSPA 5J0WA 1ZYQA 4MFAA 1RZTA 2F1JA 2BDPA 4QZBA 4KLUA 1VDVA 1JN3A 3ORYA 5DB7A 3ETRA 4WJ3B 3EW9A 4QIWF 3RTVA 2Y1IA 4AYBC 1ZJMA 3BQ1A 4I2FA 5AM1A 2NRVA 5BOMA 3UXNA 4MHVA 1ZQKA 4OJPA 5J2FA 2P35A 3H7IA 4M9JA 2LM1A 5AKKA 2ZUCA 3ZDBA 9ICBA 4NJ8A 1JXEA 5KL8B 3T5KA 2KVSA 4F4XA 3OPXA 3THVA 4YCXA 3S6JA 1N5WA 3WKCA 4RQ8A 2W9AA 2ZJ5A 2GOLA 5DG8A 1D8BA 1T7PA 4R65A 1Q8KA 4O0IA 1N62A 2W55A 4IQVA 2F77X 3IV6A 4NL9A 1JXLA 4P0QB 1Z00B 3GIJA 2UVRA 3I1YA 4C8KA 2FPLA 1X6JA 1X6IA 4KMUA 2CXYA 4LZDA 4C80A 4ED6A 4XRHA 2LYHA 5HR6A 2MRLA 3EPIA 2FLLA 5KG3A 1UQVA 4QW9A 2PXIA 3QEBZ 3NTUA 2BCRA 4O5KA 3IG5A 1KEJA 1SWVA 2EAPA 2MSNA 2ZUDA 4DSIA 5AKXA 3IRUA 3CYMA 3Q8LA 3CNHA 3WK7A 3RR7A 1ZQHA 4O3PA 3IM1A 3BZKA 1LKYB 4NM1A 1V85A 2YMPA 3M6ZA 2IMWP 2V4QA 4PGYA 4DSEA 2M0NA 3PVXA 4C8LA 4JUZA 2C2EA 2AJQA 3T5JA 1ZQSA 3EUB2 1QQ7A 1S0NA 1U48A 4QZIA 1UT8A 2ES6A 5D49A 2LM4A 2W03A 5KG2A 3VC8A 9ICMA 1L3VA 4P4MA 2F8LA 2Y9TA 3OHAA 2Y0SC 4QZEA 3C2MA 2G09A 1Z19A 4YP3A 9ICQA 2NO4A 3BQTA 1JI7A 1NJWA 4ZH4A 4I2DA 3TAPA 3C5FA 2K4HA 2ZTEA 3V7JA 5ALXA 3GIKA 3PR5B 1JMSA 2Q0ZX 4TQSA 2XCPA 1MA7A 2I1QA 4PHAA 2K4EA 4P0QA 1Z00A 3EWAA 3K1ZA 3WKAA 4I2GA 3DDHA 5J0XA 1ZQAA 3Q8KA 1KL9A 1PVQA 1QQ6A 4M9HA 3E58A 3KZXA 5KFIA 1ZD5A 1BNOA 9ICRA 3EPGA 4Q8FA 2HVHA 2AGQA 1N2XA 4DFPA 2JRZA 3KHGA 5ALPA 5KFKA 3H40A 4IS7A 8ICVA 2EZZA 2Z7JA 8ICQA 1HJPA 4DQSA 5IILA 5AM4A 4O3SA 1NKEA 5D46A 3ALRA 5DBCA 1KDHA 4M9GA 5AI5A 5DDYA 4F50A 1U49A 5F9LA 1NK9A 1LKYA 2KOBA 5L1KA 2MUTA 2KHQA 2KEYA 1BPYA 3LVVA 3ZI4A 1Z3EB 4F2RA 2ZJ8A 7ICPA 3C1YA 1PVPA 1NJZA 3KHRA 2HHQA 2KHVA 3N97B 3TADC 1HEKA 1NZPA 3C21A 1ZQEA 2ASJA 4F3OA 3CRXA 2P6UA 3KOOA 4MF8A 4IQUA 4C8NA 4XQ8A 5AM2A 5AI0A 2BGWA 7ICTA 4GC7A 3RFAA 1AQ6A 2BPCA 3RAXA 2M9NA 5KFFA 2NRTA 3PW5A 1M6YA 5C5JA 1CI4A 1O03A 4FS1A 3T3FA 4O9MA 5ALTA 2E8PA 3B9JA 9ICGA 4U7CA 1SL2A 2FPMA 1Q3VA 2BPGA 3WK5A 3HRDD 5IIOA 3BQ2A 2XI9A 3D2SA 3M9OB 4UAWA 1J2MA 2XICA 4YMMA 1SV0C 3H8WA 5AKZA 4DL4A 4RUAA 2K8AA 4Y2SA 1L5UA 9ICCA 4M6WB 4CF3A 2BHNA 1XC9A 3AM9A 4KLGA 4DFMA 8ICGA 4B9MA 4UB4A 4B6JA 3LK9A 3QX7A 5L9XA 4DL5A 1X9XA 4PL2A 1T4GA 3ZDAA 5KAFU 7ICNA 3N28A 5KFYA 3PX4A 4UQGA 1V97A 5KFAA 4KLSA 2R18A 2W8LA 2OH2A 3UM9A 3NVWA 7ICKA 4GC6A 2AU0A 4KLDA 4JB3A 3WKBA 5KG5A 4NY8A 4UASA 4ICAA 5KFPA 2JXJA 4J9NA 1RM6C 5J2GA 3N7PD 4P4OA 2DBYA 4KLLA 2ISPA 9ICLA 1C20A 4J9PA 2F44A 4KLOA 5EE3A 4MFCA 4CDGA 5EWGA 3H8SA 1LVHA 5ALNA 2RDJA 2JEIA 5AKHA 1CUKA 3F5AA 3SI8A 3C2LA 4RT2A 4KX3A 4QWBA 2KJ8A 2HOQA 5KG6A 5J8YA 1QSYA 3NASA 2LI6A 1YT3A 3PY8A 1ZQFA 4J9QA 4DSJA 3V72A 4RQMA 2W7PA 5J0TA 1P7DA 4DQRA 1PK1B 4Y2JA 2ESEA 4LVSA 3E2EA 2LYAA 1FIQA 3M9NB 2W11A 5AKLA 2HW3A 2B21A 5GTHU 4F4ZA 4C8OA 5ALEA 5IIJA 1SKSA 4NLZA 3K1RB 4M6WA 3AN1A 2J6SA 5AKIA 1L3SA 2KJ5A 2ASLA 4Z6CA 2G5HB 3GFKB 2C2DA 9ICTA 4J9SA 4RZRA 4P0PA 3Q8MA 3AL0B 2E3TA 4DS5A 5BPCA 1L8OA 1FFUA 1Z1VA 4YD2A 5IIKA 1SZHA 4C4SA 2PI4A 1MC8A 4AP9A 4EYIB 5KFSA 2KN7A 3TACB 2I9GA 4ACOA 5KG1A 4QWDA 4FBTA 4C7ZA 3WK4A 8ICRA 2W43A 5T14A 3PV8A 1PZNA 4O3RA 5KFLA 3MGHA 1VJ5A 1RXWA 5B5EU 1N63A 1U4BA 4XUSA 2YQEA 4M47A 3QNMA 3KKAC 5JTIA 3FYHA 2C2RA 1ZQPA 3QUQA 4YVZA 4ECTA 4C4TA 3TFSA 3MABA 3ZD9A 5ALIA 5L1LA 2J6TA 3FM9A 2JH7A 5HNKA 1ZQOA 5DQGA 4F72A 4Q43A 5KFZA 2C28A 5GTIU 2JEFA 5CHGA 2E5SA 3HKZF 4US9A 1XSLA 4IC9A 3G6VA 8ICPA 7ICVA 3WK8A 2R8GA 5KFCA 3PX0A 2BCVA 4CNQA 4EZ9A 1A0PA 3RR8A 1KQQA 2GH1A 4TUPA 3SEIA 5AK3A 8ICYA 1B43A 3F2CA 9ICVA 2A1AA 2CN1A 1TAQA 4RQ7A 1N56A 5CEHA 2HBJA 5BOLA 4ED2A 2ALZA 4YG2A 4QW8A 2OXOA 3M8SA 5KFTA 1XS9D 3KHLA 4RNNA 3TADA 1ZQTA 2H3IA 4PZOA 2ZUBA 4BDPA 1Y88A 1TK5A 3N4MB 3RH4A 3SR6A 1ZRNA 2PFNA 7ICRA 5J2HA 1N48A 2VA3A 2G06A 3PW7A 1XO1A 1MSWD 2K4IA 4OJOA 3PZPA 4DL6A 7ICUA 5AKGA 9ICAA 4US8A 4RUCA 4M9NA 3SD7A 3SMVA 1NKCA 1UCVA 2HHVA 1KKXA 4QZ8A 4C8MA 2ZIWB 1SV0A 4CGZA 4QZAA 4LZGA 1DGJA 2FLPA 5KL1B 3UQ0A 4C7YA 3FC4A 1D8LA 4RQ2A 3A0HU 5G5HA 5HMLA 2EDUA 2AQ4A 5KT6A 1D9DA 2H5XA 3L3FX 4J03A 1NKBA 3J81j 3D2NA 3NUQA 2RLTA 4QWAA 5K4LA 5HP4A 3NGDA 3MR2A 4MF2A 5AKYA 4RNOA 2YMMA 4QNLA 2FDRA 1FEZA 4KX5A 5TISU 2JZBA 3LWLA 4ECUA 4B9TA 4YR0A 3RB0A 3QXGA 4ECRA 2YB4A 2UVVA 3RJEA 3C23A 4PHDA 4MFFA 1VLBA 4QZCA 2PI5A 3JPPA 1D9FA 4BJQA 4OD0A 4KLFA 4Y2QA 3HPOA 5KG4A 3GZFA 1Q3UA 1X9WA 4PGXA 3BQ0A 9ICEA 2KMDA 3PSIA 2ZG6A 2FJ6A 2WTFA 2G08A 4DQIA 1CRXA 1ZXIA 5CR0A 4DL2A 3M9MB 5J0OA 1ZQCA 5J0SA 2MAXA 5EWFA 3RBEA 2KICA 3AEVA 1Z4OA 1KBUA 3QU5A 4KLIA 4UATA 3RJKA 2K8BB 2KNJA 3MR3A 9ICNA 8ICSA 4B9UA 2ZIWA 2R8HA 2W3SA 4QWCA 3TFRA 1Z1BA 4NLNA 4FZLA 2ZTCA 2QB0B 3MGVA 5L1JA 1BGXT 1JUDA 4KLEA 2MUTB 1S77D 2RHFA 3V6KA 4J9RA 7ICOA 3UMCA 5ALGA 1BPXA 4DO9A 2MU2A 2G0AA 2HHUA 5TZVA 9ICFA 5ALWA 8ICUA 3SV4A 4FFDA 5KFMA 5C0YA 5KT5A 4ED1A 2Y0SF 1ECWA 4ECQA 4PZNA 1KFSA 5ALRA 5KFDA 1S10A 2VJ4A 2YB1A 4USAA 4Y2YA 1IV8A 5KT2A 4F5OA 1LB2B 3CP8A 1C7YA 4F2SA 2IOFA 2ZJAA 3F5EA 1IM4A 4IR1A 2GO7A 5KT4A 3HW8A 5IINA 1RXVA 3TARA 4DLEA 3ETLA 4QZHA 4Q44A 3KTQA 1NK8A 1ZD2P 4F91B 4PHEA 1JX4A 2G5IB 3DEEA 3R9KA 9ICHA 3BDPA 2WFAA 1TKDA 2P66A 5L1MA 4KLHA 7ICFA 2NRZA 4RPXA 5CB1A 3F2DA 3V6HA 2WF9A 4TUQA 2QB0A 2ODGA 2PFQA 3RB4A 2BCUA 4J9OA 2E1EA 3PW4A 1B0XA 2BCSA 4DFDA 4M0AA 1WWVA 1NJXA 4O3OA 3PMLA 7ICQA 4I2JA 1YZ7A 2F8KA 3H0LB 4RPZA 2PMZF 4DQQA 1U9LA 4RU9A 2FE9A 2D3DA 1RQLA 8ICKA 1ZQWA 1L7MA 3IN5A 2EAOA 2WAQF 4C4RA 4EEYA 2PFPA 5KFJA 3MDCA 2NO5A 4MEXA 4F5RA 2DFLA 2XVTA 2EANA 1T3NA 1A77A 2ASDA 3OJSA 4EBDA 4UAUA 3QZ8A 2AHOB 3JPSA 4TUSA 2DPJA 2D6FC 2XY7A 5AK4A 4DSKA 2KKVA 2YMQA 4ED0A 2Y1JA 2W9MA 2BQRA 4GXJA 1ZQUA 2H3ZA 2KZMA 2K89A 3GIMA 5FP0A 1ZRMA 2E8OA 4I2CA 1MN8A 3PMNA 3SAGA 1SV4A 1T8EA 3MR6A 3NS1A 1XSNA 2H3VA 5KT7A 1HUOA 1L8LA 2JH1A 1IIPA 4ECWA 1B22A 1BNPA 3QE9Y 1S0OA 3AQFA 1SGGA 3UMBA 2G07A 3HT3A 4P0PB 4P4PA 5CA7A 1NNLA 4DSLA 3BQ7A 5AK5A 9ICOA 9ICKA 3OSNA 5B66U 4PJ0U 4O3MA 2HHSA 2HCFA 2UVWA 1LV5A 1NOMA 2JV3A 2A1JB 2AGPA 4RPYA 1TVAA 2R8KA 3LVWA 3ONNA 8ICTA 1UA0A 1WG8A 3QUTA 3AMZA 5AIAA 1TE2A 2LHTA 4CRXA 3MGIA 1NZBA 4J9KA 4BXOB 1N60A 2OEHA 4DEZA 1X9SA 3NRZA 2WF7A 5DLFA 1ZD4A 1TK8A 2HHXA 4ELUA 4PL1A 1ZQBA 4G3IA 3UXOA 2KP7A 5ALUA 3BS7A 4HYKA 9ICXA 4NM2A 4ECVA 2BPFA 1UHUA 2XY5A 1JALA 3G6XA 1JRPA 3VCBA 5ALYA 8ICBA 5KFQA 2OYYA 3SENA 3B0XA 1F5SA 5J2EA 2E1FA 3F53A 2LYBA 4GXIA 3HX0A 1RDFA 1TAUA 4KLTA 1SKRA 5KAIU 5KT3A 1KLNA 2DF4B 5F3XB 1V38A 3H0RB 4IQWA 4KLMA 3PSFA 3OJUA 2XO7A 5EE9A 5DDMA 2NRXA 4ZOHC 3UMGA 5JRTA 1O08A 2F2AB 5J2DA 4JWNA 2EZYA 4Q8EA 2A1JA 2AQ0A 1PVRA 3NRWA 2XGPA 3TI0A 8ICCA 4UB2A 3PW0A 2DPIA 3UQ2A 3JPTA 5G5GA 2YN4A 1URJA 3GV8B 2DUYA 2PFOA 1WUDA 2JEGA 4BXOA 5IIIA 2CPRA 5EWEA 3LDAA 4RQ1A 1RYUA 3H0MB 7ICGA 3QU7A 1PUZA 4EENA 2K4PA 4CE6A 2Q4TA 3PO5A 5KFUA 1SXDA 1YZ6A 2ZIVB 1FO4A 2RRDA 4F5PA 5DLGA 2IHMA 3V7KA 4GIBA 2QB1A 3N7RC 2F1HA 2KK0A 3C2KA 1L3TA 4NLGA 4I2IA 1S0VA 4LJXA 2CRXA 4Y2PA 3SAFA 4M04A 2VJ5A 5AM3A 4ED7A 1KN5A 2QKQA 2LBOA 2WB1F 1K5OA 7ICSA 4MEYA 5AM5A 8ICLA 2EH9A 4GXKA 8ICXA 4B9NA 3HKZC 2YMLA 3HWTA 3MDAA 2HHWA 3PO4A 5KFEA 1TFRA 4B9VA 1KFTA 2JZBB 1A76A 2DWQA 3CW2C 2IOHA 1NJYA 3RH5A 1DXSA 5J0QA 5CWRA 1S76D 2XIDA 2VKQA 1HIWA 8ICWA 5KFVA 1ZQGA 5AICA 4PPXA 3F2BA 3LYSA 2KE7A 5DKWA 2KZ3A 5ALOA 1ZQXA 4DF8A 1L6NA 4F5QA 4DCCA 2V9WA 2KV2A 4JK1A 4BWJA 2FMQA 5ALZA 2I6XA 1V9PA 5ALHA 1KRPA 1WWUA 3AUOA 4YMOA 2AXTU 1N61A 5HMMA 4B9LA 2F76X 5KG7A 2ZIVA 5J2KA 2KG5A 1SL1A 4TURA 1K1QA 5AI9A 1DK3A 5ALFA 3C28A 4O5EA 1AROP 5H2FU 4PHPA 5DG9A 1XNSA 5KFRA 1JIHA 4EBEA 3NVVA 4AYBF 4U6PA 3AU6A 1DRGA 3PW2A 3IP4B 1J97A 2BCQA 3SYZA 3K75D 1ZETA 5J2JA 3MFIA 4UBCA 4QWEA 3I76A 3MC1A 3QEAZ 1ZQIA 5DB6A 1L7OA 4QIWC 4F92B 1SIJA 1H38A 1BVSA 1KFDA 5DBAA 3M6KA 1ZJNA 4BWMA 4I2BA 5KG0A 4IRDA 3WK6A 5KFWA 4ECSA 2JEJA 1BPZA 1S5LU 1HUZA 4E0DA 1TAMA 4EX7A 2OHFA 5AIBA 2EAMA 3T79A 3QUBA 1WCNA 1WYGA 2YTUA 8ICNA 2KSOB 2UVUA 3SQIA 3Q8QB 4I2EA 5J8YC 4EX6A 1NK4A 4F71A 1DK2A 1XU4A 4DFKA 3PX6A 3RAQA 1NK5A 1X9MA 2XCAA 2JR5A 4DL7A 7ICHA 3ZDEA 2XGQA 4GLXA 3KHHA 3KD3A 8ICMA 2N1RA 2W9CA 1SZPA 4FBUA 4F4WA 1COOA 3BZCA 4EBCA 3GQCA 2WF5A 1MQ2A 4K4HA 2FMPA 5ALSA 1RYSA 3E0FA 1IXRA 2IOFK 3GU3A 3Q8SB 1ZQMA 1CEZA 4YXMA 5AKEA 4M9LA 1Z4NA 5KFXA 3SZ2A 3UPQA 1KTQA 4Y2TA 3WKDA 2A3VA 1N5XA 2W54A 5DQHA 3C5GA 3GDXA 3GV5B 4UB8U 1RQNA 5DG7A 4A8EA 4Y2XA 4RQ6A 5J0PA 4UB5A 2DKXA 3RJJA 2YY6A 2BR0A 2YX8A 2HVIA 4RQ5A 4QZFA 3EZ5A 7ICEA 3C1ZA 4ED3A 2LMRA 2ATLA 2EZXA 4RQ4A 4RT3A 2FMSA 1MQ3A 3IDWA 3QU2A 3D6JA 3BS5B 4DF4A 2HOIA 4KITB 3HJEA 3KKAA 1X42A 2AGOA 1UT5A 2LPEA 1ZQJA 3MR5A 3QUCA 8ICEA 5KFNA 4QZDA 4IQTA 2KJ9A 1BPDA 1WCLA 1F0MA 2NRWA 4UAZA 3T5HA 9ICIA 2KSOA 2HHTA 3RJHA 1ZQNA 3JPQA 3Q8PB 2WF8A 4OCZA 2BDUA 2QLTA 3RF9A 2ISOA 3WU2U 1NK7A 1TK0A 3RB6A 4NXZA 3QU9A 4IR9A 2QARB 4QZ9A 1BPBA 3TAQA 2KZZA 4RNMA 4J9LA 2W04A 1XSPA 1NK0A 1L7NA 4OJ6A 2BZFA 2KIWA 3IHQB 2RP5A 2ZXIA 5DBBA 3V7LA 4Q45A 1L7PA 5DQIA 9ICSA 8ICOA 2OCEA 3UXPA 4KLJA 2KVCA 5KFGA 2XC9A 8ICZA 4UB6U 5IIMA 2ZIXB 2W9BB 3JPRA 1OW5A 2K60A 5J2BA 5JU5A 2HBMA 4B9SA 3HP6A 4UAVA 1X66A 5J29A 4I28A 2IA6A 8ICAA 4JWMA 3Q8RB 2PMZC 5L1IA 1ZQZA 1U47A 5J0UA 4ECXA 3ZDCA 2VA8A 5CP2A 2D8CA 3KZIU 2I5HA 4JV2A 1PK3A 4KTQA 2LKYA 3JPNA 3ZDDA 2WAQC 4Z6EA 5DGAA 1ZQVA 2KD1A 3BS5A 4QZGA 2WHEA 2W8KA 4P2HA 1QSLA 5EE1A 3SAHA 1SL0A 8ICHA 4YXJA 3JPOA 7ICLA 3AU2A 4JV1A 4R66A 2DQNB 3SV3A 3EYZA 4DL3A 5DB8A 3RBDA 3L4PA 4F93B 5KNIA 4BUGA 2RDIA 3B0YA 2JGAA 3NVZA 1SKWA 1ZQDA 3FDSA 4EELA 1ZQQA 3I28A 4ELTA 4F8RA 4NLCA 1S0MA 3RH6A 2RQ5A 2KFZA 3T5LA 5J2IA 1COKA 2HBKA 4CF5A 4F4YA 1ZD3A 5HHHA 4XA5A 2QARA 1ZQYA 5KTQA 3PR4A 2NYVA 4OJLA 8ICJA 3RJIA 4EYHB 3OTQA 2B6GA 1L3UA 4RQ3A 4DOBA 4IL6U 2KFNA 2ZTDA 4NWIA 1ZQLA 2DKZA 2H3QA 5ALJA 4ED8A 2ZIXA 1ZQ1C 3ISDA 1QSSA 3GIIA 2W9BA 1K1SA 5CRXA 1KW4A 3GV7B 5J0YA 1NK6A 4NLKA 3H8JA 1J2NA 3PSPA 5ALLA 2PKEA 4YQWA 2ZXHA 4O3QA 2GLEA 1UA1A 5AI6A 2EQYA 3H8MA 2VIXA 3ZD8A 4BGDA 4CCHA 1ED1A 4YMNA 1U45A 1QCKA 2IBKA 2H3FA 3MBYA 3RJGA 8ICFA 5EE0A 2JMGA 4YFKA 5JUMA 4Y2RA 4NL9C 1B4FA 3NVYA 2BQ3A 2P6RA 3ISBA 4DFJA 3AQEA 5AK6A 3WKEA 2NV3A 3FAHA 2FLNA 4Y2UA 1DGSA 1SXEA 4C0ZA 4J9MA 3PSTA
chains in the Genus database with same CATH topology
3BS5B 2E8MA 5JRTA 3BQ7A 3KKAA 3HILA 1UCVA 2LPEA 2KE7A 2QB0A 5KNIA 1F0MA 2EAMA 3KKAC 3TADC 5JTIA 2ES6A 2KSOA 1SV0A 1B0XA 2F3NA 2JV3A 2QB0B 5J8YA 1WWVA 2YTUA 2KSOB 2DL0A 4MHVA 5J8YC 4RQMA 2Y9TA 2F8KA 1COKA 4RQNA 1PK1B 2QARA 1WWUA 1JI7A 4NJ8A 2FE9A 2ESEA 2D3DA 2E8PA 2QARB 2EAOA 2Y9UA 2B6GA 2K4PA 1X40A 2L5YA 2KG5A 1SXDA 3K1RB 2E8NA 1SV0C 2DKZA 2EANA 3BS7A 4PZNA 4NL9A 3SEIA 2QB1A 1KW4A 1OW5A 2K60A 2KIVA 5JU5A 2GLEA 1OXJA 1X66A 4IS7A 3H8MA 1X9XA 2E8OA 1UQVA 3SENA 1Z1VA 2QKQA 1SV4A 3TADA 2DKXA 4PZOA 2EAPA 3TACB 2D8CA 2KMDA 4NL9C 1PK3A 1B4FA 5F3XB 1LKYA 1V38A 1SGGA 2LMRA 1LKYB 3BS5A 1RG6A 1PK1A 1V85A 1SXEA 2F44A 3IDWA 1DXSA 5L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS5 B;  2E8M A;  5JRT A;  3BQ7 A;  3KKA A;  3HIL A;  1UCV A;  2LPE A;  2KE7 A;  2QB0 A;  5KNI A;  1F0M A;  2EAM A;  3KKA C;  3TAD C;  5JTI A;  2ES6 A;  2KSO A;  1SV0 A;  1B0X A;  2F3N A;  2JV3 A;  2QB0 B;  5J8Y A;  1WWV A;  2YTU A;  2KSO B;  2DL0 A;  4MHV A;  5J8Y C;  4RQM A;  2Y9T A;  2F8K A;  1COK A;  4RQN A;  1PK1 B;  2QAR A;  1WWU A;  1JI7 A;  4NJ8 A;  2FE9 A;  2ESE A;  2D3D A;  2E8P A;  2QAR B;  2EAO A;  2Y9U A;  2B6G A;  2K4P A;  1X40 A;  2L5Y A;  2KG5 A;  1SXD A;  3K1R B;  2E8N A;  1SV0 C;  2DKZ A;  2EAN A;  3BS7 A;  4PZN A;  4NL9 A;  3SEI A;  2QB1 A;  1KW4 A;  1OW5 A;  2K60 A;  2KIV A;  5JU5 A;  2GLE A;  1OXJ A;  1X66 A;  4IS7 A;  3H8M A;  1X9X A;  2E8O A;  1UQV A;  3SEN A;  1Z1V A;  2QKQ A;  1SV4 A;  3TAD A;  2DKX A;  4PZO A;  2EAP A;  3TAC B;  2D8C A;  2KMD A;  4NL9 C;  1PK3 A;  1B4F A;  5F3X B;  1LKY A;  1V38 A;  1SGG A;  2LMR A;  1LKY B;  3BS5 A;  1RG6 A;  1PK1 A;  1V85 A;  1SXE A;  2F44 A;  3IDW A;  1DXS A;  5L1M A; 
#chains in the Genus database with same CATH topology
 2HI0 A;  2E8M A;  2GWS A;  3GIL A;  1JRO A;  2K8C B;  3O0F A;  2R8I A;  1X2I A;  3DV9 A;  3HIL A;  1F44 A;  4GFJ A;  4NLB A;  2OM6 A;  2FPK A;  3IG8 A;  4UB1 A;  2R8J A;  9ICU A;  9ICW A;  1ZQR A;  2F3N A;  4Y2V A;  4TQR A;  4R8U B;  4KLQ A;  4O3N A;  5DGB A;  2WF6 A;  4YR2 A;  2DL0 A;  2KTQ A;  1RYR A;  3RRG A;  4CF4 A;  5KFH A;  4R64 A;  2J6U A;  2KKP A;  2ZIU B;  4FZM A;  4RQN A;  3TKA A;  2HOF A;  5ALV A;  3KFU F;  4K4G A;  1X40 A;  4F4K A;  1IG6 A;  4UAR A;  5J2C A;  4FE3 A;  2E8N A;  5E79 U;  5J2A A;  4JMU A;  2FI1 A;  2HMX A;  4FZN A;  4RQ0 A;  3M8R A;  9ICJ A;  5EOZ A;  1S97 A;  3C29 A;  3ED5 A;  2KIV A;  2W3R A;  3G6Y A;  4DS4 A;  4EZ6 A;  2VA2 A;  1DOQ A;  1XWL A;  5HHI A;  5AKJ A;  5AI8 A;  2HBL A;  4F5N A;  4DSF A;  1QH9 A;  3ICX A;  4DOC A;  2BKE A;  3OSP A;  1T94 A;  8ICI A;  2JHD A;  2B0C A;  4DQP A;  3QZ7 A;  4ECZ A;  3PNC A;  5HR7 A;  4OO1 J;  2IHN A;  4OJ5 A;  3TQ1 A;  3KBB A;  4UAY A;  4PH5 A;  4FS2 A;  5ALQ A;  5ALM A;  1PK1 A;  3M7D A;  4KN7 A;  4PGQ A;  4QJF B;  4O5C A;  3QU4 A;  1S9F A;  1BPE A;  5ALD A;  4I2H A;  4KN4 A;  4DWI A;  4I2A A;  7ICJ A;  4Z6F A;  4R8U A;  4BX9 C;  2V4R A;  2MA1 A;  3N7S C;  1XO0 A;  4YD1 A;  5F9N A;  3QYP A;  3L5K A;  4UB3 A;  4K4I A;  9ICP A;  2ZIU A;  2HSZ A;  1NI3 A;  5AHX A;  2O6K A;  1SWW A;  3OGU A;  4YN4 A;  1ZOL A;  2HDO A;  2WB1 C;  4KMO B;  4Z6D A;  5KFB A;  4I27 A;  5AM0 A;  4DOA A;  3D2Q A;  1A6S A;  5J0R A;  5CJ7 A;  2Y9U A;  3RB3 A;  4UW9 A;  3H4D A;  2L5Y A;  4R63 A;  7ICM A;  1Q46 A;  1D8Y A;  1QLN A;  2BQU A;  1FFV A;  4JV0 A;  3MFH A;  5KFO A;  4I29 A;  3A0B U;  4M2Y A;  1SB3 C;  4FO6 A;  3H4B A;  2F1I A;  7ICI A;  1OXJ A;  5DB9 A;  1UPH A;  2AH5 A;  5ALK A;  3M1Y A;  4X5V A;  3V6J A;  2OWO A;  1EXN A;  2W9C B;  4ELV A;  1RPL A;  4EEK A;  3WK9 A;  5AI4 A;  4ECY A;  3OHB A;  4HAI A;  1OUQ A;  2DGZ A;  5A0L A;  3RJF A;  3ISC A;  3LWM A;  3TAN A;  3K4G A;  4DLG A;  1GO3 F;  2XY6 A;  1QTM A;  2A19 A;  4IRC A;  2C22 A;  2VAN A;  4YR3 A;  1RG6 A;  1S8O A;  1T3Q A;  4NV0 A;  3BJY A;  4IRK A;  5D4B A;  3U26 A;  4UBB A;  1QQ5 A;  2W7O A;  3RRH A;  1TV9 A;  4G9B A;  1KSP A;  5J0W A;  1ZYQ A;  4MFA A;  1RZT A;  2F1J A;  2BDP A;  4QZB A;  4KLU A;  1VDV A;  1JN3 A;  3ORY A;  5DB7 A;  3ETR A;  4WJ3 B;  3EW9 A;  4QIW F;  3RTV A;  2Y1I A;  4AYB C;  1ZJM A;  3BQ1 A;  4I2F A;  5AM1 A;  2NRV A;  5BOM A;  3UXN A;  4MHV A;  1ZQK A;  4OJP A;  5J2F A;  2P35 A;  3H7I A;  4M9J A;  2LM1 A;  5AKK A;  2ZUC A;  3ZDB A;  9ICB A;  4NJ8 A;  1JXE A;  5KL8 B;  3T5K A;  2KVS A;  4F4X A;  3OPX A;  3THV A;  4YCX A;  3S6J A;  1N5W A;  3WKC A;  4RQ8 A;  2W9A A;  2ZJ5 A;  2GOL A;  5DG8 A;  1D8B A;  1T7P A;  4R65 A;  1Q8K A;  4O0I A;  1N62 A;  2W55 A;  4IQV A;  2F77 X;  3IV6 A;  4NL9 A;  1JXL A;  4P0Q B;  1Z00 B;  3GIJ A;  2UVR A;  3I1Y A;  4C8K A;  2FPL A;  1X6J A;  1X6I A;  4KMU A;  2CXY A;  4LZD A;  4C80 A;  4ED6 A;  4XRH A;  2LYH A;  5HR6 A;  2MRL A;  3EPI A;  2FLL A;  5KG3 A;  1UQV A;  4QW9 A;  2PXI A;  3QEB Z;  3NTU A;  2BCR A;  4O5K A;  3IG5 A;  1KEJ A;  1SWV A;  2EAP A;  2MSN A;  2ZUD A;  4DSI A;  5AKX A;  3IRU A;  3CYM A;  3Q8L A;  3CNH A;  3WK7 A;  3RR7 A;  1ZQH A;  4O3P A;  3IM1 A;  3BZK A;  1LKY B;  4NM1 A;  1V85 A;  2YMP A;  3M6Z A;  2IMW P;  2V4Q A;  4PGY A;  4DSE A;  2M0N A;  3PVX A;  4C8L A;  4JUZ A;  2C2E A;  2AJQ A;  3T5J A;  1ZQS A;  3EUB 2;  1QQ7 A;  1S0N A;  1U48 A;  4QZI A;  1UT8 A;  2ES6 A;  5D49 A;  2LM4 A;  2W03 A;  5KG2 A;  3VC8 A;  9ICM A;  1L3V A;  4P4M A;  2F8L A;  2Y9T A;  3OHA A;  2Y0S C;  4QZE A;  3C2M A;  2G09 A;  1Z19 A;  4YP3 A;  9ICQ A;  2NO4 A;  3BQT A;  1JI7 A;  1NJW A;  4ZH4 A;  4I2D A;  3TAP A;  3C5F A;  2K4H A;  2ZTE A;  3V7J A;  5ALX A;  3GIK A;  3PR5 B;  1JMS A;  2Q0Z X;  4TQS A;  2XCP A;  1MA7 A;  2I1Q A;  4PHA A;  2K4E A;  4P0Q A;  1Z00 A;  3EWA A;  3K1Z A;  3WKA A;  4I2G A;  3DDH A;  5J0X A;  1ZQA A;  3Q8K A;  1KL9 A;  1PVQ A;  1QQ6 A;  4M9H A;  3E58 A;  3KZX A;  5KFI A;  1ZD5 A;  1BNO A;  9ICR A;  3EPG A;  4Q8F A;  2HVH A;  2AGQ A;  1N2X A;  4DFP A;  2JRZ A;  3KHG A;  5ALP A;  5KFK A;  3H40 A;  4IS7 A;  8ICV A;  2EZZ A;  2Z7J A;  8ICQ A;  1HJP A;  4DQS A;  5IIL A;  5AM4 A;  4O3S A;  1NKE A;  5D46 A;  3ALR A;  5DBC A;  1KDH A;  4M9G A;  5AI5 A;  5DDY A;  4F50 A;  1U49 A;  5F9L A;  1NK9 A;  1LKY A;  2KOB A;  5L1K A;  2MUT A;  2KHQ A;  2KEY A;  1BPY A;  3LVV A;  3ZI4 A;  1Z3E B;  4F2R A;  2ZJ8 A;  7ICP A;  3C1Y A;  1PVP A;  1NJZ A;  3KHR A;  2HHQ A;  2KHV A;  3N97 B;  3TAD C;  1HEK A;  1NZP A;  3C21 A;  1ZQE A;  2ASJ A;  4F3O A;  3CRX A;  2P6U A;  3KOO A;  4MF8 A;  4IQU A;  4C8N A;  4XQ8 A;  5AM2 A;  5AI0 A;  2BGW A;  7ICT A;  4GC7 A;  3RFA A;  1AQ6 A;  2BPC A;  3RAX A;  2M9N A;  5KFF A;  2NRT A;  3PW5 A;  1M6Y A;  5C5J A;  1CI4 A;  1O03 A;  4FS1 A;  3T3F A;  4O9M A;  5ALT A;  2E8P A;  3B9J A;  9ICG A;  4U7C A;  1SL2 A;  2FPM A;  1Q3V A;  2BPG A;  3WK5 A;  3HRD D;  5IIO A;  3BQ2 A;  2XI9 A;  3D2S A;  3M9O B;  4UAW A;  1J2M A;  2XIC A;  4YMM A;  1SV0 C;  3H8W A;  5AKZ A;  4DL4 A;  4RUA A;  2K8A A;  4Y2S A;  1L5U A;  9ICC A;  4M6W B;  4CF3 A;  2BHN A;  1XC9 A;  3AM9 A;  4KLG A;  4DFM A;  8ICG A;  4B9M A;  4UB4 A;  4B6J A;  3LK9 A;  3QX7 A;  5L9X A;  4DL5 A;  1X9X A;  4PL2 A;  1T4G A;  3ZDA A;  5KAF U;  7ICN A;  3N28 A;  5KFY A;  3PX4 A;  4UQG A;  1V97 A;  5KFA A;  4KLS A;  2R18 A;  2W8L A;  2OH2 A;  3UM9 A;  3NVW A;  7ICK A;  4GC6 A;  2AU0 A;  4KLD A;  4JB3 A;  3WKB A;  5KG5 A;  4NY8 A;  4UAS A;  4ICA A;  5KFP A;  2JXJ A;  4J9N A;  1RM6 C;  5J2G A;  3N7P D;  4P4O A;  2DBY A;  4KLL A;  2ISP A;  9ICL A;  1C20 A;  4J9P A;  2F44 A;  4KLO A;  5EE3 A;  4MFC A;  4CDG A;  5EWG A;  3H8S A;  1LVH A;  5ALN A;  2RDJ A;  2JEI A;  5AKH A;  1CUK A;  3F5A A;  3SI8 A;  3C2L A;  4RT2 A;  4KX3 A;  4QWB A;  2KJ8 A;  2HOQ A;  5KG6 A;  5J8Y A;  1QSY A;  3NAS A;  2LI6 A;  1YT3 A;  3PY8 A;  1ZQF A;  4J9Q A;  4DSJ A;  3V72 A;  4RQM A;  2W7P A;  5J0T A;  1P7D A;  4DQR A;  1PK1 B;  4Y2J A;  2ESE A;  4LVS A;  3E2E A;  2LYA A;  1FIQ A;  3M9N B;  2W11 A;  5AKL A;  2HW3 A;  2B21 A;  5GTH U;  4F4Z A;  4C8O A;  5ALE A;  5IIJ A;  1SKS A;  4NLZ A;  3K1R B;  4M6W A;  3AN1 A;  2J6S A;  5AKI A;  1L3S A;  2KJ5 A;  2ASL A;  4Z6C A;  2G5H B;  3GFK B;  2C2D A;  9ICT A;  4J9S A;  4RZR A;  4P0P A;  3Q8M A;  3AL0 B;  2E3T A;  4DS5 A;  5BPC A;  1L8O A;  1FFU A;  1Z1V A;  4YD2 A;  5IIK A;  1SZH A;  4C4S A;  2PI4 A;  1MC8 A;  4AP9 A;  4EYI B;  5KFS A;  2KN7 A;  3TAC B;  2I9G A;  4ACO A;  5KG1 A;  4QWD A;  4FBT A;  4C7Z A;  3WK4 A;  8ICR A;  2W43 A;  5T14 A;  3PV8 A;  1PZN A;  4O3R A;  5KFL A;  3MGH A;  1VJ5 A;  1RXW A;  5B5E U;  1N63 A;  1U4B A;  4XUS A;  2YQE A;  4M47 A;  3QNM A;  3KKA C;  5JTI A;  3FYH A;  2C2R A;  1ZQP A;  3QUQ A;  4YVZ A;  4ECT A;  4C4T A;  3TFS A;  3MAB A;  3ZD9 A;  5ALI A;  5L1L A;  2J6T A;  3FM9 A;  2JH7 A;  5HNK A;  1ZQO A;  5DQG A;  4F72 A;  4Q43 A;  5KFZ A;  2C28 A;  5GTI U;  2JEF A;  5CHG A;  2E5S A;  3HKZ F;  4US9 A;  1XSL A;  4IC9 A;  3G6V A;  8ICP A;  7ICV A;  3WK8 A;  2R8G A;  5KFC A;  3PX0 A;  2BCV A;  4CNQ A;  4EZ9 A;  1A0P A;  3RR8 A;  1KQQ A;  2GH1 A;  4TUP A;  3SEI A;  5AK3 A;  8ICY A;  1B43 A;  3F2C A;  9ICV A;  2A1A A;  2CN1 A;  1TAQ A;  4RQ7 A;  1N56 A;  5CEH A;  2HBJ A;  5BOL A;  4ED2 A;  2ALZ A;  4YG2 A;  4QW8 A;  2OXO A;  3M8S A;  5KFT A;  1XS9 D;  3KHL A;  4RNN A;  3TAD A;  1ZQT A;  2H3I A;  4PZO A;  2ZUB A;  4BDP A;  1Y88 A;  1TK5 A;  3N4M B;  3RH4 A;  3SR6 A;  1ZRN A;  2PFN A;  7ICR A;  5J2H A;  1N48 A;  2VA3 A;  2G06 A;  3PW7 A;  1XO1 A;  1MSW D;  2K4I A;  4OJO A;  3PZP A;  4DL6 A;  7ICU A;  5AKG A;  9ICA A;  4US8 A;  4RUC A;  4M9N A;  3SD7 A;  3SMV A;  1NKC A;  1UCV A;  2HHV A;  1KKX A;  4QZ8 A;  4C8M A;  2ZIW B;  1SV0 A;  4CGZ A;  4QZA A;  4LZG A;  1DGJ A;  2FLP A;  5KL1 B;  3UQ0 A;  4C7Y A;  3FC4 A;  1D8L A;  4RQ2 A;  3A0H U;  5G5H A;  5HML A;  2EDU A;  2AQ4 A;  5KT6 A;  1D9D A;  2H5X A;  3L3F X;  4J03 A;  1NKB A;  3J81 j;  3D2N A;  3NUQ A;  2RLT A;  4QWA A;  5K4L A;  5HP4 A;  3NGD A;  3MR2 A;  4MF2 A;  5AKY A;  4RNO A;  2YMM A;  4QNL A;  2FDR A;  1FEZ A;  4KX5 A;  5TIS U;  2JZB A;  3LWL A;  4ECU A;  4B9T A;  4YR0 A;  3RB0 A;  3QXG A;  4ECR A;  2YB4 A;  2UVV A;  3RJE A;  3C23 A;  4PHD A;  4MFF A;  1VLB A;  4QZC A;  2PI5 A;  3JPP A;  1D9F A;  4BJQ A;  4OD0 A;  4KLF A;  4Y2Q A;  3HPO A;  5KG4 A;  3GZF A;  1Q3U A;  1X9W A;  4PGX A;  3BQ0 A;  9ICE A;  2KMD A;  3PSI A;  2ZG6 A;  2FJ6 A;  2WTF A;  2G08 A;  4DQI A;  1CRX A;  1ZXI A;  5CR0 A;  4DL2 A;  3M9M B;  5J0O A;  1ZQC A;  5J0S A;  2MAX A;  5EWF A;  3RBE A;  2KIC A;  3AEV A;  1Z4O A;  1KBU A;  3QU5 A;  4KLI A;  4UAT A;  3RJK A;  2K8B B;  2KNJ A;  3MR3 A;  9ICN A;  8ICS A;  4B9U A;  2ZIW A;  2R8H A;  2W3S A;  4QWC A;  3TFR A;  1Z1B A;  4NLN A;  4FZL A;  2ZTC A;  2QB0 B;  3MGV A;  5L1J A;  1BGX T;  1JUD A;  4KLE A;  2MUT B;  1S77 D;  2RHF A;  3V6K A;  4J9R A;  7ICO A;  3UMC A;  5ALG A;  1BPX A;  4DO9 A;  2MU2 A;  2G0A A;  2HHU A;  5TZV A;  9ICF A;  5ALW A;  8ICU A;  3SV4 A;  4FFD A;  5KFM A;  5C0Y A;  5KT5 A;  4ED1 A;  2Y0S F;  1ECW A;  4ECQ A;  4PZN A;  1KFS A;  5ALR A;  5KFD A;  1S10 A;  2VJ4 A;  2YB1 A;  4USA A;  4Y2Y A;  1IV8 A;  5KT2 A;  4F5O A;  1LB2 B;  3CP8 A;  1C7Y A;  4F2S A;  2IOF A;  2ZJA A;  3F5E A;  1IM4 A;  4IR1 A;  2GO7 A;  5KT4 A;  3HW8 A;  5IIN A;  1RXV A;  3TAR A;  4DLE A;  3ETL A;  4QZH A;  4Q44 A;  3KTQ A;  1NK8 A;  1ZD2 P;  4F91 B;  4PHE A;  1JX4 A;  2G5I B;  3DEE A;  3R9K A;  9ICH A;  3BDP A;  2WFA A;  1TKD A;  2P66 A;  5L1M A;  4KLH A;  7ICF A;  2NRZ A;  4RPX A;  5CB1 A;  3F2D A;  3V6H A;  2WF9 A;  4TUQ A;  2QB0 A;  2ODG A;  2PFQ A;  3RB4 A;  2BCU A;  4J9O A;  2E1E A;  3PW4 A;  1B0X A;  2BCS A;  4DFD A;  4M0A A;  1WWV A;  1NJX A;  4O3O A;  3PML A;  7ICQ A;  4I2J A;  1YZ7 A;  2F8K A;  3H0L B;  4RPZ A;  2PMZ F;  4DQQ A;  1U9L A;  4RU9 A;  2FE9 A;  2D3D A;  1RQL A;  8ICK A;  1ZQW A;  1L7M A;  3IN5 A;  2EAO A;  2WAQ F;  4C4R A;  4EEY A;  2PFP A;  5KFJ A;  3MDC A;  2NO5 A;  4MEX A;  4F5R A;  2DFL A;  2XVT A;  2EAN A;  1T3N A;  1A77 A;  2ASD A;  3OJS A;  4EBD A;  4UAU A;  3QZ8 A;  2AHO B;  3JPS A;  4TUS A;  2DPJ A;  2D6F C;  2XY7 A;  5AK4 A;  4DSK A;  2KKV A;  2YMQ A;  4ED0 A;  2Y1J A;  2W9M A;  2BQR A;  4GXJ A;  1ZQU A;  2H3Z A;  2KZM A;  2K89 A;  3GIM A;  5FP0 A;  1ZRM A;  2E8O A;  4I2C A;  1MN8 A;  3PMN A;  3SAG A;  1SV4 A;  1T8E A;  3MR6 A;  3NS1 A;  1XSN A;  2H3V A;  5KT7 A;  1HUO A;  1L8L A;  2JH1 A;  1IIP A;  4ECW A;  1B22 A;  1BNP A;  3QE9 Y;  1S0O A;  3AQF A;  1SGG A;  3UMB A;  2G07 A;  3HT3 A;  4P0P B;  4P4P A;  5CA7 A;  1NNL A;  4DSL A;  3BQ7 A;  5AK5 A;  9ICO A;  9ICK A;  3OSN A;  5B66 U;  4PJ0 U;  4O3M A;  2HHS A;  2HCF A;  2UVW A;  1LV5 A;  1NOM A;  2JV3 A;  2A1J B;  2AGP A;  4RPY A;  1TVA A;  2R8K A;  3LVW A;  3ONN A;  8ICT A;  1UA0 A;  1WG8 A;  3QUT A;  3AMZ A;  5AIA A;  1TE2 A;  2LHT A;  4CRX A;  3MGI A;  1NZB A;  4J9K A;  4BXO B;  1N60 A;  2OEH A;  4DEZ A;  1X9S A;  3NRZ A;  2WF7 A;  5DLF A;  1ZD4 A;  1TK8 A;  2HHX A;  4ELU A;  4PL1 A;  1ZQB A;  4G3I A;  3UXO A;  2KP7 A;  5ALU A;  3BS7 A;  4HYK A;  9ICX A;  4NM2 A;  4ECV A;  2BPF A;  1UHU A;  2XY5 A;  1JAL A;  3G6X A;  1JRP A;  3VCB A;  5ALY A;  8ICB A;  5KFQ A;  2OYY A;  3SEN A;  3B0X A;  1F5S A;  5J2E A;  2E1F A;  3F53 A;  2LYB A;  4GXI A;  3HX0 A;  1RDF A;  1TAU A;  4KLT A;  1SKR A;  5KAI U;  5KT3 A;  1KLN A;  2DF4 B;  5F3X B;  1V38 A;  3H0R B;  4IQW A;  4KLM A;  3PSF A;  3OJU A;  2XO7 A;  5EE9 A;  5DDM A;  2NRX A;  4ZOH C;  3UMG A;  5JRT A;  1O08 A;  2F2A B;  5J2D A;  4JWN A;  2EZY A;  4Q8E A;  2A1J A;  2AQ0 A;  1PVR A;  3NRW A;  2XGP A;  3TI0 A;  8ICC A;  4UB2 A;  3PW0 A;  2DPI A;  3UQ2 A;  3JPT A;  5G5G A;  2YN4 A;  1URJ A;  3GV8 B;  2DUY A;  2PFO A;  1WUD A;  2JEG A;  4BXO A;  5III A;  2CPR A;  5EWE A;  3LDA A;  4RQ1 A;  1RYU A;  3H0M B;  7ICG A;  3QU7 A;  1PUZ A;  4EEN A;  2K4P A;  4CE6 A;  2Q4T A;  3PO5 A;  5KFU A;  1SXD A;  1YZ6 A;  2ZIV B;  1FO4 A;  2RRD A;  4F5P A;  5DLG A;  2IHM A;  3V7K A;  4GIB A;  2QB1 A;  3N7R C;  2F1H A;  2KK0 A;  3C2K A;  1L3T A;  4NLG A;  4I2I A;  1S0V A;  4LJX A;  2CRX A;  4Y2P A;  3SAF A;  4M04 A;  2VJ5 A;  5AM3 A;  4ED7 A;  1KN5 A;  2QKQ A;  2LBO A;  2WB1 F;  1K5O A;  7ICS A;  4MEY A;  5AM5 A;  8ICL A;  2EH9 A;  4GXK A;  8ICX A;  4B9N A;  3HKZ C;  2YML A;  3HWT A;  3MDA A;  2HHW A;  3PO4 A;  5KFE A;  1TFR A;  4B9V A;  1KFT A;  2JZB B;  1A76 A;  2DWQ A;  3CW2 C;  2IOH A;  1NJY A;  3RH5 A;  1DXS A;  5J0Q A;  5CWR A;  1S76 D;  2XID A;  2VKQ A;  1HIW A;  8ICW A;  5KFV A;  1ZQG A;  5AIC A;  4PPX A;  3F2B A;  3LYS A;  2KE7 A;  5DKW A;  2KZ3 A;  5ALO A;  1ZQX A;  4DF8 A;  1L6N A;  4F5Q A;  4DCC A;  2V9W A;  2KV2 A;  4JK1 A;  4BWJ A;  2FMQ A;  5ALZ A;  2I6X A;  1V9P A;  5ALH A;  1KRP A;  1WWU A;  3AUO A;  4YMO A;  2AXT U;  1N61 A;  5HMM A;  4B9L A;  2F76 X;  5KG7 A;  2ZIV A;  5J2K A;  2KG5 A;  1SL1 A;  4TUR A;  1K1Q A;  5AI9 A;  1DK3 A;  5ALF A;  3C28 A;  4O5E A;  1ARO P;  5H2F U;  4PHP A;  5DG9 A;  1XNS A;  5KFR A;  1JIH A;  4EBE A;  3NVV A;  4AYB F;  4U6P A;  3AU6 A;  1DRG A;  3PW2 A;  3IP4 B;  1J97 A;  2BCQ A;  3SYZ A;  3K75 D;  1ZET A;  5J2J A;  3MFI A;  4UBC A;  4QWE A;  3I76 A;  3MC1 A;  3QEA Z;  1ZQI A;  5DB6 A;  1L7O A;  4QIW C;  4F92 B;  1SIJ A;  1H38 A;  1BVS A;  1KFD A;  5DBA A;  3M6K A;  1ZJN A;  4BWM A;  4I2B A;  5KG0 A;  4IRD A;  3WK6 A;  5KFW A;  4ECS A;  2JEJ A;  1BPZ A;  1S5L U;  1HUZ A;  4E0D A;  1TAM A;  4EX7 A;  2OHF A;  5AIB A;  2EAM A;  3T79 A;  3QUB A;  1WCN A;  1WYG A;  2YTU A;  8ICN A;  2KSO B;  2UVU A;  3SQI A;  3Q8Q B;  4I2E A;  5J8Y C;  4EX6 A;  1NK4 A;  4F71 A;  1DK2 A;  1XU4 A;  4DFK A;  3PX6 A;  3RAQ A;  1NK5 A;  1X9M A;  2XCA A;  2JR5 A;  4DL7 A;  7ICH A;  3ZDE A;  2XGQ A;  4GLX A;  3KHH A;  3KD3 A;  8ICM A;  2N1R A;  2W9C A;  1SZP A;  4FBU A;  4F4W A;  1COO A;  3BZC A;  4EBC A;  3GQC A;  2WF5 A;  1MQ2 A;  4K4H A;  2FMP A;  5ALS A;  1RYS A;  3E0F A;  1IXR A;  2IOF K;  3GU3 A;  3Q8S B;  1ZQM A;  1CEZ A;  4YXM A;  5AKE A;  4M9L A;  1Z4N A;  5KFX A;  3SZ2 A;  3UPQ A;  1KTQ A;  4Y2T A;  3WKD A;  2A3V A;  1N5X A;  2W54 A;  5DQH A;  3C5G A;  3GDX A;  3GV5 B;  4UB8 U;  1RQN A;  5DG7 A;  4A8E A;  4Y2X A;  4RQ6 A;  5J0P A;  4UB5 A;  2DKX A;  3RJJ A;  2YY6 A;  2BR0 A;  2YX8 A;  2HVI A;  4RQ5 A;  4QZF A;  3EZ5 A;  7ICE A;  3C1Z A;  4ED3 A;  2LMR A;  2ATL A;  2EZX A;  4RQ4 A;  4RT3 A;  2FMS A;  1MQ3 A;  3IDW A;  3QU2 A;  3D6J A;  3BS5 B;  4DF4 A;  2HOI A;  4KIT B;  3HJE A;  3KKA A;  1X42 A;  2AGO A;  1UT5 A;  2LPE A;  1ZQJ A;  3MR5 A;  3QUC A;  8ICE A;  5KFN A;  4QZD A;  4IQT A;  2KJ9 A;  1BPD A;  1WCL A;  1F0M A;  2NRW A;  4UAZ A;  3T5H A;  9ICI A;  2KSO A;  2HHT A;  3RJH A;  1ZQN A;  3JPQ A;  3Q8P B;  2WF8 A;  4OCZ A;  2BDU A;  2QLT A;  3RF9 A;  2ISO A;  3WU2 U;  1NK7 A;  1TK0 A;  3RB6 A;  4NXZ A;  3QU9 A;  4IR9 A;  2QAR B;  4QZ9 A;  1BPB A;  3TAQ A;  2KZZ A;  4RNM A;  4J9L A;  2W04 A;  1XSP A;  1NK0 A;  1L7N A;  4OJ6 A;  2BZF A;  2KIW A;  3IHQ B;  2RP5 A;  2ZXI A;  5DBB A;  3V7L A;  4Q45 A;  1L7P A;  5DQI A;  9ICS A;  8ICO A;  2OCE A;  3UXP A;  4KLJ A;  2KVC A;  5KFG A;  2XC9 A;  8ICZ A;  4UB6 U;  5IIM A;  2ZIX B;  2W9B B;  3JPR A;  1OW5 A;  2K60 A;  5J2B A;  5JU5 A;  2HBM A;  4B9S A;  3HP6 A;  4UAV A;  1X66 A;  5J29 A;  4I28 A;  2IA6 A;  8ICA A;  4JWM A;  3Q8R B;  2PMZ C;  5L1I A;  1ZQZ A;  1U47 A;  5J0U A;  4ECX A;  3ZDC A;  2VA8 A;  5CP2 A;  2D8C A;  3KZI U;  2I5H A;  4JV2 A;  1PK3 A;  4KTQ A;  2LKY A;  3JPN A;  3ZDD A;  2WAQ C;  4Z6E A;  5DGA A;  1ZQV A;  2KD1 A;  3BS5 A;  4QZG A;  2WHE A;  2W8K A;  4P2H A;  1QSL A;  5EE1 A;  3SAH A;  1SL0 A;  8ICH A;  4YXJ A;  3JPO A;  7ICL A;  3AU2 A;  4JV1 A;  4R66 A;  2DQN B;  3SV3 A;  3EYZ A;  4DL3 A;  5DB8 A;  3RBD A;  3L4P A;  4F93 B;  5KNI A;  4BUG A;  2RDI A;  3B0Y A;  2JGA A;  3NVZ A;  1SKW A;  1ZQD A;  3FDS A;  4EEL A;  1ZQQ A;  3I28 A;  4ELT A;  4F8R A;  4NLC A;  1S0M A;  3RH6 A;  2RQ5 A;  2KFZ A;  3T5L A;  5J2I A;  1COK A;  2HBK A;  4CF5 A;  4F4Y A;  1ZD3 A;  5HHH A;  4XA5 A;  2QAR A;  1ZQY A;  5KTQ A;  3PR4 A;  2NYV A;  4OJL A;  8ICJ A;  3RJI A;  4EYH B;  3OTQ A;  2B6G A;  1L3U A;  4RQ3 A;  4DOB A;  4IL6 U;  2KFN A;  2ZTD A;  4NWI A;  1ZQL A;  2DKZ A;  2H3Q A;  5ALJ A;  4ED8 A;  2ZIX A;  1ZQ1 C;  3ISD A;  1QSS A;  3GII A;  2W9B A;  1K1S A;  5CRX A;  1KW4 A;  3GV7 B;  5J0Y A;  1NK6 A;  4NLK A;  3H8J A;  1J2N A;  3PSP A;  5ALL A;  2PKE A;  4YQW A;  2ZXH A;  4O3Q A;  2GLE A;  1UA1 A;  5AI6 A;  2EQY A;  3H8M A;  2VIX A;  3ZD8 A;  4BGD A;  4CCH A;  1ED1 A;  4YMN A;  1U45 A;  1QCK A;  2IBK A;  2H3F A;  3MBY A;  3RJG A;  8ICF A;  5EE0 A;  2JMG A;  4YFK A;  5JUM A;  4Y2R A;  4NL9 C;  1B4F A;  3NVY A;  2BQ3 A;  2P6R A;  3ISB A;  4DFJ A;  3AQE A;  5AK6 A;  3WKE A;  2NV3 A;  3FAH A;  2FLN A;  4Y2U A;  1DGS A;  1SXE A;  4C0Z A;  4J9M A;  3PST A; 
#chains in the Genus database with same CATH homology
 3BS5 B;  2E8M A;  5JRT A;  3BQ7 A;  3KKA A;  3HIL A;  1UCV A;  2LPE A;  2KE7 A;  2QB0 A;  5KNI A;  1F0M A;  2EAM A;  3KKA C;  3TAD C;  5JTI A;  2ES6 A;  2KSO A;  1SV0 A;  1B0X A;  2F3N A;  2JV3 A;  2QB0 B;  5J8Y A;  1WWV A;  2YTU A;  2KSO B;  2DL0 A;  4MHV A;  5J8Y C;  4RQM A;  2Y9T A;  2F8K A;  1COK A;  4RQN A;  1PK1 B;  2QAR A;  1WWU A;  1JI7 A;  4NJ8 A;  2FE9 A;  2ESE A;  2D3D A;  2E8P A;  2QAR B;  2EAO A;  2Y9U A;  2B6G A;  2K4P A;  1X40 A;  2L5Y A;  2KG5 A;  1SXD A;  3K1R B;  2E8N A;  1SV0 C;  2DKZ A;  2EAN A;  3BS7 A;  4PZN A;  4NL9 A;  3SEI A;  2QB1 A;  1KW4 A;  1OW5 A;  2K60 A;  2KIV A;  5JU5 A;  2GLE A;  1OXJ A;  1X66 A;  4IS7 A;  3H8M A;  1X9X A;  2E8O A;  1UQV A;  3SEN A;  1Z1V A;  2QKQ A;  1SV4 A;  3TAD A;  2DKX A;  4PZO A;  2EAP A;  3TAC B;  2D8C A;  2KMD A;  4NL9 C;  1PK3 A;  1B4F A;  5F3X B;  1LKY A;  1V38 A;  1SGG A;  2LMR A;  1LKY B;  3BS5 A;  1RG6 A;  1PK1 A;  1V85 A;  1SXE A;  2F44 A;  3IDW A;  1DXS A;  5L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...