1OW5A

Nmr structure of the saccharomyces cerevisiae sam (sterile alpha motif) domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
PFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the S.cerevisiae Ste11 MAPKKK SAM domain and its partnership with Ste50.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase STE11
total genus 15
structure length 60
sequence length 60
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ow5A00
2E8MA 3KKAA 4IS7A 1X66A 2YTUA 1WWUA 4PZOA 2KE7A 5JU5A 2E8PA 2QARA 1LKYB 2E8OA 1OXJA 2K4PA 3BQ7A 2QB0B 2K60A 1LKYA 5L1MA 1X40A 1PK3A 2DL0A 1KW4A 2KSOB 1X9XA 2KMDA 1Z1VA 1SXDA 1V85A 3TACB 3KKAC 1SV0C 2FE9A 4RQNA 5J8YC 3SENA 1WWVA 3BS5A 2LPEA 2QKQA 1UCVA 2QB1A 1B0XA 1V38A 2F44A 5KNIA 2LMRA 4NL9C 1COKA 3SEIA 3K1RB 1SV0A 4RQMA 2DKXA 2ES6A 5JRTA 2L5YA 2EAOA 2JV3A 2EANA 4NJ8A 2EAPA 2Y9UA 2EAMA 5F3XB 1F0MA 1OW5A 3IDWA 2D8CA 2F8KA 1JI7A 1PK1B 3BS7A 1DXSA 1B4FA 3TADA 2GLEA 2B6GA 1RG6A 5J8YA 2DKZA 2D3DA 2Y9TA 2QB0A 2ESEA 1SV4A 3BS5B 4MHVA 1SGGA 3H8MA 1PK1A 4NL9A 4PZNA 3HILA 1UQVA 2KG5A 3TADC 5JTIA 2KIVA 2KSOA 1SXEA 2F3NA 2QARB 2E8NA
chains in the Genus database with same CATH superfamily
4TQSA 5DBAA 3KKAA 2KOBA 4F5OA 3H0RB 5ALSA 4G9BA 9ICFA 2KZMA 2FPLA 4DLEA 1K1QA 2CXYA 3A0HU 1ZQVA 2O6KA 1J97A 3ORYA 4C8MA 3QUCA 1X6IA 4I2EA 1ZQ1C 2IOFK 2BR0A 2I1QA 4ICAA 4J9MA 1ZD3A 1NJYA 5L1MA 4O0IA 1S10A 4UB2A 3WU2U 2ZTCA 4ED2A 3DEEA 4DL4A 5L1LA 4NLZA 2WF7A 2FMPA 8ICUA 3PW4A 4RQNA 4M47A 5J2AA 3GDXA 4I29A 3PR5B 5J2IA 1V38A 3LK9A 3UXPA 4M04A 3K1RB 5ALOA 1JN3A 4GIBA 5KFQA 4J9LA 5ALGA 5AM1A 4OD0A 2JGAA 1UHUA 3QU9A 7ICSA 2EANA 5AKGA 1N48A 1D9FA 4B9NA 4J9QA 4I2AA 3LVWA 4EZ9A 2HOIA 5AICA 3TFSA 1JI7A 2F1JA 3B0YA 1SWVA 1RXVA 5J2BA 3AM9A 3UQ0A 1BPYA 3RBEA 2DKZA 2WB1C 2QB0A 3KZXA 2BQUA 4FZLA 2BPGA 4ED8A 3RJIA 5KAIU 3CRXA 1S77D 7ICLA 4YR2A 4EEYA 5JTIA 3MC1A 3PNCA 2BDPA 2JHDA 5ALRA 4C8NA 4O9MA 3G6YA 1XSLA 5KFNA 8ICQA 1V97A 1ZQFA 4GXKA 4IR9A 4R8UB 2G5HB 4BWMA 3NVZA 3UMGA 3EZ5A 5DGAA 1SKSA 4ECZA 1COOA 4RZRA 1PVQA 1RQLA 4KLSA 4C7ZA 4DSFA 3PR4A 5DB6A 1N60A 4UB8U 3OTQA 3BQ1A 5EE1A 3OHBA 4DS4A 3H4DA 2UVRA 4ZH4A 3QE9Y 3ZDAA 5FP0A 1ZXIA 1SXDA 5KFDA 1DK3A 2PKEA 4ECSA 4YG2A 4CE6A 2LPEA 2R8HA 2QKQA 2Y0SF 4ED3A 1UCVA 4MFFA 2EZZA 4BX9C 3N4MB 3GQCA 5AK3A 2A1JA 3HKZF 3F2BA 2KKVA 3C2KA 3GILA 1KRPA 4JK1A 3SR6A 2HW3A 4QJFB 1N63A 3WKBA 1TE2A 4Q43A 1Q3UA 3JPSA 4XUSA 3Q8RB 5KFGA 2KVCA 2GWSA 2HVIA 4KLUA 1WYGA 4Y2QA 3RTVA 4OO1J 4NWIA 3ZDDA 2G5IB 5AKEA 3IV6A 5KFXA 2WHEA 4F92B 4YR3A 1NKCA 1RYSA 5L1IA 1V9PA 1Q3VA 2AU0A 4XQ8A 1VLBA 2Q0ZX 1QQ5A 3B0XA 2BHNA 4KLJA 1HJPA 5J0WA 4UQGA 2KHVA 3RFAA 4PGYA 2W7OA 4KLIA 4C4SA 1DRGA 5AI6A 3UM9A 2FMQA 2DQNB 4K4IA 4ACOA 5DG7A 4PZOA 5KG0A 1NK8A 4DL3A 5AHXA 3Q8LA 2W3SA 1BPZA 5J0XA 8ICWA 2D6FC 3MR6A 4DFKA 4J03A 3MBYA 4QW8A 2WF6A 1KL9A 4CF4A 3OSPA 4QZ8A 3KTQA 4R65A 4MF8A 4C80A 4JV1A 3MDCA 2ASDA 3V7JA 4Z6FA 3MFIA 3F2CA 2A3VA 5DBBA 4IQWA 2MUTB 5AK5A 1JXEA 4KMUA 2VKQA 1ZD4A 1SV0C 4KLTA 1WCNA 2MSNA 3IP4B 3N7SC 4EENA 2VJ4A 5EE0A 2AGQA 4KLLA 2R8KA 5H2FU 3THVA 1JRPA 2K8BB 2C2EA 1NZPA 1QCKA 3OSNA 3QZ8A 4UAVA 3M9OB 4UB6U 4OJLA 1BPEA 2E1EA 4EELA 5AKKA 4UW9A 1RG6A 9ICHA 4DSIA 3C28A 5J2JA 1BPDA 4ED1A 2ZUBA 1PK1A 3DDHA 1SIJA 1HUZA 4R8UA 9ICCA 2HBMA 4UAYA 4F2RA 3KHGA 4Y2PA 1ED1A 3RB3A 5AK4A 4CCHA 3M7DA 2KV2A 5GTIU 3HP6A 8ICRA 1C7YA 2NRWA 3VC8A 1GO3F 3D2QA 5D49A 4JWNA 2BQRA 7ICJA 2KZZA 2ZIXB 2K4PA 2KHQA 5KT2A 1J2NA 3BQ7A 5KFAA 3L3FX 2LI6A 5AK6A 4X5VA 4DL5A 4YD1A 3PO4A 3TAPA 1U9LA 3E0FA 1S9FA 5B5EU 2JRZA 1ZQWA 3HT3A 2KK0A 5ALVA 3I76A 4KX3A 5D46A 4DF8A 2RLTA 5AI5A 2G0AA 3TACB 5KG1A 5AI9A 3HRDD 1IM4A 2LMRA 1FIQA 4O5KA 4J9OA 1KSPA 1RQNA 5JRTA 3JPOA 4YVZA 2NV3A 3C29A 1B22A 2CRXA 4DQPA 4NJ8A 1SL1A 2ZJ5A 3ETRA 1F0MA 1QH9A 2K4HA 4B9UA 5DDYA 1BNOA 1NNLA 4EEKA 2Y1JA 2Y0SC 1NK7A 3BS7A 3TADA 2BQ3A 4EYIB 2RP5A 5CJ7A 4F71A 1X42A 4Q44A 9ICOA 5ALJA 3GU3A 1TAQA 2F2AB 3RR8A 3RB0A 4OJOA 4O3QA 4O3RA 5J0UA 4FBUA 4B9MA 5ALYA 2RRDA 2F3NA 7ICRA 5IIIA 5ALHA 2NRZA 2AHOB 3OGUA 3KHHA 3ISBA 4J9KA 2I5HA 4IQTA 4IRDA 3QX7A 3C1ZA 4GXIA 1XS9D 5KFEA 4IQVA 4LZDA 5DQGA 4RNNA 4DO9A 1LKYB 2J6UA 1SL2A 3E58A 4KLMA 3TI0A 1ZQJA 2W03A 2VJ5A 3C23A 1S8OA 5KFPA 2W11A 1KKXA 3LWLA 5L1KA 4KLDA 4BUGA 2F1HA 1MC8A 1ZRMA 1QSSA 2EZXA 1X40A 1L3VA 5KFUA 3ZDCA 3AU2A 4UASA 3BQ0A 2W8KA 2DF4B 3G6VA 3QEAZ 4F5QA 2JZBB 1ZQOA 1JIHA 5KFLA 4QZDA 4QZHA 5KFTA 4F4WA 1M6YA 4NL9C 1COKA 3O0FA 2NO5A 3D6JA 1AROP 3Q8PB 3GFKB 7ICHA 4DQIA 2WAQC 4YMMA 4LZGA 4P0PA 2WB1F 3OHAA 2XO7A 1S5LU 1A0PA 9ICXA 4TUQA 5KFFA 2Y9UA 5TZVA 2OH2A 4RQ5A 2RQ5A 5DB9A 1MSWD 3PSTA 3NRWA 5AM0A 4US9A 1ZQNA 4F4ZA 4ECWA 1B4FA 3ZI4A 5J0PA 1UA0A 7ICTA 1IXRA 2AJQA 4MFCA 3WKEA 2H3FA 4U6PA 4QWEA 2YMMA 4KLEA 4Y2YA 4KTQA 2KG5A 1B43A 3QU7A 1NK0A 5L1JA 2KJ9A 2P6UA 1Q46A 3ONNA 9ICTA 1WG8A 3L4PA 8ICOA 4RUAA 1BVSA 5ALMA 1VJ5A 2HSZA 1SZHA 4KX5A 4FBTA 5K4LA 2JR5A 4UATA 2DPJA 3QZ7A 4NLBA 1RZTA 3ZDBA 3S6JA 7ICIA 3LDAA 3QU2A 4C4TA 3M9MB 2FI1A 4QZBA 8ICMA 4JMUA 1PK3A 1X9XA 4P2HA 2KMDA 2AXTU 4G3IA 4QWDA 1ZQXA 2FE9A 4F3OA 2Z7JA 5IIKA 4KLOA 2ZG6A 2JH1A 5KG7A 2XY7A 4HAIA 2NYVA 3MR3A 2B0CA 4O3NA 3N7PD 3SYZA 2W54A 3H8JA 3QUQA 2HOQA 2HHUA 2L5YA 8ICHA 2BCUA 3EW9A 2W43A 4LJXA 4DFMA 5F3XB 4Y2XA 5ALXA 4UB5A 3UMCA 3M9NB 4DSJA 4Y2VA 4RQ8A 2D3DA 4AYBF 4Y2UA 2UVVA 8ICNA 1SGGA 3PMLA 4PZNA 2C22A 4FFDA 1PZNA 4M9NA 3M8SA 3WK8A 4PGQA 4KMOB 4F93B 2QARB 3KD3A 5HMLA 1NKEA 4QZAA 4I2IA 3RBDA 4DL2A 1KEJA 3PMNA 2UVUA 5EOZA 1DOQA 4RU9A 1IIPA 1KFTA 2IMWP 4DOCA 2KICA 3GV5B 3MR2A 2LYAA 3RJEA 3M1YA 4R64A 4C8LA 2F76X 2W8LA 2YN4A 5ALFA 4I27A 2QB0B 3PSFA 3ED5A 4B9TA 4I2CA 4ZOHC 1NK4A 4C8OA 8ICVA 3FDSA 1L3UA 2G07A 1IG6A 4JWMA 2K89A 2KZ3A 2BDUA 5HHHA 1XU4A 2XICA 3V6KA 2GOLA 2ZIVB 3AN1A 5KL1B 2BKEA 3BDPA 5KFWA 3ISDA 1WUDA 4ED6A 2K4IA 4PPXA 2V4RA 4QWAA 4Q45A 4R63A 2HBLA 4I28A 4ED0A 2ZJ8A 4UBBA 3H7IA 1U47A 2E1FA 2KJ5A 2C28A 5DB8A 3LVVA 5DLFA 2WTFA 4DQRA 3T5KA 3L5KA 2CN1A 4UAWA 5AI8A 1U4BA 2OYYA 2XGQA 1ZQMA 3Q8KA 3EUB2 1CEZA 2HHVA 7ICOA 2HHWA 4KITB 1P7DA 2F8KA 4QWCA 1N62A 4F4XA 3SV4A 2EDUA 5DQHA 2ZIUA 5ALIA 2VA8A 4C0ZA 3RB4A 5IIMA 5J0SA 1BPBA 3RAQA 9ICMA 9ICQA 4C8KA 3UXNA 2J6TA 3SQIA 1SZPA 3N97B 5KT7A 1QLNA 1RM6C 2H3QA 2XCAA 5KG4A 3J81j 3MGHA 4RQ4A 5J0RA 1N5WA 3NVWA 3R9KA 2PI4A 4O5EA 4PHAA 1X9MA 5AM3A 1QQ6A 4F72A 5DBCA 4EBCA 9ICKA 2BPCA 2G09A 4XA5A 5KFSA 5KG2A 1BPXA 3C2LA 3H8WA 4NLCA 3HWTA 5ALPA 1L7PA 3G6XA 2FLPA 9ICVA 4KLFA 1L8LA 2B21A 3BZCA 1JXLA 5JUMA 2M9NA 3BS5A 4KN7A 1RXWA 2J6SA 2AGOA 5KTQA 4OJ5A 8ICFA 5KFKA 8ICXA 2W9BB 3IM1A 3PZPA 5KFYA 5J2EA 1SKWA 3PW7A 3JPPA 2KIWA 4ECQA 5KAFU 4BWJA 3KOOA 1ZQPA 1OW5A 4PL2A 2RDJA 2DPIA 2K8AA 3LYSA 2MUTA 4FZNA 1F44A 1DXSA 5AKYA 3HKZC 5EE3A 4F5RA 3MGIA 3QYPA 4BJQA 2W9CA 3JPRA 2ESEA 2AH5A 2AQ0A 1TK8A 8ICZA 1T3QA 2P35A 3KZIU 5J2DA 2GO7A 4RT3A 4BXOB 1JUDA 2IOHA 1L7OA 2PI5A 1HUOA 4EYHB 3PX0A 3V7LA 4P4MA 2YMQA 3NVVA 2ZXIA 4IL6U 1QSYA 3QU4A 2WF8A 4MEXA 5E79U 2W9BA 5C5JA 2E3TA 4XRHA 4FS1A 1K1SA 2ZIVA 2KEYA 3SMVA 2HHQA 2YMLA 3RJFA 3EPIA 9ICEA 3Q8MA 2ZIWB 4OJPA 5KFMA 1NJWA 1KW4A 4P4OA 8ICYA 3ICXA 5KT6A 4UARA 4Y2RA 4YP3A 2Q4TA 2GH1A 4QW9A 1WWVA 2W9MA 2BGWA 4I2BA 3BZKA 1WCLA 4RT2A 3D2SA 4M9JA 4PGXA 4NXZA 2FMSA 1KTQA 2ZXHA 4M0AA 1NOMA 2HBJA 2XY5A 4ECYA 1ZQHA 1JMSA 4NM2A 4Q8EA 2ASJA 2G06A 2NRTA 2JV3A 2ZIUB 3PW2A 4JV2A 1NK5A 3GV7B 7ICGA 4GFJA 4YQWA 1MQ3A 4RPXA 4QIWF 1A76A 4RPYA 4F2SA 5J8YA 5HP4A 2LKYA 2V9WA 1N5XA 5KT4A 3RH5A 2ZIWA 1UQVA 1ZQRA 1ZQKA 2KIVA 4FO6A 3KHLA 4U7CA 4F5PA 3GIKA 3V6JA 3K75D 1RYUA 2G08A 5ALZA 3UPQA 4QZCA 3T5HA 5ALUA 2BCRA 4IS7A 1Z4OA 4B6JA 1S0VA 3RJGA 5AKIA 2KE7A 5JU5A 1EXNA 2E8PA 1ZJMA 2LYHA 5AKXA 4DQQA 1KDHA 1Z00B 4NY8A 2H3ZA 4K4HA 4DCCA 1DGJA 1U49A 2KVSA 5C0YA 5CRXA 8ICSA 1H38A 2JEJA 3OJUA 4DOBA 2XY6A 4Z6DA 4ED7A 2HOFA 2IOFA 2IBKA 3FYHA 3TQ1A 1QTMA 3RJKA 4TUPA 1Z1VA 2C2DA 3SAHA 1L7NA 3QUBA 3ZD8A 3EYZA 5IINA 2M0NA 4O3PA 4GC7A 1B0XA 4Y2SA 9ICIA 3KFUF 5ALEA 9ICAA 5J29A 5IILA 3PSIA 3U26A 5CR0A 2EZYA 8ICEA 3M6ZA 4DL6A 3TANA 8ICTA 2EAPA 2ZTEA 1CRXA 2A1JB 3SV3A 4C7YA 2I9GA 3F2DA 2ZJAA 1Z00A 2KJ8A 5DG9A 2PXIA 3N7RC 5EE9A 2W04A 5B66U 3UQ2A 1ZQTA 1KFDA 1YZ7A 3H8MA 2W7PA 1N56A 5DGBA 5J2GA 4B9LA 2KSOA 4M9GA 2ISOA 4CGZA 1NI3A 5IIJA 5ALQA 5ALWA 5HR6A 2JXJA 3NTUA 4BGDA 2PFQA 1ZJNA 2R8GA 1RPLA 1ECWA 4LVSA 2FJ6A 4RNOA 4DFDA 1OXJA 5KFIA 1N61A 5F9NA 2BCVA 2F1IA 2V4QA 3IG5A 4EX7A 3JPNA 5KFRA 1SB3C 5J2CA 2H5XA 5AKZA 4M9LA 4ECUA 3CYMA 3TFRA 3V72A 9ICUA 4QZ9A 5CHGA 5KFCA 8ICBA 1PVPA 4FZMA 4QZGA 4YCXA 3AL0B 2ISPA 2AQ4A 4GC6A 9ICLA 3C1YA 1SWWA 1V85A 1X9SA 1S0MA 4YFKA 4RQ2A 9ICRA 5DQIA 4DWIA 2YX8A 3SENA 1TFRA 4KLGA 4F91B 3RAXA 5BPCA 2QB1A 2BCSA 2HHTA 2MAXA 4UB3A 1SV0A 4Y2TA 5J2KA 4PHDA 1A77A 4CRXA 4IRKA 2XGPA 1O03A 2A19A 1ZQCA 2HHSA 4DSLA 4A8EA 5D4BA 3ISCA 2NRXA 4RQ0A 3TARA 1D8LA 4NM1A 3AQEA 1ZD2P 3WK9A 3Q8QB 4UB4A 1PK1B 3LWMA 4QZEA 4B9SA 3KHRA 3QNMA 1XO1A 2B6GA 3K1ZA 2DFLA 4ELTA 2DWQA 3CP8A 2UVWA 3UMBA 3H0LB 5ALLA 1TK5A 1T4GA 1CUKA 4YR0A 3GIJA 4NL9A 4MFAA 2R8JA 1ZQAA 3HILA 4RUCA 2HMXA 7ICEA 1KQQA 3C2MA 1MA7A 4GXJA 2HBKA 3MGVA 1ZD5A 2ZIXA 4USAA 1SL0A 4DFPA 1UT8A 2K4EA 3T5JA 3IRUA 3WKDA 1Z4NA 2YTUA 8ICJA 4PHEA 2IHMA 3NASA 1Z3EB 4DL7A 4YMOA 3KBBA 2FLNA 2Y1IA 4UAUA 2ZUCA 2NO4A 4ECTA 5CWRA 3H4BA 1T3NA 4YD2A 1J2MA 2WF9A 2FDRA 1U45A 2MU2A 2YQEA 3ALRA 2BCQA 4IC9A 1Q8KA 4I2GA 3GIIA 5GTHU 4TQRA 2EH9A 3NUQA 2YMPA 3FM9A 2W3RA 4DFJA 4QNLA 7ICNA 1VDVA 3F53A 3WKCA 2JEIA 2F44A 3IG8A 1CI4A 2N1RA 1O08A 5J0YA 2A1AA 1OUQA 1K5OA 2H3IA 5J0QA 3MR5A 1FEZA 5AM4A 1U48A 2ES6A 2CPRA 3OPXA 3JPQA 1NJXA 1X6JA 4RQ7A 2EAOA 4I2DA 4EBDA 3D2NA 5KG3A 3SAFA 1ZQDA 3F5AA 1LV5A 4P4PA 1PVRA 1A6SA 2AGPA 2MRLA 1L6NA 4NLKA 4O3OA 2GLEA 7ICPA 4EZ6A 5KFHA 4DEZA 4ECVA 2VANA 3MABA 2PFPA 4BDPA 4F4YA 1HIWA 4J9PA 5KT5A 2ODGA 3Q8SB 3TADC 2VA3A 2KD1A 2VIXA 1YT3A 2HHXA 1ZOLA 2KP7A 3PV8A 3I1YA 2E8NA 1JX4A 1URJA 1X66A 1ZQUA 5J2HA 3K4GA 1RDFA 1XSPA 4B9VA 7ICMA 4RPZA 2YB1A 3RRGA 1S0NA 4HYKA 4EBEA 5DDMA 3MFHA 2P6RA 3HJEA 2WF5A 4ECRA 2JZBA 1LKYA 2JH7A 4DF4A 4AP9A 3RR7A 3GIMA 1QSLA 4DLGA 3PVXA 2YB4A 5BOLA 4CDGA 5ALNA 5ALDA 2ATLA 1LB2B 1ZQBA 5EWEA 4RQ6A 1NK9A 4M6WA 7ICQA 1ZQSA 4OJ6A 4R66A 5F9LA 4QIWC 4F4KA 2RDIA 3SEIA 4E0DA 5CB1A 4Z6EA 4RQMA 3RRHA 4YXMA 3VCBA 1Y88A 2R8IA 1JALA 3AQFA 1MN8A 5DB7A 2FPKA 4FS2A 4PHPA 2OEHA 3B9JA 2D8CA 4QZIA 4P0PB 1L3SA 2K8CB 3ZD9A 5HNKA 3BS5B 2XC9A 3HPOA 4NV0A 4TUSA 4I2JA 4NLNA 1ZRNA 4IR1A 5J0TA 1SXEA 4KLQA 4UBCA 1FO4A 7ICKA 1C20A 3A0BU 4F5NA 1XO0A 2E8MA 2F77X 3CNHA 4OCZA 9ICJA 4DQSA 4CNQA 5A0LA 1WWUA 1DGSA 2IA6A 5AI0A 5KFZA 3E2EA 2R18A 4C4RA 2RHFA 3I28A 1KLNA 4MF2A 2JMGA 2ZUDA 3CW2C 8ICAA 3C5GA 4J9NA 2F8LA 1JROA 5CEHA 9ICPA 1XC9A 5HR7A 3PW0A 1T94A 4Z6CA 5AI4A 4MEYA 3QU5A 3IN5A 2XVTA 4JV0A 1D9DA 2JEGA 3T5LA 4QWBA 7ICFA 1L3TA 4TURA 4YXJA 1ZQGA 5DLGA 1RYRA 3HW8A 2DGZA 4P0QB 4ECXA 1TKDA 5KFOA 2LM1A 4YMNA 8ICLA 4UB1A 2OWOA 4O3SA 3AUOA 2E5SA 3NRZA 5G5GA 4O3MA 2OM6A 2C2RA 1TVAA 4NLGA 4M2YA 9ICBA 3V7KA 1ZYQA 4JB3A 5ALKA 2LYBA 1NK6A 4YN4A 2FPMA 2KN7A 3NS1A 4WJ3B 5J2FA 4GLXA 1ZQQA 4IRCA 1UPHA 1MQ2A 2HVHA 3GZFA 1S0OA 3BQTA 8ICIA 4DSKA 3AEVA 3WK5A 5DG8A 1XWLA 9ICSA 1TAUA 4ELUA 3OJSA 2PFOA 4PJ0U 1ZQEA 4Q8FA 5BOMA 4IQUA 1XSNA 1X2IA 2ALZA 3SI8A 4FE3A 1QQ7A 4K4GA 2LHTA 3QUTA 5EWFA 4M9HA 4P0QA 3M6KA 1Z1BA 5T14A 4DS5A 3H8SA 5HHIA 9ICNA 1HEKA 3PY8A 4PL1A 9ICWA 3RB6A 2QARA 4DOAA 2E8OA 1S97A 1TAMA 3ZDEA 3N28A 3RH6A 2K60A 3TAQA 2OHFA 4I2HA 8ICKA 4KN4A 3PX4A 5AKHA 3SAGA 5J0OA 1X9WA 5AIAA 3C5FA 3H40A 2OXOA 2KTQA 3PW5A 4M6WB 3BQ2A 1TK0A 2DL0A 2VA2A 5ALTA 1T7PA 3GV8B 5KFBA 1NZBA 5EWGA 1AQ6A 3KKAC 3F5EA 5IIOA 1L5UA 2PMZC 2DUYA 1T8EA 2NRVA 2EQYA 8ICPA 4UAZA 1FFVA 4Y2JA 5KT3A 1UT5A 1LVHA 3PX6A 2DKXA 1DK2A 3FAHA 2JEFA 3PO5A 1ZETA 1NJZA 5AM5A 3TKAA 3NVYA 3BJYA 8ICGA 1IV8A 2EAMA 3RH4A 3IDWA 3QXGA 1TV9A 5KG5A 5AKJA 3M8RA 3C21A 3UXOA 2FLLA 2KFZA 4RQ3A 2HCFA 1SV4A 4J9SA 5AIBA 4RQ1A 3JPTA 3WK6A 2HI0A 4PH5A 4O5CA 5HMMA 5CA7A 3V6HA 9ICGA 2XCPA 5L9XA 5CP2A 4US8A 2W9AA 2I6XA 1ZQYA 3ETLA 4F50A 2QLTA 2WFAA 4JUZA 3T79A 2XI9A 7ICUA 3DV9A 1BNPA 1Z19A 1ZQLA 1F5SA 1YZ6A 3RF9A 2OCEA 5KFJA 4EX6A 3RJJA 3RJHA 4DSEA 7ICVA 2KNJA 3NGDA 1KN5A 1FFUA 1S76D 3WKAA 2KSOB 2H3VA 1D8YA 4I2FA 1D8BA 4CF3A 5J8YC 1BGXT 2PFNA 5AKLA 1N2XA 3SD7A 2P66A 1XNSA 3SZ2A 3HX0A 5KL8B 4QZFA 5KNIA 2LBOA 5G5HA 3AMZA 2PMZF 4AYBC 1ZQZA 3H0MB 3FC4A 2W55A 3EPGA 2IHNA 5DKWA 4F8RA 2YY6A 2MA1A 3WK4A 2LM4A 1KBUA 4CF5A 4BXOA 2ZTDA 3EWAA 3PSPA 2Y9TA 1ZQIA 4ELVA 4KLHA 2BZFA 2WAQF 3WK7A 2KKPA 1PUZA 2XIDA 1L8OA 1UA1A 4MHVA 5AM2A 1KFSA 3T3FA 3IHQB 2BPFA 2DBYA 3QEBZ 2HDOA 2KFNA 3MDAA 1L7MA 5KFVA 1NKBA 5TISU 1SKRA 2ASLA 4J9RA 4RNMA 2W9CB 5KG6A 3AU6A 8ICCA
chains in the Genus database with same CATH topology
2E8MA 3KKAA 4IS7A 1X66A 2YTUA 1WWUA 4PZOA 2KE7A 5JU5A 2E8PA 2QARA 1LKYB 2E8OA 1OXJA 2K4PA 3BQ7A 2QB0B 2K60A 1LKYA 5L1MA 1X40A 1PK3A 2DL0A 1KW4A 2KSOB 1X9XA 2KMDA 1Z1VA 1SXDA 1V85A 3TACB 3KKAC 1SV0C 2FE9A 4RQNA 5J8YC 3SENA 1WWVA 3BS5A 2LPEA 2QKQA 1UCVA 2QB1A 1B0XA 1V38A 2F44A 5KNIA 2LMRA 4NL9C 1COKA 3SEIA 3K1RB 1SV0A 4RQMA 2DKXA 2ES6A 5JRTA 2L5YA 2EAOA 2JV3A 2EANA 4NJ8A 2EAPA 2Y9UA 2EAMA 5F3XB 1F0MA 1OW5A 3IDWA 2D8CA 2F8KA 1JI7A 1PK1B 3BS7A 1DXSA 1B4FA 3TADA 2GLEA 2B6GA 1RG6A 5J8YA 2DKZA 2D3DA 2Y9TA 2QB0A 2ESEA 1SV4A 3BS5B 4MHVA 1SGGA 3H8MA 1PK1A 4NL9A 4PZNA 3HILA 1UQVA 2KG5A 3TADC 5JTIA 2KIVA 2KSOA 1SXEA 2F3NA 2QARB 2E8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8M A;  3KKA A;  4IS7 A;  1X66 A;  2YTU A;  1WWU A;  4PZO A;  2KE7 A;  5JU5 A;  2E8P A;  2QAR A;  1LKY B;  2E8O A;  1OXJ A;  2K4P A;  3BQ7 A;  2QB0 B;  2K60 A;  1LKY A;  5L1M A;  1X40 A;  1PK3 A;  2DL0 A;  1KW4 A;  2KSO B;  1X9X A;  2KMD A;  1Z1V A;  1SXD A;  1V85 A;  3TAC B;  3KKA C;  1SV0 C;  2FE9 A;  4RQN A;  5J8Y C;  3SEN A;  1WWV A;  3BS5 A;  2LPE A;  2QKQ A;  1UCV A;  2QB1 A;  1B0X A;  1V38 A;  2F44 A;  5KNI A;  2LMR A;  4NL9 C;  1COK A;  3SEI A;  3K1R B;  1SV0 A;  4RQM A;  2DKX A;  2ES6 A;  5JRT A;  2L5Y A;  2EAO A;  2JV3 A;  2EAN A;  4NJ8 A;  2EAP A;  2Y9U A;  2EAM A;  5F3X B;  1F0M A;  1OW5 A;  3IDW A;  2D8C A;  2F8K A;  1JI7 A;  1PK1 B;  3BS7 A;  1DXS A;  1B4F A;  3TAD A;  2GLE A;  2B6G A;  1RG6 A;  5J8Y A;  2DKZ A;  2D3D A;  2Y9T A;  2QB0 A;  2ESE A;  1SV4 A;  3BS5 B;  4MHV A;  1SGG A;  3H8M A;  1PK1 A;  4NL9 A;  4PZN A;  3HIL A;  1UQV A;  2KG5 A;  3TAD C;  5JTI A;  2KIV A;  2KSO A;  1SXE A;  2F3N A;  2QAR B;  2E8N A; 
#chains in the Genus database with same CATH topology
 4TQS A;  5DBA A;  3KKA A;  2KOB A;  4F5O A;  3H0R B;  5ALS A;  4G9B A;  9ICF A;  2KZM A;  2FPL A;  4DLE A;  1K1Q A;  2CXY A;  3A0H U;  1ZQV A;  2O6K A;  1J97 A;  3ORY A;  4C8M A;  3QUC A;  1X6I A;  4I2E A;  1ZQ1 C;  2IOF K;  2BR0 A;  2I1Q A;  4ICA A;  4J9M A;  1ZD3 A;  1NJY A;  5L1M A;  4O0I A;  1S10 A;  4UB2 A;  3WU2 U;  2ZTC A;  4ED2 A;  3DEE A;  4DL4 A;  5L1L A;  4NLZ A;  2WF7 A;  2FMP A;  8ICU A;  3PW4 A;  4RQN A;  4M47 A;  5J2A A;  3GDX A;  4I29 A;  3PR5 B;  5J2I A;  1V38 A;  3LK9 A;  3UXP A;  4M04 A;  3K1R B;  5ALO A;  1JN3 A;  4GIB A;  5KFQ A;  4J9L A;  5ALG A;  5AM1 A;  4OD0 A;  2JGA A;  1UHU A;  3QU9 A;  7ICS A;  2EAN A;  5AKG A;  1N48 A;  1D9F A;  4B9N A;  4J9Q A;  4I2A A;  3LVW A;  4EZ9 A;  2HOI A;  5AIC A;  3TFS A;  1JI7 A;  2F1J A;  3B0Y A;  1SWV A;  1RXV A;  5J2B A;  3AM9 A;  3UQ0 A;  1BPY A;  3RBE A;  2DKZ A;  2WB1 C;  2QB0 A;  3KZX A;  2BQU A;  4FZL A;  2BPG A;  4ED8 A;  3RJI A;  5KAI U;  3CRX A;  1S77 D;  7ICL A;  4YR2 A;  4EEY A;  5JTI A;  3MC1 A;  3PNC A;  2BDP A;  2JHD A;  5ALR A;  4C8N A;  4O9M A;  3G6Y A;  1XSL A;  5KFN A;  8ICQ A;  1V97 A;  1ZQF A;  4GXK A;  4IR9 A;  4R8U B;  2G5H B;  4BWM A;  3NVZ A;  3UMG A;  3EZ5 A;  5DGA A;  1SKS A;  4ECZ A;  1COO A;  4RZR A;  1PVQ A;  1RQL A;  4KLS A;  4C7Z A;  4DSF A;  3PR4 A;  5DB6 A;  1N60 A;  4UB8 U;  3OTQ A;  3BQ1 A;  5EE1 A;  3OHB A;  4DS4 A;  3H4D A;  2UVR A;  4ZH4 A;  3QE9 Y;  3ZDA A;  5FP0 A;  1ZXI A;  1SXD A;  5KFD A;  1DK3 A;  2PKE A;  4ECS A;  4YG2 A;  4CE6 A;  2LPE A;  2R8H A;  2QKQ A;  2Y0S F;  4ED3 A;  1UCV A;  4MFF A;  2EZZ A;  4BX9 C;  3N4M B;  3GQC A;  5AK3 A;  2A1J A;  3HKZ F;  3F2B A;  2KKV A;  3C2K A;  3GIL A;  1KRP A;  4JK1 A;  3SR6 A;  2HW3 A;  4QJF B;  1N63 A;  3WKB A;  1TE2 A;  4Q43 A;  1Q3U A;  3JPS A;  4XUS A;  3Q8R B;  5KFG A;  2KVC A;  2GWS A;  2HVI A;  4KLU A;  1WYG A;  4Y2Q A;  3RTV A;  4OO1 J;  4NWI A;  3ZDD A;  2G5I B;  5AKE A;  3IV6 A;  5KFX A;  2WHE A;  4F92 B;  4YR3 A;  1NKC A;  1RYS A;  5L1I A;  1V9P A;  1Q3V A;  2AU0 A;  4XQ8 A;  1VLB A;  2Q0Z X;  1QQ5 A;  3B0X A;  2BHN A;  4KLJ A;  1HJP A;  5J0W A;  4UQG A;  2KHV A;  3RFA A;  4PGY A;  2W7O A;  4KLI A;  4C4S A;  1DRG A;  5AI6 A;  3UM9 A;  2FMQ A;  2DQN B;  4K4I A;  4ACO A;  5DG7 A;  4PZO A;  5KG0 A;  1NK8 A;  4DL3 A;  5AHX A;  3Q8L A;  2W3S A;  1BPZ A;  5J0X A;  8ICW A;  2D6F C;  3MR6 A;  4DFK A;  4J03 A;  3MBY A;  4QW8 A;  2WF6 A;  1KL9 A;  4CF4 A;  3OSP A;  4QZ8 A;  3KTQ A;  4R65 A;  4MF8 A;  4C80 A;  4JV1 A;  3MDC A;  2ASD A;  3V7J A;  4Z6F A;  3MFI A;  3F2C A;  2A3V A;  5DBB A;  4IQW A;  2MUT B;  5AK5 A;  1JXE A;  4KMU A;  2VKQ A;  1ZD4 A;  1SV0 C;  4KLT A;  1WCN A;  2MSN A;  3IP4 B;  3N7S C;  4EEN A;  2VJ4 A;  5EE0 A;  2AGQ A;  4KLL A;  2R8K A;  5H2F U;  3THV A;  1JRP A;  2K8B B;  2C2E A;  1NZP A;  1QCK A;  3OSN A;  3QZ8 A;  4UAV A;  3M9O B;  4UB6 U;  4OJL A;  1BPE A;  2E1E A;  4EEL A;  5AKK A;  4UW9 A;  1RG6 A;  9ICH A;  4DSI A;  3C28 A;  5J2J A;  1BPD A;  4ED1 A;  2ZUB A;  1PK1 A;  3DDH A;  1SIJ A;  1HUZ A;  4R8U A;  9ICC A;  2HBM A;  4UAY A;  4F2R A;  3KHG A;  4Y2P A;  1ED1 A;  3RB3 A;  5AK4 A;  4CCH A;  3M7D A;  2KV2 A;  5GTI U;  3HP6 A;  8ICR A;  1C7Y A;  2NRW A;  3VC8 A;  1GO3 F;  3D2Q A;  5D49 A;  4JWN A;  2BQR A;  7ICJ A;  2KZZ A;  2ZIX B;  2K4P A;  2KHQ A;  5KT2 A;  1J2N A;  3BQ7 A;  5KFA A;  3L3F X;  2LI6 A;  5AK6 A;  4X5V A;  4DL5 A;  4YD1 A;  3PO4 A;  3TAP A;  1U9L A;  3E0F A;  1S9F A;  5B5E U;  2JRZ A;  1ZQW A;  3HT3 A;  2KK0 A;  5ALV A;  3I76 A;  4KX3 A;  5D46 A;  4DF8 A;  2RLT A;  5AI5 A;  2G0A A;  3TAC B;  5KG1 A;  5AI9 A;  3HRD D;  1IM4 A;  2LMR A;  1FIQ A;  4O5K A;  4J9O A;  1KSP A;  1RQN A;  5JRT A;  3JPO A;  4YVZ A;  2NV3 A;  3C29 A;  1B22 A;  2CRX A;  4DQP A;  4NJ8 A;  1SL1 A;  2ZJ5 A;  3ETR A;  1F0M A;  1QH9 A;  2K4H A;  4B9U A;  5DDY A;  1BNO A;  1NNL A;  4EEK A;  2Y1J A;  2Y0S C;  1NK7 A;  3BS7 A;  3TAD A;  2BQ3 A;  4EYI B;  2RP5 A;  5CJ7 A;  4F71 A;  1X42 A;  4Q44 A;  9ICO A;  5ALJ A;  3GU3 A;  1TAQ A;  2F2A B;  3RR8 A;  3RB0 A;  4OJO A;  4O3Q A;  4O3R A;  5J0U A;  4FBU A;  4B9M A;  5ALY A;  2RRD A;  2F3N A;  7ICR A;  5III A;  5ALH A;  2NRZ A;  2AHO B;  3OGU A;  3KHH A;  3ISB A;  4J9K A;  2I5H A;  4IQT A;  4IRD A;  3QX7 A;  3C1Z A;  4GXI A;  1XS9 D;  5KFE A;  4IQV A;  4LZD A;  5DQG A;  4RNN A;  4DO9 A;  1LKY B;  2J6U A;  1SL2 A;  3E58 A;  4KLM A;  3TI0 A;  1ZQJ A;  2W03 A;  2VJ5 A;  3C23 A;  1S8O A;  5KFP A;  2W11 A;  1KKX A;  3LWL A;  5L1K A;  4KLD A;  4BUG A;  2F1H A;  1MC8 A;  1ZRM A;  1QSS A;  2EZX A;  1X40 A;  1L3V A;  5KFU A;  3ZDC A;  3AU2 A;  4UAS A;  3BQ0 A;  2W8K A;  2DF4 B;  3G6V A;  3QEA Z;  4F5Q A;  2JZB B;  1ZQO A;  1JIH A;  5KFL A;  4QZD A;  4QZH A;  5KFT A;  4F4W A;  1M6Y A;  4NL9 C;  1COK A;  3O0F A;  2NO5 A;  3D6J A;  1ARO P;  3Q8P B;  3GFK B;  7ICH A;  4DQI A;  2WAQ C;  4YMM A;  4LZG A;  4P0P A;  2WB1 F;  3OHA A;  2XO7 A;  1S5L U;  1A0P A;  9ICX A;  4TUQ A;  5KFF A;  2Y9U A;  5TZV A;  2OH2 A;  4RQ5 A;  2RQ5 A;  5DB9 A;  1MSW D;  3PST A;  3NRW A;  5AM0 A;  4US9 A;  1ZQN A;  4F4Z A;  4ECW A;  1B4F A;  3ZI4 A;  5J0P A;  1UA0 A;  7ICT A;  1IXR A;  2AJQ A;  4MFC A;  3WKE A;  2H3F A;  4U6P A;  4QWE A;  2YMM A;  4KLE A;  4Y2Y A;  4KTQ A;  2KG5 A;  1B43 A;  3QU7 A;  1NK0 A;  5L1J A;  2KJ9 A;  2P6U A;  1Q46 A;  3ONN A;  9ICT A;  1WG8 A;  3L4P A;  8ICO A;  4RUA A;  1BVS A;  5ALM A;  1VJ5 A;  2HSZ A;  1SZH A;  4KX5 A;  4FBT A;  5K4L A;  2JR5 A;  4UAT A;  2DPJ A;  3QZ7 A;  4NLB A;  1RZT A;  3ZDB A;  3S6J A;  7ICI A;  3LDA A;  3QU2 A;  4C4T A;  3M9M B;  2FI1 A;  4QZB A;  8ICM A;  4JMU A;  1PK3 A;  1X9X A;  4P2H A;  2KMD A;  2AXT U;  4G3I A;  4QWD A;  1ZQX A;  2FE9 A;  4F3O A;  2Z7J A;  5IIK A;  4KLO A;  2ZG6 A;  2JH1 A;  5KG7 A;  2XY7 A;  4HAI A;  2NYV A;  3MR3 A;  2B0C A;  4O3N A;  3N7P D;  3SYZ A;  2W54 A;  3H8J A;  3QUQ A;  2HOQ A;  2HHU A;  2L5Y A;  8ICH A;  2BCU A;  3EW9 A;  2W43 A;  4LJX A;  4DFM A;  5F3X B;  4Y2X A;  5ALX A;  4UB5 A;  3UMC A;  3M9N B;  4DSJ A;  4Y2V A;  4RQ8 A;  2D3D A;  4AYB F;  4Y2U A;  2UVV A;  8ICN A;  1SGG A;  3PML A;  4PZN A;  2C22 A;  4FFD A;  1PZN A;  4M9N A;  3M8S A;  3WK8 A;  4PGQ A;  4KMO B;  4F93 B;  2QAR B;  3KD3 A;  5HML A;  1NKE A;  4QZA A;  4I2I A;  3RBD A;  4DL2 A;  1KEJ A;  3PMN A;  2UVU A;  5EOZ A;  1DOQ A;  4RU9 A;  1IIP A;  1KFT A;  2IMW P;  4DOC A;  2KIC A;  3GV5 B;  3MR2 A;  2LYA A;  3RJE A;  3M1Y A;  4R64 A;  4C8L A;  2F76 X;  2W8L A;  2YN4 A;  5ALF A;  4I27 A;  2QB0 B;  3PSF A;  3ED5 A;  4B9T A;  4I2C A;  4ZOH C;  1NK4 A;  4C8O A;  8ICV A;  3FDS A;  1L3U A;  2G07 A;  1IG6 A;  4JWM A;  2K89 A;  2KZ3 A;  2BDU A;  5HHH A;  1XU4 A;  2XIC A;  3V6K A;  2GOL A;  2ZIV B;  3AN1 A;  5KL1 B;  2BKE A;  3BDP A;  5KFW A;  3ISD A;  1WUD A;  4ED6 A;  2K4I A;  4PPX A;  2V4R A;  4QWA A;  4Q45 A;  4R63 A;  2HBL A;  4I28 A;  4ED0 A;  2ZJ8 A;  4UBB A;  3H7I A;  1U47 A;  2E1F A;  2KJ5 A;  2C28 A;  5DB8 A;  3LVV A;  5DLF A;  2WTF A;  4DQR A;  3T5K A;  3L5K A;  2CN1 A;  4UAW A;  5AI8 A;  1U4B A;  2OYY A;  2XGQ A;  1ZQM A;  3Q8K A;  3EUB 2;  1CEZ A;  2HHV A;  7ICO A;  2HHW A;  4KIT B;  1P7D A;  2F8K A;  4QWC A;  1N62 A;  4F4X A;  3SV4 A;  2EDU A;  5DQH A;  2ZIU A;  5ALI A;  2VA8 A;  4C0Z A;  3RB4 A;  5IIM A;  5J0S A;  1BPB A;  3RAQ A;  9ICM A;  9ICQ A;  4C8K A;  3UXN A;  2J6T A;  3SQI A;  1SZP A;  3N97 B;  5KT7 A;  1QLN A;  1RM6 C;  2H3Q A;  2XCA A;  5KG4 A;  3J81 j;  3MGH A;  4RQ4 A;  5J0R A;  1N5W A;  3NVW A;  3R9K A;  2PI4 A;  4O5E A;  4PHA A;  1X9M A;  5AM3 A;  1QQ6 A;  4F72 A;  5DBC A;  4EBC A;  9ICK A;  2BPC A;  2G09 A;  4XA5 A;  5KFS A;  5KG2 A;  1BPX A;  3C2L A;  3H8W A;  4NLC A;  3HWT A;  5ALP A;  1L7P A;  3G6X A;  2FLP A;  9ICV A;  4KLF A;  1L8L A;  2B21 A;  3BZC A;  1JXL A;  5JUM A;  2M9N A;  3BS5 A;  4KN7 A;  1RXW A;  2J6S A;  2AGO A;  5KTQ A;  4OJ5 A;  8ICF A;  5KFK A;  8ICX A;  2W9B B;  3IM1 A;  3PZP A;  5KFY A;  5J2E A;  1SKW A;  3PW7 A;  3JPP A;  2KIW A;  4ECQ A;  5KAF U;  4BWJ A;  3KOO A;  1ZQP A;  1OW5 A;  4PL2 A;  2RDJ A;  2DPI A;  2K8A A;  3LYS A;  2MUT A;  4FZN A;  1F44 A;  1DXS A;  5AKY A;  3HKZ C;  5EE3 A;  4F5R A;  3MGI A;  3QYP A;  4BJQ A;  2W9C A;  3JPR A;  2ESE A;  2AH5 A;  2AQ0 A;  1TK8 A;  8ICZ A;  1T3Q A;  2P35 A;  3KZI U;  5J2D A;  2GO7 A;  4RT3 A;  4BXO B;  1JUD A;  2IOH A;  1L7O A;  2PI5 A;  1HUO A;  4EYH B;  3PX0 A;  3V7L A;  4P4M A;  2YMQ A;  3NVV A;  2ZXI A;  4IL6 U;  1QSY A;  3QU4 A;  2WF8 A;  4MEX A;  5E79 U;  2W9B A;  5C5J A;  2E3T A;  4XRH A;  4FS1 A;  1K1S A;  2ZIV A;  2KEY A;  3SMV A;  2HHQ A;  2YML A;  3RJF A;  3EPI A;  9ICE A;  3Q8M A;  2ZIW B;  4OJP A;  5KFM A;  1NJW A;  1KW4 A;  4P4O A;  8ICY A;  3ICX A;  5KT6 A;  4UAR A;  4Y2R A;  4YP3 A;  2Q4T A;  2GH1 A;  4QW9 A;  1WWV A;  2W9M A;  2BGW A;  4I2B A;  3BZK A;  1WCL A;  4RT2 A;  3D2S A;  4M9J A;  4PGX A;  4NXZ A;  2FMS A;  1KTQ A;  2ZXH A;  4M0A A;  1NOM A;  2HBJ A;  2XY5 A;  4ECY A;  1ZQH A;  1JMS A;  4NM2 A;  4Q8E A;  2ASJ A;  2G06 A;  2NRT A;  2JV3 A;  2ZIU B;  3PW2 A;  4JV2 A;  1NK5 A;  3GV7 B;  7ICG A;  4GFJ A;  4YQW A;  1MQ3 A;  4RPX A;  4QIW F;  1A76 A;  4RPY A;  4F2S A;  5J8Y A;  5HP4 A;  2LKY A;  2V9W A;  1N5X A;  5KT4 A;  3RH5 A;  2ZIW A;  1UQV A;  1ZQR A;  1ZQK A;  2KIV A;  4FO6 A;  3KHL A;  4U7C A;  4F5P A;  3GIK A;  3V6J A;  3K75 D;  1RYU A;  2G08 A;  5ALZ A;  3UPQ A;  4QZC A;  3T5H A;  5ALU A;  2BCR A;  4IS7 A;  1Z4O A;  4B6J A;  1S0V A;  3RJG A;  5AKI A;  2KE7 A;  5JU5 A;  1EXN A;  2E8P A;  1ZJM A;  2LYH A;  5AKX A;  4DQQ A;  1KDH A;  1Z00 B;  4NY8 A;  2H3Z A;  4K4H A;  4DCC A;  1DGJ A;  1U49 A;  2KVS A;  5C0Y A;  5CRX A;  8ICS A;  1H38 A;  2JEJ A;  3OJU A;  4DOB A;  2XY6 A;  4Z6D A;  4ED7 A;  2HOF A;  2IOF A;  2IBK A;  3FYH A;  3TQ1 A;  1QTM A;  3RJK A;  4TUP A;  1Z1V A;  2C2D A;  3SAH A;  1L7N A;  3QUB A;  3ZD8 A;  3EYZ A;  5IIN A;  2M0N A;  4O3P A;  4GC7 A;  1B0X A;  4Y2S A;  9ICI A;  3KFU F;  5ALE A;  9ICA A;  5J29 A;  5IIL A;  3PSI A;  3U26 A;  5CR0 A;  2EZY A;  8ICE A;  3M6Z A;  4DL6 A;  3TAN A;  8ICT A;  2EAP A;  2ZTE A;  1CRX A;  2A1J B;  3SV3 A;  4C7Y A;  2I9G A;  3F2D A;  2ZJA A;  1Z00 A;  2KJ8 A;  5DG9 A;  2PXI A;  3N7R C;  5EE9 A;  2W04 A;  5B66 U;  3UQ2 A;  1ZQT A;  1KFD A;  1YZ7 A;  3H8M A;  2W7P A;  1N56 A;  5DGB A;  5J2G A;  4B9L A;  2KSO A;  4M9G A;  2ISO A;  4CGZ A;  1NI3 A;  5IIJ A;  5ALQ A;  5ALW A;  5HR6 A;  2JXJ A;  3NTU A;  4BGD A;  2PFQ A;  1ZJN A;  2R8G A;  1RPL A;  1ECW A;  4LVS A;  2FJ6 A;  4RNO A;  4DFD A;  1OXJ A;  5KFI A;  1N61 A;  5F9N A;  2BCV A;  2F1I A;  2V4Q A;  3IG5 A;  4EX7 A;  3JPN A;  5KFR A;  1SB3 C;  5J2C A;  2H5X A;  5AKZ A;  4M9L A;  4ECU A;  3CYM A;  3TFR A;  3V72 A;  9ICU A;  4QZ9 A;  5CHG A;  5KFC A;  8ICB A;  1PVP A;  4FZM A;  4QZG A;  4YCX A;  3AL0 B;  2ISP A;  2AQ4 A;  4GC6 A;  9ICL A;  3C1Y A;  1SWW A;  1V85 A;  1X9S A;  1S0M A;  4YFK A;  4RQ2 A;  9ICR A;  5DQI A;  4DWI A;  2YX8 A;  3SEN A;  1TFR A;  4KLG A;  4F91 B;  3RAX A;  5BPC A;  2QB1 A;  2BCS A;  2HHT A;  2MAX A;  4UB3 A;  1SV0 A;  4Y2T A;  5J2K A;  4PHD A;  1A77 A;  4CRX A;  4IRK A;  2XGP A;  1O03 A;  2A19 A;  1ZQC A;  2HHS A;  4DSL A;  4A8E A;  5D4B A;  3ISC A;  2NRX A;  4RQ0 A;  3TAR A;  1D8L A;  4NM1 A;  3AQE A;  1ZD2 P;  3WK9 A;  3Q8Q B;  4UB4 A;  1PK1 B;  3LWM A;  4QZE A;  4B9S A;  3KHR A;  3QNM A;  1XO1 A;  2B6G A;  3K1Z A;  2DFL A;  4ELT A;  2DWQ A;  3CP8 A;  2UVW A;  3UMB A;  3H0L B;  5ALL A;  1TK5 A;  1T4G A;  1CUK A;  4YR0 A;  3GIJ A;  4NL9 A;  4MFA A;  2R8J A;  1ZQA A;  3HIL A;  4RUC A;  2HMX A;  7ICE A;  1KQQ A;  3C2M A;  1MA7 A;  4GXJ A;  2HBK A;  3MGV A;  1ZD5 A;  2ZIX A;  4USA A;  1SL0 A;  4DFP A;  1UT8 A;  2K4E A;  3T5J A;  3IRU A;  3WKD A;  1Z4N A;  2YTU A;  8ICJ A;  4PHE A;  2IHM A;  3NAS A;  1Z3E B;  4DL7 A;  4YMO A;  3KBB A;  2FLN A;  2Y1I A;  4UAU A;  2ZUC A;  2NO4 A;  4ECT A;  5CWR A;  3H4B A;  1T3N A;  4YD2 A;  1J2M A;  2WF9 A;  2FDR A;  1U45 A;  2MU2 A;  2YQE A;  3ALR A;  2BCQ A;  4IC9 A;  1Q8K A;  4I2G A;  3GII A;  5GTH U;  4TQR A;  2EH9 A;  3NUQ A;  2YMP A;  3FM9 A;  2W3R A;  4DFJ A;  4QNL A;  7ICN A;  1VDV A;  3F53 A;  3WKC A;  2JEI A;  2F44 A;  3IG8 A;  1CI4 A;  2N1R A;  1O08 A;  5J0Y A;  2A1A A;  1OUQ A;  1K5O A;  2H3I A;  5J0Q A;  3MR5 A;  1FEZ A;  5AM4 A;  1U48 A;  2ES6 A;  2CPR A;  3OPX A;  3JPQ A;  1NJX A;  1X6J A;  4RQ7 A;  2EAO A;  4I2D A;  4EBD A;  3D2N A;  5KG3 A;  3SAF A;  1ZQD A;  3F5A A;  1LV5 A;  4P4P A;  1PVR A;  1A6S A;  2AGP A;  2MRL A;  1L6N A;  4NLK A;  4O3O A;  2GLE A;  7ICP A;  4EZ6 A;  5KFH A;  4DEZ A;  4ECV A;  2VAN A;  3MAB A;  2PFP A;  4BDP A;  4F4Y A;  1HIW A;  4J9P A;  5KT5 A;  2ODG A;  3Q8S B;  3TAD C;  2VA3 A;  2KD1 A;  2VIX A;  1YT3 A;  2HHX A;  1ZOL A;  2KP7 A;  3PV8 A;  3I1Y A;  2E8N A;  1JX4 A;  1URJ A;  1X66 A;  1ZQU A;  5J2H A;  3K4G A;  1RDF A;  1XSP A;  4B9V A;  7ICM A;  4RPZ A;  2YB1 A;  3RRG A;  1S0N A;  4HYK A;  4EBE A;  5DDM A;  3MFH A;  2P6R A;  3HJE A;  2WF5 A;  4ECR A;  2JZB A;  1LKY A;  2JH7 A;  4DF4 A;  4AP9 A;  3RR7 A;  3GIM A;  1QSL A;  4DLG A;  3PVX A;  2YB4 A;  5BOL A;  4CDG A;  5ALN A;  5ALD A;  2ATL A;  1LB2 B;  1ZQB A;  5EWE A;  4RQ6 A;  1NK9 A;  4M6W A;  7ICQ A;  1ZQS A;  4OJ6 A;  4R66 A;  5F9L A;  4QIW C;  4F4K A;  2RDI A;  3SEI A;  4E0D A;  5CB1 A;  4Z6E A;  4RQM A;  3RRH A;  4YXM A;  3VCB A;  1Y88 A;  2R8I A;  1JAL A;  3AQF A;  1MN8 A;  5DB7 A;  2FPK A;  4FS2 A;  4PHP A;  2OEH A;  3B9J A;  2D8C A;  4QZI A;  4P0P B;  1L3S A;  2K8C B;  3ZD9 A;  5HNK A;  3BS5 B;  2XC9 A;  3HPO A;  4NV0 A;  4TUS A;  4I2J A;  4NLN A;  1ZRN A;  4IR1 A;  5J0T A;  1SXE A;  4KLQ A;  4UBC A;  1FO4 A;  7ICK A;  1C20 A;  3A0B U;  4F5N A;  1XO0 A;  2E8M A;  2F77 X;  3CNH A;  4OCZ A;  9ICJ A;  4DQS A;  4CNQ A;  5A0L A;  1WWU A;  1DGS A;  2IA6 A;  5AI0 A;  5KFZ A;  3E2E A;  2R18 A;  4C4R A;  2RHF A;  3I28 A;  1KLN A;  4MF2 A;  2JMG A;  2ZUD A;  3CW2 C;  8ICA A;  3C5G A;  4J9N A;  2F8L A;  1JRO A;  5CEH A;  9ICP A;  1XC9 A;  5HR7 A;  3PW0 A;  1T94 A;  4Z6C A;  5AI4 A;  4MEY A;  3QU5 A;  3IN5 A;  2XVT A;  4JV0 A;  1D9D A;  2JEG A;  3T5L A;  4QWB A;  7ICF A;  1L3T A;  4TUR A;  4YXJ A;  1ZQG A;  5DLG A;  1RYR A;  3HW8 A;  2DGZ A;  4P0Q B;  4ECX A;  1TKD A;  5KFO A;  2LM1 A;  4YMN A;  8ICL A;  4UB1 A;  2OWO A;  4O3S A;  3AUO A;  2E5S A;  3NRZ A;  5G5G A;  4O3M A;  2OM6 A;  2C2R A;  1TVA A;  4NLG A;  4M2Y A;  9ICB A;  3V7K A;  1ZYQ A;  4JB3 A;  5ALK A;  2LYB A;  1NK6 A;  4YN4 A;  2FPM A;  2KN7 A;  3NS1 A;  4WJ3 B;  5J2F A;  4GLX A;  1ZQQ A;  4IRC A;  1UPH A;  1MQ2 A;  2HVH A;  3GZF A;  1S0O A;  3BQT A;  8ICI A;  4DSK A;  3AEV A;  3WK5 A;  5DG8 A;  1XWL A;  9ICS A;  1TAU A;  4ELU A;  3OJS A;  2PFO A;  4PJ0 U;  1ZQE A;  4Q8F A;  5BOM A;  4IQU A;  1XSN A;  1X2I A;  2ALZ A;  3SI8 A;  4FE3 A;  1QQ7 A;  4K4G A;  2LHT A;  3QUT A;  5EWF A;  4M9H A;  4P0Q A;  3M6K A;  1Z1B A;  5T14 A;  4DS5 A;  3H8S A;  5HHI A;  9ICN A;  1HEK A;  3PY8 A;  4PL1 A;  9ICW A;  3RB6 A;  2QAR A;  4DOA A;  2E8O A;  1S97 A;  1TAM A;  3ZDE A;  3N28 A;  3RH6 A;  2K60 A;  3TAQ A;  2OHF A;  4I2H A;  8ICK A;  4KN4 A;  3PX4 A;  5AKH A;  3SAG A;  5J0O A;  1X9W A;  5AIA A;  3C5F A;  3H40 A;  2OXO A;  2KTQ A;  3PW5 A;  4M6W B;  3BQ2 A;  1TK0 A;  2DL0 A;  2VA2 A;  5ALT A;  1T7P A;  3GV8 B;  5KFB A;  1NZB A;  5EWG A;  1AQ6 A;  3KKA C;  3F5E A;  5IIO A;  1L5U A;  2PMZ C;  2DUY A;  1T8E A;  2NRV A;  2EQY A;  8ICP A;  4UAZ A;  1FFV A;  4Y2J A;  5KT3 A;  1UT5 A;  1LVH A;  3PX6 A;  2DKX A;  1DK2 A;  3FAH A;  2JEF A;  3PO5 A;  1ZET A;  1NJZ A;  5AM5 A;  3TKA A;  3NVY A;  3BJY A;  8ICG A;  1IV8 A;  2EAM A;  3RH4 A;  3IDW A;  3QXG A;  1TV9 A;  5KG5 A;  5AKJ A;  3M8R A;  3C21 A;  3UXO A;  2FLL A;  2KFZ A;  4RQ3 A;  2HCF A;  1SV4 A;  4J9S A;  5AIB A;  4RQ1 A;  3JPT A;  3WK6 A;  2HI0 A;  4PH5 A;  4O5C A;  5HMM A;  5CA7 A;  3V6H A;  9ICG A;  2XCP A;  5L9X A;  5CP2 A;  4US8 A;  2W9A A;  2I6X A;  1ZQY A;  3ETL A;  4F50 A;  2QLT A;  2WFA A;  4JUZ A;  3T79 A;  2XI9 A;  7ICU A;  3DV9 A;  1BNP A;  1Z19 A;  1ZQL A;  1F5S A;  1YZ6 A;  3RF9 A;  2OCE A;  5KFJ A;  4EX6 A;  3RJJ A;  3RJH A;  4DSE A;  7ICV A;  2KNJ A;  3NGD A;  1KN5 A;  1FFU A;  1S76 D;  3WKA A;  2KSO B;  2H3V A;  1D8Y A;  4I2F A;  1D8B A;  4CF3 A;  5J8Y C;  1BGX T;  2PFN A;  5AKL A;  1N2X A;  3SD7 A;  2P66 A;  1XNS A;  3SZ2 A;  3HX0 A;  5KL8 B;  4QZF A;  5KNI A;  2LBO A;  5G5H A;  3AMZ A;  2PMZ F;  4AYB C;  1ZQZ A;  3H0M B;  3FC4 A;  2W55 A;  3EPG A;  2IHN A;  5DKW A;  4F8R A;  2YY6 A;  2MA1 A;  3WK4 A;  2LM4 A;  1KBU A;  4CF5 A;  4BXO A;  2ZTD A;  3EWA A;  3PSP A;  2Y9T A;  1ZQI A;  4ELV A;  4KLH A;  2BZF A;  2WAQ F;  3WK7 A;  2KKP A;  1PUZ A;  2XID A;  1L8O A;  1UA1 A;  4MHV A;  5AM2 A;  1KFS A;  3T3F A;  3IHQ B;  2BPF A;  2DBY A;  3QEB Z;  2HDO A;  2KFN A;  3MDA A;  1L7M A;  5KFV A;  1NKB A;  5TIS U;  1SKR A;  2ASL A;  4J9R A;  4RNM A;  2W9C B;  5KG6 A;  3AU6 A;  8ICC A; 
#chains in the Genus database with same CATH homology
 2E8M A;  3KKA A;  4IS7 A;  1X66 A;  2YTU A;  1WWU A;  4PZO A;  2KE7 A;  5JU5 A;  2E8P A;  2QAR A;  1LKY B;  2E8O A;  1OXJ A;  2K4P A;  3BQ7 A;  2QB0 B;  2K60 A;  1LKY A;  5L1M A;  1X40 A;  1PK3 A;  2DL0 A;  1KW4 A;  2KSO B;  1X9X A;  2KMD A;  1Z1V A;  1SXD A;  1V85 A;  3TAC B;  3KKA C;  1SV0 C;  2FE9 A;  4RQN A;  5J8Y C;  3SEN A;  1WWV A;  3BS5 A;  2LPE A;  2QKQ A;  1UCV A;  2QB1 A;  1B0X A;  1V38 A;  2F44 A;  5KNI A;  2LMR A;  4NL9 C;  1COK A;  3SEI A;  3K1R B;  1SV0 A;  4RQM A;  2DKX A;  2ES6 A;  5JRT A;  2L5Y A;  2EAO A;  2JV3 A;  2EAN A;  4NJ8 A;  2EAP A;  2Y9U A;  2EAM A;  5F3X B;  1F0M A;  1OW5 A;  3IDW A;  2D8C A;  2F8K A;  1JI7 A;  1PK1 B;  3BS7 A;  1DXS A;  1B4F A;  3TAD A;  2GLE A;  2B6G A;  1RG6 A;  5J8Y A;  2DKZ A;  2D3D A;  2Y9T A;  2QB0 A;  2ESE A;  1SV4 A;  3BS5 B;  4MHV A;  1SGG A;  3H8M A;  1PK1 A;  4NL9 A;  4PZN A;  3HIL A;  1UQV A;  2KG5 A;  3TAD C;  5JTI A;  2KIV A;  2KSO A;  1SXE A;  2F3N A;  2QAR B;  2E8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...