1OW6A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
134
structure length
134
Chain Sequence
b'NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6A02
3AE6C 1UFBA 3GM2A 2L6GA 3SFEC 3TULA 2YWAA 3K7DA 3JZ0A 4EBKA 3AEFC 1KNYA 3RQFA 1ZOYC 3MFNA 2LK4A 3AE3C 3C8GD 2WQYC 3GM1A 2KK1A 3AEAC 3RQEA 2JPUA 3AEBC 1WOLA 1OW6A 2HSBA 4NQFA 2H88C 1OW7A 3AE9C 2H89C 1K04A 2L6HA 3JYYA 3L8JA 1OW8A 3AEGC 4YTPC 3AE4C 4R32A 3AECC 1K40A 4EBJA 2JX0A 1JOGA 3L8IA 3AE1C 1KTMA 3C8GA 1O3UA 3RQGA 3ABVC 3B71A 3U0CA 1YQ3C 1QVXA 1V4AA 2FBWC 3SFDC 2PBEA 1PV3A 3GM3A 3C18A 1K05A 1WTYA 4XEKA 3BRJA 4YXDC 3AE5C 5F28E 3O10A 3AE7C 1ZP0C 2G3AA 4XEFA 2L6FA 4XEVA 2Q00A 3AEEC 1WWPA 3AEDC 3AJMA 3AE2C 3S9OA 3AE8C 1ZZPA 1YQ4C 3U3FA 3C8GB
chains in the Genus database with same CATH superfamily
1RQUA 3GMAA 3PP5A 5AVVB 1GL2A 2HS5A 2Y3BA 1UFBA 2YL0A 3CEXA 2K37A 2FYUD 1BE3D 1Y8AA 1VOMA 3AOUA 1K73Q 2EPOA 5AC5A 2LP4A 4U3FG 3ATPA 1LTAC 3BCCG 2A6EF 2DYRC 1BCCJ 3ABMC 1D1AA 4OD5A 3W2VA 2W6BA 4Y99B 1NTKJ 3B29A 2JWAA 2XLVA 1WASA 2OQQA 4QDLA 2D5RB 4C7RA 4CJGA 1FOSE 3U5SA 1M90Q 2YIUB 3ASNC 4WY4B 1SFCC 3GF7A 4W8KA 3AE9C 5TISH 1E79H 4J7TA 4D6TD 3HE4A 1TWGA 2KLUA 5AVXB 3G6EP 2FYUK 5DS6A 5A6AA 3G3ZA 1VQ8P 2IFNA 4MQ9F 3KYQA 1PL5A 5KAFH 4EBJA 1NBBA 4L75A 1ZMEC 3K33A 1L0NG 4R4MA 3I5CA 3V5BA 1PZQA 1HMDA 2P7VA 1T6AA 2LIGA 2Q9IA 1GL2D 2P58A 2G3KA 1FFTC 1QL1A 1CZQA 1HJBA 3EGXB 4H44D 3GWLA 3H1ID 2EPLX 3ZQVA 5BU5A 5CBOA 3EJNA 3E70C 5L0CA 2G8YA 3L74E 2XXAB 4XPYA 4IL6X 4G78A 3H2VA 2PP6A 2LXCB 1EDLA 3MX3A 2IZ0A 5DJTB 1Y6DA 2P61A 4UB8E 1N7SB 3HNJA 3QVZA 1G8XA 3X2QC 2YMYA 4PK4A 1YTZI 2IXNA 1AJYA 3LLKA 1VK5A 4OIPF 2QA4P 2H43A 3HRNA 2O9XA 3W8HA 3GM2A 1OXZA 1ZYRF 2J9WA 4H0LD 1M6TA 3DM5A 3WODF 5A6BD 3IEEA 2P1AA 1SZIA 1AUEA 2J8WA 1FNTc 4WBAA 1KNYA 5AVQB 3U3BA 4CX9A 1Z5ZA 3V4QA 1TKNA 3P8CE 1Q90D 4K0DA 4WABA 4DBQA 4CS8C 4IWBA 4Q4ZF 3R4YA 1Q81Q 4HB1A 2FFDB 3RYLA 3LS1A 2W90A 3CCRP 4Q5SF 3GHGA 3HUSC 4U5BE 2QM8A 1AQTA 3RK2C 5KYXA 4IGGA 3EWKA 3GODA 3G71P 1N86A 2WVRA 1ZVZA 4PACA 2OKUA 1DEEG 2DW3A 2W8ZA 4NPFX 5KLVG 3JYYA 5C39A 4HKZH 1SQXJ 2NSFA 1OCZC 4YT5A 1MNEA 3LW5H 3AEGC 1JRAA 3CLQA 4U9DA 1FTSA 4PV1D 4HFFB 1JY2N 2VCBA 1SQVG 1ZR2A 2XZRA 4ASWA 4H13D 1K40A 1URQC 2K9YA 2KSFA 1PP9G 4PR9A 5APWA 5TJ5E 3BRTB 5JSLA 4BJ6A 1JOGA 5JP7A 2SPZA 1E83A 1Q2NA 3FXDA 3TQOA 3B0UX 3B71A 4XLPF 2OTKE 4YXWH 3JSVC 1S4XA 4C7NB 3CXHI 2I8BA 4O6MA 2LD6A 2VASA 1SQBD 3CWBG 3SXKA 3LIEA 5AVRB 3T6JA 2WZLA 3TK0A 3DI5A 1X9VA 2P6VA 2H7BA 2WZGA 2HJMA 3ZSUA 1ZV8A 3JCUE 3MZWB 1KC8Q 1A7DA 4KNWA 3CXHH 1HUCA 1KYOE 4PFOA 3H1HG 2JKVA 2PX0A 3MUDC 2PFDA 4GEHA 1WWPA 4ZKUA 4A7PA 1SVFA 1PIXA 1OCCC 4FESA 1IZNB 1SYQA 3VMZA 4JE9A 4GOFA 4I1OB 2ZT9C 3JRMO 3S90A 2H7HA 1MKMA 1L7CA 4EUKB 4IFFA 2KZJA 1RKCA 2YEVA 1SQBK 4UB8H 1L0LJ 2XRHA 4ER9A 1KQFB 2E42A 2HODA 1E5WA 2ZVNB 3A11A 3K7DA 2IBFA 3RBZA 2M3BA 2E76C 5KKZC 4MS2A 3RQFA 2Q9BA 3FDQA 3MD0A 1D7MA 5AW2B 3T9OA 3IPMO 1N73C 4JKVA 5BQGA 1LE4A 3IQ6A 2HG5D 1LT1A 1ZR4A 3L75D 3EZHA 2KK1A 3M1CB 1GDTA 1BDJB 1WOLA 2E75D 4NQFA 3H2UA 4XTKA 3RFYA 2OGUA 1S5LE 1SMYF 1NU7D 4A2NB 1MMNA 4K35A 2XLHA 5CIVA 1BR4A 1JY2P 1JCCA 1M2OA 3VTPC 3L70J 1FDMA 2XXAA 1Z3IX 3MGNA 2C04A 2W45A 1FZGA 2NPSC 1BBHA 1M2VA 1U0BB 3VMYA 5M1BA 1N7SA 3MIWA 3V5YA 1KMIZ 1BDCA 3EG9B 3J06A 1SQPJ 1YYXA 1LI7A 3TGUE 3UNGC 1LKXA 4N78E 3L8IA 2YMKA 4OWFA 1ZHWA 3O55A 2IM8A 3HUSB 4LLEA 4MVQA 3L74G 4YWQA 1RF0C 5AVTB 1HVVA 1VQ6P 3M4CA 1K05A 2LFFA 1J1DC 3AGUA 3L37A 4DBRA 2WSFH 2AWYA 2YKZA 4A4AA 1NKZB 5GPGB 3II6A 1KZUB 4HEAJ 2YLIA 2YKQA 3B5NC 1G5ZA 2YO2A 5CCHC 3S27A 4NTBA 4ULVA 3LEOA 3AEEC 4IARA 2GWWA 2FXMA 2L7AA 5DS4A 3P8CD 2XV5A 3E1IA 1NTZG 2B0JA 3T6GB 4PD4I 1U6HA 2KYVA 4Z9JA 3U8PA 2ZD9A 3NYMA 2Q9CA 3HNIA 1MFTA 2A06D 2ETSA 3PLNA 1N7SD 3NFQA 4GIFA 3VAYA 3T6BA 2LKMA 4PD4H 2PNOA 5DQTA 3H1JE 3RKOF 4U5GA 2UUHA 2N9BA 2RN0A 2EIMC 2D2CC 2IDBA 1U57A 1W2WA 1SFCA 3FWNA 2XS8A 2TMVP 2J5UA 5DVWA 4C7NA 2POHA 3ZC4A 1B68A 3L71E 2YRFA 3GF3A 5JUAA 3U59A 1SQQG 3HTKC 2A45I 2ZT9B 1JTHB 3IQCA 1EKYA 3Q1MA 4YL0A 3E1RA 4H54A 1XZQA 1DD3A 2PF4E 2E76B 2FY8A 2A45H 5KKZB 3U8VA 2ZXRA 1JNMA 1RJ9B 3K1IC 3IHUA 5KYYB 1IK7A 4YTPC 1JO5A 4XA4A 4DT0A 1K8AQ 3G50A 3FXHA 1FE6A 4LERA 3SXZA 4Y28J 1EDKA 1KYOD 3EQLF 4U3FE 4YPCA 3TDKA 3BCCE 2OYHB 1CI6B 3S4RA 3GANA 3LLIA 2GA1A 2P10A 4PJJA 3U9JA 1LP1B 2MKVA 1PFIA 2NPSB 3H65A 2FYUJ 1BE3J 2Q9AA 1YA7O 3L36A 1AVOA 3SNHA 1CGME 1R5SA 5KJ7C 4JYCA 2BEZF 4G7HF 1GU4A 3AE5C 4PJLA 3CCQP 1SFCD 2QEXP 3ZG1A 3A0HE 5A69A 4OGQD 4IL6E 3VMAA 4ULWA 2CPSA 3VP8A 2L91A 2IXPA 1DOWA 1EZVI 4JTDB 1JMBA 3L34A 3C8ZA 3OJAB 2KXPB 2KIKA 2P7JA 2HZ8A 3WG7C 5CBNA 4GYTA 2IYLD 2R32A 4G7OF 1D0XA 1KQGB 3V7OA 4D6TJ 2J46A 1H89A 4YT8A 4I2LC 1T3JA 1L0NE 2A69F 3ZVRA 5APTA 3A0BH 3V2PA 1JPNA 2A45G 1T2KC 1CGNA 1ORYA 3DJNB 2NSGA 1X22A 2KS1B 1NU9C 4D4XA 3L72G 3LUTB 1NFNA 3DZAA 2VC9A 1T6IA 3TJ6A 1Z23A 3HUSA 4JPZB 2ZXXA 3Q5SA 3D70A 1R8EA 4WVZA 5AVYB 4IFDK 1PPJG 2V4HA 4L76A 2WTYA 5L8RJ 5L0JA 4WB4A 4NPEA 2XL6A 4BEJA 3TGUD 2HSBA 3W8IA 1K9MQ 2LQGA 4N78D 2H88C 1VQ9P 4E17A 4R4LA 3EHNA 2UWJE 1QX8A 2OYOA 3H1IJ 2CCYA 3FOOA 1URQA 4WY4C 1FZEA 2XLOA 2QE9A 1M1KQ 1RHZB 1E2XA 3CCSP 4DJGA 4N3YB 5GTHH 4EWCA 3H1LG 4EIJA 1C17M 1Q0FA 3E9VA 1LWUB 2MHRA 3V5ZA 1PD1A 1QVFO 1VTMP 1NLXA 1EI7A 2A1DD 4IFMA 3U1CA 4R32A 5AW3B 4CIPA 1IFJA 2I15A 3HTKB 3SWKA 1TU3F 2PRRA 1Q0KA 3CX5D 2R3SA 1GD2E 1YYJA 5COMA 4BPMA 4OD4A 3A9CA 3QW0A 4LLHA 4CS7A 3S29A 2KK7A 3T97A 1T01A 5KAFE 5COFA 2FKWB 1QZXA 3F46A 3SSUA 3IQ5A 1RH5B 2O3JA 1PV3A 2WSCH 3OA7A 1EZVG 3MUDA 3US6A 1OVUA 1WTYA 4RJTA 2Z5IA 2R3CA 4Q7CA 1HH0A 4K3AA 2CW0F 3FAPB 4PJMA 1D0YA 3DKAA 5F28E 1JTHA 3RK2D 5KLVE 4HJGH 2Q00A 1D1CA 1YZAA 3JYHA 1FZAA 5CI8A 3V2RA 4FWVA 3H1JD 2QM7A 1M1JA 3O8ZA 5AVUB 3N4XA 5GTIH 1VQPP 4JTCB 1LTJA 1SQVE 3AE2C 4E0HA 1PP9E 5DJUB 1LJ2A 1HJ0A 1URQD 3L71D 4O9BA 5AW8B 1MMGA 2AXCA 1RJ9A 1ZW0A 3BATA 1N73A 2E74B 3CQZA 1TFOB 3SFEC 5JVEA 2YWAA 3WUUA 3FHDA 5BUOA 2YL1A 1NGMB 2YKPA 2JD3A 1YYCA 3UIAA 4JF7A 3VYWA 2M5AA 3QW1A 5KYWB 1NFOA 4J32B 5KYNA 1QPUA 3NMJA 3IN6A 3M79A 4O6NA 1EDIA 2KW3C 1LP1A 3QH9A 2NPSA 2Y0CA 2JPUA 3SWYA 2QTVA 3H1HE 4O6YA 1SQBJ 3M0DC 3VP9A 1T3UA 1RE4C 1QSPA 1GM5A 3V4WA 4U3FD 4HFKB 3P32A 1W2BO 1JY2O 4GT1A 3BCCD 1TWCA 3A7OA 1FZCB 4QI0A 3G4XA 1RE3C 1IFIA 1XZPA 4O7GA 2WWWA 2WL8A 1TR2A 4LDKA 2Y9ZA 1A02F 4OINF 4JZAA 4I6MC 1HTLC 4C7OB 1G1IA 4CBEA 2BASA 1HWTC 1E85A 4Z9HA 4NTFA 1A7EA 3NMIA 4E7ZA 3B5NA 1KN7A 1TQGA 2CGEA 2FGYA 3PMRA 4MTOA 2KS1A 5CCHA 1VYIA 3DE9A 4J30B 2KSJA 2XLEA 2IYOA 1LTGC 2XNXA 1L4AC 1R5LA 3IR9A 3RK3C 4JQ0D 1KILB 1IO4A 1EC5A 1L0ND 3WHNA 2ZAEB 1FMWA 3W4YA 4MW8A 5CMZA 3L75J 1OXKA 3RL0D 2WPSA 4N6CA 1VMAA 3MHVA 3S28A 2XLWA 3CCLP 1GW3A 3CXHE 1FDIA 1NSGB 3POVA 1LS4A 1GMJA 5E3AA 4EDFA 3AE8C 1PGPA 2B89A 1LT9C 1EA8A 3S0XA 3W67A 4CSAA 3UR3C 5CCGC 2Y39A 3C8GB 1OFCX 2GDCA 3AE6C 2W83C 2M64A 1MNDA 1M57D 1VQ5P 3JTLO 1SS1A 5E2QA 2Y0EA 1VQNP 3LAYA 2HMZA 2QJKB 1DH3A 3AEFC 3MYIA 1VL2A 3H32A 1W2EA 4AUWA 3KYIA 1L0NK 3ITFA 4F4BA 1VQKP 1LTSC 2WQYC 3M06A 3O6QA 1ZHZA 5L0IA 5DLJA 2HMQA 3B5ND 3GWNA 3RBXA 1OW6A 4WJ0A 1JEKA 2NPUA 1G4WR 3QVYA 3CC7P 1M56C 2RH0A 1NTZE 4TT3H 3EFOA 2L6HA 2R7XA 4BEMJ 2AWCA 4W7YA 3TOMA 2EPMX 5BQHA 3FWLA 4MNDA 3K6BA 3ZDMA 4CS9A 3H1KG 3X1OA 1NTMG 1H0TA 5KJ7A 1I5NA 2BC5A 2WT7B 1ZN5A 5AW9B 1TWHA 5BVZA 5KLVD 3VRCA 5K0IA 3TK1A 1E86A 1V4AA 2D2CD 3PCVA 4U5EE 1N2DC 1N7LA 1OWAA 4BJ5A 3GM3A 1SQQE 4C3DA 1D1BA 1SQVD 1V74B 1PP9D 5HSWA 2AU5A 1U7MA 2V7QJ 5CJ0A 2H7VC 3A2AA 3SXYA 3KPEA 2O01J 1NU1G 4BRYB 3D71A 1CW5A 1BZ4A 2L6FA 2BEQD 1OMIA 3CWBD 2NUPB 5A6KA 4AK9A 1LVKA 3KPHA 1VQ4P 5JS5A 4PFPA 2CK3H 3PHLA 2HPCB 3JC22 1WATA 1RY3A 1L4AB 3G9RA 3CZ6A 3SZRA 5KLVK 3RK3B 1S2EA 4AQRD 1ZZPA 4JW1A 3E7KA 3L73G 1DEBA 4IRUA 3H1HD 1DX7A 4NTAA 4DOJA 4OIOF 2WVNA 2XSEA 2YL7A 1SQVK 5EK0A 1BGYG 2DI3A 1AQ5A 3GEEA 1FOSF 5APSA 1R4TA 4WY4A 3TNUB 1HY5A 4E7SA 5KJ7D 4CPGA 3GEIA 1QQ3A 4I1MA 4QI2A 1CGOA 4PD4E 3Q7GA 3RQEA 1LT9B 2PGDA 2KUBA 4EI2A 4MVOA 1XWJA 4DRHB 1O5HA 1S05A 2JO1A 4ZMDA 2WZ7A 2G62A 3G4ZA 4HH2A 3S1KA 2QJYC 1BCCG 2RMZA 4BG0A 5EGYA 1K04A 5EHHA 2Z4EA 3ABKC 4YT4A 5DQZA 3RK3E 3ECSA 1VLSA 5T1DB 1NTKG 2K9JB 2AEMA 1S9KE 3AECC 1IFNA 3FAJA 4D4NA 2EPNA 4E0IA 5TJHA 2R7VA 2M8RA 4XE5B 3L72E 5L0FA 3B8EB 1VDFA 4P9TA 3C8GA 3EGXA 1FAVA 3RQGA 1RMVA 4O79A 1OR2A 2FFHA 2OYHC 2Y9YA 2CNWA 1KB9I 4KNVA 1PPJE 3CXHD 3ZQYA 3SXMA 2X51A 2A68F 2DB4A 1NOHA 2IBZI 3ZTMA 3F5HA 3VMXA 1V54C 2K1AA 4RESB 3L70E 2E43A 2PP4A 2HSQA 2BCCJ 1KB9H 4CDAA 3L74D 2WSSH 4WY4D 5B5EH 3BASA 1R5ID 3NMDA 3TGUJ 4C46A 1GZLA 1YTZT 3GW6A 3H1LE 3CC4P 5L0GA 4JEBA 3CMEP 1Y4CA 1H7IA 4L6RA 4W80A 2EILC 2KSEA 3O39A 4B6IA 4LGDE 2XL4A 3B9QA 2LXBA 2ZXEB 3U3FA 2WSEJ 3M9QA 4H44C 1YVIA 2Q3EA 2R7WA 4KHXA 1DOVA 2FFDA 1F1MA 2H7OA 2VH3A 5KAIH 2J9UA 1RE4A 2OU6A 1L2PA 3A0BE 5AW5B 2WT7A 1EZVE 1NTZD 3EZIA 1JB0J 2LK4A 2QVAA 4U7JA 2O1JA 2YZSA 5DS5A 2W4BA 3C8GD 3GM1A 2KLVA 5D92A 2V3CC 1YJWP 2J9VA 1RE3A 3AEBC 1ZHYA 2CNWD 1LIHA 2IXOA 2Y0DA 2Q3TA 1Z7Qc 3TJ5A 3LNMB 4KJMA 4H0LC 4YN0B 1FJPA 5BU8B 1LTIC 4WGYA 4EKWA 4QMAA 1PGJA 2H89C 3CCMP 1NKNA 2BL2A 1NYHA 1SQQD 1VQOP 1OKKA 1LWUC 3EFFK 1JCDA 1GTWA 1EDJA 3H1JJ 2HPCA 3V6IA 2DGJA 2YXQB 2IBZG 1NTZK 5GTHE 1L4AA 5L0HA 2QLAA 1SP4A 2R7UA 3FOPA 4XFJA 2YKOA 3L71J 4JEAA 3LS0A 3CD6P 1RKEB 1RXQA 2FBWC 2QJYB 1SQXG 2A0BA 2ICWG 2ZXPA 1KQSO 2HV6A 3NKDA 1OVVA 1C02A 2WZFA 1JUNA 1VF5C 1YI2P 1Z56A 4OIRF 1PD0A 3L1MA 1FAPB 2ZYGA 4E18A 3AG3C 3BEHA 2HFED 4H13C 5FZTA 3DE8A 1LT9A 1SQQK 3HE5B 3Q7LA 3WAQA 3PDMP 2I8DA 3HD7C 2W6JH 1UIIA 2KI7B 4YL1A 4XLNF 3CCJP 2WSCJ 3Q5RA 3N0TA 4U3FJ 3ZDLA 1C03A 3MP7B 1FDOA 3BCCJ 1ZHTA 1VLTA 4PD4D 2ZYAA 4ZLDA 4IB4A 2Q1KA 2E74C 5GTIE 3FMSA 4P9FA 2FYUE 2ZYDA 1OKKD 3UGPA 5HV9A 5L3QA 1YJGA 2JEEA 4MW3A 2CPBA 2W6AA 4JC7A 2QUPA 2ZFCA 5L0DA 4NC3A 3RK3D 1GL2B 4WWIA 2ZXOA 3B4SA 1S9KD 1EXIA 3U9MA 1L0LG 2E5TA 1A02J 1ZW2A 4AE4B 4H44B 5CI9A 3VN0A 4CS8A 2WB7A 2YXRB 3L72D 4XWJA 3I55P 1NAYA 4M63A 2CDQA 3EG9A 3C7JA 1FU1A 2Q7RA 2L9JA 1NZEA 2J7PA 1H6GA 4I44A 1L0NJ 1YIJP 4Z9IA 3OW2O 5KYUB 2VRSA 1PPJD 1G2CB 1FZCC 3TF5A 3UGOA 4FX5A 3AQBA 1PCXA 1OIPA 2W27A 2N9YB 3NDBB 3P8MC 2J9BA 3P7KA 2OOCA 3U1AA 2E75C 4YT2A 3RIPA 2FXOA 2JR8A 1OVRA 4P6IC 3HE4B 3L70G 2D4UA 1T5OA 1U7JA 3KDPB 3ABVC 4H0LB 3C62A 4JIOA 1IC2A 1T6UA 4BXLA 2XDJA 2IPPA 4N6HA 3H1LD 2A6HF 2IXMA 1RQVA 1Z63A 3OA1A 3PH0A 1H9GA 3C18A 3D6YA 1SQPG 5KTBA 2BCCG 2GM4A 1OX3A 3W68A 1KILC 4H4KC 1WMKA 2Z5HA 2HLOA 1G1JA 2NUTB 1JR8A 5E79E 4MTFA 3KYJA 4DRIB 1UIXA 3SP1A 1RF1C 1VQLP 2G3AA 4G0HA 1M56D 4GDOA 1IFPA 2I1JA 5AVWB 3G4SP 3MBGA 1EZVD 3AEDC 3F89A 2R7QA 1NWQA 3AJMA 2WMMA 4IOIH 4U9EA 1VF5B 4GKGA 1P84I 3H1KE 2WVOA 1NTME 2C0WA 1YHQP 5T3WA 2J7PD 3KZIH 3NYJA 1RCPA 1H9TA 3NKEA 4H13B 1NO4A 3MLGA 3R2PA 1HGVA 2KNHA 3H6PA 1T6QA 3HD7B 2M0BA 3HKKA 2QJKC 5B1BC 2B9BA 4GOEA 1P84H 4K1OA 2HUJA 4YL3A 2QJPC 4JJFA 5KLIB 2AVKA 1S72P 4GODA 2QNLA 3AE3C 3JCUQ 3FX0A 1EQ7A 3AG2C 5KLVJ 3A5TA 1YJ9P 3IF4A 2UUIA 3VM6A 4ONSA 4LDQA 1JMWA 5FCLA 1NU1E 3Q6MA 1DIPA 5EFWB 2JWDA 4KI2A 5KYYA 2IZ1A 1S7ZA 256BA 2YLGA 1OW7A 1PP9J 3B0VC 3C8VA 5B66H 3HNLA 1JM0A 4DZOA 2ASRA 2R5BA 1JAFA 1NVOA 5APVA 1QGKB 1CI6A 3L73E 2OYHA 1FR0A 3CWBJ 4KBLA 3JRTA 3RL0g 5AW7B 3LNRA 3ITKA 5KYXB 5AW4B 1JY3N 2OG2A 1BGYE 2LSEA 1YITP 1QLEC 2C0XA 1MV8A 4DVZA 3TYYA 3H1HJ 5AW0B 4Z1MH 3NRHA 4OIQF 4EYYQ 1APCA 3CCVP 1KQLA 3NTNA 2OJQA 1KV4A 4MTGA 2L5GB 1LI5A 2ZT9D 1ORSC 1RF0A 3AQCA 2R7SA 3I5QA 2LCHA 4NPDA 1UG7A 2HFIA 2E75B 3ASOC 1DD4A 2OYIC 4BJ1A 3V2QA 1BCCE 4AE4A 4HE8D 2E76D 3WUVA 5AW1B 3RF3A 2FYUG 1BE3G 1X8YA 3ZIBA 1SR2A 2J0WA 2FYZA 4EHPA 1NTKE 2Y3DA 3LW5J 3LIDA 2AEFA 3S9OA 1BDDA 2RSEB 5KYUA 5E79H 1G2CA 2EIJC 4ANJA 1ZW3A 2R02A 1NJIQ 3PRJA 3QTHA 5BQIA 4K7BA 3BVHA 1RF1B 2Q6QA 1Q0GA 3MYFA 1X79B 2NPSD 4OGQC 2NZ2A 1XTGB 3V2NA 2P0NA 5H2FH 3R7CA 5A6BA 1Y9BA 4D6TG 3L75E 1J1EC 2RKLA 2NG1A 2C9NY 5T3TA 2HODB 1GGQA 3CCEP 3TSIA 1LWUA 1IK9A 3EQ2A 1KFNA 2R9RB 4W7ZA 2DYSC 3HTKA 3SEOA 4FAPB 2Q3IA 4J7YA 2NUTA 3M9BA 1IFDA 3PHF2 5APXA 1ZU4A 1JPJA 3RGUA 1JY3P 2QJPB 3L74J 1KILE 3I4UA 4BWNA 2GUSA 4N6JA 4IJJA 2C03A 2J59M 3KXDA 1BR2A 1AVYA 3Q2YA 1OCOC 3OEOA 2JX0A 1Y47A 4TLFA 3H1IG 1H8AA 3K1IA 5APUA 5CCHD 3N2ZB 3FVYA 1CSBA 1KTMA 4GQHA 1M2VB 3U0CA 1T8ZA 1YQ3C 2VB6A 2XS1A 2R44A 2PBEA 2LFDA 3RW0A 3KQGA 3HD7A 3CPWO 3DD7A 2H8AA 5AW6B 4I7ZB 3FXEA 2Q5UA 3H1KD 1NTZJ 1NTMD 4MN4C 1ORJA 1FS0E 4PJ0E 3NG1A 2OQMA 4U5FE 3Q6NA 1ZP0C 1TWAA 3NXSA 3IFMA 5APQA 3KMIA 2LR2A 1GK6A 1E84A 1KB9E 4BJTA 2P67A 1GK4A 1OCRC 5B5EE 4I3MA 3EPVA 2IBZE 4RO0A 1ZHXA 2J45A 4JBZA 2OEVA 3AGTA 3I56P 5KYWA 2A06E 1NU1D 2K88A 1FBMA 1SQQJ 2F22A 2QG4A 5IY5C 1NH4A 3USSA 2OYIB 2OTLP 1USEA 1SQXE 1V55C 4KC9A 3A3YB 3V5XA 3JZ0A 3U2LA 1NTMK 1XTCC 4X0RA 1VF5D 1YA9A 2WSFJ 3U2MA 5APYA 1T9KA 5KAIE 3H25A 3AG1C 3L73D 5A6JA 4L74A 3D6ZA 1NAFA 1FZCA 1LE2A 3IQTA 1PGQA 2FYNC 2NRGA 2L81A 1QL2A 3HD7D 2XLDA 2B87B 4AYCA 1BGYD 3RVYA 3HJCA 4XQ1A 2XLMA 4MVSA 4YJWA 1SFCB 4KT0J 1J8MF 2IFMA 2QIWA 4RDAA 4C7OA 1LGHB 3FGAD 3SWFA 4OGQB 2KP8A 3LEVA 1NU1K 2N1TC 3UMKA 1I4ZA 1N8RQ 3L0IA 2E5YA 2MJZA 1SLQA 1SQBG 2YO3A 2QSIA 2WITA 1AEPA 4MVRA 1J1EB 2E74D 2AXTE 2KGOA 4LACB 1PGOA 4ZNCA 3EFGA 1KILA 4RBNA 4JURI 1BCCD 1YBKA 4JJGA 3CCUP 2B88A 4G7ZF 2H8PD 3EH2A 1OR3A 3CSKA 1NTKD 1RF1A 1IFMA 1L0LE 4L73A 2R5DA 2VCCA 4DJ9A 4XEKA 2V26A 2WPQA 4NCQA 1WRGA 3EHMA 2IYPA 2P1JA 1T2KD 2EPKX 4IAOA 1M1JC 5E3CA 1AFOA 4NY3A 4UDVA 4CDVA 2J0XA 3AG4C 1LTJC 2KNCB 3I5PA 1FC2C 2A0UA 1AVOB 5CJ4A 4WGZA 3L72J 1ZU5A 2B0HA 1W5CE 5B3SC 3WU2E 3PJSK 1VPCA 2R25A 4PJ0H 5JLIA 1YQ4C 1ZRTE 2JJLA 5F5FA 1NTKK 3L75G 1A41A 3MTUE 1IJDB 1FJKA 3RL0C 4LLCA 2WPVB 2OCCC 4W8PA 2XM0A 1BSNA 3RH3A 1SQPE 5AVSB 1ZOYC 2BCCE 3WMM0 3HLZA 1KILD 2XKMA 1GL2C 3QZCA 2Y3HA 2YVKA 3M9HA 1HGZA 3H1LJ 1MFZA 3AEAC 4DVYP 1IZMA 1NG1A 1Q86Q 1L3PA 2YQYA 2YHSA 1CPRA 1U89A 4XPXA 3ABLC 2HKVA 2V7QH 2KYHA 1M57C 2KZIA 3QWOC 2KC3A 4U5CE 3RK2B 3M0DA 1OXBA 5AGFA 2O01H 1CPQA 4ZKPA 2PAJA 4C3BA 2YLDA 2ZVOB 4OH8B 1MUUA 4CDYA 3GG2A 3B0PA 3DM9B 4JVSA 2KB7P 2HR3A 3CX5E 1YZCA 1URQB 2HYNA 2O01N 2FYNB 1EXJA 1KYOI 2ZJSE 2G3VA 3K66A 2GUVA 2W4MA 3DWWA 3DXJF 1J2JB 3UMHA 3GORA 4OVNF 2R7TA 1KB9D 2OYIA 2J58A 4BRYA 4N06A 4PJNA 4ZLCA 2N1TB 1QKRA 2AXTH 2Q7CA 3JCUH 4JCHA 1LNQA 2NUPA 1M7LA 1VQMP 3OAKA 2RD9A 1KYOH 2IBZD 2I1KA 4YXDC 1EQ1A 1KU2A 3T97B 3GLMA 1HBWA 2Y69C 2JDIH 3N24A 4MVMA 3VF0A 1AA0A 3WUTA 4DCKA 1Q7YQ 3LESA 3PTZA 2A06G 1SQXD 2GFHA 2MYSA 1J8YF 3RVZA 1WT6A 2B87A 4CSAC 1SF8A 2Z15A 5CHXA 3ZTZA 2OJED 2WPRA 3M4BA 2GAQA 3VOPA 2ZXWC 3M91A 4PV1C 3TNUA 4EIYA 3F47A 1QLED 1GW4A 2L6GA 2MWQA 4ASVA 2XL8A 1M1JB 5CCGA 1Q0DA 3KZIE 4XPWA 1MZ9A 1LTJB 3K5BA 3WU2H 3KKBA 4LC1A 5KLIC 1D0ZA 1LTTC 3MFNA 1ZLLA 2PFXA 1GU5A 1KD1Q 1Z6AA 1N73B 4HYTB 3OWTA 5AC4A 1S5LH 1SQXK 1P84E 3O6XA 3C1LA 5B1AC 3TOLA 4IAQA 4JCZA 3NMKA 1S3JA 1MMAA 3L4FA 4I1LA 2K9JA 2WVQA 3IAOA 1LS1A 2Y3GA 2M5AB 1BE3E 2YNYA 3N7NA 3K1HA 2YL3A 1FZFA 4RD9A 2QRXA 4AX2A 3EGDB 4MVUA 2OEXA 3RL0B 4AL0A 2VCAA 1JY3O 2O1KA 4JRZA 1QVGO 2QY9A 2KNCA 1L4AD 2R7RA 1OW8A 5B66E 4CS9C 1N1CA 1L0LD 3SYNA 2QE7H 1Q82Q 3AE4C 3GHGC 3Q3DA 3CX5I 4JTAB 1YLMA 4DXWA 2WSEH 4BJ5C 1MQVA 3DMDA 1O87A 1BR1A 1KFMA 1QVXA 4D6TE 2HJ3A 3SFDC 1IW7F 2KQ9A 3CL3D 3VYIA 3CX5H 3JT1A 3M15A 2XU6A 1J1DB 3KL4A 5COGA 4UB6E 2FXPA 4BJ6C 2IOQA 3BRJA 5CCGD 2JP3A 1ZRTD 1GS9A 5D91A 3L70D 4AL1A 3B5NB 5JRAA 1AV1A 3AE7C 5L3VA 1L0LK 2EIKC 2EINC 1HMOA 3S84A 1QEXA 3DAFA 1A7VA 4XEVA 5B3IA 1A0BA 3M0AA 2R05A 1SQPD 2BCCD 1ST6A 4RKUJ 1FZBA 2R03A 4Y99C 3CI9A 1OQCA 3DAGA 3H1IE 3C9IA 1JMMA 1HE9A 4JYBA 2PX3A 1I4YA 1HF9A 3EH1A 3TGUG 2YIUC 3BRVB 3TULA 1GQAA 2X0CA 2HV7A 1TFKB 1LTBC 2E87A 4EBKA 2Q4FA 2ITAA 2OARA 1MMDA 2AP3A 1LPEA 2D2CB 5TISE 2C9LY 1VB5A 2N1TA 4LDRA 2ZPAA 5H2FE 1S5LX 1JOCA 1FMVA 2XNDH 1KORA 2XM4A 5AVZB 4PV1B 1SQPK 3C63A 3CC2P 3H32B 4M3LA 4YK5A 1YARO 2CYDA 3H1KJ 1NTMJ 2IX7C 2OTJP 1X0TA 2KJGA 3HNKA 2FAPB 3O6QB 3L8JA 3CAXA 4C3EA 3JSZA 4U5HA 1RKEA 4MVZA 1HW1A 2W9YA 1S1CX 4N4WA 4U5DE 1G4US 3LJBA 3DJUB 2P2UA 1OZHA 3TD7A 3EFOB 3AE1C 1SQVJ 1M8OB 3UMIA 1VQ7P 1O3UA 1WGWA 2GA0A 3QMKA 3KH2A 4CJOA 1N7SC 1NU1J 4B86A 4EBBA 1H88A 3HE5A 1Q0MA 4DOZA 5E33A 4EOTA 3H1JG 4CIHA 1HE1A 2M4EA 1H0TB 4I7ZC 1YJNP 2M3EA 3L35A 1ZXGA 1NHLA 1WN0A 1YDIA 3ZWIA 3A0HH 3GHGB 1HW2A 1VYKA 2BE5F 4IL6H 3L71G 3L73J 3O10A 5F5HA 3KHUA 4XEFA 4DRJB 1FFHA 3CWBE 5K5GB 1USDA 2K3RA 3CMAP 2N1TD 5JT4A 4UB6H 3T4RA 1LM3B 3Q5PA 1SQBE 1BGYJ 1YAUO 3GEHA 3EGDA 2AEJA 3NYLA 2KOGA 2R7OA 3JSEO 1P84D 1BSHA 3W2WA 2FFDC
chains in the Genus database with same CATH topology
2WSEJ 1RQUA 4H44C 4PV1C 3AE6C 3GMAA 2E74B 2E74C 1UFBA 3GM2A 4H13B 1HF9A 2L6GA 4H0LD 1KQFB 3SFEC 2YIUC 3TULA 2YWAA 3K7DA 2QJKC 3JZ0A 4EBKA 2WPVB 3AEFC 2E76C 1NGMB 1VL2A 4OGQC 1KNYA 2NZ2A 2QJPC 5KKZC 5KLIC 1JB0J 3RQFA 1VF5D 1ZOYC 3C8GB 1Q90D 2D2CB 2D2CC 2IDBA 1U57A 2WSFJ 1Y9BA 4U7JA 3Q5SA 3AE3C 1R8EA 2LK4A 3IN6A 2J5UA 3H25A 3C8GD 2WQYC 5L8RJ 3GM1A 3O6QA 3GF3A 3D6ZA 3MFNA 3R4YA 1EXIA 3AEAC 2KK1A 2ZT9B 2JPUA 3AEBC 3RQEA 1S5LX 3Q1MA 1WOLA 2E75D 1KORA 2FYNC 2OQQA 1OW6A 1DIPA 2HSBA 4H44B 4PV1B 4NQFA 2H88C 3IAOA 2JO1A 1OW7A 4H0LC 4R4LA 3C8VA 3GF7A 4KT0J 2QIWA 1DD3A 3AE9C 3EWKA 2QJYC 3FGAD 2E76B 4OGQB 4TT3H 2H89C 1K04A 2L6HA 3JYYA 3D70A 3L8JA 1NYHA 3RK3E 1OW8A 1KILE 5M1BA 1KMIZ 3AEGC 2QSIA 1IK7A 3AE4C 4YTPC 3AECC 4PV1D 3RL0g 4R32A 1S1CX 2E74D 3Q3DA 1TU3F 1PL5A 1K40A 4H13D 2K9YA 3Q2YA 1EXJA 4EBJA 2E75C 2JX0A 1JOGA 4Y28J 1ZMEC 3L8IA 2YMKA 3AE1C 4XFJA 1KTMA 4R4MA 3C8GA 1O3UA 3RQGA 4H0LB 3ABVC 3B71A 3U0CA 4Z1MH 1YQ3C 1QVXA 1V4AA 2D2CD 2FBWC 2P10A 3SFDC 2PBEA 2MKVA 1RQVA 1PV3A 3GM3A 3C18A 1K05A 1VF5C 3D6YA 2ZT9D 2FXPA 4I7ZB 4I7ZC 1WTYA 4XEKA 3BRJA 1WMKA 4H44D 4YXDC 2BEZF 2JP3A 2V7QJ 2G8YA 3AE5C 3GLMA 3T97B 4H13C 2E75B 5F28E 1DD4A 4IL6X 3O10A 1UIXA 2O01J 3D71A 3AE7C 1ZP0C 2G3AA 4XEFA 4GDOA 2E76D 4OGQD 2L6FA 4XEVA 2Q00A 2BEQD 2WSCJ 1OMIA 3AEEC 1WWPA 1FDIA 3Q5PA 3Q5RA 3AEDC 3LW5J 1PIXA 3AJMA 1GMJA 4RKUJ 1FDOA 1VF5B 3AE8C 3AE2C 3G9RA 3S9OA 1KQGB 2ZT9C 1AJYA 1HJ0A 1YQ4C 1ZZPA 3U3FA 1ZRTE 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE6 C;  1UFB A;  3GM2 A;  2L6G A;  3SFE C;  3TUL A;  2YWA A;  3K7D A;  3JZ0 A;  4EBK A;  3AEF C;  1KNY A;  3RQF A;  1ZOY C;  3MFN A;  2LK4 A;  3AE3 C;  3C8G D;  2WQY C;  3GM1 A;  2KK1 A;  3AEA C;  3RQE A;  2JPU A;  3AEB C;  1WOL A;  1OW6 A;  2HSB A;  4NQF A;  2H88 C;  1OW7 A;  3AE9 C;  2H89 C;  1K04 A;  2L6H A;  3JYY A;  3L8J A;  1OW8 A;  3AEG C;  4YTP C;  3AE4 C;  4R32 A;  3AEC C;  1K40 A;  4EBJ A;  2JX0 A;  1JOG A;  3L8I A;  3AE1 C;  1KTM A;  3C8G A;  1O3U A;  3RQG A;  3ABV C;  3B71 A;  3U0C A;  1YQ3 C;  1QVX A;  1V4A A;  2FBW C;  3SFD C;  2PBE A;  1PV3 A;  3GM3 A;  3C18 A;  1K05 A;  1WTY A;  4XEK A;  3BRJ A;  4YXD C;  3AE5 C;  5F28 E;  3O10 A;  3AE7 C;  1ZP0 C;  2G3A A;  4XEF A;  2L6F A;  4XEV A;  2Q00 A;  3AEE C;  1WWP A;  3AED C;  3AJM A;  3AE2 C;  3S9O A;  3AE8 C;  1ZZP A;  1YQ4 C;  3U3F A;  3C8G B; 
#chains in the Genus database with same CATH topology
 1RQU A;  3GMA A;  3PP5 A;  5AVV B;  1GL2 A;  2HS5 A;  2Y3B A;  1UFB A;  2YL0 A;  3CEX A;  2K37 A;  2FYU D;  1BE3 D;  1Y8A A;  1VOM A;  3AOU A;  1K73 Q;  2EPO A;  5AC5 A;  2LP4 A;  4U3F G;  3ATP A;  1LTA C;  3BCC G;  2A6E F;  2DYR C;  1BCC J;  3ABM C;  1D1A A;  4OD5 A;  3W2V A;  2W6B A;  4Y99 B;  1NTK J;  3B29 A;  2JWA A;  2XLV A;  1WAS A;  2OQQ A;  4QDL A;  2D5R B;  4C7R A;  4CJG A;  1FOS E;  3U5S A;  1M90 Q;  2YIU B;  3ASN C;  4WY4 B;  1SFC C;  3GF7 A;  4W8K A;  3AE9 C;  5TIS H;  1E79 H;  4J7T A;  4D6T D;  3HE4 A;  1TWG A;  2KLU A;  5AVX B;  3G6E P;  2FYU K;  5DS6 A;  5A6A A;  3G3Z A;  1VQ8 P;  2IFN A;  4MQ9 F;  3KYQ A;  1PL5 A;  5KAF H;  4EBJ A;  1NBB A;  4L75 A;  1ZME C;  3K33 A;  1L0N G;  4R4M A;  3I5C A;  3V5B A;  1PZQ A;  1HMD A;  2P7V A;  1T6A A;  2LIG A;  2Q9I A;  1GL2 D;  2P58 A;  2G3K A;  1FFT C;  1QL1 A;  1CZQ A;  1HJB A;  3EGX B;  4H44 D;  3GWL A;  3H1I D;  2EPL X;  3ZQV A;  5BU5 A;  5CBO A;  3EJN A;  3E70 C;  5L0C A;  2G8Y A;  3L74 E;  2XXA B;  4XPY A;  4IL6 X;  4G78 A;  3H2V A;  2PP6 A;  2LXC B;  1EDL A;  3MX3 A;  2IZ0 A;  5DJT B;  1Y6D A;  2P61 A;  4UB8 E;  1N7S B;  3HNJ A;  3QVZ A;  1G8X A;  3X2Q C;  2YMY A;  4PK4 A;  1YTZ I;  2IXN A;  1AJY A;  3LLK A;  1VK5 A;  4OIP F;  2QA4 P;  2H43 A;  3HRN A;  2O9X A;  3W8H A;  3GM2 A;  1OXZ A;  1ZYR F;  2J9W A;  4H0L D;  1M6T A;  3DM5 A;  3WOD F;  5A6B D;  3IEE A;  2P1A A;  1SZI A;  1AUE A;  2J8W A;  1FNT c;  4WBA A;  1KNY A;  5AVQ B;  3U3B A;  4CX9 A;  1Z5Z A;  3V4Q A;  1TKN A;  3P8C E;  1Q90 D;  4K0D A;  4WAB A;  4DBQ A;  4CS8 C;  4IWB A;  4Q4Z F;  3R4Y A;  1Q81 Q;  4HB1 A;  2FFD B;  3RYL A;  3LS1 A;  2W90 A;  3CCR P;  4Q5S F;  3GHG A;  3HUS C;  4U5B E;  2QM8 A;  1AQT A;  3RK2 C;  5KYX A;  4IGG A;  3EWK A;  3GOD A;  3G71 P;  1N86 A;  2WVR A;  1ZVZ A;  4PAC A;  2OKU A;  1DEE G;  2DW3 A;  2W8Z A;  4NPF X;  5KLV G;  3JYY A;  5C39 A;  4HKZ H;  1SQX J;  2NSF A;  1OCZ C;  4YT5 A;  1MNE A;  3LW5 H;  3AEG C;  1JRA A;  3CLQ A;  4U9D A;  1FTS A;  4PV1 D;  4HFF B;  1JY2 N;  2VCB A;  1SQV G;  1ZR2 A;  2XZR A;  4ASW A;  4H13 D;  1K40 A;  1URQ C;  2K9Y A;  2KSF A;  1PP9 G;  4PR9 A;  5APW A;  5TJ5 E;  3BRT B;  5JSL A;  4BJ6 A;  1JOG A;  5JP7 A;  2SPZ A;  1E83 A;  1Q2N A;  3FXD A;  3TQO A;  3B0U X;  3B71 A;  4XLP F;  2OTK E;  4YXW H;  3JSV C;  1S4X A;  4C7N B;  3CXH I;  2I8B A;  4O6M A;  2LD6 A;  2VAS A;  1SQB D;  3CWB G;  3SXK A;  3LIE A;  5AVR B;  3T6J A;  2WZL A;  3TK0 A;  3DI5 A;  1X9V A;  2P6V A;  2H7B A;  2WZG A;  2HJM A;  3ZSU A;  1ZV8 A;  3JCU E;  3MZW B;  1KC8 Q;  1A7D A;  4KNW A;  3CXH H;  1HUC A;  1KYO E;  4PFO A;  3H1H G;  2JKV A;  2PX0 A;  3MUD C;  2PFD A;  4GEH A;  1WWP A;  4ZKU A;  4A7P A;  1SVF A;  1PIX A;  1OCC C;  4FES A;  1IZN B;  1SYQ A;  3VMZ A;  4JE9 A;  4GOF A;  4I1O B;  2ZT9 C;  3JRM O;  3S90 A;  2H7H A;  1MKM A;  1L7C A;  4EUK B;  4IFF A;  2KZJ A;  1RKC A;  2YEV A;  1SQB K;  4UB8 H;  1L0L J;  2XRH A;  4ER9 A;  1KQF B;  2E42 A;  2HOD A;  1E5W A;  2ZVN B;  3A11 A;  3K7D A;  2IBF A;  3RBZ A;  2M3B A;  2E76 C;  5KKZ C;  4MS2 A;  3RQF A;  2Q9B A;  3FDQ A;  3MD0 A;  1D7M A;  5AW2 B;  3T9O A;  3IPM O;  1N73 C;  4JKV A;  5BQG A;  1LE4 A;  3IQ6 A;  2HG5 D;  1LT1 A;  1ZR4 A;  3L75 D;  3EZH A;  2KK1 A;  3M1C B;  1GDT A;  1BDJ B;  1WOL A;  2E75 D;  4NQF A;  3H2U A;  4XTK A;  3RFY A;  2OGU A;  1S5L E;  1SMY F;  1NU7 D;  4A2N B;  1MMN A;  4K35 A;  2XLH A;  5CIV A;  1BR4 A;  1JY2 P;  1JCC A;  1M2O A;  3VTP C;  3L70 J;  1FDM A;  2XXA A;  1Z3I X;  3MGN A;  2C04 A;  2W45 A;  1FZG A;  2NPS C;  1BBH A;  1M2V A;  1U0B B;  3VMY A;  5M1B A;  1N7S A;  3MIW A;  3V5Y A;  1KMI Z;  1BDC A;  3EG9 B;  3J06 A;  1SQP J;  1YYX A;  1LI7 A;  3TGU E;  3UNG C;  1LKX A;  4N78 E;  3L8I A;  2YMK A;  4OWF A;  1ZHW A;  3O55 A;  2IM8 A;  3HUS B;  4LLE A;  4MVQ A;  3L74 G;  4YWQ A;  1RF0 C;  5AVT B;  1HVV A;  1VQ6 P;  3M4C A;  1K05 A;  2LFF A;  1J1D C;  3AGU A;  3L37 A;  4DBR A;  2WSF H;  2AWY A;  2YKZ A;  4A4A A;  1NKZ B;  5GPG B;  3II6 A;  1KZU B;  4HEA J;  2YLI A;  2YKQ A;  3B5N C;  1G5Z A;  2YO2 A;  5CCH C;  3S27 A;  4NTB A;  4ULV A;  3LEO A;  3AEE C;  4IAR A;  2GWW A;  2FXM A;  2L7A A;  5DS4 A;  3P8C D;  2XV5 A;  3E1I A;  1NTZ G;  2B0J A;  3T6G B;  4PD4 I;  1U6H A;  2KYV A;  4Z9J A;  3U8P A;  2ZD9 A;  3NYM A;  2Q9C A;  3HNI A;  1MFT A;  2A06 D;  2ETS A;  3PLN A;  1N7S D;  3NFQ A;  4GIF A;  3VAY A;  3T6B A;  2LKM A;  4PD4 H;  2PNO A;  5DQT A;  3H1J E;  3RKO F;  4U5G A;  2UUH A;  2N9B A;  2RN0 A;  2EIM C;  2D2C C;  2IDB A;  1U57 A;  1W2W A;  1SFC A;  3FWN A;  2XS8 A;  2TMV P;  2J5U A;  5DVW A;  4C7N A;  2POH A;  3ZC4 A;  1B68 A;  3L71 E;  2YRF A;  3GF3 A;  5JUA A;  3U59 A;  1SQQ G;  3HTK C;  2A45 I;  2ZT9 B;  1JTH B;  3IQC A;  1EKY A;  3Q1M A;  4YL0 A;  3E1R A;  4H54 A;  1XZQ A;  1DD3 A;  2PF4 E;  2E76 B;  2FY8 A;  2A45 H;  5KKZ B;  3U8V A;  2ZXR A;  1JNM A;  1RJ9 B;  3K1I C;  3IHU A;  5KYY B;  1IK7 A;  4YTP C;  1JO5 A;  4XA4 A;  4DT0 A;  1K8A Q;  3G50 A;  3FXH A;  1FE6 A;  4LER A;  3SXZ A;  4Y28 J;  1EDK A;  1KYO D;  3EQL F;  4U3F E;  4YPC A;  3TDK A;  3BCC E;  2OYH B;  1CI6 B;  3S4R A;  3GAN A;  3LLI A;  2GA1 A;  2P10 A;  4PJJ A;  3U9J A;  1LP1 B;  2MKV A;  1PFI A;  2NPS B;  3H65 A;  2FYU J;  1BE3 J;  2Q9A A;  1YA7 O;  3L36 A;  1AVO A;  3SNH A;  1CGM E;  1R5S A;  5KJ7 C;  4JYC A;  2BEZ F;  4G7H F;  1GU4 A;  3AE5 C;  4PJL A;  3CCQ P;  1SFC D;  2QEX P;  3ZG1 A;  3A0H E;  5A69 A;  4OGQ D;  4IL6 E;  3VMA A;  4ULW A;  2CPS A;  3VP8 A;  2L91 A;  2IXP A;  1DOW A;  1EZV I;  4JTD B;  1JMB A;  3L34 A;  3C8Z A;  3OJA B;  2KXP B;  2KIK A;  2P7J A;  2HZ8 A;  3WG7 C;  5CBN A;  4GYT A;  2IYL D;  2R32 A;  4G7O F;  1D0X A;  1KQG B;  3V7O A;  4D6T J;  2J46 A;  1H89 A;  4YT8 A;  4I2L C;  1T3J A;  1L0N E;  2A69 F;  3ZVR A;  5APT A;  3A0B H;  3V2P A;  1JPN A;  2A45 G;  1T2K C;  1CGN A;  1ORY A;  3DJN B;  2NSG A;  1X22 A;  2KS1 B;  1NU9 C;  4D4X A;  3L72 G;  3LUT B;  1NFN A;  3DZA A;  2VC9 A;  1T6I A;  3TJ6 A;  1Z23 A;  3HUS A;  4JPZ B;  2ZXX A;  3Q5S A;  3D70 A;  1R8E A;  4WVZ A;  5AVY B;  4IFD K;  1PPJ G;  2V4H A;  4L76 A;  2WTY A;  5L8R J;  5L0J A;  4WB4 A;  4NPE A;  2XL6 A;  4BEJ A;  3TGU D;  2HSB A;  3W8I A;  1K9M Q;  2LQG A;  4N78 D;  2H88 C;  1VQ9 P;  4E17 A;  4R4L A;  3EHN A;  2UWJ E;  1QX8 A;  2OYO A;  3H1I J;  2CCY A;  3FOO A;  1URQ A;  4WY4 C;  1FZE A;  2XLO A;  2QE9 A;  1M1K Q;  1RHZ B;  1E2X A;  3CCS P;  4DJG A;  4N3Y B;  5GTH H;  4EWC A;  3H1L G;  4EIJ A;  1C17 M;  1Q0F A;  3E9V A;  1LWU B;  2MHR A;  3V5Z A;  1PD1 A;  1QVF O;  1VTM P;  1NLX A;  1EI7 A;  2A1D D;  4IFM A;  3U1C A;  4R32 A;  5AW3 B;  4CIP A;  1IFJ A;  2I15 A;  3HTK B;  3SWK A;  1TU3 F;  2PRR A;  1Q0K A;  3CX5 D;  2R3S A;  1GD2 E;  1YYJ A;  5COM A;  4BPM A;  4OD4 A;  3A9C A;  3QW0 A;  4LLH A;  4CS7 A;  3S29 A;  2KK7 A;  3T97 A;  1T01 A;  5KAF E;  5COF A;  2FKW B;  1QZX A;  3F46 A;  3SSU A;  3IQ5 A;  1RH5 B;  2O3J A;  1PV3 A;  2WSC H;  3OA7 A;  1EZV G;  3MUD A;  3US6 A;  1OVU A;  1WTY A;  4RJT A;  2Z5I A;  2R3C A;  4Q7C A;  1HH0 A;  4K3A A;  2CW0 F;  3FAP B;  4PJM A;  1D0Y A;  3DKA A;  5F28 E;  1JTH A;  3RK2 D;  5KLV E;  4HJG H;  2Q00 A;  1D1C A;  1YZA A;  3JYH A;  1FZA A;  5CI8 A;  3V2R A;  4FWV A;  3H1J D;  2QM7 A;  1M1J A;  3O8Z A;  5AVU B;  3N4X A;  5GTI H;  1VQP P;  4JTC B;  1LTJ A;  1SQV E;  3AE2 C;  4E0H A;  1PP9 E;  5DJU B;  1LJ2 A;  1HJ0 A;  1URQ D;  3L71 D;  4O9B A;  5AW8 B;  1MMG A;  2AXC A;  1RJ9 A;  1ZW0 A;  3BAT A;  1N73 A;  2E74 B;  3CQZ A;  1TFO B;  3SFE C;  5JVE A;  2YWA A;  3WUU A;  3FHD A;  5BUO A;  2YL1 A;  1NGM B;  2YKP A;  2JD3 A;  1YYC A;  3UIA A;  4JF7 A;  3VYW A;  2M5A A;  3QW1 A;  5KYW B;  1NFO A;  4J32 B;  5KYN A;  1QPU A;  3NMJ A;  3IN6 A;  3M79 A;  4O6N A;  1EDI A;  2KW3 C;  1LP1 A;  3QH9 A;  2NPS A;  2Y0C A;  2JPU A;  3SWY A;  2QTV A;  3H1H E;  4O6Y A;  1SQB J;  3M0D C;  3VP9 A;  1T3U A;  1RE4 C;  1QSP A;  1GM5 A;  3V4W A;  4U3F D;  4HFK B;  3P32 A;  1W2B O;  1JY2 O;  4GT1 A;  3BCC D;  1TWC A;  3A7O A;  1FZC B;  4QI0 A;  3G4X A;  1RE3 C;  1IFI A;  1XZP A;  4O7G A;  2WWW A;  2WL8 A;  1TR2 A;  4LDK A;  2Y9Z A;  1A02 F;  4OIN F;  4JZA A;  4I6M C;  1HTL C;  4C7O B;  1G1I A;  4CBE A;  2BAS A;  1HWT C;  1E85 A;  4Z9H A;  4NTF A;  1A7E A;  3NMI A;  4E7Z A;  3B5N A;  1KN7 A;  1TQG A;  2CGE A;  2FGY A;  3PMR A;  4MTO A;  2KS1 A;  5CCH A;  1VYI A;  3DE9 A;  4J30 B;  2KSJ A;  2XLE A;  2IYO A;  1LTG C;  2XNX A;  1L4A C;  1R5L A;  3IR9 A;  3RK3 C;  4JQ0 D;  1KIL B;  1IO4 A;  1EC5 A;  1L0N D;  3WHN A;  2ZAE B;  1FMW A;  3W4Y A;  4MW8 A;  5CMZ A;  3L75 J;  1OXK A;  3RL0 D;  2WPS A;  4N6C A;  1VMA A;  3MHV A;  3S28 A;  2XLW A;  3CCL P;  1GW3 A;  3CXH E;  1FDI A;  1NSG B;  3POV A;  1LS4 A;  1GMJ A;  5E3A A;  4EDF A;  3AE8 C;  1PGP A;  2B89 A;  1LT9 C;  1EA8 A;  3S0X A;  3W67 A;  4CSA A;  3UR3 C;  5CCG C;  2Y39 A;  3C8G B;  1OFC X;  2GDC A;  3AE6 C;  2W83 C;  2M64 A;  1MND A;  1M57 D;  1VQ5 P;  3JTL O;  1SS1 A;  5E2Q A;  2Y0E A;  1VQN P;  3LAY A;  2HMZ A;  2QJK B;  1DH3 A;  3AEF C;  3MYI A;  1VL2 A;  3H32 A;  1W2E A;  4AUW A;  3KYI A;  1L0N K;  3ITF A;  4F4B A;  1VQK P;  1LTS C;  2WQY C;  3M06 A;  3O6Q A;  1ZHZ A;  5L0I A;  5DLJ A;  2HMQ A;  3B5N D;  3GWN A;  3RBX A;  1OW6 A;  4WJ0 A;  1JEK A;  2NPU A;  1G4W R;  3QVY A;  3CC7 P;  1M56 C;  2RH0 A;  1NTZ E;  4TT3 H;  3EFO A;  2L6H A;  2R7X A;  4BEM J;  2AWC A;  4W7Y A;  3TOM A;  2EPM X;  5BQH A;  3FWL A;  4MND A;  3K6B A;  3ZDM A;  4CS9 A;  3H1K G;  3X1O A;  1NTM G;  1H0T A;  5KJ7 A;  1I5N A;  2BC5 A;  2WT7 B;  1ZN5 A;  5AW9 B;  1TWH A;  5BVZ A;  5KLV D;  3VRC A;  5K0I A;  3TK1 A;  1E86 A;  1V4A A;  2D2C D;  3PCV A;  4U5E E;  1N2D C;  1N7L A;  1OWA A;  4BJ5 A;  3GM3 A;  1SQQ E;  4C3D A;  1D1B A;  1SQV D;  1V74 B;  1PP9 D;  5HSW A;  2AU5 A;  1U7M A;  2V7Q J;  5CJ0 A;  2H7V C;  3A2A A;  3SXY A;  3KPE A;  2O01 J;  1NU1 G;  4BRY B;  3D71 A;  1CW5 A;  1BZ4 A;  2L6F A;  2BEQ D;  1OMI A;  3CWB D;  2NUP B;  5A6K A;  4AK9 A;  1LVK A;  3KPH A;  1VQ4 P;  5JS5 A;  4PFP A;  2CK3 H;  3PHL A;  2HPC B;  3JC2 2;  1WAT A;  1RY3 A;  1L4A B;  3G9R A;  3CZ6 A;  3SZR A;  5KLV K;  3RK3 B;  1S2E A;  4AQR D;  1ZZP A;  4JW1 A;  3E7K A;  3L73 G;  1DEB A;  4IRU A;  3H1H D;  1DX7 A;  4NTA A;  4DOJ A;  4OIO F;  2WVN A;  2XSE A;  2YL7 A;  1SQV K;  5EK0 A;  1BGY G;  2DI3 A;  1AQ5 A;  3GEE A;  1FOS F;  5APS A;  1R4T A;  4WY4 A;  3TNU B;  1HY5 A;  4E7S A;  5KJ7 D;  4CPG A;  3GEI A;  1QQ3 A;  4I1M A;  4QI2 A;  1CGO A;  4PD4 E;  3Q7G A;  3RQE A;  1LT9 B;  2PGD A;  2KUB A;  4EI2 A;  4MVO A;  1XWJ A;  4DRH B;  1O5H A;  1S05 A;  2JO1 A;  4ZMD A;  2WZ7 A;  2G62 A;  3G4Z A;  4HH2 A;  3S1K A;  2QJY C;  1BCC G;  2RMZ A;  4BG0 A;  5EGY A;  1K04 A;  5EHH A;  2Z4E A;  3ABK C;  4YT4 A;  5DQZ A;  3RK3 E;  3ECS A;  1VLS A;  5T1D B;  1NTK G;  2K9J B;  2AEM A;  1S9K E;  3AEC C;  1IFN A;  3FAJ A;  4D4N A;  2EPN A;  4E0I A;  5TJH A;  2R7V A;  2M8R A;  4XE5 B;  3L72 E;  5L0F A;  3B8E B;  1VDF A;  4P9T A;  3C8G A;  3EGX A;  1FAV A;  3RQG A;  1RMV A;  4O79 A;  1OR2 A;  2FFH A;  2OYH C;  2Y9Y A;  2CNW A;  1KB9 I;  4KNV A;  1PPJ E;  3CXH D;  3ZQY A;  3SXM A;  2X51 A;  2A68 F;  2DB4 A;  1NOH A;  2IBZ I;  3ZTM A;  3F5H A;  3VMX A;  1V54 C;  2K1A A;  4RES B;  3L70 E;  2E43 A;  2PP4 A;  2HSQ A;  2BCC J;  1KB9 H;  4CDA A;  3L74 D;  2WSS H;  4WY4 D;  5B5E H;  3BAS A;  1R5I D;  3NMD A;  3TGU J;  4C46 A;  1GZL A;  1YTZ T;  3GW6 A;  3H1L E;  3CC4 P;  5L0G A;  4JEB A;  3CME P;  1Y4C A;  1H7I A;  4L6R A;  4W80 A;  2EIL C;  2KSE A;  3O39 A;  4B6I A;  4LGD E;  2XL4 A;  3B9Q A;  2LXB A;  2ZXE B;  3U3F A;  2WSE J;  3M9Q A;  4H44 C;  1YVI A;  2Q3E A;  2R7W A;  4KHX A;  1DOV A;  2FFD A;  1F1M A;  2H7O A;  2VH3 A;  5KAI H;  2J9U A;  1RE4 A;  2OU6 A;  1L2P A;  3A0B E;  5AW5 B;  2WT7 A;  1EZV E;  1NTZ D;  3EZI A;  1JB0 J;  2LK4 A;  2QVA A;  4U7J A;  2O1J A;  2YZS A;  5DS5 A;  2W4B A;  3C8G D;  3GM1 A;  2KLV A;  5D92 A;  2V3C C;  1YJW P;  2J9V A;  1RE3 A;  3AEB C;  1ZHY A;  2CNW D;  1LIH A;  2IXO A;  2Y0D A;  2Q3T A;  1Z7Q c;  3TJ5 A;  3LNM B;  4KJM A;  4H0L C;  4YN0 B;  1FJP A;  5BU8 B;  1LTI C;  4WGY A;  4EKW A;  4QMA A;  1PGJ A;  2H89 C;  3CCM P;  1NKN A;  2BL2 A;  1NYH A;  1SQQ D;  1VQO P;  1OKK A;  1LWU C;  3EFF K;  1JCD A;  1GTW A;  1EDJ A;  3H1J J;  2HPC A;  3V6I A;  2DGJ A;  2YXQ B;  2IBZ G;  1NTZ K;  5GTH E;  1L4A A;  5L0H A;  2QLA A;  1SP4 A;  2R7U A;  3FOP A;  4XFJ A;  2YKO A;  3L71 J;  4JEA A;  3LS0 A;  3CD6 P;  1RKE B;  1RXQ A;  2FBW C;  2QJY B;  1SQX G;  2A0B A;  2ICW G;  2ZXP A;  1KQS O;  2HV6 A;  3NKD A;  1OVV A;  1C02 A;  2WZF A;  1JUN A;  1VF5 C;  1YI2 P;  1Z56 A;  4OIR F;  1PD0 A;  3L1M A;  1FAP B;  2ZYG A;  4E18 A;  3AG3 C;  3BEH A;  2HFE D;  4H13 C;  5FZT A;  3DE8 A;  1LT9 A;  1SQQ K;  3HE5 B;  3Q7L A;  3WAQ A;  3PDM P;  2I8D A;  3HD7 C;  2W6J H;  1UII A;  2KI7 B;  4YL1 A;  4XLN F;  3CCJ P;  2WSC J;  3Q5R A;  3N0T A;  4U3F J;  3ZDL A;  1C03 A;  3MP7 B;  1FDO A;  3BCC J;  1ZHT A;  1VLT A;  4PD4 D;  2ZYA A;  4ZLD A;  4IB4 A;  2Q1K A;  2E74 C;  5GTI E;  3FMS A;  4P9F A;  2FYU E;  2ZYD A;  1OKK D;  3UGP A;  5HV9 A;  5L3Q A;  1YJG A;  2JEE A;  4MW3 A;  2CPB A;  2W6A A;  4JC7 A;  2QUP A;  2ZFC A;  5L0D A;  4NC3 A;  3RK3 D;  1GL2 B;  4WWI A;  2ZXO A;  3B4S A;  1S9K D;  1EXI A;  3U9M A;  1L0L G;  2E5T A;  1A02 J;  1ZW2 A;  4AE4 B;  4H44 B;  5CI9 A;  3VN0 A;  4CS8 A;  2WB7 A;  2YXR B;  3L72 D;  4XWJ A;  3I55 P;  1NAY A;  4M63 A;  2CDQ A;  3EG9 A;  3C7J A;  1FU1 A;  2Q7R A;  2L9J A;  1NZE A;  2J7P A;  1H6G A;  4I44 A;  1L0N J;  1YIJ P;  4Z9I A;  3OW2 O;  5KYU B;  2VRS A;  1PPJ D;  1G2C B;  1FZC C;  3TF5 A;  3UGO A;  4FX5 A;  3AQB A;  1PCX A;  1OIP A;  2W27 A;  2N9Y B;  3NDB B;  3P8M C;  2J9B A;  3P7K A;  2OOC A;  3U1A A;  2E75 C;  4YT2 A;  3RIP A;  2FXO A;  2JR8 A;  1OVR A;  4P6I C;  3HE4 B;  3L70 G;  2D4U A;  1T5O A;  1U7J A;  3KDP B;  3ABV C;  4H0L B;  3C62 A;  4JIO A;  1IC2 A;  1T6U A;  4BXL A;  2XDJ A;  2IPP A;  4N6H A;  3H1L D;  2A6H F;  2IXM A;  1RQV A;  1Z63 A;  3OA1 A;  3PH0 A;  1H9G A;  3C18 A;  3D6Y A;  1SQP G;  5KTB A;  2BCC G;  2GM4 A;  1OX3 A;  3W68 A;  1KIL C;  4H4K C;  1WMK A;  2Z5H A;  2HLO A;  1G1J A;  2NUT B;  1JR8 A;  5E79 E;  4MTF A;  3KYJ A;  4DRI B;  1UIX A;  3SP1 A;  1RF1 C;  1VQL P;  2G3A A;  4G0H A;  1M56 D;  4GDO A;  1IFP A;  2I1J A;  5AVW B;  3G4S P;  3MBG A;  1EZV D;  3AED C;  3F89 A;  2R7Q A;  1NWQ A;  3AJM A;  2WMM A;  4IOI H;  4U9E A;  1VF5 B;  4GKG A;  1P84 I;  3H1K E;  2WVO A;  1NTM E;  2C0W A;  1YHQ P;  5T3W A;  2J7P D;  3KZI H;  3NYJ A;  1RCP A;  1H9T A;  3NKE A;  4H13 B;  1NO4 A;  3MLG A;  3R2P A;  1HGV A;  2KNH A;  3H6P A;  1T6Q A;  3HD7 B;  2M0B A;  3HKK A;  2QJK C;  5B1B C;  2B9B A;  4GOE A;  1P84 H;  4K1O A;  2HUJ A;  4YL3 A;  2QJP C;  4JJF A;  5KLI B;  2AVK A;  1S72 P;  4GOD A;  2QNL A;  3AE3 C;  3JCU Q;  3FX0 A;  1EQ7 A;  3AG2 C;  5KLV J;  3A5T A;  1YJ9 P;  3IF4 A;  2UUI A;  3VM6 A;  4ONS A;  4LDQ A;  1JMW A;  5FCL A;  1NU1 E;  3Q6M A;  1DIP A;  5EFW B;  2JWD A;  4KI2 A;  5KYY A;  2IZ1 A;  1S7Z A;  256B A;  2YLG A;  1OW7 A;  1PP9 J;  3B0V C;  3C8V A;  5B66 H;  3HNL A;  1JM0 A;  4DZO A;  2ASR A;  2R5B A;  1JAF A;  1NVO A;  5APV A;  1QGK B;  1CI6 A;  3L73 E;  2OYH A;  1FR0 A;  3CWB J;  4KBL A;  3JRT A;  3RL0 g;  5AW7 B;  3LNR A;  3ITK A;  5KYX B;  5AW4 B;  1JY3 N;  2OG2 A;  1BGY E;  2LSE A;  1YIT P;  1QLE C;  2C0X A;  1MV8 A;  4DVZ A;  3TYY A;  3H1H J;  5AW0 B;  4Z1M H;  3NRH A;  4OIQ F;  4EYY Q;  1APC A;  3CCV P;  1KQL A;  3NTN A;  2OJQ A;  1KV4 A;  4MTG A;  2L5G B;  1LI5 A;  2ZT9 D;  1ORS C;  1RF0 A;  3AQC A;  2R7S A;  3I5Q A;  2LCH A;  4NPD A;  1UG7 A;  2HFI A;  2E75 B;  3ASO C;  1DD4 A;  2OYI C;  4BJ1 A;  3V2Q A;  1BCC E;  4AE4 A;  4HE8 D;  2E76 D;  3WUV A;  5AW1 B;  3RF3 A;  2FYU G;  1BE3 G;  1X8Y A;  3ZIB A;  1SR2 A;  2J0W A;  2FYZ A;  4EHP A;  1NTK E;  2Y3D A;  3LW5 J;  3LID A;  2AEF A;  3S9O A;  1BDD A;  2RSE B;  5KYU A;  5E79 H;  1G2C A;  2EIJ C;  4ANJ A;  1ZW3 A;  2R02 A;  1NJI Q;  3PRJ A;  3QTH A;  5BQI A;  4K7B A;  3BVH A;  1RF1 B;  2Q6Q A;  1Q0G A;  3MYF A;  1X79 B;  2NPS D;  4OGQ C;  2NZ2 A;  1XTG B;  3V2N A;  2P0N A;  5H2F H;  3R7C A;  5A6B A;  1Y9B A;  4D6T G;  3L75 E;  1J1E C;  2RKL A;  2NG1 A;  2C9N Y;  5T3T A;  2HOD B;  1GGQ A;  3CCE P;  3TSI A;  1LWU A;  1IK9 A;  3EQ2 A;  1KFN A;  2R9R B;  4W7Z A;  2DYS C;  3HTK A;  3SEO A;  4FAP B;  2Q3I A;  4J7Y A;  2NUT A;  3M9B A;  1IFD A;  3PHF 2;  5APX A;  1ZU4 A;  1JPJ A;  3RGU A;  1JY3 P;  2QJP B;  3L74 J;  1KIL E;  3I4U A;  4BWN A;  2GUS A;  4N6J A;  4IJJ A;  2C03 A;  2J59 M;  3KXD A;  1BR2 A;  1AVY A;  3Q2Y A;  1OCO C;  3OEO A;  2JX0 A;  1Y47 A;  4TLF A;  3H1I G;  1H8A A;  3K1I A;  5APU A;  5CCH D;  3N2Z B;  3FVY A;  1CSB A;  1KTM A;  4GQH A;  1M2V B;  3U0C A;  1T8Z A;  1YQ3 C;  2VB6 A;  2XS1 A;  2R44 A;  2PBE A;  2LFD A;  3RW0 A;  3KQG A;  3HD7 A;  3CPW O;  3DD7 A;  2H8A A;  5AW6 B;  4I7Z B;  3FXE A;  2Q5U A;  3H1K D;  1NTZ J;  1NTM D;  4MN4 C;  1ORJ A;  1FS0 E;  4PJ0 E;  3NG1 A;  2OQM A;  4U5F E;  3Q6N A;  1ZP0 C;  1TWA A;  3NXS A;  3IFM A;  5APQ A;  3KMI A;  2LR2 A;  1GK6 A;  1E84 A;  1KB9 E;  4BJT A;  2P67 A;  1GK4 A;  1OCR C;  5B5E E;  4I3M A;  3EPV A;  2IBZ E;  4RO0 A;  1ZHX A;  2J45 A;  4JBZ A;  2OEV A;  3AGT A;  3I56 P;  5KYW A;  2A06 E;  1NU1 D;  2K88 A;  1FBM A;  1SQQ J;  2F22 A;  2QG4 A;  5IY5 C;  1NH4 A;  3USS A;  2OYI B;  2OTL P;  1USE A;  1SQX E;  1V55 C;  4KC9 A;  3A3Y B;  3V5X A;  3JZ0 A;  3U2L A;  1NTM K;  1XTC C;  4X0R A;  1VF5 D;  1YA9 A;  2WSF J;  3U2M A;  5APY A;  1T9K A;  5KAI E;  3H25 A;  3AG1 C;  3L73 D;  5A6J A;  4L74 A;  3D6Z A;  1NAF A;  1FZC A;  1LE2 A;  3IQT A;  1PGQ A;  2FYN C;  2NRG A;  2L81 A;  1QL2 A;  3HD7 D;  2XLD A;  2B87 B;  4AYC A;  1BGY D;  3RVY A;  3HJC A;  4XQ1 A;  2XLM A;  4MVS A;  4YJW A;  1SFC B;  4KT0 J;  1J8M F;  2IFM A;  2QIW A;  4RDA A;  4C7O A;  1LGH B;  3FGA D;  3SWF A;  4OGQ B;  2KP8 A;  3LEV A;  1NU1 K;  2N1T C;  3UMK A;  1I4Z A;  1N8R Q;  3L0I A;  2E5Y A;  2MJZ A;  1SLQ A;  1SQB G;  2YO3 A;  2QSI A;  2WIT A;  1AEP A;  4MVR A;  1J1E B;  2E74 D;  2AXT E;  2KGO A;  4LAC B;  1PGO A;  4ZNC A;  3EFG A;  1KIL A;  4RBN A;  4JUR I;  1BCC D;  1YBK A;  4JJG A;  3CCU P;  2B88 A;  4G7Z F;  2H8P D;  3EH2 A;  1OR3 A;  3CSK A;  1NTK D;  1RF1 A;  1IFM A;  1L0L E;  4L73 A;  2R5D A;  2VCC A;  4DJ9 A;  4XEK A;  2V26 A;  2WPQ A;  4NCQ A;  1WRG A;  3EHM A;  2IYP A;  2P1J A;  1T2K D;  2EPK X;  4IAO A;  1M1J C;  5E3C A;  1AFO A;  4NY3 A;  4UDV A;  4CDV A;  2J0X A;  3AG4 C;  1LTJ C;  2KNC B;  3I5P A;  1FC2 C;  2A0U A;  1AVO B;  5CJ4 A;  4WGZ A;  3L72 J;  1ZU5 A;  2B0H A;  1W5C E;  5B3S C;  3WU2 E;  3PJS K;  1VPC A;  2R25 A;  4PJ0 H;  5JLI A;  1YQ4 C;  1ZRT E;  2JJL A;  5F5F A;  1NTK K;  3L75 G;  1A41 A;  3MTU E;  1IJD B;  1FJK A;  3RL0 C;  4LLC A;  2WPV B;  2OCC C;  4W8P A;  2XM0 A;  1BSN A;  3RH3 A;  1SQP E;  5AVS B;  1ZOY C;  2BCC E;  3WMM 0;  3HLZ A;  1KIL D;  2XKM A;  1GL2 C;  3QZC A;  2Y3H A;  2YVK A;  3M9H A;  1HGZ A;  3H1L J;  1MFZ A;  3AEA C;  4DVY P;  1IZM A;  1NG1 A;  1Q86 Q;  1L3P A;  2YQY A;  2YHS A;  1CPR A;  1U89 A;  4XPX A;  3ABL C;  2HKV A;  2V7Q H;  2KYH A;  1M57 C;  2KZI A;  3QWO C;  2KC3 A;  4U5C E;  3RK2 B;  3M0D A;  1OXB A;  5AGF A;  2O01 H;  1CPQ A;  4ZKP A;  2PAJ A;  4C3B A;  2YLD A;  2ZVO B;  4OH8 B;  1MUU A;  4CDY A;  3GG2 A;  3B0P A;  3DM9 B;  4JVS A;  2KB7 P;  2HR3 A;  3CX5 E;  1YZC A;  1URQ B;  2HYN A;  2O01 N;  2FYN B;  1EXJ A;  1KYO I;  2ZJS E;  2G3V A;  3K66 A;  2GUV A;  2W4M A;  3DWW A;  3DXJ F;  1J2J B;  3UMH A;  3GOR A;  4OVN F;  2R7T A;  1KB9 D;  2OYI A;  2J58 A;  4BRY A;  4N06 A;  4PJN A;  4ZLC A;  2N1T B;  1QKR A;  2AXT H;  2Q7C A;  3JCU H;  4JCH A;  1LNQ A;  2NUP A;  1M7L A;  1VQM P;  3OAK A;  2RD9 A;  1KYO H;  2IBZ D;  2I1K A;  4YXD C;  1EQ1 A;  1KU2 A;  3T97 B;  3GLM A;  1HBW A;  2Y69 C;  2JDI H;  3N24 A;  4MVM A;  3VF0 A;  1AA0 A;  3WUT A;  4DCK A;  1Q7Y Q;  3LES A;  3PTZ A;  2A06 G;  1SQX D;  2GFH A;  2MYS A;  1J8Y F;  3RVZ A;  1WT6 A;  2B87 A;  4CSA C;  1SF8 A;  2Z15 A;  5CHX A;  3ZTZ A;  2OJE D;  2WPR A;  3M4B A;  2GAQ A;  3VOP A;  2ZXW C;  3M91 A;  4PV1 C;  3TNU A;  4EIY A;  3F47 A;  1QLE D;  1GW4 A;  2L6G A;  2MWQ A;  4ASV A;  2XL8 A;  1M1J B;  5CCG A;  1Q0D A;  3KZI E;  4XPW A;  1MZ9 A;  1LTJ B;  3K5B A;  3WU2 H;  3KKB A;  4LC1 A;  5KLI C;  1D0Z A;  1LTT C;  3MFN A;  1ZLL A;  2PFX A;  1GU5 A;  1KD1 Q;  1Z6A A;  1N73 B;  4HYT B;  3OWT A;  5AC4 A;  1S5L H;  1SQX K;  1P84 E;  3O6X A;  3C1L A;  5B1A C;  3TOL A;  4IAQ A;  4JCZ A;  3NMK A;  1S3J A;  1MMA A;  3L4F A;  4I1L A;  2K9J A;  2WVQ A;  3IAO A;  1LS1 A;  2Y3G A;  2M5A B;  1BE3 E;  2YNY A;  3N7N A;  3K1H A;  2YL3 A;  1FZF A;  4RD9 A;  2QRX A;  4AX2 A;  3EGD B;  4MVU A;  2OEX A;  3RL0 B;  4AL0 A;  2VCA A;  1JY3 O;  2O1K A;  4JRZ A;  1QVG O;  2QY9 A;  2KNC A;  1L4A D;  2R7R A;  1OW8 A;  5B66 E;  4CS9 C;  1N1C A;  1L0L D;  3SYN A;  2QE7 H;  1Q82 Q;  3AE4 C;  3GHG C;  3Q3D A;  3CX5 I;  4JTA B;  1YLM A;  4DXW A;  2WSE H;  4BJ5 C;  1MQV A;  3DMD A;  1O87 A;  1BR1 A;  1KFM A;  1QVX A;  4D6T E;  2HJ3 A;  3SFD C;  1IW7 F;  2KQ9 A;  3CL3 D;  3VYI A;  3CX5 H;  3JT1 A;  3M15 A;  2XU6 A;  1J1D B;  3KL4 A;  5COG A;  4UB6 E;  2FXP A;  4BJ6 C;  2IOQ A;  3BRJ A;  5CCG D;  2JP3 A;  1ZRT D;  1GS9 A;  5D91 A;  3L70 D;  4AL1 A;  3B5N B;  5JRA A;  1AV1 A;  3AE7 C;  5L3V A;  1L0L K;  2EIK C;  2EIN C;  1HMO A;  3S84 A;  1QEX A;  3DAF A;  1A7V A;  4XEV A;  5B3I A;  1A0B A;  3M0A A;  2R05 A;  1SQP D;  2BCC D;  1ST6 A;  4RKU J;  1FZB A;  2R03 A;  4Y99 C;  3CI9 A;  1OQC A;  3DAG A;  3H1I E;  3C9I A;  1JMM A;  1HE9 A;  4JYB A;  2PX3 A;  1I4Y A;  1HF9 A;  3EH1 A;  3TGU G;  2YIU C;  3BRV B;  3TUL A;  1GQA A;  2X0C A;  2HV7 A;  1TFK B;  1LTB C;  2E87 A;  4EBK A;  2Q4F A;  2ITA A;  2OAR A;  1MMD A;  2AP3 A;  1LPE A;  2D2C B;  5TIS E;  2C9L Y;  1VB5 A;  2N1T A;  4LDR A;  2ZPA A;  5H2F E;  1S5L X;  1JOC A;  1FMV A;  2XND H;  1KOR A;  2XM4 A;  5AVZ B;  4PV1 B;  1SQP K;  3C63 A;  3CC2 P;  3H32 B;  4M3L A;  4YK5 A;  1YAR O;  2CYD A;  3H1K J;  1NTM J;  2IX7 C;  2OTJ P;  1X0T A;  2KJG A;  3HNK A;  2FAP B;  3O6Q B;  3L8J A;  3CAX A;  4C3E A;  3JSZ A;  4U5H A;  1RKE A;  4MVZ A;  1HW1 A;  2W9Y A;  1S1C X;  4N4W A;  4U5D E;  1G4U S;  3LJB A;  3DJU B;  2P2U A;  1OZH A;  3TD7 A;  3EFO B;  3AE1 C;  1SQV J;  1M8O B;  3UMI A;  1VQ7 P;  1O3U A;  1WGW A;  2GA0 A;  3QMK A;  3KH2 A;  4CJO A;  1N7S C;  1NU1 J;  4B86 A;  4EBB A;  1H88 A;  3HE5 A;  1Q0M A;  4DOZ A;  5E33 A;  4EOT A;  3H1J G;  4CIH A;  1HE1 A;  2M4E A;  1H0T B;  4I7Z C;  1YJN P;  2M3E A;  3L35 A;  1ZXG A;  1NHL A;  1WN0 A;  1YDI A;  3ZWI A;  3A0H H;  3GHG B;  1HW2 A;  1VYK A;  2BE5 F;  4IL6 H;  3L71 G;  3L73 J;  3O10 A;  5F5H A;  3KHU A;  4XEF A;  4DRJ B;  1FFH A;  3CWB E;  5K5G B;  1USD A;  2K3R A;  3CMA P;  2N1T D;  5JT4 A;  4UB6 H;  3T4R A;  1LM3 B;  3Q5P A;  1SQB E;  1BGY J;  1YAU O;  3GEH A;  3EGD A;  2AEJ A;  3NYL A;  2KOG A;  2R7O A;  3JSE O;  1P84 D;  1BSH A;  3W2W A;  2FFD C; 
#chains in the Genus database with same CATH homology
 2WSE J;  1RQU A;  4H44 C;  4PV1 C;  3AE6 C;  3GMA A;  2E74 B;  2E74 C;  1UFB A;  3GM2 A;  4H13 B;  1HF9 A;  2L6G A;  4H0L D;  1KQF B;  3SFE C;  2YIU C;  3TUL A;  2YWA A;  3K7D A;  2QJK C;  3JZ0 A;  4EBK A;  2WPV B;  3AEF C;  2E76 C;  1NGM B;  1VL2 A;  4OGQ C;  1KNY A;  2NZ2 A;  2QJP C;  5KKZ C;  5KLI C;  1JB0 J;  3RQF A;  1VF5 D;  1ZOY C;  3C8G B;  1Q90 D;  2D2C B;  2D2C C;  2IDB A;  1U57 A;  2WSF J;  1Y9B A;  4U7J A;  3Q5S A;  3AE3 C;  1R8E A;  2LK4 A;  3IN6 A;  2J5U A;  3H25 A;  3C8G D;  2WQY C;  5L8R J;  3GM1 A;  3O6Q A;  3GF3 A;  3D6Z A;  3MFN A;  3R4Y A;  1EXI A;  3AEA C;  2KK1 A;  2ZT9 B;  2JPU A;  3AEB C;  3RQE A;  1S5L X;  3Q1M A;  1WOL A;  2E75 D;  1KOR A;  2FYN C;  2OQQ A;  1OW6 A;  1DIP A;  2HSB A;  4H44 B;  4PV1 B;  4NQF A;  2H88 C;  3IAO A;  2JO1 A;  1OW7 A;  4H0L C;  4R4L A;  3C8V A;  3GF7 A;  4KT0 J;  2QIW A;  1DD3 A;  3AE9 C;  3EWK A;  2QJY C;  3FGA D;  2E76 B;  4OGQ B;  4TT3 H;  2H89 C;  1K04 A;  2L6H A;  3JYY A;  3D70 A;  3L8J A;  1NYH A;  3RK3 E;  1OW8 A;  1KIL E;  5M1B A;  1KMI Z;  3AEG C;  2QSI A;  1IK7 A;  3AE4 C;  4YTP C;  3AEC C;  4PV1 D;  3RL0 g;  4R32 A;  1S1C X;  2E74 D;  3Q3D A;  1TU3 F;  1PL5 A;  1K40 A;  4H13 D;  2K9Y A;  3Q2Y A;  1EXJ A;  4EBJ A;  2E75 C;  2JX0 A;  1JOG A;  4Y28 J;  1ZME C;  3L8I A;  2YMK A;  3AE1 C;  4XFJ A;  1KTM A;  4R4M A;  3C8G A;  1O3U A;  3RQG A;  4H0L B;  3ABV C;  3B71 A;  3U0C A;  4Z1M H;  1YQ3 C;  1QVX A;  1V4A A;  2D2C D;  2FBW C;  2P10 A;  3SFD C;  2PBE A;  2MKV A;  1RQV A;  1PV3 A;  3GM3 A;  3C18 A;  1K05 A;  1VF5 C;  3D6Y A;  2ZT9 D;  2FXP A;  4I7Z B;  4I7Z C;  1WTY A;  4XEK A;  3BRJ A;  1WMK A;  4H44 D;  4YXD C;  2BEZ F;  2JP3 A;  2V7Q J;  2G8Y A;  3AE5 C;  3GLM A;  3T97 B;  4H13 C;  2E75 B;  5F28 E;  1DD4 A;  4IL6 X;  3O10 A;  1UIX A;  2O01 J;  3D71 A;  3AE7 C;  1ZP0 C;  2G3A A;  4XEF A;  4GDO A;  2E76 D;  4OGQ D;  2L6F A;  4XEV A;  2Q00 A;  2BEQ D;  2WSC J;  1OMI A;  3AEE C;  1WWP A;  1FDI A;  3Q5P A;  3Q5R A;  3AED C;  3LW5 J;  1PIX A;  3AJM A;  1GMJ A;  4RKU J;  1FDO A;  1VF5 B;  3AE8 C;  3AE2 C;  3G9R A;  3S9O A;  1KQG B;  2ZT9 C;  1AJY A;  1HJ0 A;  1YQ4 C;  1ZZP A;  3U3F A;  1ZRT E;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...