1OW6A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 58
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6A02
1WTYA 1UFBA 2H88C 3AEFC 2HSBA 3JZ0A 1K04A 1JOGA 3AECC 3S9OA 3SFDC 3AE7C 2PBEA 3L8JA 3U3FA 1OW8A 1O3UA 4YTPC 2G3AA 3GM3A 1ZOYC 3C8GD 3RQGA 3ABVC 3AEGC 3L8IA 3AJMA 4XEFA 3GM2A 4R32A 3AE4C 4NQFA 4XEKA 2FBWC 2Q00A 1ZZPA 4YXDC 1V4AA 1OW6A 3U0CA 3AE3C 1K05A 2L6GA 3AEEC 3AE9C 2WQYC 3C8GA 3AEDC 2L6HA 3AE6C 1WWPA 3MFNA 1ZP0C 3AE8C 2H89C 3RQEA 3C18A 2L6FA 3JYYA 3B71A 3AEAC 5F28E 1PV3A 3BRJA 3K7DA 3AE5C 3RQFA 4EBJA 1K40A 2YWAA 3C8GB 4EBKA 2JPUA 1KNYA 2JX0A 3AE2C 3TULA 3O10A 3SFEC 4XEVA 2LK4A 2KK1A 1YQ4C 1WOLA 3AEBC 1KTMA 1YQ3C 1QVXA 3GM1A 3AE1C 1OW7A
chains in the Genus database with same CATH superfamily
2YIUC 1BCCG 1JM0A 1TWAA 1L0LD 4HYTB 3MX3A 4AE4B 3TOMA 3HE4A 4IFMA 5AVTB 2CPBA 4JYBA 1NTMD 1JPNA 1SYQA 1VMAA 5B66H 2OG2A 5KYYA 3VTPC 1Z5ZA 2LFDA 1M2OA 3FWLA 3KZIH 1XTGB 2A06E 2AEMA 2Q6QA 1MFTA 1WATA 3S27A 5DJTB 3FGAD 4BRYA 3DKAA 3B9QA 1HTLC 1GW3A 3T6GB 1M1JA 1GDTA 2GAQA 1BE3E 4O7GA 4E0IA 3C7JA 3RK2C 2RD9A 1EZVD 2HS5A 3T9OA 3WUVA 2K9YA 5AW2B 1BCCJ 3WU2E 1S05A 3GHGB 4MN4C 3CX5D 1CPQA 1Q0FA 4MTGA 5L3VA 4LGDE 3TDKA 1RHZB 5T1DB 2FGYA 3EGDB 2WSSH 4YT2A 2WB7A 2P10A 2L6GA 3DE9A 1QPUA 1SQXE 4ASVA 3CXHE 3EGXA 4YT5A 1Q7YQ 3CC7P 2ZYDA 3ZSUA 5KLVG 3X1OA 5AVVB 2HPCB 4YT8A 2OYIA 3MUDA 3P8MC 3T97A 1YA7O 2J0XA 4I44A 2YL3A 2YL7A 3K7DA 4BWNA 4G7HF 4TT3H 5K5GB 4N4WA 2QIWA 3L73E 5KYUB 3FXDA 3L72D 3PLNA 2J9UA 5AVSB 2IDBA 3O10A 1RJ9A 5DJUB 4XEVA 3EFGA 2L81A 2OARA 2WT7A 4N6HA 3E7KA 4OD4A 1NTKG 1R8EA 3HJCA 2CNWA 3EPVA 4F4BA 1I5NA 2D5RB 3PTZA 1IFPA 1JCDA 2E87A 1RMVA 1KTMA 2B88A 4WBAA 1T5OA 4TLFA 1KZUB 1N86A 1PGOA 5TJ5E 3RKOF 3Q3DA 4NCQA 1JNMA 2J0WA 1A7DA 3JCUQ 2YKPA 1BR2A 2XM4A 2E43A 1KORA 2LIGA 3CCRP 3BCCG 1NU1G 5APXA 2H7BA 1YYCA 2YVKA 5E33A 3WG7C 4I6MC 2ZXPA 3IF4A 3MTUE 1NBBA 2NG1A 1N73A 1EZVI 3SXKA 5KYXA 1G1IA 3DM9B 1HUCA 1PP9D 1ZVZA 5B66E 5AW6B 3DXJF 1VQ9P 2XLHA 3U3FA 5COGA 1ZU5A 1EDJA 2XLOA 2Q7RA 4B86A 1CSBA 2KNCA 3HUSB 2J45A 1LIHA 2IBZD 3ABVC 4BRYB 1U57A 1QLEC 2RN0A 1N7LA 1LT1A 1WGWA 3AGTA 1G5ZA 1VLSA 2YLIA 3CAXA 5CBOA 3I55P 3BRTB 1HE1A 2ZXWC 3AGUA 3EG9A 4YT4A 2OYOA 2A69F 2C03A 2Q9CA 3M0DA 1JB0J 3B0VC 2WITA 3M1CB 2KIKA 1LTSC 3L1MA 3AG4C 4O79A 3KQGA 4PFOA 4WGZA 3AE3C 4MVQA 5APQA 2DYSC 3H1HD 2WQYC 3M4BA 3EGDA 1NAYA 2Q1KA 1N73C 2A45I 2W6AA 2M0BA 4BJ5A 1AUEA 2KSEA 1ZHYA 4GQHA 2OU6A 1JMBA 3T6JA 5AW4B 3PRJA 1RKCA 2HV6A 4PJNA 2AXTE 4UB6E 1IW7F 3QW0A 1PV3A 4J30B 4X0RA 1DIPA 3U59A 3SYNA 2KNHA 3IPMO 1VLTA 4NY3A 1K40A 2PP4A 4U5BE 4PR9A 1AVYA 3JCUH 1NTZJ 3AE2C 3L72E 4XE5B 2GM4A 2QSIA 4U5FE 1YJ9P 4BJ6C 1URQD 2L5GB 1BCCE 3LIEA 1EI7A 3M0DC 3RF3A 4IAOA 3RVZA 1BDCA 1S2EA 3CL3D 4AL1A 3USSA 5AVXB 4GYTA 3AQCA 3AEBC 5KYWA 1AQTA 2YMYA 2KYHA 3ASNC 1PP9J 1NOHA 3JC22 4QMAA 1K73Q 5B1BC 1NTZE 2PP6A 3L72J 2M3EA 3JRTA 4BJ5C 1OW7A 3CXHD 4JEBA 2IXPA 3AEFC 5DQTA 4DBRA 3TGUE 3L71E 1T01A 5BVZA 3CEXA 4I2LC 1MMNA 3L70E 4NPFX 1P84D 5AC4A 1RF1C 3BCCD 3SEOA 1TU3F 2CPSA 5EGYA 2XU6A 3WUTA 4D6TG 2YL0A 2ZAEB 2G62A 5E2QA 2NZ2A 3WU2H 4CX9A 2E5YA 1BE3D 2G3AA 4PD4E 2QJKB 2I8BA 3LNMB 1QEXA 2R7QA 3POVA 2YXQB 4OD5A 2DYRC 2HR3A 1XWJA 1GTWA 4GIFA 1KMIZ 2ZJSE 1Y9BA 1C03A 1NTKD 1W2WA 2LQGA 4U9EA 4FX5A 2WPQA 5KTBA 3HNIA 4WJ0A 1M8OB 1S72P 3HE4B 3VN0A 1VQ6P 2XLDA 3IQ6A 2XNDH 1MZ9A 2AXTH 4OGQB 4YXDC 3OWTA 4UB8H 1AVOA 2N9BA 2JEEA 1SQPJ 3DWWA 1BGYG 1JTHA 5AVQB 4E7ZA 1NH4A 1HGZA 2HMQA 3C8ZA 1LTTC 2OOCA 3C8GA 3JRMO 4H4KC 3EJNA 2H89C 4U9DA 4DRIB 1IK9A 5AVRB 2NSFA 5T3WA 3Q5SA 5BU8B 3C1LA 1SFCA 1N7SC 2CNWD 1TFKB 4A4AA 1FU1A 3VM6A 3RIPA 2X51A 1T6IA 5CMZA 1Q86Q 2Q5UA 1VYIA 1FZGA 4HB1A 3DAGA 3EZIA 1JPJA 4UDVA 1QL1A 4EBJA 3C8GB 2ZYGA 4I3MA 4QDLA 2C9LY 3BCCE 4H54A 2AXCA 2I15A 4MW8A 3L74D 4EBBA 1PPJE 1HW1A 1G2CB 4WVZA 1GM5A 4PV1B 4CSAA 1PL5A 3NMIA 5L0HA 2BEZF 2ZVNB 3TGUD 2H7VC 5D92A 2QG4A 5L0CA 1VQMP 1SQQJ 3H1LG 2R7OA 3VYIA 3QZCA 2IZ1A 3UMHA 4UB6H 2FXMA 1RKEB 4W80A 3R4YA 3AG1C 3W8IA 2IM8A 3K66A 1JY3P 5FZTA 3ZWIA 2OTKE 2WVRA 1ZV8A 4ULVA 3L0IA 1X8YA 3CCEP 1NTZG 1KC8Q 5GTIH 5CI8A 2XM0A 4YTPC 1Q90D 3CCUP 1YTZT 5A6BD 2GWWA 1HE9A 4K3AA 3KYJA 3G3ZA 1ZOYC 2E74C 1L0LK 3ABLC 2YXRB 5FCLA 4C7NA 4CSAC 3Q2YA 1H8AA 5KYXB 3AEGC 4I7ZC 1JUNA 3TNUB 1FZCC 1WASA 5APTA 3RVYA 2YO2A 3Q7LA 3L8IA 1IFIA 1SQPG 2WVQA 3HNJA 4JYCA 1ST6A 1LTAC 4U3FJ 3V4QA 3O39A 1FNTc 5EK0A 1UIIA 3AE4C 3M9HA 1N7SB 1Q0DA 1TWHA 4H13C 2JWAA 2K1AA 2YHSA 3RL0C 3AEEC 3BVHA 4JVSA 1E83A 5L0JA 2WZFA 5L0DA 2M4EA 5B5EH 1I4ZA 4CS8A 2HJMA 1FDMA 2UUHA 1VTMP 3HUSC 4K0DA 3GEIA 1RQVA 4KNWA 1GW4A 5DVWA 2R7TA 4HEAJ 1Y47A 1BGYE 2XNXA 1C02A 4XLPF 2PGDA 5HSWA 3SNHA 2PX3A 3L70D 2MHRA 3TJ6A 3CC2P 5BUOA 1NTKK 4EBKA 2KS1B 1OCOC 3CXHH 4DOJA 3D6YA 3PP5A 2M8RA 1OZHA 3TQOA 4ZNCA 1IZNB 3N4XA 2WSEH 1YLMA 1WRGA 1AA0A 1MMAA 4OIQF 1MMGA 2WPSA 3IQTA 1IFNA 1LTJC 2A68F 2QEXP 3L75E 2HKVA 3I4UA 2HYNA 1NU1K 2QLAA 1GU5A 1UIXA 2HSQA 3QVYA 2NPSC 3I5QA 3E1IA 4IL6E 1YZAA 2O01J 2KNCB 3HUSA 3G4ZA 3GANA 3NKDA 1FR0A 1RY3A 1L0ND 5KYWB 3JZ0A 1RF1A 1HWTC 1M56C 2KB7P 2DGJA 2ZT9C 2H8PD 3H65A 2DB4A 2O3JA 2XLWA 3U2LA 1NU1E 4C7NB 2NPSD 1E84A 1IJDB 3S9OA 4M63A 4IFFA 5B5EE 3AE7C 1AFOA 1W2EA 2ASRA 1S5LE 1KB9I 2BE5F 1PCXA 1KILB 1VQLP 1Z3IX 1ZW3A 2P1AA 1Z56A 1FDIA 4I1LA 3VMAA 3NYLA 3H1LD 2WMMA 4CS7A 1Z7Qc 4MVMA 2FFHA 4G0HA 3A7OA 1BBHA 2HFED 3K1IA 1JRAA 2NPSA 4KT0J 3L35A 3GM2A 3GHGA 2EIMC 3QWOC 2IYLD 3L75J 1A0BA 1A41A 4L73A 4J7YA 3LAYA 1NLXA 3RH3A 2HJ3A 1NTZD 1IFJA 3KZIE 3L34A 4EKWA 2PRRA 1QL2A 4JE9A 1ZN5A 3PH0A 4CS9C 2P1JA 4DZOA 1GL2D 3DI5A 2D2CC 1LT9C 1V54C 2OYHC 1ZU4A 3LNRA 1JTHB 1LTIC 3V7OA 3KYIA 4K1OA 1PPJG 3B71A 3CQZA 4U5HA 1ZLLA 2AP3A 2JDIH 3W68A 4R4LA 2N1TB 3RQFA 4FWVA 3WODF 5KJ7D 3G71P 4W7YA 1MFZA 1URQC 1L0NG 5A6JA 3SSUA 4BJ1A 4DCKA 5BQGA 2YKOA 1APCA 3K1IC 1LM3B 3SFEC 1J8YF 1PFIA 3VYWA 1GL2A 1NJIQ 1CI6A 3VOPA 3KXDA 2KXPB 3HE5B 4OIRF 2M3BA 1LS1A 2W8ZA 1Y4CA 1L0LE 4C46A 4C3BA 5TISH 5KJ7A 4PJ0E 4MW3A 1OVRA 2NRGA 5C39A 2V7QH 3LEOA 4GOEA 1OWAA 2LR2A 1G4US 3U5SA 2A1DD 2A6EF 3CLQA 2LD6A 1CZQA 2H8AA 3ZG1A 3SP1A 1MNEA 1UG7A 5B3IA 1RF1B 4D6TD 4L76A 4J32B 3GF3A 4G7ZF 2WVOA 2Y3HA 2L9JA 3TGUG 3SFDC 1EXIA 4W7ZA 1KQLA 3GORA 3B0UX 4HJGH 3H1IG 1KU2A 5B3SC 5A69A 1L4AC 3L70G 2FKWB 2P7JA 1SQBE 3GM3A 3LLIA 3DE8A 1Y6DA 2YZSA 4ZLCA 2IBZG 4MS2A 4BG0A 4ZKUA 4HKZH 1SLQA 1T8ZA 4AYCA 1PGPA 1SFCB 1SMYF 3O6QA 256BA 2H43A 4R32A 1YYJA 1NTME 2E74D 2WWWA 4NTFA 4EI2A 1LT9B 3CD6P 1LP1A 1EC5A 4LDQA 1N2DC 2HODB 1SQQK 4IOIH 1TWGA 4OVNF 2Z5IA 2HZ8A 2ZFCA 2J58A 1N7SD 3M91A 4RD9A 1VQPP 2VCAA 3FMSA 4XPXA 1J2JB 5BU5A 4XQ1A 1JR8A 3HD7C 2WZGA 5AGFA 2FFDB 2LXBA 4XA4A 2Y39A 3L71G 2GFHA 1YA9A 3EHNA 1K9MQ 2A06G 3PJSK 3UMIA 3H1HG 1EQ7A 5AW1B 5AW0B 2XLEA 3CX5I 3F89A 5JSLA 1HF9A 1ZRTE 3DMDA 4D6TE 3V5BA 1HY5A 3H1KG 2H7OA 4IFDK 1R4TA 4KBLA 1SQBG 2BCCE 2GDCA 3DAFA 2OYIC 5K0IA 3JCUE 1JY2P 3WMM0 2ZVOB 1OR2A 4C7OB 1XZPA 2IXMA 4AX2A 4IL6X 2JR8A 4M3LA 3RBZA 3CMAP 3L71J 3NYMA 3HNKA 1O87A 1BSNA 3HD7A 1NTZK 2WPRA 2HV7A 3KMIA 4YXWH 3ZDLA 4Z9JA 2W90A 2KGOA 1NU9C 3U1AA 1KV4A 5GTHE 3D71A 1PP9E 1TWCA 2B87A 2YNYA 2YEVA 3H1KJ 1KD1Q 4XTKA 4C7RA 3UIAA 3K1HA 3ITFA 3G4SP 1EKYA 1JOCA 3RQGA 3IN6A 2PX0A 2MKVA 4WY4D 2OTLP 3TD7A 2HFIA 1C17M 1DX7A 1AEPA 3J06A 3GHGC 1J1DB 1FZBA 1P84H 3H1HJ 3EFOB 2RMZA 2QJPB 3NTNA 2XXAA 1IO4A 1E79H 1LWUB 5B1AC 2QUPA 1N73B 2VCBA 3UGPA 1R5ID 3D6ZA 2QE7H 5KAFH 4IGGA 3ABKC 3UMKA 1SQBJ 3W4YA 4FESA 4ANJA 2XDJA 2R7XA 3OEOA 5AW9B 3RL0g 3VAYA 4WY4A 3Q1MA 1DH3A 2NSGA 4BEMJ 2E75C 3H1JJ 1LKXA 3LS1A 3TGUJ 4L74A 3CCJP 2EILC 1EDIA 2J46A 2R32A 1JMMA 3RFYA 3AE5C 2F22A 1EZVE 2IXOA 3ABMC 3CCMP 2B0JA 3C62A 1DD3A 1RF0A 1DEBA 1QGKB 4GDOA 1G8XA 3MP7B 3A0BH 4UB8E 4CJGA 4U7JA 3CWBE 1FBMA 2FAPB 3V2QA 2CCYA 2P58A 3ZC4A 1JY2N 3ECSA 3Q6NA 1W5CE 2AU5A 1GU4A 3TF5A 1J8MF 2XLMA 2ZT9B 3O55A 1T6UA 1AV1A 4L6RA 3S28A 1NZEA 4PJMA 2A45G 4NPDA 3KHUA 5DS6A 3V2PA 2IYPA 1D1AA 2DI3A 2KUBA 2DW3A 4RBNA 1M56D 1ZRTD 4ZKPA 2J8WA 1GK4A 4WABA 1HBWA 3L75D 4H0LD 1H9GA 3CX5H 2EPLX 3B5ND 2YLDA 4CBEA 1L4AA 4MVSA 3AOUA 2V7QJ 4BEJA 1LPEA 3IQCA 4WB4A 1G4WR 1SQQE 3EH2A 5CCHD 1M2VA 1IZMA 1R5LA 3E9VA 1LWUA 1H6GA 1PGQA 2E76D 1E5WA 1RH5B 2ZXOA 1NFOA 4D4NA 1E2XA 5EFWB 2SPZA 3V5ZA 1YARO 1S9KE 2YL1A 3BCCJ 3B5NA 1FZCB 2QA4P 1OFCX 1QSPA 5AW8B 2HMZA 3MYIA 2IYOA 1FAPB 4NQFA 1TFOB 2OKUA 3K6BA 3FOOA 3I5CA 1PZQA 3P8CE 3FDQA 2E76C 2FXPA 2O1KA 1M1KQ 4LC1A 4DT0A 1K05A 2WZLA 2BASA 4H13B 2L6HA 2Y9ZA 4JURI 4JZAA 2Y3DA 1TQGA 2C0WA 3H1LJ 2A6HF 3RK3B 3UR3C 1VB5A 3CI9A 3Q5PA 4H44C 2QJYB 2BCCJ 5KLIB 3S84A 4LLHA 4ZMDA 3NMKA 3JTLO 4O6NA 2IFMA 2EIKC 1LWUC 5CJ4A 3M79A 1T9KA 2Q9IA 3CSKA 3M06A 1T3UA 1FZAA 2AVKA 2YWAA 4ASWA 1S3JA 4RKUJ 2XSEA 3TULA 1R5SA 1OXKA 2Q3TA 1SF8A 4LLCA 4B6IA 3N24A 2E76B 2XRHA 4RDAA 1DEEG 2NUPA 4YWQA 1S4XA 2WSFH 3FXHA 3M9QA 3JSVC 4XPYA 1LE4A 3GW6A 5KYUA 3H1JG 1LVKA 2KLVA 1M57D 1VYKA 4DXWA 1JAFA 1H0TA 2K88A 2NUPB 1NKNA 2KQ9A 1RCPA 1U7JA 2PBEA 3HNLA 2H7HA 2WSEJ 3FAPB 4KJMA 1N1CA 1O3UA 2I8DA 2XS1A 2NPSB 4DJ9A 2KZJA 1NO4A 1M2VB 1KILC 1YJGA 5KLIC 1GGQA 3AG2C 2QJPC 2R05A 5AW3B 5CIVA 3TSIA 4YL0A 2E74B 1BDJB 1Q81Q 1SQVE 3CCSP 1QLED 3T4RA 3KDPB 1SQQG 4WGYA 1SP4A 3LW5J 4JKVA 2N9YB 1IK7A 5DS5A 2Q3IA 2EPKX 3L37A 1ZXGA 4WY4C 5KYYB 3A11A 1SQPK 4U3FD 3RK2D 4EHPA 3MFNA 3H1LE 1QZXA 1ZR4A 4LDRA 4C3DA 1MNDA 1FFTC 1HMOA 5CHXA 1XZQA 1RE3A 4RESB 1GMJA 4BJ6A 1Z6AA 1KFNA 3L74J 5F28E 3DJUB 2EPMX 3BRJA 4PACA 4Y99B 1E85A 2XZRA 5GPGB 3O8ZA 2VASA 3FX0A 4PD4I 1KQGB 4MTFA 1A02F 5KLVJ 1EDLA 3UGOA 4PV1D 3LS0A 1D1CA 2B89A 2OTJP 3PDMP 2B9BA 3HTKA 5E79E 3MIWA 2QM7A 3QTHA 3M0AA 1M6TA 1BDDA 2FYZA 5APWA 2FYUG 1U7MA 2Q9AA 1VK5A 3ZQYA 3R2PA 4Y28J 1LI7A 2K3RA 4L75A 2QRXA 3PCVA 5CBNA 4CDVA 3K5BA 4N78D 1YBKA 4D4XA 1O5HA 3H25A 2Y3GA 3W8HA 2QE9A 1VQNP 3QH9A 2G3KA 4CDAA 3PMRA 1PPJD 1VQKP 2R44A 4FAPB 1PIXA 5T3TA 1K04A 1YTZI 3FOPA 1KILE 5KYNA 1GZLA 4HH2A 1BCCD 1OMIA 3Q5RA 4CIPA 5L8RJ 5KKZC 2QNLA 2R5DA 4AL0A 1LE2A 1YIJP 1M1JB 3CC4P 3B5NC 3WUUA 5DQZA 5JLIA 2CGEA 2LXCB 2G8YA 2PAJA 2MJZA 3NKEA 5AC5A 1NTMJ 4XEKA 4N3YB 2WL8A 3S90A 3GODA 1NU7D 3MHVA 5CJ0A 4I1MA 1M1JC 3V5YA 1S1CX 5A6BA 3ATPA 3DD7A 1BR4A 1X9VA 1WWPA 1SQVD 4H44B 1VQ4P 1VL2A 2OJQA 2HPCA 4LERA 5H2FE 1J1DC 1WT6A 3L74G 1JY2O 1IFDA 3TJ5A 3DJNB 1ZW0A 2KZIA 2GA0A 2Z4EA 1FJPA 3AEAC 3SWKA 1JY3N 4IL6H 1AVOB 2P6VA 2IBZI 4PV1C 1ZMEC 2LSEA 1YAUO 2Q3EA 1D0ZA 1FJKA 1VOMA 3NFQA 2P67A 1CGNA 3X2QC 3OW2O 3H1JE 4OINF 3B0PA 2C9NY 2PFXA 2GA1A 3U1CA 3C9IA 2QY9A 1D1BA 2QTVA 5KLVD 1GQAA 5APVA 1ZHZA 4U5CE 5F5FA 1FE6A 4PD4H 2EINC 1M7LA 5CI9A 3HD7B 2XKMA 3MBGA 1YHQP 2C04A 1SR2A 1JY3O 1EA8A 3K33A 1W2BO 4O6MA 2J5UA 4XLNF 4RO0A 2IXNA 1YJWP 2MYSA 3KPHA 1KB9H 2YIUB 4DRHB 5L0IA 1URQA 4EOTA 1DOWA 3GEHA 2FYUE 4IARA 2PF4E 5JS5A 2D2CB 5CCHC 1NG1A 2ICWG 4P9FA 5L0GA 3IQ5A 2K9JA 1WMKA 4DJGA 3GWLA 4OH8B 1BE3G 2AWCA 1M57C 2A0BA 1FDOA 3L73D 2P2UA 4E7SA 1OVUA 2LP4A 3TOLA 3C8GD 2R25A 2OGUA 3RW0A 3WAQA 1RKEA 4OIPF 3LUTB 3CPWO 2Z15A 3EQLF 2UWJE 1JMWA 1A02J 3AJMA 3C8VA 4XEFA 3P32A 1IC2A 1ZZPA 3WHNA 1OVVA 2WTYA 4DBQA 5KLVE 3M9BA 2EPNA 2D4UA 4NC3A 3OJAB 1SZIA 5H2FH 2LKMA 2W27A 3L36A 1OXBA 1LTGC 3EFFK 3ZTZA 2GUVA 1P84I 3TNUA 3NMJA 2ZXEB 1GL2B 2E75B 2O9XA 5KAFE 3SXYA 4Y99C 1GD2E 3F47A 1B68A 4JJGA 5BQHA 1FMVA 2XL6A 1KB9E 3OAKA 1YDIA 2ZD9A 3KPEA 2OEXA 2WZ7A 2VRSA 1LTJB 2JX0A 3HTKC 3A0HE 2AEFA 1T6AA 3A0HH 3NDBB 3HE5A 1ZHTA 5A6AA 1NYHA 4KC9A 4LDKA 1L0NE 1SFCD 4H0LB 4XPWA 4P6IC 3E1RA 4O6YA 3MYFA 2R9RB 3L70J 1NWQA 1M90Q 3LJBA 1SQVK 3N0TA 3EH1A 1CPRA 3E70C 4EDFA 3H6PA 1FZEA 3HTKB 1L4AB 4KNVA 3GEEA 3KH2A 4N78E 2HSBA 4GOFA 2BCCD 2KSFA 2Y69C 4GT1A 1JOGA 2J9VA 1CGME 5L3QA 1KYOI 1HJBA 3IAOA 3LIDA 2LCHA 1OXZA 2POHA 1G2CA 1NTKJ 4JJFA 1T2KC 3NXSA 2RH0A 2YRFA 2KJGA 4GODA 4U3FG 1L7CA 1V74B 3M4CA 3EWKA 1QVGO 4YJWA 3MD0A 4C7OA 2Y3BA 3VMXA 3MUDC 4ONSA 5IY5C 4PK4A 3RL0D 3T97B 3BASA 1GS9A 3L75G 1T2KD 3RK3D 5F5HA 3SXMA 4Q4ZF 4E18A 1L0LJ 2OYHA 5E79H 3RBXA 1L3PA 2R7RA 1DOVA 2E42A 5EHHA 3U0CA 5AW7B 5KLVK 2J9WA 3BATA 4JBZA 3AE6C 2N1TC 2A0UA 2V3CC 3H32B 3R7CA 3VMYA 1X0TA 1BZ4A 4JRZA 2HG5D 2L6FA 2R5BA 2WSCJ 3L72G 4BJTA 2QJYC 1RJ9B 2J7PA 3U9MA 1RXQA 3H1ID 1U0BB 4PJLA 3EZHA 2JPUA 1SQBD 3G9RA 1N7SA 1SFCC 1ZW2A 1KB9D 4DOZA 4JCZA 2M64A 1VF5B 1Q0MA 2KI7B 2YLGA 4GKGA 3JYHA 1CI6B 4JTAB 4YN0B 2CK3H 2IZ0A 1N8RQ 1KYOD 3RK3E 3H1KE 2BEQD 2I1JA 1MKMA 1OCZC 3IFMA 3VP8A 1SQVG 2I1KA 3S4RA 5A6KA 3CZ6A 1RF0C 2OCCC 5AVYB 3Q6MA 2KS1A 1MMDA 4Z9HA 2Y0EA 1H89A 4MVUA 4WWIA 3V2RA 1H0TB 1S7ZA 2TMVP 3AECC 4OWFA 4H0LC 4U5DE 1BGYJ 1LI5A 3IEEA 3FHDA 2ZXRA 2KW3C 1RE4A 4QI0A 1D0YA 1P84E 5E3AA 1VDFA 3TK0A 3V2NA 1EZVG 1QQ3A 2ZT9D 2PFDA 3US6A 1YI2P 4YL3A 2W9YA 2JWDA 4PJ0H 4JCHA 2R3CA 1NFNA 4CDYA 1L0LG 2XXAB 1SQVJ 1FAVA 3FWNA 3CMEP 1LGHB 3LW5H 1OX3A 4IWBA 3V6IA 4EIJA 2YKZA 2D2CD 2FYNC 2VC9A 4U3FE 4XFJA 1V4AA 2NPUA 4YPCA 3KKBA 1A7EA 4KHXA 2AWYA 1DD4A 3A2AA 2WSCH 3ZIBA 3B5NB 1FZCA 1LP1B 3D70A 3L73J 3AEDC 1SQXJ 3V4WA 3BRVB 3H1KD 1YJNP 1FOSE 1TR2A 3S1KA 2XL8A 3HRNA 1ZHXA 5AW5B 4NTBA 3QMKA 5GTIE 4CJOA 1RE4C 3O6QB 3JYYA 3ITKA 3OA1A 5HV9A 3U8VA 1FMWA 1E86A 1TKNA 1FTSA 5BQIA 2L7AA 4Q7CA 3CWBD 3A5TA 2W6JH 4OGQD 1HMDA 5CCGA 1VQ8P 2R03A 3DZAA 2K37A 4N6CA 5JRAA 1JCCA 3VF0A 1SQBK 2M5AA 2YQYA 1H9TA 1SQXG 1S5LH 2KK1A 2UUIA 1WOLA 1NTMK 3P8CD 5JT4A 3T6BA 2K9JB 2FYUD 4A2NB 1V55C 2EPOA 1QVXA 2Q7CA 1LNQA 3NG1A 4N06A 5CCGD 2QVAA 3ZQVA 2M5AB 1LTBC 1QX8A 2WVNA 4PFPA 1LTJA 3L73G 1AQ5A 2QM8A 1USEA 3EHMA 2IPPA 2HODA 5APUA 1G1JA 3EQ2A 2R7WA 1OKKA 1NTKE 1EQ1A 3L8JA 5CCGC 2A06D 1SVFA 1OW8A 2WPVB 3W2WA 2VB6A 4DRJB 2B87B 4IB4A 4NPEA 1BE3J 3LESA 3F46A 3Q7GA 4K7BA 5D91A 1HGVA 3HLZA 4DVZA 2OJED 4XWJA 4Z9IA 5L0FA 1KILD 2JJLA 2W6BA 4HFKB 3VMZA 4EYYQ 4IRUA 1L4AD 2J7PD 2Q00A 5JUAA 1PGJA 1OKKD 2JKVA 2N1TA 1U6HA 3PHLA 4JTDB 2X0CA 3NYJA 3N7NA 5KAIH 3O6XA 3NMDA 2CW0F 1FZFA 4I7ZB 4MVRA 3A0BE 1ZP0C 3IR9A 2R7VA 2OQMA 3RQEA 3RK3C 1S9KD 4BXLA 3MLGA 2R7SA 1VF5C 3KYQA 1U89A 4ULWA 2FY8A 2FFDC 2W45A 1HJ0A 4D6TJ 3EFOA 1PP9G 3A3YB 2O1JA 5E3CA 1JO5A 4JTCB 2R3SA 2ZYAA 2KC3A 3SXZA 2MWQA 3W2VA 1OR3A 2N1TD 3JSZA 1KYOH 1OCRC 1I4YA 1A7VA 3EGXB 2VH3A 1CGOA 2OYHB 3H1IE 3DM5A 1HVVA 1LT9A 3A9CA 2KSJA 2XL4A 2FXOA 5APSA 2P0NA 3BEHA 2KLUA 3SWFA 2KOGA 3HD7D 1L0NK 2LFFA 4G78A 4Z1MH 1NKZB 3C63A 3U8PA 2OEVA 4LLEA 4C3EA 4CPGA 3P7KA 4E0HA 4A7PA 1HW2A 1D7MA 2OQQA 1J1EC 4AE4A 2W4MA 1SQXK 3FVYA 4MVOA 1OIPA 3B8EB 1KQFB 1ORSC 2QJKC 2FYUK 3LEVA 3H2VA 1NTMG 1Q0KA 1NAFA 2FFDA 2H88C 3JT1A 3QVZA 1NGMB 2Y9YA 2G3VA 1KQSO 5KKZB 1PD0A 1VPCA 4PD4D 4EWCA 2O01H 4K35A 2RKLA 2HLOA 4OIOF 3CXHI 3CWBG 4IJJA 2ITAA 1S5LX 4CS8C 2ETSA 2J59M 1VQ7P 1IFMA 3CCVP 1YITP 2J9BA 3PHF2 2OYIB 1Q0GA 2E5TA 2XLVA 2KP8A 2Y0DA 1F1MA 3H32A 4N6JA 1Q2NA 3I5PA 2RSEB 2YKQA 2YMKA 3H1HE 2Y0CA 5JVEA 2E75D 1BR1A 4H13D 1T3JA 2KK7A 1BSHA 5COFA 3ZTMA 3G6EP 1MUUA 3B4SA 3NRHA 4ER9A 3V5XA 3II6A 4U5EE 1KYOE 1T6QA 4R4MA 3GWNA 3CX5E 1Q82Q 2P7VA 3IHUA 3U2MA 2FYUJ 2C0XA 4AK9A 4JPZB 3EG9B 3GMAA 4JQ0D 3I56P 2JO1A 2NUTB 2JP3A 3QW1A 2WT7B 5KAIE 3VRCA 4I1OB 4HE8D 4BPMA 4JEAA 4AQRD 5DS4A 4KI2A 2CYDA 2AEJA 2BC5A 4IAQA 5M1BA 1D0XA 2L91A 3CWBJ 1EDKA 4YK5A 2EIJC 4JW1A 2LK4A 1JEKA 1YVIA 1LJ2A 1RQUA 3TYYA 4WY4B 3S0XA 1Y8AA 5TJHA 2NUTA 2R7UA 3H2UA 3ZDMA 1L2PA 1KN7A 1YQ3C 1QVFO 2O01N 2A45H 2CDQA 2W83C 2B0HA 2W4BA 3CCQP 3ZVRA 3GM1A 3FXEA 2YO3A 5DLJA 1Z63A 2PNOA 3AE1C 4LACB 1ORJA 1WTYA 1UFBA 4W8PA 4GEHA 4EUKB 3GG2A 3VP9A 1CW5A 1L0NJ 1FOSF 3L4FA 4Q5SF 1KILA 2GUSA 1HH0A 2R02A 3AG3C 5APYA 1H7IA 1X22A 4HFFB 3G4XA 3AQBA 2FYNB 4O9BA 1AJYA 2IBZE 3RL0B 4AUWA 1ZYRF 3G50A 3JSEO 4QI2A 5COMA 4CS9A 4MTOA 1ORYA 2ZXXA 1EXJA 2WSFJ 1VQOP 2XV5A 1SQQD 4MNDA 3B29A 3RYLA 3S29A 3N2ZB 2VCCA 5JP7A 4MQ9F 1MQVA 5AVWB 4JC7A 1H88A 1SQXD 1XTCC 4DVYP 1WN0A 3U9JA 3SZRA 4G7OF 4RJTA 2JD3A 2Q4FA 3FAJA 2V4HA 4JF7A 5GTHH 1PD1A 2FBWC 1ZR2A 1RE3C 4H44D 3MGNA 4MVZA 5CCHA 1OW6A 4W8KA 4YL1A 2HUJA 3OA7A 3ASOC 1USDA 2BL2A 4J7TA 4CIHA 1GL2C 3AE9C 3SWYA 1YZCA 1GK6A 3MZWB 4U5GA 3AE8C 5AVUB 1NVOA 3UNGC 3RGUA 4PJJA 1NU1J 1OCCC 3C18A 2Q9BA 2ZPAA 2XS8A 4NTAA 1QKRA 3LLKA 5KJ7C 3M15A 4JIOA 5AVZB 1LS4A 4OGQC 1NHLA 1Z23A 2V26A 2IX7C 3H1JD 3L74E 4ZLDA 3F5HA 1SQPE 4EIYA 1BGYD 1OQCA 5TISE 1FS0E 1VF5D 1KNYA 1MV8A 3H1IJ 3GLMA 3KL4A 2BCCG 1FC2C 1SQPD 3TK1A 1NSGB 2P61A 1URQB 3U3BA 1X79B 1J1EB 3L71D 1KFMA 2Z5HA 2IFNA 2IBFA 1ZHWA 1YQ4C 1NU1D 1VQ5P 2KYVA 3RK2B 1FFHA 1YYXA 1K8AQ 4P9TA 3W67A 2IOQA 3HKKA 4E17A 1SS1A 3GF7A 3CCLP
chains in the Genus database with same CATH topology
4IL6X 2O01J 1WTYA 1UFBA 2YIUC 2H88C 3AEFC 1NGMB 4H0LD 3R4YA 2HSBA 3JZ0A 1PIXA 1K04A 2ZT9C 1KILE 2D2CB 1JOGA 3AECC 3IAOA 4H0LC 3GF3A 2V7QJ 1OMIA 3S9OA 3Q5RA 1TU3F 1WMKA 3SFDC 1EXIA 3AE7C 3D71A 2PBEA 3L8JA 1AJYA 3U3FA 2WSEJ 5L8RJ 1OW8A 2NZ2A 2WPVB 5KKZC 1FDOA 1O3UA 4YTPC 1Q90D 1S5LX 2G3AA 3FGAD 3GM3A 1ZOYC 2E74C 3EWKA 3C8GD 1EXJA 2WSFJ 3RQGA 3ABVC 1FDIA 3IN6A 2ZT9D 2MKVA 2E76D 5KLIC 1U57A 3Q2YA 3AEGC 2QJPC 4I7ZC 3T97B 1KMIZ 1Y9BA 2K9YA 2E74B 2G8YA 2YMKA 3L8IA 3AJMA 3C8VA 3O6QA 2E75D 4KT0J 4XEFA 4H13D 3GM2A 4R32A 1JB0J 2D2CD 2FYNC 3AE4C 2FBWC 4NQFA 3LW5J 2Q00A 4XEKA 1IK7A 2E74D 4XFJA 4OGQB 4YXDC 1V4AA 1ZZPA 4H44D 2E76C 3D6ZA 1OW6A 2FXPA 1S1CX 1DD4A 3AE3C 4H13C 4R4MA 2P10A 1K05A 2L6GA 3U0CA 3AEEC 2WQYC 3AE9C 3D70A 3C8GA 3AEDC 4H13B 2L6HA 3AE6C 3RL0g 4I7ZB 1WWPA 4H44B 3MFNA 1VL2A 1ZP0C 3Q1MA 3AE8C 2H89C 3RQEA 2E75C 1VF5C 2D2CC 2E75B 3Q5SA 1HJ0A 1RQVA 3C18A 3GMAA 3Q5PA 2L6FA 4H44C 1GMJA 3JYYA 2WSCJ 3B71A 3AEAC 2JO1A 4OGQC 2QJYC 5F28E 1PV3A 2JP3A 1DIPA 3BRJA 3K7DA 3AE5C 4R4LA 3RQFA 4PV1C 1ZMEC 4TT3H 1DD3A 4EBJA 4OGQD 1KQGB 2QIWA 1K40A 2YWAA 3C8GB 4EBKA 4GDOA 1VF5D 4RKUJ 5M1BA 1KNYA 2JPUA 3AE2C 2JX0A 4U7JA 4PV1D 3TULA 3G9RA 2QSIA 2IDBA 3O10A 3GLMA 3D6YA 3SFEC 4XEVA 2LK4A 1HF9A 1ZRTE 1NYHA 1RQUA 2KK1A 4Z1MH 4PV1B 1R8EA 4H0LB 1PL5A 2E76B 1VF5B 1YQ4C 1WOLA 2BEZF 2ZT9B 3AEBC 1KTMA 1YQ3C 2OQQA 4Y28J 3GF7A 1QVXA 1UIXA 1KQFB 3Q3DA 3RK3E 3GM1A 2QJKC 2BEQD 1MKMA 3H25A 3AE1C 1OW7A 1KORA 2J5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTY A;  1UFB A;  2H88 C;  3AEF C;  2HSB A;  3JZ0 A;  1K04 A;  1JOG A;  3AEC C;  3S9O A;  3SFD C;  3AE7 C;  2PBE A;  3L8J A;  3U3F A;  1OW8 A;  1O3U A;  4YTP C;  2G3A A;  3GM3 A;  1ZOY C;  3C8G D;  3RQG A;  3ABV C;  3AEG C;  3L8I A;  3AJM A;  4XEF A;  3GM2 A;  4R32 A;  3AE4 C;  4NQF A;  4XEK A;  2FBW C;  2Q00 A;  1ZZP A;  4YXD C;  1V4A A;  1OW6 A;  3U0C A;  3AE3 C;  1K05 A;  2L6G A;  3AEE C;  3AE9 C;  2WQY C;  3C8G A;  3AED C;  2L6H A;  3AE6 C;  1WWP A;  3MFN A;  1ZP0 C;  3AE8 C;  2H89 C;  3RQE A;  3C18 A;  2L6F A;  3JYY A;  3B71 A;  3AEA C;  5F28 E;  1PV3 A;  3BRJ A;  3K7D A;  3AE5 C;  3RQF A;  4EBJ A;  1K40 A;  2YWA A;  3C8G B;  4EBK A;  2JPU A;  1KNY A;  2JX0 A;  3AE2 C;  3TUL A;  3O10 A;  3SFE C;  4XEV A;  2LK4 A;  2KK1 A;  1YQ4 C;  1WOL A;  3AEB C;  1KTM A;  1YQ3 C;  1QVX A;  3GM1 A;  3AE1 C;  1OW7 A; 
#chains in the Genus database with same CATH topology
 2YIU C;  1BCC G;  1JM0 A;  1TWA A;  1L0L D;  4HYT B;  3MX3 A;  4AE4 B;  3TOM A;  3HE4 A;  4IFM A;  5AVT B;  2CPB A;  4JYB A;  1NTM D;  1JPN A;  1SYQ A;  1VMA A;  5B66 H;  2OG2 A;  5KYY A;  3VTP C;  1Z5Z A;  2LFD A;  1M2O A;  3FWL A;  3KZI H;  1XTG B;  2A06 E;  2AEM A;  2Q6Q A;  1MFT A;  1WAT A;  3S27 A;  5DJT B;  3FGA D;  4BRY A;  3DKA A;  3B9Q A;  1HTL C;  1GW3 A;  3T6G B;  1M1J A;  1GDT A;  2GAQ A;  1BE3 E;  4O7G A;  4E0I A;  3C7J A;  3RK2 C;  2RD9 A;  1EZV D;  2HS5 A;  3T9O A;  3WUV A;  2K9Y A;  5AW2 B;  1BCC J;  3WU2 E;  1S05 A;  3GHG B;  4MN4 C;  3CX5 D;  1CPQ A;  1Q0F A;  4MTG A;  5L3V A;  4LGD E;  3TDK A;  1RHZ B;  5T1D B;  2FGY A;  3EGD B;  2WSS H;  4YT2 A;  2WB7 A;  2P10 A;  2L6G A;  3DE9 A;  1QPU A;  1SQX E;  4ASV A;  3CXH E;  3EGX A;  4YT5 A;  1Q7Y Q;  3CC7 P;  2ZYD A;  3ZSU A;  5KLV G;  3X1O A;  5AVV B;  2HPC B;  4YT8 A;  2OYI A;  3MUD A;  3P8M C;  3T97 A;  1YA7 O;  2J0X A;  4I44 A;  2YL3 A;  2YL7 A;  3K7D A;  4BWN A;  4G7H F;  4TT3 H;  5K5G B;  4N4W A;  2QIW A;  3L73 E;  5KYU B;  3FXD A;  3L72 D;  3PLN A;  2J9U A;  5AVS B;  2IDB A;  3O10 A;  1RJ9 A;  5DJU B;  4XEV A;  3EFG A;  2L81 A;  2OAR A;  2WT7 A;  4N6H A;  3E7K A;  4OD4 A;  1NTK G;  1R8E A;  3HJC A;  2CNW A;  3EPV A;  4F4B A;  1I5N A;  2D5R B;  3PTZ A;  1IFP A;  1JCD A;  2E87 A;  1RMV A;  1KTM A;  2B88 A;  4WBA A;  1T5O A;  4TLF A;  1KZU B;  1N86 A;  1PGO A;  5TJ5 E;  3RKO F;  3Q3D A;  4NCQ A;  1JNM A;  2J0W A;  1A7D A;  3JCU Q;  2YKP A;  1BR2 A;  2XM4 A;  2E43 A;  1KOR A;  2LIG A;  3CCR P;  3BCC G;  1NU1 G;  5APX A;  2H7B A;  1YYC A;  2YVK A;  5E33 A;  3WG7 C;  4I6M C;  2ZXP A;  3IF4 A;  3MTU E;  1NBB A;  2NG1 A;  1N73 A;  1EZV I;  3SXK A;  5KYX A;  1G1I A;  3DM9 B;  1HUC A;  1PP9 D;  1ZVZ A;  5B66 E;  5AW6 B;  3DXJ F;  1VQ9 P;  2XLH A;  3U3F A;  5COG A;  1ZU5 A;  1EDJ A;  2XLO A;  2Q7R A;  4B86 A;  1CSB A;  2KNC A;  3HUS B;  2J45 A;  1LIH A;  2IBZ D;  3ABV C;  4BRY B;  1U57 A;  1QLE C;  2RN0 A;  1N7L A;  1LT1 A;  1WGW A;  3AGT A;  1G5Z A;  1VLS A;  2YLI A;  3CAX A;  5CBO A;  3I55 P;  3BRT B;  1HE1 A;  2ZXW C;  3AGU A;  3EG9 A;  4YT4 A;  2OYO A;  2A69 F;  2C03 A;  2Q9C A;  3M0D A;  1JB0 J;  3B0V C;  2WIT A;  3M1C B;  2KIK A;  1LTS C;  3L1M A;  3AG4 C;  4O79 A;  3KQG A;  4PFO A;  4WGZ A;  3AE3 C;  4MVQ A;  5APQ A;  2DYS C;  3H1H D;  2WQY C;  3M4B A;  3EGD A;  1NAY A;  2Q1K A;  1N73 C;  2A45 I;  2W6A A;  2M0B A;  4BJ5 A;  1AUE A;  2KSE A;  1ZHY A;  4GQH A;  2OU6 A;  1JMB A;  3T6J A;  5AW4 B;  3PRJ A;  1RKC A;  2HV6 A;  4PJN A;  2AXT E;  4UB6 E;  1IW7 F;  3QW0 A;  1PV3 A;  4J30 B;  4X0R A;  1DIP A;  3U59 A;  3SYN A;  2KNH A;  3IPM O;  1VLT A;  4NY3 A;  1K40 A;  2PP4 A;  4U5B E;  4PR9 A;  1AVY A;  3JCU H;  1NTZ J;  3AE2 C;  3L72 E;  4XE5 B;  2GM4 A;  2QSI A;  4U5F E;  1YJ9 P;  4BJ6 C;  1URQ D;  2L5G B;  1BCC E;  3LIE A;  1EI7 A;  3M0D C;  3RF3 A;  4IAO A;  3RVZ A;  1BDC A;  1S2E A;  3CL3 D;  4AL1 A;  3USS A;  5AVX B;  4GYT A;  3AQC A;  3AEB C;  5KYW A;  1AQT A;  2YMY A;  2KYH A;  3ASN C;  1PP9 J;  1NOH A;  3JC2 2;  4QMA A;  1K73 Q;  5B1B C;  1NTZ E;  2PP6 A;  3L72 J;  2M3E A;  3JRT A;  4BJ5 C;  1OW7 A;  3CXH D;  4JEB A;  2IXP A;  3AEF C;  5DQT A;  4DBR A;  3TGU E;  3L71 E;  1T01 A;  5BVZ A;  3CEX A;  4I2L C;  1MMN A;  3L70 E;  4NPF X;  1P84 D;  5AC4 A;  1RF1 C;  3BCC D;  3SEO A;  1TU3 F;  2CPS A;  5EGY A;  2XU6 A;  3WUT A;  4D6T G;  2YL0 A;  2ZAE B;  2G62 A;  5E2Q A;  2NZ2 A;  3WU2 H;  4CX9 A;  2E5Y A;  1BE3 D;  2G3A A;  4PD4 E;  2QJK B;  2I8B A;  3LNM B;  1QEX A;  2R7Q A;  3POV A;  2YXQ B;  4OD5 A;  2DYR C;  2HR3 A;  1XWJ A;  1GTW A;  4GIF A;  1KMI Z;  2ZJS E;  1Y9B A;  1C03 A;  1NTK D;  1W2W A;  2LQG A;  4U9E A;  4FX5 A;  2WPQ A;  5KTB A;  3HNI A;  4WJ0 A;  1M8O B;  1S72 P;  3HE4 B;  3VN0 A;  1VQ6 P;  2XLD A;  3IQ6 A;  2XND H;  1MZ9 A;  2AXT H;  4OGQ B;  4YXD C;  3OWT A;  4UB8 H;  1AVO A;  2N9B A;  2JEE A;  1SQP J;  3DWW A;  1BGY G;  1JTH A;  5AVQ B;  4E7Z A;  1NH4 A;  1HGZ A;  2HMQ A;  3C8Z A;  1LTT C;  2OOC A;  3C8G A;  3JRM O;  4H4K C;  3EJN A;  2H89 C;  4U9D A;  4DRI B;  1IK9 A;  5AVR B;  2NSF A;  5T3W A;  3Q5S A;  5BU8 B;  3C1L A;  1SFC A;  1N7S C;  2CNW D;  1TFK B;  4A4A A;  1FU1 A;  3VM6 A;  3RIP A;  2X51 A;  1T6I A;  5CMZ A;  1Q86 Q;  2Q5U A;  1VYI A;  1FZG A;  4HB1 A;  3DAG A;  3EZI A;  1JPJ A;  4UDV A;  1QL1 A;  4EBJ A;  3C8G B;  2ZYG A;  4I3M A;  4QDL A;  2C9L Y;  3BCC E;  4H54 A;  2AXC A;  2I15 A;  4MW8 A;  3L74 D;  4EBB A;  1PPJ E;  1HW1 A;  1G2C B;  4WVZ A;  1GM5 A;  4PV1 B;  4CSA A;  1PL5 A;  3NMI A;  5L0H A;  2BEZ F;  2ZVN B;  3TGU D;  2H7V C;  5D92 A;  2QG4 A;  5L0C A;  1VQM P;  1SQQ J;  3H1L G;  2R7O A;  3VYI A;  3QZC A;  2IZ1 A;  3UMH A;  4UB6 H;  2FXM A;  1RKE B;  4W80 A;  3R4Y A;  3AG1 C;  3W8I A;  2IM8 A;  3K66 A;  1JY3 P;  5FZT A;  3ZWI A;  2OTK E;  2WVR A;  1ZV8 A;  4ULV A;  3L0I A;  1X8Y A;  3CCE P;  1NTZ G;  1KC8 Q;  5GTI H;  5CI8 A;  2XM0 A;  4YTP C;  1Q90 D;  3CCU P;  1YTZ T;  5A6B D;  2GWW A;  1HE9 A;  4K3A A;  3KYJ A;  3G3Z A;  1ZOY C;  2E74 C;  1L0L K;  3ABL C;  2YXR B;  5FCL A;  4C7N A;  4CSA C;  3Q2Y A;  1H8A A;  5KYX B;  3AEG C;  4I7Z C;  1JUN A;  3TNU B;  1FZC C;  1WAS A;  5APT A;  3RVY A;  2YO2 A;  3Q7L A;  3L8I A;  1IFI A;  1SQP G;  2WVQ A;  3HNJ A;  4JYC A;  1ST6 A;  1LTA C;  4U3F J;  3V4Q A;  3O39 A;  1FNT c;  5EK0 A;  1UII A;  3AE4 C;  3M9H A;  1N7S B;  1Q0D A;  1TWH A;  4H13 C;  2JWA A;  2K1A A;  2YHS A;  3RL0 C;  3AEE C;  3BVH A;  4JVS A;  1E83 A;  5L0J A;  2WZF A;  5L0D A;  2M4E A;  5B5E H;  1I4Z A;  4CS8 A;  2HJM A;  1FDM A;  2UUH A;  1VTM P;  3HUS C;  4K0D A;  3GEI A;  1RQV A;  4KNW A;  1GW4 A;  5DVW A;  2R7T A;  4HEA J;  1Y47 A;  1BGY E;  2XNX A;  1C02 A;  4XLP F;  2PGD A;  5HSW A;  3SNH A;  2PX3 A;  3L70 D;  2MHR A;  3TJ6 A;  3CC2 P;  5BUO A;  1NTK K;  4EBK A;  2KS1 B;  1OCO C;  3CXH H;  4DOJ A;  3D6Y A;  3PP5 A;  2M8R A;  1OZH A;  3TQO A;  4ZNC A;  1IZN B;  3N4X A;  2WSE H;  1YLM A;  1WRG A;  1AA0 A;  1MMA A;  4OIQ F;  1MMG A;  2WPS A;  3IQT A;  1IFN A;  1LTJ C;  2A68 F;  2QEX P;  3L75 E;  2HKV A;  3I4U A;  2HYN A;  1NU1 K;  2QLA A;  1GU5 A;  1UIX A;  2HSQ A;  3QVY A;  2NPS C;  3I5Q A;  3E1I A;  4IL6 E;  1YZA A;  2O01 J;  2KNC B;  3HUS A;  3G4Z A;  3GAN A;  3NKD A;  1FR0 A;  1RY3 A;  1L0N D;  5KYW B;  3JZ0 A;  1RF1 A;  1HWT C;  1M56 C;  2KB7 P;  2DGJ A;  2ZT9 C;  2H8P D;  3H65 A;  2DB4 A;  2O3J A;  2XLW A;  3U2L A;  1NU1 E;  4C7N B;  2NPS D;  1E84 A;  1IJD B;  3S9O A;  4M63 A;  4IFF A;  5B5E E;  3AE7 C;  1AFO A;  1W2E A;  2ASR A;  1S5L E;  1KB9 I;  2BE5 F;  1PCX A;  1KIL B;  1VQL P;  1Z3I X;  1ZW3 A;  2P1A A;  1Z56 A;  1FDI A;  4I1L A;  3VMA A;  3NYL A;  3H1L D;  2WMM A;  4CS7 A;  1Z7Q c;  4MVM A;  2FFH A;  4G0H A;  3A7O A;  1BBH A;  2HFE D;  3K1I A;  1JRA A;  2NPS A;  4KT0 J;  3L35 A;  3GM2 A;  3GHG A;  2EIM C;  3QWO C;  2IYL D;  3L75 J;  1A0B A;  1A41 A;  4L73 A;  4J7Y A;  3LAY A;  1NLX A;  3RH3 A;  2HJ3 A;  1NTZ D;  1IFJ A;  3KZI E;  3L34 A;  4EKW A;  2PRR A;  1QL2 A;  4JE9 A;  1ZN5 A;  3PH0 A;  4CS9 C;  2P1J A;  4DZO A;  1GL2 D;  3DI5 A;  2D2C C;  1LT9 C;  1V54 C;  2OYH C;  1ZU4 A;  3LNR A;  1JTH B;  1LTI C;  3V7O A;  3KYI A;  4K1O A;  1PPJ G;  3B71 A;  3CQZ A;  4U5H A;  1ZLL A;  2AP3 A;  2JDI H;  3W68 A;  4R4L A;  2N1T B;  3RQF A;  4FWV A;  3WOD F;  5KJ7 D;  3G71 P;  4W7Y A;  1MFZ A;  1URQ C;  1L0N G;  5A6J A;  3SSU A;  4BJ1 A;  4DCK A;  5BQG A;  2YKO A;  1APC A;  3K1I C;  1LM3 B;  3SFE C;  1J8Y F;  1PFI A;  3VYW A;  1GL2 A;  1NJI Q;  1CI6 A;  3VOP A;  3KXD A;  2KXP B;  3HE5 B;  4OIR F;  2M3B A;  1LS1 A;  2W8Z A;  1Y4C A;  1L0L E;  4C46 A;  4C3B A;  5TIS H;  5KJ7 A;  4PJ0 E;  4MW3 A;  1OVR A;  2NRG A;  5C39 A;  2V7Q H;  3LEO A;  4GOE A;  1OWA A;  2LR2 A;  1G4U S;  3U5S A;  2A1D D;  2A6E F;  3CLQ A;  2LD6 A;  1CZQ A;  2H8A A;  3ZG1 A;  3SP1 A;  1MNE A;  1UG7 A;  5B3I A;  1RF1 B;  4D6T D;  4L76 A;  4J32 B;  3GF3 A;  4G7Z F;  2WVO A;  2Y3H A;  2L9J A;  3TGU G;  3SFD C;  1EXI A;  4W7Z A;  1KQL A;  3GOR A;  3B0U X;  4HJG H;  3H1I G;  1KU2 A;  5B3S C;  5A69 A;  1L4A C;  3L70 G;  2FKW B;  2P7J A;  1SQB E;  3GM3 A;  3LLI A;  3DE8 A;  1Y6D A;  2YZS A;  4ZLC A;  2IBZ G;  4MS2 A;  4BG0 A;  4ZKU A;  4HKZ H;  1SLQ A;  1T8Z A;  4AYC A;  1PGP A;  1SFC B;  1SMY F;  3O6Q A;  256B A;  2H43 A;  4R32 A;  1YYJ A;  1NTM E;  2E74 D;  2WWW A;  4NTF A;  4EI2 A;  1LT9 B;  3CD6 P;  1LP1 A;  1EC5 A;  4LDQ A;  1N2D C;  2HOD B;  1SQQ K;  4IOI H;  1TWG A;  4OVN F;  2Z5I A;  2HZ8 A;  2ZFC A;  2J58 A;  1N7S D;  3M91 A;  4RD9 A;  1VQP P;  2VCA A;  3FMS A;  4XPX A;  1J2J B;  5BU5 A;  4XQ1 A;  1JR8 A;  3HD7 C;  2WZG A;  5AGF A;  2FFD B;  2LXB A;  4XA4 A;  2Y39 A;  3L71 G;  2GFH A;  1YA9 A;  3EHN A;  1K9M Q;  2A06 G;  3PJS K;  3UMI A;  3H1H G;  1EQ7 A;  5AW1 B;  5AW0 B;  2XLE A;  3CX5 I;  3F89 A;  5JSL A;  1HF9 A;  1ZRT E;  3DMD A;  4D6T E;  3V5B A;  1HY5 A;  3H1K G;  2H7O A;  4IFD K;  1R4T A;  4KBL A;  1SQB G;  2BCC E;  2GDC A;  3DAF A;  2OYI C;  5K0I A;  3JCU E;  1JY2 P;  3WMM 0;  2ZVO B;  1OR2 A;  4C7O B;  1XZP A;  2IXM A;  4AX2 A;  4IL6 X;  2JR8 A;  4M3L A;  3RBZ A;  3CMA P;  3L71 J;  3NYM A;  3HNK A;  1O87 A;  1BSN A;  3HD7 A;  1NTZ K;  2WPR A;  2HV7 A;  3KMI A;  4YXW H;  3ZDL A;  4Z9J A;  2W90 A;  2KGO A;  1NU9 C;  3U1A A;  1KV4 A;  5GTH E;  3D71 A;  1PP9 E;  1TWC A;  2B87 A;  2YNY A;  2YEV A;  3H1K J;  1KD1 Q;  4XTK A;  4C7R A;  3UIA A;  3K1H A;  3ITF A;  3G4S P;  1EKY A;  1JOC A;  3RQG A;  3IN6 A;  2PX0 A;  2MKV A;  4WY4 D;  2OTL P;  3TD7 A;  2HFI A;  1C17 M;  1DX7 A;  1AEP A;  3J06 A;  3GHG C;  1J1D B;  1FZB A;  1P84 H;  3H1H J;  3EFO B;  2RMZ A;  2QJP B;  3NTN A;  2XXA A;  1IO4 A;  1E79 H;  1LWU B;  5B1A C;  2QUP A;  1N73 B;  2VCB A;  3UGP A;  1R5I D;  3D6Z A;  2QE7 H;  5KAF H;  4IGG A;  3ABK C;  3UMK A;  1SQB J;  3W4Y A;  4FES A;  4ANJ A;  2XDJ A;  2R7X A;  3OEO A;  5AW9 B;  3RL0 g;  3VAY A;  4WY4 A;  3Q1M A;  1DH3 A;  2NSG A;  4BEM J;  2E75 C;  3H1J J;  1LKX A;  3LS1 A;  3TGU J;  4L74 A;  3CCJ P;  2EIL C;  1EDI A;  2J46 A;  2R32 A;  1JMM A;  3RFY A;  3AE5 C;  2F22 A;  1EZV E;  2IXO A;  3ABM C;  3CCM P;  2B0J A;  3C62 A;  1DD3 A;  1RF0 A;  1DEB A;  1QGK B;  4GDO A;  1G8X A;  3MP7 B;  3A0B H;  4UB8 E;  4CJG A;  4U7J A;  3CWB E;  1FBM A;  2FAP B;  3V2Q A;  2CCY A;  2P58 A;  3ZC4 A;  1JY2 N;  3ECS A;  3Q6N A;  1W5C E;  2AU5 A;  1GU4 A;  3TF5 A;  1J8M F;  2XLM A;  2ZT9 B;  3O55 A;  1T6U A;  1AV1 A;  4L6R A;  3S28 A;  1NZE A;  4PJM A;  2A45 G;  4NPD A;  3KHU A;  5DS6 A;  3V2P A;  2IYP A;  1D1A A;  2DI3 A;  2KUB A;  2DW3 A;  4RBN A;  1M56 D;  1ZRT D;  4ZKP A;  2J8W A;  1GK4 A;  4WAB A;  1HBW A;  3L75 D;  4H0L D;  1H9G A;  3CX5 H;  2EPL X;  3B5N D;  2YLD A;  4CBE A;  1L4A A;  4MVS A;  3AOU A;  2V7Q J;  4BEJ A;  1LPE A;  3IQC A;  4WB4 A;  1G4W R;  1SQQ E;  3EH2 A;  5CCH D;  1M2V A;  1IZM A;  1R5L A;  3E9V A;  1LWU A;  1H6G A;  1PGQ A;  2E76 D;  1E5W A;  1RH5 B;  2ZXO A;  1NFO A;  4D4N A;  1E2X A;  5EFW B;  2SPZ A;  3V5Z A;  1YAR O;  1S9K E;  2YL1 A;  3BCC J;  3B5N A;  1FZC B;  2QA4 P;  1OFC X;  1QSP A;  5AW8 B;  2HMZ A;  3MYI A;  2IYO A;  1FAP B;  4NQF A;  1TFO B;  2OKU A;  3K6B A;  3FOO A;  3I5C A;  1PZQ A;  3P8C E;  3FDQ A;  2E76 C;  2FXP A;  2O1K A;  1M1K Q;  4LC1 A;  4DT0 A;  1K05 A;  2WZL A;  2BAS A;  4H13 B;  2L6H A;  2Y9Z A;  4JUR I;  4JZA A;  2Y3D A;  1TQG A;  2C0W A;  3H1L J;  2A6H F;  3RK3 B;  3UR3 C;  1VB5 A;  3CI9 A;  3Q5P A;  4H44 C;  2QJY B;  2BCC J;  5KLI B;  3S84 A;  4LLH A;  4ZMD A;  3NMK A;  3JTL O;  4O6N A;  2IFM A;  2EIK C;  1LWU C;  5CJ4 A;  3M79 A;  1T9K A;  2Q9I A;  3CSK A;  3M06 A;  1T3U A;  1FZA A;  2AVK A;  2YWA A;  4ASW A;  1S3J A;  4RKU J;  2XSE A;  3TUL A;  1R5S A;  1OXK A;  2Q3T A;  1SF8 A;  4LLC A;  4B6I A;  3N24 A;  2E76 B;  2XRH A;  4RDA A;  1DEE G;  2NUP A;  4YWQ A;  1S4X A;  2WSF H;  3FXH A;  3M9Q A;  3JSV C;  4XPY A;  1LE4 A;  3GW6 A;  5KYU A;  3H1J G;  1LVK A;  2KLV A;  1M57 D;  1VYK A;  4DXW A;  1JAF A;  1H0T A;  2K88 A;  2NUP B;  1NKN A;  2KQ9 A;  1RCP A;  1U7J A;  2PBE A;  3HNL A;  2H7H A;  2WSE J;  3FAP B;  4KJM A;  1N1C A;  1O3U A;  2I8D A;  2XS1 A;  2NPS B;  4DJ9 A;  2KZJ A;  1NO4 A;  1M2V B;  1KIL C;  1YJG A;  5KLI C;  1GGQ A;  3AG2 C;  2QJP C;  2R05 A;  5AW3 B;  5CIV A;  3TSI A;  4YL0 A;  2E74 B;  1BDJ B;  1Q81 Q;  1SQV E;  3CCS P;  1QLE D;  3T4R A;  3KDP B;  1SQQ G;  4WGY A;  1SP4 A;  3LW5 J;  4JKV A;  2N9Y B;  1IK7 A;  5DS5 A;  2Q3I A;  2EPK X;  3L37 A;  1ZXG A;  4WY4 C;  5KYY B;  3A11 A;  1SQP K;  4U3F D;  3RK2 D;  4EHP A;  3MFN A;  3H1L E;  1QZX A;  1ZR4 A;  4LDR A;  4C3D A;  1MND A;  1FFT C;  1HMO A;  5CHX A;  1XZQ A;  1RE3 A;  4RES B;  1GMJ A;  4BJ6 A;  1Z6A A;  1KFN A;  3L74 J;  5F28 E;  3DJU B;  2EPM X;  3BRJ A;  4PAC A;  4Y99 B;  1E85 A;  2XZR A;  5GPG B;  3O8Z A;  2VAS A;  3FX0 A;  4PD4 I;  1KQG B;  4MTF A;  1A02 F;  5KLV J;  1EDL A;  3UGO A;  4PV1 D;  3LS0 A;  1D1C A;  2B89 A;  2OTJ P;  3PDM P;  2B9B A;  3HTK A;  5E79 E;  3MIW A;  2QM7 A;  3QTH A;  3M0A A;  1M6T A;  1BDD A;  2FYZ A;  5APW A;  2FYU G;  1U7M A;  2Q9A A;  1VK5 A;  3ZQY A;  3R2P A;  4Y28 J;  1LI7 A;  2K3R A;  4L75 A;  2QRX A;  3PCV A;  5CBN A;  4CDV A;  3K5B A;  4N78 D;  1YBK A;  4D4X A;  1O5H A;  3H25 A;  2Y3G A;  3W8H A;  2QE9 A;  1VQN P;  3QH9 A;  2G3K A;  4CDA A;  3PMR A;  1PPJ D;  1VQK P;  2R44 A;  4FAP B;  1PIX A;  5T3T A;  1K04 A;  1YTZ I;  3FOP A;  1KIL E;  5KYN A;  1GZL A;  4HH2 A;  1BCC D;  1OMI A;  3Q5R A;  4CIP A;  5L8R J;  5KKZ C;  2QNL A;  2R5D A;  4AL0 A;  1LE2 A;  1YIJ P;  1M1J B;  3CC4 P;  3B5N C;  3WUU A;  5DQZ A;  5JLI A;  2CGE A;  2LXC B;  2G8Y A;  2PAJ A;  2MJZ A;  3NKE A;  5AC5 A;  1NTM J;  4XEK A;  4N3Y B;  2WL8 A;  3S90 A;  3GOD A;  1NU7 D;  3MHV A;  5CJ0 A;  4I1M A;  1M1J C;  3V5Y A;  1S1C X;  5A6B A;  3ATP A;  3DD7 A;  1BR4 A;  1X9V A;  1WWP A;  1SQV D;  4H44 B;  1VQ4 P;  1VL2 A;  2OJQ A;  2HPC A;  4LER A;  5H2F E;  1J1D C;  1WT6 A;  3L74 G;  1JY2 O;  1IFD A;  3TJ5 A;  3DJN B;  1ZW0 A;  2KZI A;  2GA0 A;  2Z4E A;  1FJP A;  3AEA C;  3SWK A;  1JY3 N;  4IL6 H;  1AVO B;  2P6V A;  2IBZ I;  4PV1 C;  1ZME C;  2LSE A;  1YAU O;  2Q3E A;  1D0Z A;  1FJK A;  1VOM A;  3NFQ A;  2P67 A;  1CGN A;  3X2Q C;  3OW2 O;  3H1J E;  4OIN F;  3B0P A;  2C9N Y;  2PFX A;  2GA1 A;  3U1C A;  3C9I A;  2QY9 A;  1D1B A;  2QTV A;  5KLV D;  1GQA A;  5APV A;  1ZHZ A;  4U5C E;  5F5F A;  1FE6 A;  4PD4 H;  2EIN C;  1M7L A;  5CI9 A;  3HD7 B;  2XKM A;  3MBG A;  1YHQ P;  2C04 A;  1SR2 A;  1JY3 O;  1EA8 A;  3K33 A;  1W2B O;  4O6M A;  2J5U A;  4XLN F;  4RO0 A;  2IXN A;  1YJW P;  2MYS A;  3KPH A;  1KB9 H;  2YIU B;  4DRH B;  5L0I A;  1URQ A;  4EOT A;  1DOW A;  3GEH A;  2FYU E;  4IAR A;  2PF4 E;  5JS5 A;  2D2C B;  5CCH C;  1NG1 A;  2ICW G;  4P9F A;  5L0G A;  3IQ5 A;  2K9J A;  1WMK A;  4DJG A;  3GWL A;  4OH8 B;  1BE3 G;  2AWC A;  1M57 C;  2A0B A;  1FDO A;  3L73 D;  2P2U A;  4E7S A;  1OVU A;  2LP4 A;  3TOL A;  3C8G D;  2R25 A;  2OGU A;  3RW0 A;  3WAQ A;  1RKE A;  4OIP F;  3LUT B;  3CPW O;  2Z15 A;  3EQL F;  2UWJ E;  1JMW A;  1A02 J;  3AJM A;  3C8V A;  4XEF A;  3P32 A;  1IC2 A;  1ZZP A;  3WHN A;  1OVV A;  2WTY A;  4DBQ A;  5KLV E;  3M9B A;  2EPN A;  2D4U A;  4NC3 A;  3OJA B;  1SZI A;  5H2F H;  2LKM A;  2W27 A;  3L36 A;  1OXB A;  1LTG C;  3EFF K;  3ZTZ A;  2GUV A;  1P84 I;  3TNU A;  3NMJ A;  2ZXE B;  1GL2 B;  2E75 B;  2O9X A;  5KAF E;  3SXY A;  4Y99 C;  1GD2 E;  3F47 A;  1B68 A;  4JJG A;  5BQH A;  1FMV A;  2XL6 A;  1KB9 E;  3OAK A;  1YDI A;  2ZD9 A;  3KPE A;  2OEX A;  2WZ7 A;  2VRS A;  1LTJ B;  2JX0 A;  3HTK C;  3A0H E;  2AEF A;  1T6A A;  3A0H H;  3NDB B;  3HE5 A;  1ZHT A;  5A6A A;  1NYH A;  4KC9 A;  4LDK A;  1L0N E;  1SFC D;  4H0L B;  4XPW A;  4P6I C;  3E1R A;  4O6Y A;  3MYF A;  2R9R B;  3L70 J;  1NWQ A;  1M90 Q;  3LJB A;  1SQV K;  3N0T A;  3EH1 A;  1CPR A;  3E70 C;  4EDF A;  3H6P A;  1FZE A;  3HTK B;  1L4A B;  4KNV A;  3GEE A;  3KH2 A;  4N78 E;  2HSB A;  4GOF A;  2BCC D;  2KSF A;  2Y69 C;  4GT1 A;  1JOG A;  2J9V A;  1CGM E;  5L3Q A;  1KYO I;  1HJB A;  3IAO A;  3LID A;  2LCH A;  1OXZ A;  2POH A;  1G2C A;  1NTK J;  4JJF A;  1T2K C;  3NXS A;  2RH0 A;  2YRF A;  2KJG A;  4GOD A;  4U3F G;  1L7C A;  1V74 B;  3M4C A;  3EWK A;  1QVG O;  4YJW A;  3MD0 A;  4C7O A;  2Y3B A;  3VMX A;  3MUD C;  4ONS A;  5IY5 C;  4PK4 A;  3RL0 D;  3T97 B;  3BAS A;  1GS9 A;  3L75 G;  1T2K D;  3RK3 D;  5F5H A;  3SXM A;  4Q4Z F;  4E18 A;  1L0L J;  2OYH A;  5E79 H;  3RBX A;  1L3P A;  2R7R A;  1DOV A;  2E42 A;  5EHH A;  3U0C A;  5AW7 B;  5KLV K;  2J9W A;  3BAT A;  4JBZ A;  3AE6 C;  2N1T C;  2A0U A;  2V3C C;  3H32 B;  3R7C A;  3VMY A;  1X0T A;  1BZ4 A;  4JRZ A;  2HG5 D;  2L6F A;  2R5B A;  2WSC J;  3L72 G;  4BJT A;  2QJY C;  1RJ9 B;  2J7P A;  3U9M A;  1RXQ A;  3H1I D;  1U0B B;  4PJL A;  3EZH A;  2JPU A;  1SQB D;  3G9R A;  1N7S A;  1SFC C;  1ZW2 A;  1KB9 D;  4DOZ A;  4JCZ A;  2M64 A;  1VF5 B;  1Q0M A;  2KI7 B;  2YLG A;  4GKG A;  3JYH A;  1CI6 B;  4JTA B;  4YN0 B;  2CK3 H;  2IZ0 A;  1N8R Q;  1KYO D;  3RK3 E;  3H1K E;  2BEQ D;  2I1J A;  1MKM A;  1OCZ C;  3IFM A;  3VP8 A;  1SQV G;  2I1K A;  3S4R A;  5A6K A;  3CZ6 A;  1RF0 C;  2OCC C;  5AVY B;  3Q6M A;  2KS1 A;  1MMD A;  4Z9H A;  2Y0E A;  1H89 A;  4MVU A;  4WWI A;  3V2R A;  1H0T B;  1S7Z A;  2TMV P;  3AEC C;  4OWF A;  4H0L C;  4U5D E;  1BGY J;  1LI5 A;  3IEE A;  3FHD A;  2ZXR A;  2KW3 C;  1RE4 A;  4QI0 A;  1D0Y A;  1P84 E;  5E3A A;  1VDF A;  3TK0 A;  3V2N A;  1EZV G;  1QQ3 A;  2ZT9 D;  2PFD A;  3US6 A;  1YI2 P;  4YL3 A;  2W9Y A;  2JWD A;  4PJ0 H;  4JCH A;  2R3C A;  1NFN A;  4CDY A;  1L0L G;  2XXA B;  1SQV J;  1FAV A;  3FWN A;  3CME P;  1LGH B;  3LW5 H;  1OX3 A;  4IWB A;  3V6I A;  4EIJ A;  2YKZ A;  2D2C D;  2FYN C;  2VC9 A;  4U3F E;  4XFJ A;  1V4A A;  2NPU A;  4YPC A;  3KKB A;  1A7E A;  4KHX A;  2AWY A;  1DD4 A;  3A2A A;  2WSC H;  3ZIB A;  3B5N B;  1FZC A;  1LP1 B;  3D70 A;  3L73 J;  3AED C;  1SQX J;  3V4W A;  3BRV B;  3H1K D;  1YJN P;  1FOS E;  1TR2 A;  3S1K A;  2XL8 A;  3HRN A;  1ZHX A;  5AW5 B;  4NTB A;  3QMK A;  5GTI E;  4CJO A;  1RE4 C;  3O6Q B;  3JYY A;  3ITK A;  3OA1 A;  5HV9 A;  3U8V A;  1FMW A;  1E86 A;  1TKN A;  1FTS A;  5BQI A;  2L7A A;  4Q7C A;  3CWB D;  3A5T A;  2W6J H;  4OGQ D;  1HMD A;  5CCG A;  1VQ8 P;  2R03 A;  3DZA A;  2K37 A;  4N6C A;  5JRA A;  1JCC A;  3VF0 A;  1SQB K;  2M5A A;  2YQY A;  1H9T A;  1SQX G;  1S5L H;  2KK1 A;  2UUI A;  1WOL A;  1NTM K;  3P8C D;  5JT4 A;  3T6B A;  2K9J B;  2FYU D;  4A2N B;  1V55 C;  2EPO A;  1QVX A;  2Q7C A;  1LNQ A;  3NG1 A;  4N06 A;  5CCG D;  2QVA A;  3ZQV A;  2M5A B;  1LTB C;  1QX8 A;  2WVN A;  4PFP A;  1LTJ A;  3L73 G;  1AQ5 A;  2QM8 A;  1USE A;  3EHM A;  2IPP A;  2HOD A;  5APU A;  1G1J A;  3EQ2 A;  2R7W A;  1OKK A;  1NTK E;  1EQ1 A;  3L8J A;  5CCG C;  2A06 D;  1SVF A;  1OW8 A;  2WPV B;  3W2W A;  2VB6 A;  4DRJ B;  2B87 B;  4IB4 A;  4NPE A;  1BE3 J;  3LES A;  3F46 A;  3Q7G A;  4K7B A;  5D91 A;  1HGV A;  3HLZ A;  4DVZ A;  2OJE D;  4XWJ A;  4Z9I A;  5L0F A;  1KIL D;  2JJL A;  2W6B A;  4HFK B;  3VMZ A;  4EYY Q;  4IRU A;  1L4A D;  2J7P D;  2Q00 A;  5JUA A;  1PGJ A;  1OKK D;  2JKV A;  2N1T A;  1U6H A;  3PHL A;  4JTD B;  2X0C A;  3NYJ A;  3N7N A;  5KAI H;  3O6X A;  3NMD A;  2CW0 F;  1FZF A;  4I7Z B;  4MVR A;  3A0B E;  1ZP0 C;  3IR9 A;  2R7V A;  2OQM A;  3RQE A;  3RK3 C;  1S9K D;  4BXL A;  3MLG A;  2R7S A;  1VF5 C;  3KYQ A;  1U89 A;  4ULW A;  2FY8 A;  2FFD C;  2W45 A;  1HJ0 A;  4D6T J;  3EFO A;  1PP9 G;  3A3Y B;  2O1J A;  5E3C A;  1JO5 A;  4JTC B;  2R3S A;  2ZYA A;  2KC3 A;  3SXZ A;  2MWQ A;  3W2V A;  1OR3 A;  2N1T D;  3JSZ A;  1KYO H;  1OCR C;  1I4Y A;  1A7V A;  3EGX B;  2VH3 A;  1CGO A;  2OYH B;  3H1I E;  3DM5 A;  1HVV A;  1LT9 A;  3A9C A;  2KSJ A;  2XL4 A;  2FXO A;  5APS A;  2P0N A;  3BEH A;  2KLU A;  3SWF A;  2KOG A;  3HD7 D;  1L0N K;  2LFF A;  4G78 A;  4Z1M H;  1NKZ B;  3C63 A;  3U8P A;  2OEV A;  4LLE A;  4C3E A;  4CPG A;  3P7K A;  4E0H A;  4A7P A;  1HW2 A;  1D7M A;  2OQQ A;  1J1E C;  4AE4 A;  2W4M A;  1SQX K;  3FVY A;  4MVO A;  1OIP A;  3B8E B;  1KQF B;  1ORS C;  2QJK C;  2FYU K;  3LEV A;  3H2V A;  1NTM G;  1Q0K A;  1NAF A;  2FFD A;  2H88 C;  3JT1 A;  3QVZ A;  1NGM B;  2Y9Y A;  2G3V A;  1KQS O;  5KKZ B;  1PD0 A;  1VPC A;  4PD4 D;  4EWC A;  2O01 H;  4K35 A;  2RKL A;  2HLO A;  4OIO F;  3CXH I;  3CWB G;  4IJJ A;  2ITA A;  1S5L X;  4CS8 C;  2ETS A;  2J59 M;  1VQ7 P;  1IFM A;  3CCV P;  1YIT P;  2J9B A;  3PHF 2;  2OYI B;  1Q0G A;  2E5T A;  2XLV A;  2KP8 A;  2Y0D A;  1F1M A;  3H32 A;  4N6J A;  1Q2N A;  3I5P A;  2RSE B;  2YKQ A;  2YMK A;  3H1H E;  2Y0C A;  5JVE A;  2E75 D;  1BR1 A;  4H13 D;  1T3J A;  2KK7 A;  1BSH A;  5COF A;  3ZTM A;  3G6E P;  1MUU A;  3B4S A;  3NRH A;  4ER9 A;  3V5X A;  3II6 A;  4U5E E;  1KYO E;  1T6Q A;  4R4M A;  3GWN A;  3CX5 E;  1Q82 Q;  2P7V A;  3IHU A;  3U2M A;  2FYU J;  2C0X A;  4AK9 A;  4JPZ B;  3EG9 B;  3GMA A;  4JQ0 D;  3I56 P;  2JO1 A;  2NUT B;  2JP3 A;  3QW1 A;  2WT7 B;  5KAI E;  3VRC A;  4I1O B;  4HE8 D;  4BPM A;  4JEA A;  4AQR D;  5DS4 A;  4KI2 A;  2CYD A;  2AEJ A;  2BC5 A;  4IAQ A;  5M1B A;  1D0X A;  2L91 A;  3CWB J;  1EDK A;  4YK5 A;  2EIJ C;  4JW1 A;  2LK4 A;  1JEK A;  1YVI A;  1LJ2 A;  1RQU A;  3TYY A;  4WY4 B;  3S0X A;  1Y8A A;  5TJH A;  2NUT A;  2R7U A;  3H2U A;  3ZDM A;  1L2P A;  1KN7 A;  1YQ3 C;  1QVF O;  2O01 N;  2A45 H;  2CDQ A;  2W83 C;  2B0H A;  2W4B A;  3CCQ P;  3ZVR A;  3GM1 A;  3FXE A;  2YO3 A;  5DLJ A;  1Z63 A;  2PNO A;  3AE1 C;  4LAC B;  1ORJ A;  1WTY A;  1UFB A;  4W8P A;  4GEH A;  4EUK B;  3GG2 A;  3VP9 A;  1CW5 A;  1L0N J;  1FOS F;  3L4F A;  4Q5S F;  1KIL A;  2GUS A;  1HH0 A;  2R02 A;  3AG3 C;  5APY A;  1H7I A;  1X22 A;  4HFF B;  3G4X A;  3AQB A;  2FYN B;  4O9B A;  1AJY A;  2IBZ E;  3RL0 B;  4AUW A;  1ZYR F;  3G50 A;  3JSE O;  4QI2 A;  5COM A;  4CS9 A;  4MTO A;  1ORY A;  2ZXX A;  1EXJ A;  2WSF J;  1VQO P;  2XV5 A;  1SQQ D;  4MND A;  3B29 A;  3RYL A;  3S29 A;  3N2Z B;  2VCC A;  5JP7 A;  4MQ9 F;  1MQV A;  5AVW B;  4JC7 A;  1H88 A;  1SQX D;  1XTC C;  4DVY P;  1WN0 A;  3U9J A;  3SZR A;  4G7O F;  4RJT A;  2JD3 A;  2Q4F A;  3FAJ A;  2V4H A;  4JF7 A;  5GTH H;  1PD1 A;  2FBW C;  1ZR2 A;  1RE3 C;  4H44 D;  3MGN A;  4MVZ A;  5CCH A;  1OW6 A;  4W8K A;  4YL1 A;  2HUJ A;  3OA7 A;  3ASO C;  1USD A;  2BL2 A;  4J7T A;  4CIH A;  1GL2 C;  3AE9 C;  3SWY A;  1YZC A;  1GK6 A;  3MZW B;  4U5G A;  3AE8 C;  5AVU B;  1NVO A;  3UNG C;  3RGU A;  4PJJ A;  1NU1 J;  1OCC C;  3C18 A;  2Q9B A;  2ZPA A;  2XS8 A;  4NTA A;  1QKR A;  3LLK A;  5KJ7 C;  3M15 A;  4JIO A;  5AVZ B;  1LS4 A;  4OGQ C;  1NHL A;  1Z23 A;  2V26 A;  2IX7 C;  3H1J D;  3L74 E;  4ZLD A;  3F5H A;  1SQP E;  4EIY A;  1BGY D;  1OQC A;  5TIS E;  1FS0 E;  1VF5 D;  1KNY A;  1MV8 A;  3H1I J;  3GLM A;  3KL4 A;  2BCC G;  1FC2 C;  1SQP D;  3TK1 A;  1NSG B;  2P61 A;  1URQ B;  3U3B A;  1X79 B;  1J1E B;  3L71 D;  1KFM A;  2Z5H A;  2IFN A;  2IBF A;  1ZHW A;  1YQ4 C;  1NU1 D;  1VQ5 P;  2KYV A;  3RK2 B;  1FFH A;  1YYX A;  1K8A Q;  4P9T A;  3W67 A;  2IOQ A;  3HKK A;  4E17 A;  1SS1 A;  3GF7 A;  3CCL P; 
#chains in the Genus database with same CATH homology
 4IL6 X;  2O01 J;  1WTY A;  1UFB A;  2YIU C;  2H88 C;  3AEF C;  1NGM B;  4H0L D;  3R4Y A;  2HSB A;  3JZ0 A;  1PIX A;  1K04 A;  2ZT9 C;  1KIL E;  2D2C B;  1JOG A;  3AEC C;  3IAO A;  4H0L C;  3GF3 A;  2V7Q J;  1OMI A;  3S9O A;  3Q5R A;  1TU3 F;  1WMK A;  3SFD C;  1EXI A;  3AE7 C;  3D71 A;  2PBE A;  3L8J A;  1AJY A;  3U3F A;  2WSE J;  5L8R J;  1OW8 A;  2NZ2 A;  2WPV B;  5KKZ C;  1FDO A;  1O3U A;  4YTP C;  1Q90 D;  1S5L X;  2G3A A;  3FGA D;  3GM3 A;  1ZOY C;  2E74 C;  3EWK A;  3C8G D;  1EXJ A;  2WSF J;  3RQG A;  3ABV C;  1FDI A;  3IN6 A;  2ZT9 D;  2MKV A;  2E76 D;  5KLI C;  1U57 A;  3Q2Y A;  3AEG C;  2QJP C;  4I7Z C;  3T97 B;  1KMI Z;  1Y9B A;  2K9Y A;  2E74 B;  2G8Y A;  2YMK A;  3L8I A;  3AJM A;  3C8V A;  3O6Q A;  2E75 D;  4KT0 J;  4XEF A;  4H13 D;  3GM2 A;  4R32 A;  1JB0 J;  2D2C D;  2FYN C;  3AE4 C;  2FBW C;  4NQF A;  3LW5 J;  2Q00 A;  4XEK A;  1IK7 A;  2E74 D;  4XFJ A;  4OGQ B;  4YXD C;  1V4A A;  1ZZP A;  4H44 D;  2E76 C;  3D6Z A;  1OW6 A;  2FXP A;  1S1C X;  1DD4 A;  3AE3 C;  4H13 C;  4R4M A;  2P10 A;  1K05 A;  2L6G A;  3U0C A;  3AEE C;  2WQY C;  3AE9 C;  3D70 A;  3C8G A;  3AED C;  4H13 B;  2L6H A;  3AE6 C;  3RL0 g;  4I7Z B;  1WWP A;  4H44 B;  3MFN A;  1VL2 A;  1ZP0 C;  3Q1M A;  3AE8 C;  2H89 C;  3RQE A;  2E75 C;  1VF5 C;  2D2C C;  2E75 B;  3Q5S A;  1HJ0 A;  1RQV A;  3C18 A;  3GMA A;  3Q5P A;  2L6F A;  4H44 C;  1GMJ A;  3JYY A;  2WSC J;  3B71 A;  3AEA C;  2JO1 A;  4OGQ C;  2QJY C;  5F28 E;  1PV3 A;  2JP3 A;  1DIP A;  3BRJ A;  3K7D A;  3AE5 C;  4R4L A;  3RQF A;  4PV1 C;  1ZME C;  4TT3 H;  1DD3 A;  4EBJ A;  4OGQ D;  1KQG B;  2QIW A;  1K40 A;  2YWA A;  3C8G B;  4EBK A;  4GDO A;  1VF5 D;  4RKU J;  5M1B A;  1KNY A;  2JPU A;  3AE2 C;  2JX0 A;  4U7J A;  4PV1 D;  3TUL A;  3G9R A;  2QSI A;  2IDB A;  3O10 A;  3GLM A;  3D6Y A;  3SFE C;  4XEV A;  2LK4 A;  1HF9 A;  1ZRT E;  1NYH A;  1RQU A;  2KK1 A;  4Z1M H;  4PV1 B;  1R8E A;  4H0L B;  1PL5 A;  2E76 B;  1VF5 B;  1YQ4 C;  1WOL A;  2BEZ F;  2ZT9 B;  3AEB C;  1KTM A;  1YQ3 C;  2OQQ A;  4Y28 J;  3GF7 A;  1QVX A;  1UIX A;  1KQF B;  3Q3D A;  3RK3 E;  3GM1 A;  2QJK C;  2BEQ D;  1MKM A;  3H25 A;  3AE1 C;  1OW7 A;  1KOR A;  2J5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...