1OW6A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 58
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6A02
3RQEA 1QVXA 2L6GA 3AE5C 2PBEA 1ZP0C 2FBWC 3AEEC 1OW7A 3MFNA 2LK4A 3U0CA 3C8GD 4XEFA 3AJMA 1OW6A 3AECC 1KTMA 2JPUA 2YWAA 2KK1A 2H89C 2JX0A 3JZ0A 3B71A 1PV3A 3AE4C 3RQGA 3SFDC 3AE7C 4XEVA 1YQ3C 3L8IA 1WWPA 2L6HA 3GM1A 3ABVC 2HSBA 4R32A 3L8JA 2WQYC 1JOGA 3AEAC 1O3UA 1WOLA 3O10A 1K05A 3K7DA 1K04A 3AEDC 3AE8C 3BRJA 3AEBC 3AEGC 3C18A 3JYYA 3AE3C 3U3FA 3TULA 1K40A 4NQFA 1ZOYC 4YXDC 3C8GB 1KNYA 3AE2C 4EBJA 3SFEC 1V4AA 4YTPC 3C8GA 3GM2A 1UFBA 4XEKA 2H88C 3S9OA 4EBKA 2Q00A 3GM3A 3RQFA 1YQ4C 1OW8A 1WTYA 1ZZPA 2G3AA 3AE9C 5F28E 2L6FA 3AEFC 3AE1C 3AE6C
chains in the Genus database with same CATH superfamily
3M0AA 4EWCA 2N1TD 3DAGA 3UGPA 1JM0A 1D0ZA 4A4AA 4LLHA 2OJED 5E33A 4RDAA 3VF0A 1SLQA 4K7BA 4YT8A 3L74E 4WB4A 3CLQA 3JCUE 3FOOA 1HJ0A 2IFNA 2EIKC 4DJGA 2JPUA 2KJGA 3L70J 4ZKPA 1MQVA 4R4MA 2QJYC 2SPZA 3HE4A 2Y39A 4HJGH 4DT0A 1YQ3C 3KDPB 3M79A 1KN7A 4BJ5C 4U5FE 4EIYA 1M1JB 3GMAA 2XDJA 1X22A 1RQVA 1JCCA 2ZPAA 1SR2A 1YLMA 3BVHA 3CCJP 1WGWA 2WQYC 2OJQA 4GEHA 3C7JA 3WHNA 3EPVA 3VOPA 1LE4A 3K7DA 1PIXA 1Y9BA 3P8CD 4GT1A 1S9KE 3HE5A 3LNRA 3OA7A 3L73G 3MYIA 1A7EA 5KJ7C 1AUEA 1T2KD 3Q6MA 2NUPA 1VQ7P 3QVYA 2EPMX 1L3PA 1O87A 3JSVC 2FXMA 1M1JC 2ZXXA 3K6BA 4BJ1A 1EQ1A 2NRGA 4HEAJ 1VF5D 3WMM0 1FAPB 3P8CE 1S9KD 2L81A 3T6BA 1ZHTA 2YL7A 4N6CA 1ZRTE 3IEEA 5KYNA 2YLIA 3CX5I 1V54C 4KJMA 3EWKA 1T6AA 1QSPA 1CW5A 3PHF2 5JT4A 3DE8A 4PR9A 1N7SD 2ZXEB 4LERA 4U7JA 3T9OA 1VLSA 2NPSC 1YI2P 1SQVK 3AQCA 3MGNA 4PD4H 3LEVA 3M9BA 4OIQF 1OW8A 4XPXA 2WPSA 1HWTC 1EDJA 2O1JA 2XXAA 1MFZA 3GWNA 1DD3A 2AXTH 4DBQA 4CJGA 2XLVA 3ABKC 4W7ZA 2OARA 3IF4A 4BRYA 1PP9E 3WUUA 3UMHA 1FZEA 4JTDB 2XM0A 2HJ3A 2LD6A 2LK4A 1XTCC 2YL3A 1LI7A 4XEFA 5A6JA 1LT9C 4MVMA 2OCCC 3NTNA 1FU1A 1N86A 2E74C 3CPWO 1U0BB 2C0XA 2J7PA 4ZMDA 1N1CA 4N4WA 2P0NA 2WPRA 3B71A 5B66E 4DXWA 4F4BA 1JY3P 1BZ4A 3SFDC 4PJJA 3ZTZA 2B0JA 1PZQA 1JUNA 2HS5A 3TD7A 3K1IC 3L71G 1NU1K 1TU3F 1YZCA 1GW4A 1S7ZA 3EG9A 2A6EF 3QW0A 4GKGA 3NMKA 1NWQA 3CEXA 3GEIA 3L8JA 5L3QA 2QM8A 4KC9A 4IFMA 2XL8A 2AEMA 4BJTA 1KILB 2PGDA 3W4YA 1YTZI 1JCDA 2OTLP 3CXHE 1HTLC 5KTBA 3IAOA 1G2CB 1Q81Q 1MV8A 4LC1A 2NG1A 1SQPE 3A0BH 2EPNA 4U9DA 1EZVE 2XS1A 1RH5B 1Y4CA 3VTPC 4KBLA 2A68F 4CDYA 4EIJA 3DAFA 3FAPB 5KJ7A 4XTKA 1M2VA 3K33A 2J5UA 1V4AA 3I56P 1NTZJ 1ZYRF 3GANA 4IRUA 3V2PA 3G4SP 5A6AA 3E9VA 3KYIA 3H1HD 1LI5A 2XRHA 1LTBC 1KYOH 3B8EB 3H1JG 5AVTB 5AW3B 3AG3C 4MW8A 4AYCA 3SWKA 5B3SC 5JUAA 4D6TE 2R7WA 3HD7B 1LM3B 1L0NE 1JPNA 3AG2C 4PJ0E 1FZBA 2P1JA 4JYCA 1XWJA 4JJGA 3CAXA 1RE4C 3A2AA 1ZW3A 1IO4A 1GTWA 2Z4EA 2G3KA 1JAFA 4RD9A 1YTZT 2KW3C 2ZVOB 3KL4A 4OGQD 1Q0GA 2E75D 2E5YA 2YO2A 3PHLA 1BCCG 1PFIA 2B9BA 1FZCA 2A45H 1IZNB 1PGQA 1QLED 1NU1E 5AGFA 2WT7B 5KLIB 1LT9A 1QX8A 1RCPA 4MVZA 4WVZA 1C02A 3VM6A 3EJNA 1D1BA 2A45I 2BC5A 3Q6NA 4MTGA 1SFCB 2V26A 4G0HA 5DQTA 2Y0DA 4UDVA 1JMBA 4PV1D 4XPWA 2AWCA 1IFMA 4JCHA 1XZQA 3TGUJ 3TK0A 2GAQA 3ABMC 5D92A 3U1CA 3L70D 1X9VA 2H7HA 5AW1B 4XLPF 2RH0A 1VQMP 4FESA 4Z1MH 1VQLP 3II6A 1GK4A 2GWWA 1SQVG 2OEVA 3K66A 1WASA 4J7YA 1M56D 2I1JA 1NZEA 4JW1A 1NTKJ 3CZ6A 2FFDB 4CSAC 4ZKUA 2DYRC 4HH2A 1ZW0A 1QKRA 2W45A 1Q86Q 2KS1A 3AEBC 4KNWA 5DJTB 1R5SA 3PP5A 3VP9A 1OCRC 1OZHA 1JNMA 1KQGB 2C9LY 2E75C 4BPMA 2J9WA 4E7SA 4CIHA 2KYVA 4MVOA 4E18A 2FXPA 3H1KG 2J9VA 2KP8A 1NU1J 2VCAA 1QLEC 1OCOC 2PRRA 3V4QA 2E87A 4IB4A 3SXYA 2QNLA 1QGKB 3HJCA 3H1IG 3RKOF 1VQKP 3EFGA 4P9TA 2R3CA 2M5AB 2GA0A 1FFHA 2E75B 2KLUA 5KLVJ 2BCCD 5F5FA 2WSEJ 4EUKB 1LTIC 3H1LG 4XLNF 1XTGB 1ORYA 3G3ZA 2WSFH 1WTYA 1QL1A 4CS9C 4L75A 1LTJB 3AE9C 2Q4FA 2FAPB 2XLHA 5IY5C 1KZUB 4FX5A 4U9EA 1MNEA 5AW7B 1S5LH 4MQ9F 3ASNC 2BL2A 3PMRA 2PBEA 2V4HA 4C3EA 2PFXA 1GD2E 1ZHWA 3GEHA 2WVRA 1PP9G 1D0YA 3JRTA 2KSFA 4MTOA 1USDA 5AC5A 1LTSC 2N1TC 5B1BC 5KAFH 1RKEA 2OTKE 1OW6A 3QVZA 2YXRB 3BCCD 4I1MA 1VOMA 5CMZA 1FC2C 5L0HA 2YWAA 2P7VA 1EZVI 4DOJA 4MN4C 2CGEA 3TOMA 5E3CA 2R44A 3QW1A 3IR9A 2MJZA 4ASVA 1HMDA 3HKKA 2ZVNB 2M3BA 1NBBA 3NFQA 3KH2A 1CGME 3UNGC 1DIPA 1L0LJ 3F46A 2YL1A 3H1KD 2FYUE 2PX0A 4AL0A 3MZWB 1VQ9P 4P6IC 1SQVJ 2UUHA 1FOSE 3ECSA 2W83C 5APYA 4CIPA 1JTHA 1WOLA 5GTHH 4YXWH 1ZR4A 4H13C 4O6YA 5TISH 3O10A 2YKQA 2XXAB 2WZLA 3L72G 4Z9HA 2LXBA 2ZJSE 4E17A 3QWOC 4IFDK 2XNXA 3BCCJ 3RK3D 2IPPA 2VB6A 3FWLA 3KHUA 2YMKA 4N3YB 3SNHA 3LW5J 3I5QA 3RL0g 5L0IA 2AWYA 2YL0A 3BEHA 3FAJA 2Q6QA 3Q3DA 2R7UA 5E2QA 5DS5A 5B66H 3FXHA 3SFEC 3M15A 1VK5A 4YTPC 1LWUC 3L72D 4WBAA 1N7SC 5B1AC 3L71J 2D4UA 3CCLP 4MW3A 2BASA 3L4FA 3PRJA 2P2UA 4CS7A 1RJ9A 2MHRA 1SYQA 2DGJA 1N2DC 4H44B 5CBOA 5COMA 3W8IA 3RQFA 5T3TA 3JT1A 4OIOF 1A02J 5CJ0A 2PFDA 1ZZPA 1YYXA 4DRHB 1PPJE 1H8AA 3J06A 4AK9A 1NTZD 2KLVA 5F5HA 2CYDA 4EDFA 3AE6C 3ZTMA 3T6GB 3CSKA 2A6HF 1JRAA 3CWBE 2OTJP 1P84H 4KT0J 4WJ0A 1JR8A 2C0WA 2YLDA 1GL2C 3AEEC 2JJLA 2B89A 1MKMA 3JYHA 3MFNA 1SQBG 3C9IA 4H44C 3HD7C 3U0CA 1EKYA 2KIKA 4NTAA 4AQRD 1NTZG 1NFOA 4Q4ZF 1AVOA 2O01H 5T3WA 1EXIA 2OYIB 3H1LJ 1PP9D 1YARO 1H7IA 1KB9D 2R3SA 1HE1A 1YA9A 1IJDB 2E76C 4ANJA 1A02F 3WODF 1MMNA 1BSHA 2HLOA 4UB8E 3JZ0A 3L71E 5EFWB 1G1IA 1SQQD 3AG1C 3LS1A 3A5TA 4L73A 5COFA 1CGNA 3KQGA 2P58A 2K3RA 2I1KA 3VMXA 2YKZA 2HSQA 5H2FH 5KLVD 1C03A 4HFFB 1P84E 3GHGB 4FWVA 1SQXE 5KLVE 3PJSK 2VCBA 1S5LE 3CXHH 1ZR2A 1CPRA 2K37A 1J1DB 1M6TA 2IXOA 1M1JA 2QVAA 3H1ID 2QE7H 3CCUP 2YZSA 2Z15A 3KMIA 1A7VA 1JMWA 1URQA 4B86A 4O79A 3DI5A 4OIRF 4B6IA 5TJHA 3AEGC 2FYZA 1AFOA 2NPUA 1NLXA 4YT4A 4OWFA 1CZQA 2KYHA 1VL2A 3ZDLA 3S0XA 1SQPK 3LIEA 1Y6DA 3LLIA 3MX3A 3O6XA 2KUBA 1T3UA 4UB6E 2XKMA 2Z5HA 2NUPB 2V3CC 2OYHA 4CS8A 4IAOA 3IFMA 4HE8D 2J45A 2QEXP 1BGYG 3B5ND 2YVKA 2R7QA 5DJUB 4ULVA 3V6IA 1FBMA 1GW3A 5AVUB 1D0XA 2YNYA 4H0LC 3ASOC 2VRSA 1Q82Q 2EIJC 3HE4B 1S1CX 3WUVA 3NMJA 3VN0A 1OVRA 5T1DB 2IBZE 3GF7A 2BEZF 3DJUB 4D6TG 3CCEP 2CCYA 1OVUA 1KB9H 3RVZA 5APQA 3WAQA 4A2NB 3W8HA 1IZMA 2L9JA 3EFOB 1KYOI 3HTKA 1GL2B 2KS1B 1L0LE 3TNUB 1VQOP 2Q7RA 2ZYGA 1NGMB 3MUDC 4L74A 1PPJG 2ZT9D 5AVVB 3A3YB 1SQVE 1KV4A 3EHMA 2CNWD 2JO1A 3H1JJ 1J2JB 3M0DA 3WUTA 3T6JA 1YBKA 1PD0A 1OXBA 3FGAD 1T8ZA 3HTKC 3RQGA 2HR3A 5AVQB 3TYYA 2FYUK 4Q7CA 2CK3H 2HG5D 4XEVA 1SQBE 4YT5A 3HNLA 4D6TD 3MUDA 4P9FA 2A06E 1VQPP 3NYMA 5C39A 1L7CA 4OVNF 1Q0KA 3HNJA 3LAYA 4R32A 3H1HE 2E42A 2A1DD 2VASA 3JCUQ 4EKWA 5CI8A 3ZWIA 4PJ0H 1GM5A 3O6QB 1S3JA 1M57D 2YO3A 5AVXB 2BE5F 2KB7P 3VRCA 1G1JA 1OXKA 1D7MA 1NTMJ 1GL2D 2J7PD 4QI0A 2O01J 3NMIA 1NU1G 5FZTA 1OCZC 3I5CA 3W2VA 3CD6P 1K40A 1U7JA 4IL6E 2Q1KA 1UIXA 2WT7A 4YXDC 1S4XA 5B5EE 3IHUA 3UR3C 1NH4A 1EA8A 4EBJA 2ZXOA 1SFCA 2V7QJ 3NMDA 2D2CD 3GM2A 2M0BA 4JKVA 2O1KA 4U5CE 3LS0A 4YWQA 2X51A 2I8DA 4JBZA 3ATPA 1URQC 1DD4A 3RYLA 2LIGA 3GORA 4EBKA 1X0TA 1V74B 2E43A 4WABA 1E79H 2L5GB 2OOCA 4JURI 2R9RB 1KMIZ 1L0NJ 3KYJA 3TK1A 2FFDC 4DVZA 4C7OA 2OGUA 1RMVA 4I2LC 3H1IJ 3LW5H 4BJ5A 1CI6B 1N7LA 4C3DA 4PJNA 1BGYJ 2VH3A 1QVXA 2JWAA 4G7OF 2J59M 4C7NA 1GQAA 2FBWC 3Q1MA 5B5EH 4DZOA 2WSCH 3M91A 4OD4A 1KILC 4C7NB 4JZAA 2QM7A 2QRXA 4GQHA 1FMWA 1J1EC 2PX3A 5KYUA 2FXOA 4H54A 5L8RJ 2D2CC 4MVSA 1SQXG 3N4XA 1N8RQ 1K9MQ 1M2VB 3H1JD 4QDLA 3G71P 2E76B 4N78D 5CCGA 3TDKA 4NPFX 3D6ZA 2HFIA 3NDBB 1BGYD 2J9BA 3OEOA 3LLKA 1I4YA 2KNHA 1SFCD 1MFTA 1JOGA 3HNIA 3I55P 4U5DE 2UUIA 1JPJA 3RK3C 2N9BA 5M1BA 1K8AQ 1R5ID 1NU7D 1K05A 3CX5E 1FS0E 3N24A 4R4LA 4G7ZF 1AEPA 3DXJF 4DRIB 3K5BA 3AE3C 4M63A 3FWNA 3ZVRA 4PK4A 2A06G 1PD1A 2LXCB 5APWA 3LESA 2N1TB 3U2MA 3U59A 4JEBA 1OFCX 1KD1Q 3A7OA 3AGTA 3HTKB 4NPDA 3JRMO 1CSBA 5EHHA 2NSGA 2N1TA 3GEEA 4XE5B 2KSEA 3G4XA 1OQCA 2NUTA 3U8PA 3TGUE 2HODA 1WMKA 2W8ZA 1TKNA 2IOQA 2W9YA 2JWDA 1S72P 4JTCB 4CSAA 1F1MA 1SMYF 1JTHB 3SXZA 2R7XA 5JLIA 3KPEA 1TWAA 1OCCC 2Y3GA 5CIVA 4D4XA 4AL1A 1YA7O 3RQEA 1KB9E 1Q7YQ 3EGDA 2CPBA 5CCHC 2IM8A 3AE5C 2AU5A 2ZXRA 1SF8A 3BCCG 2YKPA 2EPLX 2FKWB 1T5OA 1KQFB 1NVOA 2HUJA 3D6YA 2WITA 2R25A 2WZGA 2XS8A 3DM9B 2KZJA 3H1HJ 1VF5C 3RH3A 4PV1C 1FFTC 2HV6A 1FZCC 3CXHD 1GS9A 3VAYA 1FE6A 3F89A 3JCUH 4PACA 3PLNA 5B3IA 2WSEH 3R7CA 1SQBJ 1GU4A 4G78A 3B9QA 3V2NA 3D71A 4MTFA 3C62A 2J8WA 5AVWB 3C8ZA 4NCQA 2Q5UA 3AG4C 1VQNP 3V5ZA 3L37A 5GPGB 4EOTA 3EGXB 4PFOA 5JSLA 1KFNA 2XZRA 3AEAC 3HNKA 3UGOA 1NOHA 1EZVG 3MTUE 2WZ7A 2Y3HA 5E79E 1U89A 3KKBA 4LLCA 3DZAA 5KLIC 2R32A 3EH2A 4C7OB 2LKMA 1VTMP 3E1IA 1L0LK 3U3FA 5K5GB 3QH9A 5BQHA 1AJYA 5APVA 3FVYA 1A41A 3SP1A 2W90A 3B5NB 1ZU5A 1H6GA 3QTHA 4GYTA 1LTTC 5A6KA 4Y28J 1VPCA 1GL2A 3RK2D 1RKCA 3HLZA 3O55A 4PJLA 4JVSA 1DEEG 3V2RA 1BGYE 3IN6A 4IFFA 3X1OA 2XLMA 4XEKA 2QJKB 3S1KA 1DEBA 2XV5A 3UMIA 1IK9A 3MBGA 2Q3EA 3S9OA 4AE4A 1YJGA 3SWYA 4RESB 3VMYA 5E79H 2OKUA 1KU2A 1MMAA 5D91A 1BDDA 1T9KA 1FR0A 1URQB 3TF5A 3HD7A 3AEFC 2H8AA 1DOVA 1FJPA 3MHVA 2CNWA 3ITFA 1VYIA 1ZN5A 1NYHA 4HKZH 3BCCE 2L6GA 1NO4A 1T6IA 1FJKA 2M8RA 1NAYA 2WVOA 1ZU4A 5APUA 4PD4D 4JIOA 2KQ9A 3VMZA 1BCCD 4XA4A 4NPEA 2YKOA 3EZHA 4J7TA 2GFHA 2QJPC 3TSIA 4GOFA 3CWBJ 5JVEA 2HYNA 5AC4A 1L0ND 2KK1A 5KYXB 3H1LD 2XLDA 4QMAA 1H9GA 2P6VA 1HY5A 1W2BO 5KLVK 1PGPA 4IL6H 1G5ZA 5AVRB 4JE9A 1YZAA 2EILC 2D2CB 3H1LE 5AW5B 4H13D 1BE3D 2KXPB 2F22A 5APSA 2NPSA 2LP4A 3EQ2A 3GM1A 3E7KA 3W2WA 1EI7A 1LJ2A 1RE3C 1CPQA 4AUWA 2H8PD 3NXSA 2ZXWC 5A69A 3U9JA 3GWLA 1IC2A 1K04A 1YIJP 3TQOA 1EZVD 2FFDA 5CI9A 5KYYA 5FCLA 3L75E 4U3FJ 2ZYDA 3B0PA 1UG7A 1QEXA 2P7JA 1Q2NA 2B87B 5L0CA 3B0VC 4NQFA 1ZOYC 3N7NA 2DB4A 1N73B 5BUOA 3USSA 3M4BA 1OVVA 1URQD 2WSCJ 3RBXA 4W7YA 4CX9A 1NTMG 3OAKA 3FDQA 1BR1A 4PD4I 1G8XA 1PP9J 1FZAA 1S5LX 1VQ4P 1SQXJ 1KFMA 3G4ZA 1RY3A 2K1AA 3EH1A 3PTZA 1HE9A 2WTYA 4U3FG 1SP4A 1MMDA 1MMGA 5CJ4A 1NTKG 4IWBA 4U5BE 3T97A 1YJNP 4LGDE 2VCCA 2P61A 1LTGC 1SS1A 2EPKX 3GHGC 3VYIA 3ZDMA 1G4WR 1OKKA 1DH3A 4MVRA 4HFKB 3VYWA 5JS5A 1JY2O 3V7OA 2JP3A 3MYFA 1IFJA 2IZ0A 5A6BD 4LLEA 1NAFA 2YXQB 3HUSB 1KORA 3EFOA 3O39A 2IBZI 1OR3A 4DJ9A 1KTMA 4BXLA 1QPUA 1JY3N 2A69F 2PP4A 2FYUD 2YEVA 3I4UA 1JOCA 3L1MA 3IQ6A 4BEMJ 4OGQB 1LVKA 1NTMK 3GG2A 1SFCC 3KZIE 1LKXA 5EGYA 3U5SA 4D4NA 1LNQA 2JR8A 2KSJA 4TLFA 3DJNB 1H0TA 5DS6A 3HUSC 4NTBA 2Y9ZA 4JTAB 2I8BA 1T01A 2EINC 2LCHA 2TMVP 5AW8B 1KB9I 2IYPA 1D1CA 4I3MA 3IQTA 1HGZA 5AW4B 2B0HA 2NZ2A 3ZQVA 3TGUG 4WWIA 1M1KQ 3BASA 2WWWA 3JYYA 4IJJA 2L7AA 5CCHA 2DI3A 2JEEA 5L3VA 3Q5SA 3RBZA 3O8ZA 1I5NA 3N0TA 1LS4A 3L36A 3H32B 3V5BA 5KKZC 2C04A 1GZLA 3QMKA 2IX7C 1VQ6P 4I7ZB 3VMAA 5BU8B 1FOSF 2QLAA 1SQXD 1RE4A 2K9YA 3DMDA 3X2QC 4FAPB 2FYNC 3CCSP 4N78E 3RVYA 2IBZD 4CDAA 1E84A 1QVFO 1JY3O 2Q9BA 2DW3A 3CX5H 1LTAC 3MLGA 2QJKC 2RMZA 2WVNA 2G3AA 1FDOA 2XNDH 3E1RA 4C46A 2YQYA 1NTME 4ONSA 4Y99C 4O9BA 3RL0D 1W2EA 1WATA 2H7BA 1J8MF 1HJBA 3UIAA 2A45G 1OW7A 5DQZA 2O9XA 4HB1A 1D1AA 4BJ6A 2OQQA 2XLEA 3CC2P 4I1LA 3VP8A 4A7PA 1GU5A 5KYUB 3CCVP 1RJ9B 1RF1C 4I44A 1PPJD 2M64A 2NUTB 2OYIA 3ZSUA 1IFIA 2ZT9B 2JX0A 1DOWA 3H1IE 4WY4D 5K0IA 1NTZK 5EK0A 1CGOA 4K1OA 1J8YF 4MVUA 3BATA 4ZLCA 2IYOA 2ZD9A 5HSWA 1NTKK 4DRJB 2L6HA 3A0HE 3ABVC 1OXZA 2W27A 3A0BE 3L72E 1NU1D 1T3JA 5BU5A 1HVVA 1BCCE 4IARA 1PGOA 2FFHA 1ZRTD 2PF4E 1E85A 3L73E 1ZXGA 1SQQE 3AEDC 4OD5A 2Y69C 1L2PA 2XLOA 2ICWG 3QZCA 3C18A 1H9TA 3C8VA 2OYHB 2YIUC 3RK2C 3T97B 1EXJA 1FZFA 4L6RA 1Z63A 4BJ6C 3TULA 3RW0A 3L75G 4IGGA 4MS2A 2ZAEB 3C8GB 3R2PA 1VF5B 2ASRA 1IFDA 2IYLD 2QSIA 3Q5RA 1HW2A 3AQBA 1RF1A 1VB5A 5L0DA 2RD9A 5KKZB 3F47A 2KC3A 2C03A 1N73C 1JB0J 1IFNA 2ZXPA 1A0BA 2KI7B 3CCMP 3R4YA 2Q9CA 1N7SB 2G3VA 1YQ4C 2DYSC 1AVYA 1L0NK 2QG4A 3H1JE 3L74G 1H89A 2NSFA 4X0RA 4Z9IA 1M56C 1YJWP 2L6FA 1JY2N 4N6JA 1ORSC 1ZHZA 3TNUA 2IXMA 3E70C 3NRHA 4O6NA 5JP7A 4OIPF 1W5CE 1RKEB 3B0UX 2R7OA 3EGXA 1KC8Q 1ZP0C 3I5PA 1VQ8P 3Q5PA 1OKKD 3DWWA 3L74D 3HE5B 1KILE 3C8GD 3U9MA 2QY9A 4RJTA 1MNDA 4JRZA 4CBEA 3S90A 3FXEA 3RK3E 1WT6A 2QA4P 1JMMA 1SQQK 4GODA 4YN0B 3H1KJ 3JSEO 4AX2A 4KI2A 1LIHA 2L91A 1T6QA 4H13B 4L76A 1E83A 3H32A 4PJMA 1WN0A 1OX3A 1L4AA 4I6MC 1M2OA 2HV7A 3O6QA 2IDBA 4KHXA 1EQ7A 2MKVA 3OJAB 1VQ5P 2MWQA 3MD0A 3NYLA 3ITKA 2Y0CA 2HPCB 1C17M 5BVZA 1DX7A 3Q7GA 4LDRA 2LSEA 3H1HG 4BG0A 1T6UA 3DD7A 3CI9A 1J1EB 2OU6A 3L35A 4WY4A 2YIUB 1M8OB 2OYHC 2ETSA 4NTFA 1MZ9A 3L75J 4U3FE 1SZIA 2ZT9C 2R7SA 4XPYA 1GGQA 2E5TA 2QJYB 2RN0A 3A9CA 4EHPA 3Q7LA 3HUSA 1V55C 5CBNA 1ZW2A 1HW1A 3S29A 5CCGC 1SQQG 2Y3DA 4WY4C 1LP1A 3L70E 4YK5A 2R5BA 2XLWA 1QL2A 3TGUD 2H88C 3OA1A 1HH0A 5GTIH 1LGHB 2MYSA 2OG2A 4H0LB 4E7ZA 4TT3H 4YPCA 2OYOA 4BWNA 1EDLA 1BE3J 1JY2P 3L71D 1SQBD 2O3JA 3ZIBA 1JEKA 1LWUB 3V2QA 1Z23A 1BDJB 5KYYB 1IW7F 4RBNA 3H65A 3PCVA 3RL0B 1NSGB 1BSNA 4ASWA 1L0NG 2LQGA 4PD4E 2E74D 1S2EA 1X8YA 2QJPB 1TWCA 4IAQA 1HF9A 3RFYA 2GDCA 1N73A 4KNVA 1XZPA 3L74J 5KYWA 1U57A 3CWBD 3CMAP 1P84I 2R5DA 3CC4P 2KK7A 1PCXA 1BCCJ 1M7LA 1X79B 2GA1A 4XWJA 1FMVA 2XU6A 3GF3A 5KAFE 5CCGD 1FNTc 3AE4C 2IFMA 1E86A 3AE7C 1W2WA 256BA 2AVKA 1PL5A 4XFJA 2QIWA 1A7DA 3ABLC 3FHDA 1WWPA 4H4KC 4C3BA 3S84A 2HSBA 2XL4A 2BEQD 3CC7P 3NKDA 2GM4A 3CMEP 1O3UA 4BRYB 4W8KA 2EPOA 3M0DC 1R8EA 2H7VC 4IL6X 1I4ZA 2E74B 2W6BA 3CXHI 4RKUJ 3K1HA 2WL8A 1NU9C 2FGYA 4H44D 1NTMD 3EHNA 2FYUJ 3L75D 2Q9IA 2GUSA 3L34A 4ER9A 1ZV8A 3U1AA 2CW0F 2P1AA 3N2ZB 4O7GA 3HRNA 2FYNB 3A11A 3L73D 4C7RA 4BEJA 1LPEA 3DKAA 3CCQP 4U5HA 3EZIA 3RK2B 3H1KE 1Y8AA 2EIMC 4CJOA 3MP7B 2KNCA 1P84D 5CHXA 1YDIA 1VDFA 2A0UA 3CQZA 5DS4A 1E2XA 2C9NY 4DVYP 2D5RB 3S27A 4W8PA 1KQSO 2V7QH 2KNCB 3IPMO 5HV9A 1TWGA 3GODA 5L0JA 1U6HA 2G62A 5BQGA 2J0WA 1NKNA 3H2UA 1FDMA 1GMJA 4W80A 1YHQP 1MUUA 1NTKD 1SQXK 1ZLLA 3V4WA 1JO5A 3FMSA 3SYNA 2XL6A 2HMZA 3G50A 2RKLA 3EGDB 4U3FD 1KILA 3GLMA 2JKVA 2OYIC 2HZ8A 2AP3A 2KGOA 4N6HA 5AVYB 1U7MA 2BCCG 3C63A 1L4AD 4OGQC 3H2VA 3AECC 1LE2A 2UWJE 3RF3A 4WY4B 5H2FE 4ULWA 2FY8A 2H89C 1HGVA 3LUTB 1PV3A 4ZNCA 2K88A 4O6MA 2X0CA 3NG1A 4N06A 4DCKA 1QZXA 3C1LA 2R02A 3GW6A 1J1DC 2AXCA 2WMMA 3EFFK 3IQCA 3P7KA 1IFPA 4EI2A 2HPCA 3M06A 4WGYA 4CS8C 2IBZG 2KOGA 3T4RA 3ZC4A 4JYBA 5KAIH 1K73Q 2Q7CA 2IBFA 2GUVA 1RHZB 3B5NA 2P10A 1VMAA 4NC3A 5DVWA 1OMIA 2ZYAA 4CPGA 5CCHD 2K9JB 3S28A 4J30B 1SQVD 4GIFA 4DOZA 3H6PA 1LT1A 4I7ZC 1BDCA 1Z3IX 1TQGA 3L70G 1H88A 2LR2A 1LT9B 1KILD 2QE9A 1L0LD 1TFOB 1L4AC 3AE2C 2K9JA 3M9QA 1Z5ZA 4Q5SF 1TWHA 4DBRA 5KJ7D 1T2KC 4EBBA 3L73J 1FZCB 2WVQA 1UFBA 3L0IA 1NJIQ 1H0TB 2BCCE 1NG1A 3RIPA 3SXKA 1EC5A 4WGZA 2H43A 2Q9AA 1HMOA 3CCRP 1OR2A 4ZLDA 5E3AA 2J9UA 1FDIA 2Q3TA 3P8MC 2LFFA 5GTHE 3BRVB 4K3AA 1CI6A 4YT2A 1AV1A 4RO0A 1GK6A 1RE3A 4GDOA 4PFPA 1L4AB 2HMQA 4GOEA 4K35A 5F28E 4G7HF 2P67A 4E0IA 3AE1C 3A0HH 2LFDA 2NPSD 3JC22 2HJMA 3JTLO 1NKZB 4YL1A 2FYUG 2QTVA 3KYQA 1Q0MA 1ZHYA 1FAVA 1YVIA 1AVOB 5TISE 3KZIH 3M9HA 2YRFA 5COGA 3CWBG 3BRTB 2HKVA 4K0DA 5AVZB 1NTKE 1Q90D 4E0HA 4JJFA 2W6AA 3AJMA 3WU2E 2R03A 2YHSA 3NYJA 2R7VA 1USEA 2Y9YA 3KPHA 4I1OB 1G4US 2M4EA 1RXQA 2VC9A 2WZFA 5KYWB 2BCCJ 3US6A 4HYTB 1R5LA 4JCZA 1BR4A 3DM5A 1N7SA 2WSSH 1VLTA 3SWFA 1YYCA 1AQ5A 5APTA 1HBWA 1BR2A 3TJ6A 2Y3BA 4JPZB 1B68A 5AW6B 4QI2A 4CDVA 1QVGO 1O5HA 3U2LA 3L72J 1ORJA 2M3EA 3W68A 3WG7C 3W67A 2R7TA 3V5YA 3H25A 3V5XA 2YMYA 2B87A 1S05A 3D70A 3G6EP 2ZFCA 2H7OA 3AE8C 4CS9A 1SQPD 2PAJA 3MIWA 5AW9B 3U3BA 1LTJA 3CL3D 5KAIE 3OWTA 3M4CA 1AA0A 5KYXA 5KLVG 1EDIA 2W4MA 1KNYA 2HODB 2J46A 3CX5D 1SQPG 3C8GA 5L0GA 3K1IA 1R4TA 3SEOA 4IOIH 1TR2A 2B88A 2NPSB 1RF1B 4LDKA 1TFKB 3RGUA 2J58A 1NTZE 4NY3A 5JRAA 2OQMA 1ZMEC 1YITP 1EDKA 5AW2B 3EG9B 3TOLA 1Q0DA 1OIPA 1BE3E 3U8VA 3GM3A 4JEAA 5TJ5E 2IXPA 4U5GA 3RL0C 1SVFA 1PGJA 3Q2YA 2PP6A 1E5WA 4JF7A 2XSEA 1BBHA 1KQLA 4D6TJ 4Z9JA 1SQQJ 2KZIA 2CPSA 3LIDA 2WB7A 3HD7D 1KYOD 1M57C 2I15A 2Q3IA 1Q0FA 1NHLA 5A6BA 2WSFJ 3IQ5A 1WRGA 5APXA 3SXMA 1LTJC 3G9RA 4YL0A 2E76D 3ZQYA 3S4RA 3KXDA 1GDTA 3NKEA 2JD3A 4MNDA 2IZ1A 1RF0C 3DE9A 1YYJA 4MVQA 3FOPA 5BQIA 3LNMB 1RQUA 4YL3A 3TJ5A 4OH8B 4JC7A 1UIIA 1SQBK 1YJ9P 1OWAA 1ZHXA 4LACB 2WPVB 1ZVZA 1Z56A 3EQLF 1QQ3A 3POVA 1M90Q 2J0XA 4OINF 1L0LG 4J32B 2RSEB 2HFED 3L8IA 4UB6H 3M1CB 2M5AA 4PV1B 2A06D 2AXTE 1Z6AA 3AGUA 5L0FA 3RK3B 2WPQA 4LDQA 2O01N 3B4SA 2OEXA 2ITAA 5AVSB 2AEJA 1ST6A 1APCA 4M3LA 3ZG1A 3BRJA 1IK7A 3FX0A 1LWUA 2W4BA 3JSZA 2G8YA 2R05A 3OW2O 3SZRA 1AQTA 2XM4A 2A0BA 3P32A 2IXNA 2PNOA 1SQPJ 3SSUA 1G2CA 1HUCA 1Y47A 1VYKA 3AOUA 2CDQA 2Z5IA 1FTSA 3F5HA 4YJWA 4XQ1A 5DLJA 3PDMP 2YLGA 4H0LD 4EYYQ 3LEOA 3UMKA 4Y99B 1KYOE 3WU2H 1LS1A 4UB8H 2W6JH 3B5NC 3B29A 2N9YB 1LP1B 1YAUO 3FXDA 2Q00A 2JDIH 4JQ0D 1FZGA 1Z7Qc 2AEFA 1RF0A 3PH0A 1NFNA 4U5EE 2QUPA 2Y0EA 2POHA 2R7RA 5GTIE 3LJBA 1BE3G 4AE4B 5AW0B 3GHGA
chains in the Genus database with same CATH topology
3RQEA 1GMJA 1QVXA 1NYHA 2L6GA 2WSFJ 4KT0J 4OGQD 3AE5C 2E74D 2PBEA 1ZP0C 2E75D 2FBWC 3AEEC 3G9RA 2E76D 3Q5PA 2JP3A 1MKMA 1OW7A 1HF9A 3MFNA 4H44C 2LK4A 1KILE 2OQQA 3GLMA 1KQFB 3Q1MA 3C8GD 1U57A 4XEFA 3U0CA 1KORA 1NGMB 1EXIA 3D6YA 1Q90D 1HJ0A 2ZT9D 3AJMA 1OW6A 4OGQC 1RQUA 3AECC 3RK3E 2E74C 1VF5C 1KTMA 2QJPC 4PV1C 2E76C 2JPUA 2YWAA 2JO1A 5L8RJ 2KK1A 2D2CC 2H89C 2ZT9B 2JX0A 3FGAD 3JZ0A 3GF3A 3B71A 4R4MA 1PV3A 2QJYC 3AE4C 2WPVB 3RQGA 4H13B 3SFDC 4OGQB 3AE7C 4XEVA 4PV1D 2E76B 1YQ3C 1PL5A 4XFJA 2QIWA 1DIPA 2D2CB 3D6ZA 3D71A 3O6QA 4H13D 3L8IA 2IDBA 1TU3F 2MKVA 1WWPA 3GMAA 4PV1B 1RQVA 2L6HA 3GM1A 4Z1MH 3ABVC 2HSBA 2BEQD 3L8JA 4R32A 2WQYC 1JOGA 3AEAC 1O3UA 1WOLA 4H13C 3H25A 3O10A 5M1BA 1R8EA 1K05A 3K7DA 1PIXA 1K04A 1Y9BA 3D70A 4IL6X 3AEDC 2P10A 2E74B 2NZ2A 3AE8C 1IK7A 3AEBC 4RKUJ 3AEGC 3BRJA 3C18A 1OMIA 4R4LA 3JYYA 5KLIC 2G8YA 3C8VA 2YIUC 3IAOA 1VL2A 1KQGB 3T97B 2O01J 2E75C 1EXJA 3AE3C 3U3FA 1AJYA 4H44D 4I7ZC 2YMKA 3TULA 3LW5J 1K40A 4NQFA 1UIXA 2FXPA 1ZOYC 4YXDC 3RL0g 3Q5SA 3C8GB 4Y28J 1VF5B 2ZT9C 1KNYA 2QSIA 1VF5D 3AE2C 3Q3DA 3Q5RA 5KKZC 4EBJA 2WSCJ 2J5UA 3SFEC 1V4AA 4H0LD 2V7QJ 4YTPC 3C8GA 2D2CD 4I7ZB 3GM2A 1UFBA 3IN6A 1ZRTE 2K9YA 4XEKA 1WMKA 1JB0J 3EWKA 1ZMEC 2FYNC 2H88C 2E75B 1DD4A 1FDIA 1S5LX 3S9OA 4H0LC 3R4YA 4EBKA 4H44B 2WSEJ 2Q00A 1S1CX 4H0LB 4U7JA 4TT3H 3GM3A 3RQFA 1YQ4C 1KMIZ 4GDOA 2QJKC 3GF7A 2BEZF 3Q2YA 1OW8A 1WTYA 1ZZPA 2G3AA 3AE9C 1FDOA 5F28E 2L6FA 1DD3A 3AEFC 3AE1C 3AE6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQE A;  1QVX A;  2L6G A;  3AE5 C;  2PBE A;  1ZP0 C;  2FBW C;  3AEE C;  1OW7 A;  3MFN A;  2LK4 A;  3U0C A;  3C8G D;  4XEF A;  3AJM A;  1OW6 A;  3AEC C;  1KTM A;  2JPU A;  2YWA A;  2KK1 A;  2H89 C;  2JX0 A;  3JZ0 A;  3B71 A;  1PV3 A;  3AE4 C;  3RQG A;  3SFD C;  3AE7 C;  4XEV A;  1YQ3 C;  3L8I A;  1WWP A;  2L6H A;  3GM1 A;  3ABV C;  2HSB A;  4R32 A;  3L8J A;  2WQY C;  1JOG A;  3AEA C;  1O3U A;  1WOL A;  3O10 A;  1K05 A;  3K7D A;  1K04 A;  3AED C;  3AE8 C;  3BRJ A;  3AEB C;  3AEG C;  3C18 A;  3JYY A;  3AE3 C;  3U3F A;  3TUL A;  1K40 A;  4NQF A;  1ZOY C;  4YXD C;  3C8G B;  1KNY A;  3AE2 C;  4EBJ A;  3SFE C;  1V4A A;  4YTP C;  3C8G A;  3GM2 A;  1UFB A;  4XEK A;  2H88 C;  3S9O A;  4EBK A;  2Q00 A;  3GM3 A;  3RQF A;  1YQ4 C;  1OW8 A;  1WTY A;  1ZZP A;  2G3A A;  3AE9 C;  5F28 E;  2L6F A;  3AEF C;  3AE1 C;  3AE6 C; 
#chains in the Genus database with same CATH topology
 3M0A A;  4EWC A;  2N1T D;  3DAG A;  3UGP A;  1JM0 A;  1D0Z A;  4A4A A;  4LLH A;  2OJE D;  5E33 A;  4RDA A;  3VF0 A;  1SLQ A;  4K7B A;  4YT8 A;  3L74 E;  4WB4 A;  3CLQ A;  3JCU E;  3FOO A;  1HJ0 A;  2IFN A;  2EIK C;  4DJG A;  2JPU A;  2KJG A;  3L70 J;  4ZKP A;  1MQV A;  4R4M A;  2QJY C;  2SPZ A;  3HE4 A;  2Y39 A;  4HJG H;  4DT0 A;  1YQ3 C;  3KDP B;  3M79 A;  1KN7 A;  4BJ5 C;  4U5F E;  4EIY A;  1M1J B;  3GMA A;  2XDJ A;  1X22 A;  1RQV A;  1JCC A;  2ZPA A;  1SR2 A;  1YLM A;  3BVH A;  3CCJ P;  1WGW A;  2WQY C;  2OJQ A;  4GEH A;  3C7J A;  3WHN A;  3EPV A;  3VOP A;  1LE4 A;  3K7D A;  1PIX A;  1Y9B A;  3P8C D;  4GT1 A;  1S9K E;  3HE5 A;  3LNR A;  3OA7 A;  3L73 G;  3MYI A;  1A7E A;  5KJ7 C;  1AUE A;  1T2K D;  3Q6M A;  2NUP A;  1VQ7 P;  3QVY A;  2EPM X;  1L3P A;  1O87 A;  3JSV C;  2FXM A;  1M1J C;  2ZXX A;  3K6B A;  4BJ1 A;  1EQ1 A;  2NRG A;  4HEA J;  1VF5 D;  3WMM 0;  1FAP B;  3P8C E;  1S9K D;  2L81 A;  3T6B A;  1ZHT A;  2YL7 A;  4N6C A;  1ZRT E;  3IEE A;  5KYN A;  2YLI A;  3CX5 I;  1V54 C;  4KJM A;  3EWK A;  1T6A A;  1QSP A;  1CW5 A;  3PHF 2;  5JT4 A;  3DE8 A;  4PR9 A;  1N7S D;  2ZXE B;  4LER A;  4U7J A;  3T9O A;  1VLS A;  2NPS C;  1YI2 P;  1SQV K;  3AQC A;  3MGN A;  4PD4 H;  3LEV A;  3M9B A;  4OIQ F;  1OW8 A;  4XPX A;  2WPS A;  1HWT C;  1EDJ A;  2O1J A;  2XXA A;  1MFZ A;  3GWN A;  1DD3 A;  2AXT H;  4DBQ A;  4CJG A;  2XLV A;  3ABK C;  4W7Z A;  2OAR A;  3IF4 A;  4BRY A;  1PP9 E;  3WUU A;  3UMH A;  1FZE A;  4JTD B;  2XM0 A;  2HJ3 A;  2LD6 A;  2LK4 A;  1XTC C;  2YL3 A;  1LI7 A;  4XEF A;  5A6J A;  1LT9 C;  4MVM A;  2OCC C;  3NTN A;  1FU1 A;  1N86 A;  2E74 C;  3CPW O;  1U0B B;  2C0X A;  2J7P A;  4ZMD A;  1N1C A;  4N4W A;  2P0N A;  2WPR A;  3B71 A;  5B66 E;  4DXW A;  4F4B A;  1JY3 P;  1BZ4 A;  3SFD C;  4PJJ A;  3ZTZ A;  2B0J A;  1PZQ A;  1JUN A;  2HS5 A;  3TD7 A;  3K1I C;  3L71 G;  1NU1 K;  1TU3 F;  1YZC A;  1GW4 A;  1S7Z A;  3EG9 A;  2A6E F;  3QW0 A;  4GKG A;  3NMK A;  1NWQ A;  3CEX A;  3GEI A;  3L8J A;  5L3Q A;  2QM8 A;  4KC9 A;  4IFM A;  2XL8 A;  2AEM A;  4BJT A;  1KIL B;  2PGD A;  3W4Y A;  1YTZ I;  1JCD A;  2OTL P;  3CXH E;  1HTL C;  5KTB A;  3IAO A;  1G2C B;  1Q81 Q;  1MV8 A;  4LC1 A;  2NG1 A;  1SQP E;  3A0B H;  2EPN A;  4U9D A;  1EZV E;  2XS1 A;  1RH5 B;  1Y4C A;  3VTP C;  4KBL A;  2A68 F;  4CDY A;  4EIJ A;  3DAF A;  3FAP B;  5KJ7 A;  4XTK A;  1M2V A;  3K33 A;  2J5U A;  1V4A A;  3I56 P;  1NTZ J;  1ZYR F;  3GAN A;  4IRU A;  3V2P A;  3G4S P;  5A6A A;  3E9V A;  3KYI A;  3H1H D;  1LI5 A;  2XRH A;  1LTB C;  1KYO H;  3B8E B;  3H1J G;  5AVT B;  5AW3 B;  3AG3 C;  4MW8 A;  4AYC A;  3SWK A;  5B3S C;  5JUA A;  4D6T E;  2R7W A;  3HD7 B;  1LM3 B;  1L0N E;  1JPN A;  3AG2 C;  4PJ0 E;  1FZB A;  2P1J A;  4JYC A;  1XWJ A;  4JJG A;  3CAX A;  1RE4 C;  3A2A A;  1ZW3 A;  1IO4 A;  1GTW A;  2Z4E A;  2G3K A;  1JAF A;  4RD9 A;  1YTZ T;  2KW3 C;  2ZVO B;  3KL4 A;  4OGQ D;  1Q0G A;  2E75 D;  2E5Y A;  2YO2 A;  3PHL A;  1BCC G;  1PFI A;  2B9B A;  1FZC A;  2A45 H;  1IZN B;  1PGQ A;  1QLE D;  1NU1 E;  5AGF A;  2WT7 B;  5KLI B;  1LT9 A;  1QX8 A;  1RCP A;  4MVZ A;  4WVZ A;  1C02 A;  3VM6 A;  3EJN A;  1D1B A;  2A45 I;  2BC5 A;  3Q6N A;  4MTG A;  1SFC B;  2V26 A;  4G0H A;  5DQT A;  2Y0D A;  4UDV A;  1JMB A;  4PV1 D;  4XPW A;  2AWC A;  1IFM A;  4JCH A;  1XZQ A;  3TGU J;  3TK0 A;  2GAQ A;  3ABM C;  5D92 A;  3U1C A;  3L70 D;  1X9V A;  2H7H A;  5AW1 B;  4XLP F;  2RH0 A;  1VQM P;  4FES A;  4Z1M H;  1VQL P;  3II6 A;  1GK4 A;  2GWW A;  1SQV G;  2OEV A;  3K66 A;  1WAS A;  4J7Y A;  1M56 D;  2I1J A;  1NZE A;  4JW1 A;  1NTK J;  3CZ6 A;  2FFD B;  4CSA C;  4ZKU A;  2DYR C;  4HH2 A;  1ZW0 A;  1QKR A;  2W45 A;  1Q86 Q;  2KS1 A;  3AEB C;  4KNW A;  5DJT B;  1R5S A;  3PP5 A;  3VP9 A;  1OCR C;  1OZH A;  1JNM A;  1KQG B;  2C9L Y;  2E75 C;  4BPM A;  2J9W A;  4E7S A;  4CIH A;  2KYV A;  4MVO A;  4E18 A;  2FXP A;  3H1K G;  2J9V A;  2KP8 A;  1NU1 J;  2VCA A;  1QLE C;  1OCO C;  2PRR A;  3V4Q A;  2E87 A;  4IB4 A;  3SXY A;  2QNL A;  1QGK B;  3HJC A;  3H1I G;  3RKO F;  1VQK P;  3EFG A;  4P9T A;  2R3C A;  2M5A B;  2GA0 A;  1FFH A;  2E75 B;  2KLU A;  5KLV J;  2BCC D;  5F5F A;  2WSE J;  4EUK B;  1LTI C;  3H1L G;  4XLN F;  1XTG B;  1ORY A;  3G3Z A;  2WSF H;  1WTY A;  1QL1 A;  4CS9 C;  4L75 A;  1LTJ B;  3AE9 C;  2Q4F A;  2FAP B;  2XLH A;  5IY5 C;  1KZU B;  4FX5 A;  4U9E A;  1MNE A;  5AW7 B;  1S5L H;  4MQ9 F;  3ASN C;  2BL2 A;  3PMR A;  2PBE A;  2V4H A;  4C3E A;  2PFX A;  1GD2 E;  1ZHW A;  3GEH A;  2WVR A;  1PP9 G;  1D0Y A;  3JRT A;  2KSF A;  4MTO A;  1USD A;  5AC5 A;  1LTS C;  2N1T C;  5B1B C;  5KAF H;  1RKE A;  2OTK E;  1OW6 A;  3QVZ A;  2YXR B;  3BCC D;  4I1M A;  1VOM A;  5CMZ A;  1FC2 C;  5L0H A;  2YWA A;  2P7V A;  1EZV I;  4DOJ A;  4MN4 C;  2CGE A;  3TOM A;  5E3C A;  2R44 A;  3QW1 A;  3IR9 A;  2MJZ A;  4ASV A;  1HMD A;  3HKK A;  2ZVN B;  2M3B A;  1NBB A;  3NFQ A;  3KH2 A;  1CGM E;  3UNG C;  1DIP A;  1L0L J;  3F46 A;  2YL1 A;  3H1K D;  2FYU E;  2PX0 A;  4AL0 A;  3MZW B;  1VQ9 P;  4P6I C;  1SQV J;  2UUH A;  1FOS E;  3ECS A;  2W83 C;  5APY A;  4CIP A;  1JTH A;  1WOL A;  5GTH H;  4YXW H;  1ZR4 A;  4H13 C;  4O6Y A;  5TIS H;  3O10 A;  2YKQ A;  2XXA B;  2WZL A;  3L72 G;  4Z9H A;  2LXB A;  2ZJS E;  4E17 A;  3QWO C;  4IFD K;  2XNX A;  3BCC J;  3RK3 D;  2IPP A;  2VB6 A;  3FWL A;  3KHU A;  2YMK A;  4N3Y B;  3SNH A;  3LW5 J;  3I5Q A;  3RL0 g;  5L0I A;  2AWY A;  2YL0 A;  3BEH A;  3FAJ A;  2Q6Q A;  3Q3D A;  2R7U A;  5E2Q A;  5DS5 A;  5B66 H;  3FXH A;  3SFE C;  3M15 A;  1VK5 A;  4YTP C;  1LWU C;  3L72 D;  4WBA A;  1N7S C;  5B1A C;  3L71 J;  2D4U A;  3CCL P;  4MW3 A;  2BAS A;  3L4F A;  3PRJ A;  2P2U A;  4CS7 A;  1RJ9 A;  2MHR A;  1SYQ A;  2DGJ A;  1N2D C;  4H44 B;  5CBO A;  5COM A;  3W8I A;  3RQF A;  5T3T A;  3JT1 A;  4OIO F;  1A02 J;  5CJ0 A;  2PFD A;  1ZZP A;  1YYX A;  4DRH B;  1PPJ E;  1H8A A;  3J06 A;  4AK9 A;  1NTZ D;  2KLV A;  5F5H A;  2CYD A;  4EDF A;  3AE6 C;  3ZTM A;  3T6G B;  3CSK A;  2A6H F;  1JRA A;  3CWB E;  2OTJ P;  1P84 H;  4KT0 J;  4WJ0 A;  1JR8 A;  2C0W A;  2YLD A;  1GL2 C;  3AEE C;  2JJL A;  2B89 A;  1MKM A;  3JYH A;  3MFN A;  1SQB G;  3C9I A;  4H44 C;  3HD7 C;  3U0C A;  1EKY A;  2KIK A;  4NTA A;  4AQR D;  1NTZ G;  1NFO A;  4Q4Z F;  1AVO A;  2O01 H;  5T3W A;  1EXI A;  2OYI B;  3H1L J;  1PP9 D;  1YAR O;  1H7I A;  1KB9 D;  2R3S A;  1HE1 A;  1YA9 A;  1IJD B;  2E76 C;  4ANJ A;  1A02 F;  3WOD F;  1MMN A;  1BSH A;  2HLO A;  4UB8 E;  3JZ0 A;  3L71 E;  5EFW B;  1G1I A;  1SQQ D;  3AG1 C;  3LS1 A;  3A5T A;  4L73 A;  5COF A;  1CGN A;  3KQG A;  2P58 A;  2K3R A;  2I1K A;  3VMX A;  2YKZ A;  2HSQ A;  5H2F H;  5KLV D;  1C03 A;  4HFF B;  1P84 E;  3GHG B;  4FWV A;  1SQX E;  5KLV E;  3PJS K;  2VCB A;  1S5L E;  3CXH H;  1ZR2 A;  1CPR A;  2K37 A;  1J1D B;  1M6T A;  2IXO A;  1M1J A;  2QVA A;  3H1I D;  2QE7 H;  3CCU P;  2YZS A;  2Z15 A;  3KMI A;  1A7V A;  1JMW A;  1URQ A;  4B86 A;  4O79 A;  3DI5 A;  4OIR F;  4B6I A;  5TJH A;  3AEG C;  2FYZ A;  1AFO A;  2NPU A;  1NLX A;  4YT4 A;  4OWF A;  1CZQ A;  2KYH A;  1VL2 A;  3ZDL A;  3S0X A;  1SQP K;  3LIE A;  1Y6D A;  3LLI A;  3MX3 A;  3O6X A;  2KUB A;  1T3U A;  4UB6 E;  2XKM A;  2Z5H A;  2NUP B;  2V3C C;  2OYH A;  4CS8 A;  4IAO A;  3IFM A;  4HE8 D;  2J45 A;  2QEX P;  1BGY G;  3B5N D;  2YVK A;  2R7Q A;  5DJU B;  4ULV A;  3V6I A;  1FBM A;  1GW3 A;  5AVU B;  1D0X A;  2YNY A;  4H0L C;  3ASO C;  2VRS A;  1Q82 Q;  2EIJ C;  3HE4 B;  1S1C X;  3WUV A;  3NMJ A;  3VN0 A;  1OVR A;  5T1D B;  2IBZ E;  3GF7 A;  2BEZ F;  3DJU B;  4D6T G;  3CCE P;  2CCY A;  1OVU A;  1KB9 H;  3RVZ A;  5APQ A;  3WAQ A;  4A2N B;  3W8H A;  1IZM A;  2L9J A;  3EFO B;  1KYO I;  3HTK A;  1GL2 B;  2KS1 B;  1L0L E;  3TNU B;  1VQO P;  2Q7R A;  2ZYG A;  1NGM B;  3MUD C;  4L74 A;  1PPJ G;  2ZT9 D;  5AVV B;  3A3Y B;  1SQV E;  1KV4 A;  3EHM A;  2CNW D;  2JO1 A;  3H1J J;  1J2J B;  3M0D A;  3WUT A;  3T6J A;  1YBK A;  1PD0 A;  1OXB A;  3FGA D;  1T8Z A;  3HTK C;  3RQG A;  2HR3 A;  5AVQ B;  3TYY A;  2FYU K;  4Q7C A;  2CK3 H;  2HG5 D;  4XEV A;  1SQB E;  4YT5 A;  3HNL A;  4D6T D;  3MUD A;  4P9F A;  2A06 E;  1VQP P;  3NYM A;  5C39 A;  1L7C A;  4OVN F;  1Q0K A;  3HNJ A;  3LAY A;  4R32 A;  3H1H E;  2E42 A;  2A1D D;  2VAS A;  3JCU Q;  4EKW A;  5CI8 A;  3ZWI A;  4PJ0 H;  1GM5 A;  3O6Q B;  1S3J A;  1M57 D;  2YO3 A;  5AVX B;  2BE5 F;  2KB7 P;  3VRC A;  1G1J A;  1OXK A;  1D7M A;  1NTM J;  1GL2 D;  2J7P D;  4QI0 A;  2O01 J;  3NMI A;  1NU1 G;  5FZT A;  1OCZ C;  3I5C A;  3W2V A;  3CD6 P;  1K40 A;  1U7J A;  4IL6 E;  2Q1K A;  1UIX A;  2WT7 A;  4YXD C;  1S4X A;  5B5E E;  3IHU A;  3UR3 C;  1NH4 A;  1EA8 A;  4EBJ A;  2ZXO A;  1SFC A;  2V7Q J;  3NMD A;  2D2C D;  3GM2 A;  2M0B A;  4JKV A;  2O1K A;  4U5C E;  3LS0 A;  4YWQ A;  2X51 A;  2I8D A;  4JBZ A;  3ATP A;  1URQ C;  1DD4 A;  3RYL A;  2LIG A;  3GOR A;  4EBK A;  1X0T A;  1V74 B;  2E43 A;  4WAB A;  1E79 H;  2L5G B;  2OOC A;  4JUR I;  2R9R B;  1KMI Z;  1L0N J;  3KYJ A;  3TK1 A;  2FFD C;  4DVZ A;  4C7O A;  2OGU A;  1RMV A;  4I2L C;  3H1I J;  3LW5 H;  4BJ5 A;  1CI6 B;  1N7L A;  4C3D A;  4PJN A;  1BGY J;  2VH3 A;  1QVX A;  2JWA A;  4G7O F;  2J59 M;  4C7N A;  1GQA A;  2FBW C;  3Q1M A;  5B5E H;  4DZO A;  2WSC H;  3M91 A;  4OD4 A;  1KIL C;  4C7N B;  4JZA A;  2QM7 A;  2QRX A;  4GQH A;  1FMW A;  1J1E C;  2PX3 A;  5KYU A;  2FXO A;  4H54 A;  5L8R J;  2D2C C;  4MVS A;  1SQX G;  3N4X A;  1N8R Q;  1K9M Q;  1M2V B;  3H1J D;  4QDL A;  3G71 P;  2E76 B;  4N78 D;  5CCG A;  3TDK A;  4NPF X;  3D6Z A;  2HFI A;  3NDB B;  1BGY D;  2J9B A;  3OEO A;  3LLK A;  1I4Y A;  2KNH A;  1SFC D;  1MFT A;  1JOG A;  3HNI A;  3I55 P;  4U5D E;  2UUI A;  1JPJ A;  3RK3 C;  2N9B A;  5M1B A;  1K8A Q;  1R5I D;  1NU7 D;  1K05 A;  3CX5 E;  1FS0 E;  3N24 A;  4R4L A;  4G7Z F;  1AEP A;  3DXJ F;  4DRI B;  3K5B A;  3AE3 C;  4M63 A;  3FWN A;  3ZVR A;  4PK4 A;  2A06 G;  1PD1 A;  2LXC B;  5APW A;  3LES A;  2N1T B;  3U2M A;  3U59 A;  4JEB A;  1OFC X;  1KD1 Q;  3A7O A;  3AGT A;  3HTK B;  4NPD A;  3JRM O;  1CSB A;  5EHH A;  2NSG A;  2N1T A;  3GEE A;  4XE5 B;  2KSE A;  3G4X A;  1OQC A;  2NUT A;  3U8P A;  3TGU E;  2HOD A;  1WMK A;  2W8Z A;  1TKN A;  2IOQ A;  2W9Y A;  2JWD A;  1S72 P;  4JTC B;  4CSA A;  1F1M A;  1SMY F;  1JTH B;  3SXZ A;  2R7X A;  5JLI A;  3KPE A;  1TWA A;  1OCC C;  2Y3G A;  5CIV A;  4D4X A;  4AL1 A;  1YA7 O;  3RQE A;  1KB9 E;  1Q7Y Q;  3EGD A;  2CPB A;  5CCH C;  2IM8 A;  3AE5 C;  2AU5 A;  2ZXR A;  1SF8 A;  3BCC G;  2YKP A;  2EPL X;  2FKW B;  1T5O A;  1KQF B;  1NVO A;  2HUJ A;  3D6Y A;  2WIT A;  2R25 A;  2WZG A;  2XS8 A;  3DM9 B;  2KZJ A;  3H1H J;  1VF5 C;  3RH3 A;  4PV1 C;  1FFT C;  2HV6 A;  1FZC C;  3CXH D;  1GS9 A;  3VAY A;  1FE6 A;  3F89 A;  3JCU H;  4PAC A;  3PLN A;  5B3I A;  2WSE H;  3R7C A;  1SQB J;  1GU4 A;  4G78 A;  3B9Q A;  3V2N A;  3D71 A;  4MTF A;  3C62 A;  2J8W A;  5AVW B;  3C8Z A;  4NCQ A;  2Q5U A;  3AG4 C;  1VQN P;  3V5Z A;  3L37 A;  5GPG B;  4EOT A;  3EGX B;  4PFO A;  5JSL A;  1KFN A;  2XZR A;  3AEA C;  3HNK A;  3UGO A;  1NOH A;  1EZV G;  3MTU E;  2WZ7 A;  2Y3H A;  5E79 E;  1U89 A;  3KKB A;  4LLC A;  3DZA A;  5KLI C;  2R32 A;  3EH2 A;  4C7O B;  2LKM A;  1VTM P;  3E1I A;  1L0L K;  3U3F A;  5K5G B;  3QH9 A;  5BQH A;  1AJY A;  5APV A;  3FVY A;  1A41 A;  3SP1 A;  2W90 A;  3B5N B;  1ZU5 A;  1H6G A;  3QTH A;  4GYT A;  1LTT C;  5A6K A;  4Y28 J;  1VPC A;  1GL2 A;  3RK2 D;  1RKC A;  3HLZ A;  3O55 A;  4PJL A;  4JVS A;  1DEE G;  3V2R A;  1BGY E;  3IN6 A;  4IFF A;  3X1O A;  2XLM A;  4XEK A;  2QJK B;  3S1K A;  1DEB A;  2XV5 A;  3UMI A;  1IK9 A;  3MBG A;  2Q3E A;  3S9O A;  4AE4 A;  1YJG A;  3SWY A;  4RES B;  3VMY A;  5E79 H;  2OKU A;  1KU2 A;  1MMA A;  5D91 A;  1BDD A;  1T9K A;  1FR0 A;  1URQ B;  3TF5 A;  3HD7 A;  3AEF C;  2H8A A;  1DOV A;  1FJP A;  3MHV A;  2CNW A;  3ITF A;  1VYI A;  1ZN5 A;  1NYH A;  4HKZ H;  3BCC E;  2L6G A;  1NO4 A;  1T6I A;  1FJK A;  2M8R A;  1NAY A;  2WVO A;  1ZU4 A;  5APU A;  4PD4 D;  4JIO A;  2KQ9 A;  3VMZ A;  1BCC D;  4XA4 A;  4NPE A;  2YKO A;  3EZH A;  4J7T A;  2GFH A;  2QJP C;  3TSI A;  4GOF A;  3CWB J;  5JVE A;  2HYN A;  5AC4 A;  1L0N D;  2KK1 A;  5KYX B;  3H1L D;  2XLD A;  4QMA A;  1H9G A;  2P6V A;  1HY5 A;  1W2B O;  5KLV K;  1PGP A;  4IL6 H;  1G5Z A;  5AVR B;  4JE9 A;  1YZA A;  2EIL C;  2D2C B;  3H1L E;  5AW5 B;  4H13 D;  1BE3 D;  2KXP B;  2F22 A;  5APS A;  2NPS A;  2LP4 A;  3EQ2 A;  3GM1 A;  3E7K A;  3W2W A;  1EI7 A;  1LJ2 A;  1RE3 C;  1CPQ A;  4AUW A;  2H8P D;  3NXS A;  2ZXW C;  5A69 A;  3U9J A;  3GWL A;  1IC2 A;  1K04 A;  1YIJ P;  3TQO A;  1EZV D;  2FFD A;  5CI9 A;  5KYY A;  5FCL A;  3L75 E;  4U3F J;  2ZYD A;  3B0P A;  1UG7 A;  1QEX A;  2P7J A;  1Q2N A;  2B87 B;  5L0C A;  3B0V C;  4NQF A;  1ZOY C;  3N7N A;  2DB4 A;  1N73 B;  5BUO A;  3USS A;  3M4B A;  1OVV A;  1URQ D;  2WSC J;  3RBX A;  4W7Y A;  4CX9 A;  1NTM G;  3OAK A;  3FDQ A;  1BR1 A;  4PD4 I;  1G8X A;  1PP9 J;  1FZA A;  1S5L X;  1VQ4 P;  1SQX J;  1KFM A;  3G4Z A;  1RY3 A;  2K1A A;  3EH1 A;  3PTZ A;  1HE9 A;  2WTY A;  4U3F G;  1SP4 A;  1MMD A;  1MMG A;  5CJ4 A;  1NTK G;  4IWB A;  4U5B E;  3T97 A;  1YJN P;  4LGD E;  2VCC A;  2P61 A;  1LTG C;  1SS1 A;  2EPK X;  3GHG C;  3VYI A;  3ZDM A;  1G4W R;  1OKK A;  1DH3 A;  4MVR A;  4HFK B;  3VYW A;  5JS5 A;  1JY2 O;  3V7O A;  2JP3 A;  3MYF A;  1IFJ A;  2IZ0 A;  5A6B D;  4LLE A;  1NAF A;  2YXQ B;  3HUS B;  1KOR A;  3EFO A;  3O39 A;  2IBZ I;  1OR3 A;  4DJ9 A;  1KTM A;  4BXL A;  1QPU A;  1JY3 N;  2A69 F;  2PP4 A;  2FYU D;  2YEV A;  3I4U A;  1JOC A;  3L1M A;  3IQ6 A;  4BEM J;  4OGQ B;  1LVK A;  1NTM K;  3GG2 A;  1SFC C;  3KZI E;  1LKX A;  5EGY A;  3U5S A;  4D4N A;  1LNQ A;  2JR8 A;  2KSJ A;  4TLF A;  3DJN B;  1H0T A;  5DS6 A;  3HUS C;  4NTB A;  2Y9Z A;  4JTA B;  2I8B A;  1T01 A;  2EIN C;  2LCH A;  2TMV P;  5AW8 B;  1KB9 I;  2IYP A;  1D1C A;  4I3M A;  3IQT A;  1HGZ A;  5AW4 B;  2B0H A;  2NZ2 A;  3ZQV A;  3TGU G;  4WWI A;  1M1K Q;  3BAS A;  2WWW A;  3JYY A;  4IJJ A;  2L7A A;  5CCH A;  2DI3 A;  2JEE A;  5L3V A;  3Q5S A;  3RBZ A;  3O8Z A;  1I5N A;  3N0T A;  1LS4 A;  3L36 A;  3H32 B;  3V5B A;  5KKZ C;  2C04 A;  1GZL A;  3QMK A;  2IX7 C;  1VQ6 P;  4I7Z B;  3VMA A;  5BU8 B;  1FOS F;  2QLA A;  1SQX D;  1RE4 A;  2K9Y A;  3DMD A;  3X2Q C;  4FAP B;  2FYN C;  3CCS P;  4N78 E;  3RVY A;  2IBZ D;  4CDA A;  1E84 A;  1QVF O;  1JY3 O;  2Q9B A;  2DW3 A;  3CX5 H;  1LTA C;  3MLG A;  2QJK C;  2RMZ A;  2WVN A;  2G3A A;  1FDO A;  2XND H;  3E1R A;  4C46 A;  2YQY A;  1NTM E;  4ONS A;  4Y99 C;  4O9B A;  3RL0 D;  1W2E A;  1WAT A;  2H7B A;  1J8M F;  1HJB A;  3UIA A;  2A45 G;  1OW7 A;  5DQZ A;  2O9X A;  4HB1 A;  1D1A A;  4BJ6 A;  2OQQ A;  2XLE A;  3CC2 P;  4I1L A;  3VP8 A;  4A7P A;  1GU5 A;  5KYU B;  3CCV P;  1RJ9 B;  1RF1 C;  4I44 A;  1PPJ D;  2M64 A;  2NUT B;  2OYI A;  3ZSU A;  1IFI A;  2ZT9 B;  2JX0 A;  1DOW A;  3H1I E;  4WY4 D;  5K0I A;  1NTZ K;  5EK0 A;  1CGO A;  4K1O A;  1J8Y F;  4MVU A;  3BAT A;  4ZLC A;  2IYO A;  2ZD9 A;  5HSW A;  1NTK K;  4DRJ B;  2L6H A;  3A0H E;  3ABV C;  1OXZ A;  2W27 A;  3A0B E;  3L72 E;  1NU1 D;  1T3J A;  5BU5 A;  1HVV A;  1BCC E;  4IAR A;  1PGO A;  2FFH A;  1ZRT D;  2PF4 E;  1E85 A;  3L73 E;  1ZXG A;  1SQQ E;  3AED C;  4OD5 A;  2Y69 C;  1L2P A;  2XLO A;  2ICW G;  3QZC A;  3C18 A;  1H9T A;  3C8V A;  2OYH B;  2YIU C;  3RK2 C;  3T97 B;  1EXJ A;  1FZF A;  4L6R A;  1Z63 A;  4BJ6 C;  3TUL A;  3RW0 A;  3L75 G;  4IGG A;  4MS2 A;  2ZAE B;  3C8G B;  3R2P A;  1VF5 B;  2ASR A;  1IFD A;  2IYL D;  2QSI A;  3Q5R A;  1HW2 A;  3AQB A;  1RF1 A;  1VB5 A;  5L0D A;  2RD9 A;  5KKZ B;  3F47 A;  2KC3 A;  2C03 A;  1N73 C;  1JB0 J;  1IFN A;  2ZXP A;  1A0B A;  2KI7 B;  3CCM P;  3R4Y A;  2Q9C A;  1N7S B;  2G3V A;  1YQ4 C;  2DYS C;  1AVY A;  1L0N K;  2QG4 A;  3H1J E;  3L74 G;  1H89 A;  2NSF A;  4X0R A;  4Z9I A;  1M56 C;  1YJW P;  2L6F A;  1JY2 N;  4N6J A;  1ORS C;  1ZHZ A;  3TNU A;  2IXM A;  3E70 C;  3NRH A;  4O6N A;  5JP7 A;  4OIP F;  1W5C E;  1RKE B;  3B0U X;  2R7O A;  3EGX A;  1KC8 Q;  1ZP0 C;  3I5P A;  1VQ8 P;  3Q5P A;  1OKK D;  3DWW A;  3L74 D;  3HE5 B;  1KIL E;  3C8G D;  3U9M A;  2QY9 A;  4RJT A;  1MND A;  4JRZ A;  4CBE A;  3S90 A;  3FXE A;  3RK3 E;  1WT6 A;  2QA4 P;  1JMM A;  1SQQ K;  4GOD A;  4YN0 B;  3H1K J;  3JSE O;  4AX2 A;  4KI2 A;  1LIH A;  2L91 A;  1T6Q A;  4H13 B;  4L76 A;  1E83 A;  3H32 A;  4PJM A;  1WN0 A;  1OX3 A;  1L4A A;  4I6M C;  1M2O A;  2HV7 A;  3O6Q A;  2IDB A;  4KHX A;  1EQ7 A;  2MKV A;  3OJA B;  1VQ5 P;  2MWQ A;  3MD0 A;  3NYL A;  3ITK A;  2Y0C A;  2HPC B;  1C17 M;  5BVZ A;  1DX7 A;  3Q7G A;  4LDR A;  2LSE A;  3H1H G;  4BG0 A;  1T6U A;  3DD7 A;  3CI9 A;  1J1E B;  2OU6 A;  3L35 A;  4WY4 A;  2YIU B;  1M8O B;  2OYH C;  2ETS A;  4NTF A;  1MZ9 A;  3L75 J;  4U3F E;  1SZI A;  2ZT9 C;  2R7S A;  4XPY A;  1GGQ A;  2E5T A;  2QJY B;  2RN0 A;  3A9C A;  4EHP A;  3Q7L A;  3HUS A;  1V55 C;  5CBN A;  1ZW2 A;  1HW1 A;  3S29 A;  5CCG C;  1SQQ G;  2Y3D A;  4WY4 C;  1LP1 A;  3L70 E;  4YK5 A;  2R5B A;  2XLW A;  1QL2 A;  3TGU D;  2H88 C;  3OA1 A;  1HH0 A;  5GTI H;  1LGH B;  2MYS A;  2OG2 A;  4H0L B;  4E7Z A;  4TT3 H;  4YPC A;  2OYO A;  4BWN A;  1EDL A;  1BE3 J;  1JY2 P;  3L71 D;  1SQB D;  2O3J A;  3ZIB A;  1JEK A;  1LWU B;  3V2Q A;  1Z23 A;  1BDJ B;  5KYY B;  1IW7 F;  4RBN A;  3H65 A;  3PCV A;  3RL0 B;  1NSG B;  1BSN A;  4ASW A;  1L0N G;  2LQG A;  4PD4 E;  2E74 D;  1S2E A;  1X8Y A;  2QJP B;  1TWC A;  4IAQ A;  1HF9 A;  3RFY A;  2GDC A;  1N73 A;  4KNV A;  1XZP A;  3L74 J;  5KYW A;  1U57 A;  3CWB D;  3CMA P;  1P84 I;  2R5D A;  3CC4 P;  2KK7 A;  1PCX A;  1BCC J;  1M7L A;  1X79 B;  2GA1 A;  4XWJ A;  1FMV A;  2XU6 A;  3GF3 A;  5KAF E;  5CCG D;  1FNT c;  3AE4 C;  2IFM A;  1E86 A;  3AE7 C;  1W2W A;  256B A;  2AVK A;  1PL5 A;  4XFJ A;  2QIW A;  1A7D A;  3ABL C;  3FHD A;  1WWP A;  4H4K C;  4C3B A;  3S84 A;  2HSB A;  2XL4 A;  2BEQ D;  3CC7 P;  3NKD A;  2GM4 A;  3CME P;  1O3U A;  4BRY B;  4W8K A;  2EPO A;  3M0D C;  1R8E A;  2H7V C;  4IL6 X;  1I4Z A;  2E74 B;  2W6B A;  3CXH I;  4RKU J;  3K1H A;  2WL8 A;  1NU9 C;  2FGY A;  4H44 D;  1NTM D;  3EHN A;  2FYU J;  3L75 D;  2Q9I A;  2GUS A;  3L34 A;  4ER9 A;  1ZV8 A;  3U1A A;  2CW0 F;  2P1A A;  3N2Z B;  4O7G A;  3HRN A;  2FYN B;  3A11 A;  3L73 D;  4C7R A;  4BEJ A;  1LPE A;  3DKA A;  3CCQ P;  4U5H A;  3EZI A;  3RK2 B;  3H1K E;  1Y8A A;  2EIM C;  4CJO A;  3MP7 B;  2KNC A;  1P84 D;  5CHX A;  1YDI A;  1VDF A;  2A0U A;  3CQZ A;  5DS4 A;  1E2X A;  2C9N Y;  4DVY P;  2D5R B;  3S27 A;  4W8P A;  1KQS O;  2V7Q H;  2KNC B;  3IPM O;  5HV9 A;  1TWG A;  3GOD A;  5L0J A;  1U6H A;  2G62 A;  5BQG A;  2J0W A;  1NKN A;  3H2U A;  1FDM A;  1GMJ A;  4W80 A;  1YHQ P;  1MUU A;  1NTK D;  1SQX K;  1ZLL A;  3V4W A;  1JO5 A;  3FMS A;  3SYN A;  2XL6 A;  2HMZ A;  3G50 A;  2RKL A;  3EGD B;  4U3F D;  1KIL A;  3GLM A;  2JKV A;  2OYI C;  2HZ8 A;  2AP3 A;  2KGO A;  4N6H A;  5AVY B;  1U7M A;  2BCC G;  3C63 A;  1L4A D;  4OGQ C;  3H2V A;  3AEC C;  1LE2 A;  2UWJ E;  3RF3 A;  4WY4 B;  5H2F E;  4ULW A;  2FY8 A;  2H89 C;  1HGV A;  3LUT B;  1PV3 A;  4ZNC A;  2K88 A;  4O6M A;  2X0C A;  3NG1 A;  4N06 A;  4DCK A;  1QZX A;  3C1L A;  2R02 A;  3GW6 A;  1J1D C;  2AXC A;  2WMM A;  3EFF K;  3IQC A;  3P7K A;  1IFP A;  4EI2 A;  2HPC A;  3M06 A;  4WGY A;  4CS8 C;  2IBZ G;  2KOG A;  3T4R A;  3ZC4 A;  4JYB A;  5KAI H;  1K73 Q;  2Q7C A;  2IBF A;  2GUV A;  1RHZ B;  3B5N A;  2P10 A;  1VMA A;  4NC3 A;  5DVW A;  1OMI A;  2ZYA A;  4CPG A;  5CCH D;  2K9J B;  3S28 A;  4J30 B;  1SQV D;  4GIF A;  4DOZ A;  3H6P A;  1LT1 A;  4I7Z C;  1BDC A;  1Z3I X;  1TQG A;  3L70 G;  1H88 A;  2LR2 A;  1LT9 B;  1KIL D;  2QE9 A;  1L0L D;  1TFO B;  1L4A C;  3AE2 C;  2K9J A;  3M9Q A;  1Z5Z A;  4Q5S F;  1TWH A;  4DBR A;  5KJ7 D;  1T2K C;  4EBB A;  3L73 J;  1FZC B;  2WVQ A;  1UFB A;  3L0I A;  1NJI Q;  1H0T B;  2BCC E;  1NG1 A;  3RIP A;  3SXK A;  1EC5 A;  4WGZ A;  2H43 A;  2Q9A A;  1HMO A;  3CCR P;  1OR2 A;  4ZLD A;  5E3A A;  2J9U A;  1FDI A;  2Q3T A;  3P8M C;  2LFF A;  5GTH E;  3BRV B;  4K3A A;  1CI6 A;  4YT2 A;  1AV1 A;  4RO0 A;  1GK6 A;  1RE3 A;  4GDO A;  4PFP A;  1L4A B;  2HMQ A;  4GOE A;  4K35 A;  5F28 E;  4G7H F;  2P67 A;  4E0I A;  3AE1 C;  3A0H H;  2LFD A;  2NPS D;  3JC2 2;  2HJM A;  3JTL O;  1NKZ B;  4YL1 A;  2FYU G;  2QTV A;  3KYQ A;  1Q0M A;  1ZHY A;  1FAV A;  1YVI A;  1AVO B;  5TIS E;  3KZI H;  3M9H A;  2YRF A;  5COG A;  3CWB G;  3BRT B;  2HKV A;  4K0D A;  5AVZ B;  1NTK E;  1Q90 D;  4E0H A;  4JJF A;  2W6A A;  3AJM A;  3WU2 E;  2R03 A;  2YHS A;  3NYJ A;  2R7V A;  1USE A;  2Y9Y A;  3KPH A;  4I1O B;  1G4U S;  2M4E A;  1RXQ A;  2VC9 A;  2WZF A;  5KYW B;  2BCC J;  3US6 A;  4HYT B;  1R5L A;  4JCZ A;  1BR4 A;  3DM5 A;  1N7S A;  2WSS H;  1VLT A;  3SWF A;  1YYC A;  1AQ5 A;  5APT A;  1HBW A;  1BR2 A;  3TJ6 A;  2Y3B A;  4JPZ B;  1B68 A;  5AW6 B;  4QI2 A;  4CDV A;  1QVG O;  1O5H A;  3U2L A;  3L72 J;  1ORJ A;  2M3E A;  3W68 A;  3WG7 C;  3W67 A;  2R7T A;  3V5Y A;  3H25 A;  3V5X A;  2YMY A;  2B87 A;  1S05 A;  3D70 A;  3G6E P;  2ZFC A;  2H7O A;  3AE8 C;  4CS9 A;  1SQP D;  2PAJ A;  3MIW A;  5AW9 B;  3U3B A;  1LTJ A;  3CL3 D;  5KAI E;  3OWT A;  3M4C A;  1AA0 A;  5KYX A;  5KLV G;  1EDI A;  2W4M A;  1KNY A;  2HOD B;  2J46 A;  3CX5 D;  1SQP G;  3C8G A;  5L0G A;  3K1I A;  1R4T A;  3SEO A;  4IOI H;  1TR2 A;  2B88 A;  2NPS B;  1RF1 B;  4LDK A;  1TFK B;  3RGU A;  2J58 A;  1NTZ E;  4NY3 A;  5JRA A;  2OQM A;  1ZME C;  1YIT P;  1EDK A;  5AW2 B;  3EG9 B;  3TOL A;  1Q0D A;  1OIP A;  1BE3 E;  3U8V A;  3GM3 A;  4JEA A;  5TJ5 E;  2IXP A;  4U5G A;  3RL0 C;  1SVF A;  1PGJ A;  3Q2Y A;  2PP6 A;  1E5W A;  4JF7 A;  2XSE A;  1BBH A;  1KQL A;  4D6T J;  4Z9J A;  1SQQ J;  2KZI A;  2CPS A;  3LID A;  2WB7 A;  3HD7 D;  1KYO D;  1M57 C;  2I15 A;  2Q3I A;  1Q0F A;  1NHL A;  5A6B A;  2WSF J;  3IQ5 A;  1WRG A;  5APX A;  3SXM A;  1LTJ C;  3G9R A;  4YL0 A;  2E76 D;  3ZQY A;  3S4R A;  3KXD A;  1GDT A;  3NKE A;  2JD3 A;  4MND A;  2IZ1 A;  1RF0 C;  3DE9 A;  1YYJ A;  4MVQ A;  3FOP A;  5BQI A;  3LNM B;  1RQU A;  4YL3 A;  3TJ5 A;  4OH8 B;  4JC7 A;  1UII A;  1SQB K;  1YJ9 P;  1OWA A;  1ZHX A;  4LAC B;  2WPV B;  1ZVZ A;  1Z56 A;  3EQL F;  1QQ3 A;  3POV A;  1M90 Q;  2J0X A;  4OIN F;  1L0L G;  4J32 B;  2RSE B;  2HFE D;  3L8I A;  4UB6 H;  3M1C B;  2M5A A;  4PV1 B;  2A06 D;  2AXT E;  1Z6A A;  3AGU A;  5L0F A;  3RK3 B;  2WPQ A;  4LDQ A;  2O01 N;  3B4S A;  2OEX A;  2ITA A;  5AVS B;  2AEJ A;  1ST6 A;  1APC A;  4M3L A;  3ZG1 A;  3BRJ A;  1IK7 A;  3FX0 A;  1LWU A;  2W4B A;  3JSZ A;  2G8Y A;  2R05 A;  3OW2 O;  3SZR A;  1AQT A;  2XM4 A;  2A0B A;  3P32 A;  2IXN A;  2PNO A;  1SQP J;  3SSU A;  1G2C A;  1HUC A;  1Y47 A;  1VYK A;  3AOU A;  2CDQ A;  2Z5I A;  1FTS A;  3F5H A;  4YJW A;  4XQ1 A;  5DLJ A;  3PDM P;  2YLG A;  4H0L D;  4EYY Q;  3LEO A;  3UMK A;  4Y99 B;  1KYO E;  3WU2 H;  1LS1 A;  4UB8 H;  2W6J H;  3B5N C;  3B29 A;  2N9Y B;  1LP1 B;  1YAU O;  3FXD A;  2Q00 A;  2JDI H;  4JQ0 D;  1FZG A;  1Z7Q c;  2AEF A;  1RF0 A;  3PH0 A;  1NFN A;  4U5E E;  2QUP A;  2Y0E A;  2POH A;  2R7R A;  5GTI E;  3LJB A;  1BE3 G;  4AE4 B;  5AW0 B;  3GHG A; 
#chains in the Genus database with same CATH homology
 3RQE A;  1GMJ A;  1QVX A;  1NYH A;  2L6G A;  2WSF J;  4KT0 J;  4OGQ D;  3AE5 C;  2E74 D;  2PBE A;  1ZP0 C;  2E75 D;  2FBW C;  3AEE C;  3G9R A;  2E76 D;  3Q5P A;  2JP3 A;  1MKM A;  1OW7 A;  1HF9 A;  3MFN A;  4H44 C;  2LK4 A;  1KIL E;  2OQQ A;  3GLM A;  1KQF B;  3Q1M A;  3C8G D;  1U57 A;  4XEF A;  3U0C A;  1KOR A;  1NGM B;  1EXI A;  3D6Y A;  1Q90 D;  1HJ0 A;  2ZT9 D;  3AJM A;  1OW6 A;  4OGQ C;  1RQU A;  3AEC C;  3RK3 E;  2E74 C;  1VF5 C;  1KTM A;  2QJP C;  4PV1 C;  2E76 C;  2JPU A;  2YWA A;  2JO1 A;  5L8R J;  2KK1 A;  2D2C C;  2H89 C;  2ZT9 B;  2JX0 A;  3FGA D;  3JZ0 A;  3GF3 A;  3B71 A;  4R4M A;  1PV3 A;  2QJY C;  3AE4 C;  2WPV B;  3RQG A;  4H13 B;  3SFD C;  4OGQ B;  3AE7 C;  4XEV A;  4PV1 D;  2E76 B;  1YQ3 C;  1PL5 A;  4XFJ A;  2QIW A;  1DIP A;  2D2C B;  3D6Z A;  3D71 A;  3O6Q A;  4H13 D;  3L8I A;  2IDB A;  1TU3 F;  2MKV A;  1WWP A;  3GMA A;  4PV1 B;  1RQV A;  2L6H A;  3GM1 A;  4Z1M H;  3ABV C;  2HSB A;  2BEQ D;  3L8J A;  4R32 A;  2WQY C;  1JOG A;  3AEA C;  1O3U A;  1WOL A;  4H13 C;  3H25 A;  3O10 A;  5M1B A;  1R8E A;  1K05 A;  3K7D A;  1PIX A;  1K04 A;  1Y9B A;  3D70 A;  4IL6 X;  3AED C;  2P10 A;  2E74 B;  2NZ2 A;  3AE8 C;  1IK7 A;  3AEB C;  4RKU J;  3AEG C;  3BRJ A;  3C18 A;  1OMI A;  4R4L A;  3JYY A;  5KLI C;  2G8Y A;  3C8V A;  2YIU C;  3IAO A;  1VL2 A;  1KQG B;  3T97 B;  2O01 J;  2E75 C;  1EXJ A;  3AE3 C;  3U3F A;  1AJY A;  4H44 D;  4I7Z C;  2YMK A;  3TUL A;  3LW5 J;  1K40 A;  4NQF A;  1UIX A;  2FXP A;  1ZOY C;  4YXD C;  3RL0 g;  3Q5S A;  3C8G B;  4Y28 J;  1VF5 B;  2ZT9 C;  1KNY A;  2QSI A;  1VF5 D;  3AE2 C;  3Q3D A;  3Q5R A;  5KKZ C;  4EBJ A;  2WSC J;  2J5U A;  3SFE C;  1V4A A;  4H0L D;  2V7Q J;  4YTP C;  3C8G A;  2D2C D;  4I7Z B;  3GM2 A;  1UFB A;  3IN6 A;  1ZRT E;  2K9Y A;  4XEK A;  1WMK A;  1JB0 J;  3EWK A;  1ZME C;  2FYN C;  2H88 C;  2E75 B;  1DD4 A;  1FDI A;  1S5L X;  3S9O A;  4H0L C;  3R4Y A;  4EBK A;  4H44 B;  2WSE J;  2Q00 A;  1S1C X;  4H0L B;  4U7J A;  4TT3 H;  3GM3 A;  3RQF A;  1YQ4 C;  1KMI Z;  4GDO A;  2QJK C;  3GF7 A;  2BEZ F;  3Q2Y A;  1OW8 A;  1WTY A;  1ZZP A;  2G3A A;  3AE9 C;  1FDO A;  5F28 E;  2L6F A;  1DD3 A;  3AEF C;  3AE1 C;  3AE6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...