1OW6A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6A02
3AEFC 4XEKA 1UFBA 4XEVA 3AE3C 3AE7C 2JX0A 3K7DA 3SFDC 3U3FA 5F28E 1KTMA 1QVXA 2L6GA 1WOLA 3MFNA 3JYYA 3TULA 1ZOYC 3U0CA 1ZP0C 3AE5C 2H89C 3AE8C 3ABVC 3B71A 3L8JA 3AEBC 3AEEC 3JZ0A 2Q00A 3AEGC 2WQYC 1PV3A 1ZZPA 3AEDC 3AJMA 3AE2C 1OW7A 4XEFA 2L6HA 3AECC 3RQEA 1WWPA 2HSBA 1KNYA 2LK4A 4NQFA 4EBKA 1OW8A 2H88C 2FBWC 1JOGA 2G3AA 3BRJA 3AE9C 2YWAA 3O10A 2PBEA 3C18A 1OW6A 2L6FA 3RQGA 3C8GD 3C8GA 3AEAC 1YQ3C 1K05A 3AE6C 4YXDC 4YTPC 4R32A 3GM3A 1O3UA 3S9OA 3RQFA 1V4AA 2KK1A 4EBJA 1K40A 2JPUA 3C8GB 3GM1A 3AE1C 3L8IA 1YQ4C 1K04A 3GM2A 3AE4C 1WTYA 3SFEC
chains in the Genus database with same CATH superfamily
2GWWA 2ZPAA 4P9FA 2KS1B 5GTHH 2L9JA 2M5AB 2KW3C 4C46A 3K7DA 3RK2B 3SFDC 3WHNA 1LS4A 4NCQA 4U5DE 4WJ0A 2XLDA 2R3SA 2K88A 1PP9G 2WMMA 4YJWA 1K9MQ 4WBAA 1HVVA 4KNVA 4P9TA 2VRSA 3AG3C 3F46A 2WPRA 3GEIA 4DRJB 3CWBG 3CX5I 3JSVC 4LC1A 1C03A 1SQVK 3G71P 2R25A 1ZR2A 1HGVA 3LS0A 3N2ZB 1Z63A 2Q6QA 4W8PA 4A4AA 3OJAB 2NPSC 1NU1K 4G7ZF 1Z7Qc 4U3FE 5KLIB 2LXCB 5KJ7D 4CSAC 3RK3D 2YXRB 3LNMB 3R7CA 3Q3DA 5JLIA 5APVA 2O01J 1Q81Q 4W8KA 3D6YA 4GYTA 4C7RA 2JJLA 1DX7A 2P61A 1J1DB 3HD7B 1J8MF 4MTGA 1SFCD 1BCCG 4R4LA 2WPSA 2R7WA 4CSAA 1SQVJ 2AXCA 4O6MA 4MW8A 1EZVE 1IFIA 2XLHA 2IFMA 1T9KA 5L3VA 3S0XA 1WN0A 1NU1J 3HUSA 2YVKA 1ZW0A 1M90Q 4UDVA 1NYHA 2WPVB 2OQMA 1BE3D 2ZXPA 3QW1A 5CJ0A 1V4AA 1SQBE 1VQ7P 3WG7C 1D1AA 3RIPA 3N0TA 5L0CA 2W83C 2CGEA 1A0BA 1PL5A 2QUPA 2HG5D 1YQ4C 2BCCJ 2K9JB 2CK3H 3M9QA 1BGYJ 4I7ZB 4N78E 5AVWB 3DXJF 3HE5B 4JEBA 2LSEA 3L35A 5KYUB 1QLEC 1JUNA 3BCCJ 4OGQC 3N24A 2FXPA 2GUSA 2YKOA 3FHDA 1RE3A 2D4UA 2R5BA 3MFNA 3R2PA 2YKQA 4ASVA 5AW9B 3KDPB 1LTTC 3RFYA 1M6TA 3AE5C 1L4AB 2UUIA 1P84D 2FGYA 3AEBC 1VDFA 2OYOA 2XLEA 2WB7A 4N6HA 4JC7A 3FWLA 1TFKB 3M1CB 2KOGA 3JC22 2J9WA 5A6KA 1CI6B 3Q7LA 3DE8A 1E83A 2L6HA 3LAYA 4U3FD 4FX5A 3G3ZA 3LEVA 4NTAA 4YL0A 1NKZB 1VQMP 3H1IJ 4CJOA 4EBKA 1SFCC 2VASA 5JSLA 3FDQA 3L73G 1N1CA 1TWGA 3IF4A 3IQ5A 2NSGA 1J1EC 4WY4C 3ZG1A 3IPMO 3W2VA 4EYYQ 2QVAA 2WPQA 4NC3A 1EZVD 2JWAA 4G7OF 1SFCA 3CI9A 2B88A 4PD4E 2BE5F 1YYJA 1AQ5A 3JRTA 4K7BA 1RF1A 4WVZA 2C0WA 4WY4A 1MNDA 4OIQF 5FZTA 4RJTA 1XZPA 2W27A 1J2JB 2A0BA 3AEAC 3A5TA 1M2VA 1ZW3A 1KB9E 2HLOA 4PJLA 3EFOA 1VL2A 2OYHC 1LT1A 3LUTB 1K40A 3K66A 1W2WA 2Q7RA 4JBZA 3AG1C 3QWOC 4N78D 4I1LA 2OYHA 4QMAA 2HS5A 4ER9A 5EFWB 3ATPA 4M3LA 2NPSB 1S3JA 3ZQYA 1AVOA 4JZAA 1EQ1A 2IBZE 4ZKUA 3AQCA 2OYIC 2N1TC 1LTGC 3RKOF 3IN6A 2C03A 5CBOA 2OARA 3QTHA 2OGUA 3LLIA 2A45I 3H2UA 3K5BA 3GF7A 1I4YA 3TD7A 1FU1A 5JP7A 2EPOA 1SQVG 1VTMP 2N1TA 3TGUJ 2A0UA 1HE9A 5A6BD 1RH5B 2EINC 2XS8A 4ULVA 1S72P 3MHVA 1NU1G 2KGOA 1KN7A 1OXKA 4X0RA 3V5YA 3OEOA 2KNCB 1QL2A 1PP9E 2XV5A 3M9HA 3H1LJ 3AJMA 4GEHA 2ZT9D 3U9MA 2AU5A 4AE4B 5T1DB 2I1JA 2K1AA 1WMKA 3SWFA 1PZQA 3RL0C 1LWUB 2E75D 3IQTA 3C63A 2B87B 2WSEJ 3TOLA 3MBGA 3CWBE 4PD4H 1VOMA 3U59A 1JNMA 4Z1MH 1VF5C 2JWDA 2BCCG 2W90A 3B5ND 2O1JA 1BGYG 2N9YB 3L71J 4C3EA 5HV9A 1BSHA 4PD4D 1IZNB 4LLHA 4MW3A 1YLMA 3BCCG 1W5CE 3VMZA 1KB9H 4OGQB 1CGME 2ZFCA 5AVRB 5KAFE 2KSJA 2RN0A 3P7KA 4NPDA 2HJ3A 1YDIA 3VP8A 1KILD 1OW6A 4F4BA 5KLVD 2WVNA 2WT7A 3PCVA 1NWQA 4U5GA 4H4KC 2E43A 1KV4A 3GM3A 2QA4P 1EDIA 4YL3A 1WATA 3KMIA 1RHZB 1LTJC 1LNQA 3UGOA 1MFZA 1EXJA 4O7GA 5COMA 1FFHA 3X1OA 3TDKA 3T97B 3DE9A 2IZ0A 4UB8E 3RK2D 1Q0DA 2NUPA 3CLQA 3GM2A 3HTKC 3SFEC 4XQ1A 4ZNCA 1LTJA 1GL2B 1HBWA 3H1IG 3L0IA 3LIDA 3L70J 4LDKA 4XEVA 4DZOA 1NU7D 2JEEA 3ASOC 4HFKB 3E1IA 2EPMX 2LP4A 1I4ZA 3HTKA 1HWTC 1E84A 1Q86Q 1YYXA 4U5BE 2Q9IA 1USEA 1WASA 3KYIA 2H89C 2NUTB 3K1IA 2ZVOB 1PGPA 1FS0E 1GW3A 3E7KA 5KYNA 4BG0A 5A6BA 4G7HF 1LM3B 2PF4E 1PP9D 1KQGB 1LS1A 4YT8A 5CJ4A 2R03A 4OD4A 2H7HA 3W67A 3MLGA 1JY2N 2E87A 3M79A 2EPNA 3PDMP 1MMAA 4E7SA 2HODA 1Q90D 3D71A 1URQB 3ZIBA 1YI2P 3MP7B 3RYLA 1TKNA 3RW0A 3EGXA 3HD7D 3S29A 1L0LD 1A7DA 5AVTB 1E5WA 5KAFH 2R7VA 1PD0A 3M9BA 1OW8A 5DS6A 4BRYA 2OEVA 3NYMA 1LT9C 3PHLA 4I2LC 2XLWA 2J59M 4O9BA 2BL2A 1VQ6P 3EQ2A 3A2AA 4PR9A 1A7VA 2OYIB 5COFA 1G2CB 2N1TB 3L73E 3O6QA 5L3QA 3CCRP 3B29A 1GM5A 2WSSH 1SF8A 1N2DC 1NOHA 3NYJA 4UB8H 1T6AA 2XL8A 3B9QA 3TGUG 1ZV8A 1OMIA 5E33A 1SQQK 3WODF 3HE4B 3P8CE 4A7PA 5AW8B 3EQLF 3ABKC 2KK1A 1NKNA 1XWJA 2W4BA 1ZHWA 1OXZA 5APUA 3S1KA 2KS1A 1GW4A 4PJNA 3H1LG 2ZYAA 1X79B 2M5AA 1LTSC 5KYWB 1P84I 3GM1A 1FJPA 5L8RJ 3VRCA 4CDYA 3EZIA 3AE4C 2Z4EA 3RL0B 3SXYA 5A6AA 2R02A 3ABMC 1ZW2A 1M1JB 1L4AD 2XLMA 5M1BA 1OR3A 1VF5B 3AE3C 1SQQJ 4CPGA 2Y3DA 3H6PA 4CX9A 1Z3IX 3L71G 1H7IA 5K5GB 1L7CA 3KXDA 4GODA 2QEXP 3E70C 3ZQVA 2PGDA 2IXNA 3VM6A 1SQPK 1ZOYC 4IL6E 1ZHXA 1G8XA 2KJGA 3K6BA 3VF0A 5A6JA 4J30B 2JP3A 2ASRA 3IFMA 2IM8A 3I55P 4O6YA 3O6XA 1YTZI 2ZYDA 1TR2A 3JZ0A 1KYOI 3S4RA 1QVFO 2X0CA 5JS5A 2VB6A 2Q9AA 3CL3D 4BJTA 3L72J 1EZVI 4G78A 4CDVA 4E0IA 2J5UA 1MZ9A 4KHXA 2J0WA 1VQLP 4ULWA 2NUPB 1FOSF 4JURI 3DJUB 1JCDA 3GMAA 1SQPJ 2CW0F 3HD7A 3CCUP 4EOTA 1N8RQ 4JYBA 4IWBA 1MV8A 3VMXA 1IFPA 3SSUA 1IK7A 3FX0A 5BVZA 2QRXA 1Q0MA 3HTKB 1RE4C 2YQYA 4BJ6C 1JMBA 1IK9A 1WRGA 3M4BA 4UB6E 3SWKA 3L73D 4IAOA 3L70G 2OKUA 1TFOB 3FAJA 5B1AC 1RKEB 2BCCE 5B66E 1ZLLA 1TQGA 3Q1MA 3VOPA 1RE4A 3H32A 5B5EE 3HNLA 1L0NK 4H0LC 1VLSA 2BEZF 3Q5SA 1NTMK 4ZKPA 2K9JA 3FXEA 3T6BA 3US6A 1PGJA 2NPSD 4OINF 2XKMA 1BDCA 1TWHA 3HE5A 3QVZA 1Q2NA 2AP3A 4CS8C 1EQ7A 5KYUA 1HMOA 2E76B 2ZD9A 3AE1C 3L8IA 3W8HA 5L0GA 1ST6A 1ZYRF 2P6VA 2A06D 2H43A 5AW7B 3V6IA 1HH0A 4KI2A 1L0NJ 1L4AA 4CS8A 4HB1A 4XA4A 1Q0FA 1ZR4A 4R4MA 3AE7C 1NTMJ 3IQ6A 2E74C 3O6QB 1LT9B 1LTIC 1HMDA 2R3CA 3A11A 1H9GA 3H1IE 1OVVA 4D6TJ 2QLAA 3POVA 2NG1A 1QVGO 3AE8C 1MMGA 2A6HF 4CS7A 1CI6A 1FOSE 5AVZB 4DXWA 3EGDB 2WSCH 2IXMA 4RDAA 3H1HE 1A41A 4PD4I 1YVIA 3ABLC 2W45A 4JW1A 1A02J 1FJKA 1FTSA 3F89A 2ZXWC 4CBEA 2CYDA 4LDQA 4IJJA 2FYUD 4UB6H 2V7QJ 2KQ9A 1Q0GA 1JMMA 4XEFA 3TSIA 3QZCA 1KZUB 2K3RA 4ONSA 3RQEA 3EHMA 3H1KJ 1QLED 1LI7A 1NHLA 4OGQD 4E18A 5B66H 5AVQB 2WZ7A 1M8OB 3U8PA 1T01A 2RD9A 2J45A 1KFMA 4JCZA 5B5EH 3M0AA 3Q7GA 1YAUO 2OOCA 3ZTZA 5L0HA 3NMJA 3NXSA 5K0IA 1G4US 1OQCA 1TWAA 3H1JG 1KQLA 2E5TA 3LW5H 1SQQG 3L75J 2P67A 2R5DA 3SXKA 2R7OA 4NTBA 1FC2C 2YWAA 4YT4A 3AGTA 4EIYA 1BSNA 1L3PA 4N6JA 4QDLA 1X22A 2KXPB 3CCQP 1C17M 4MVMA 2FXOA 4EUKB 2A68F 2YL1A 4M63A 4Y28J 1YQ3C 3NRHA 3A7OA 2ZXXA 2B89A 1S7ZA 3WAQA 1GL2D 1CPQA 3UMKA 1YJ9P 1SVFA 2NPSA 2YLIA 3CC4P 2SPZA 5AW3B 1NTKE 2JPUA 1OFCX 3TGUE 4E7ZA 1L2PA 1OIPA 2W9YA 1RQUA 4WY4D 3V2RA 2MKVA 1VQPP 1NVOA 3JT1A 3QVYA 4OIRF 1SQPG 1H9TA 2R32A 3GEEA 4YPCA 2GM4A 4DJGA 1S05A 1T5OA 4BEJA 1UFBA 2P2UA 2R7RA 1VB5A 3H1ID 1FZCB 3M15A 4WGZA 1LWUC 2YO3A 3H32B 5DQZA 1ZXGA 3PMRA 4GOFA 5IY5C 3PLNA 3U1CA 3H25A 4C7NA 3HJCA 2KNCA 3U0CA 3HNJA 2OJQA 2YMKA 2P7VA 3H1HD 3MIWA 2DB4A 1PFIA 4AE4A 1JTHA 2KSEA 1URQD 3CCMP 2PP6A 5BQHA 2O3JA 2JD3A 3EWKA 1LWUA 2X51A 2B87A 4H0LB 3W8IA 4J32B 2J7PA 3DJNB 4D4XA 5EK0A 2KC3A 3S84A 2V4HA 2N1TD 2C0XA 2V3CC 3BRTB 2PAJA 1YARO 3MUDC 5GPGB 4EWCA 4XFJA 1JAFA 4EKWA 2H7BA 1JY2O 1R5ID 4MS2A 1L0NG 2MYSA 2IYLD 1M57D 2I8BA 1YIJP 1NTMG 1RF0C 3TK0A 1NAYA 1LE2A 2E74B 3MUDA 3FXDA 3CC2P 4HJGH 2Q3IA 2YO2A 1TU3F 1GL2C 4D6TG 1B68A 2AXTE 1N7SC 1AFOA 3T97A 1JY2P 1CSBA 1FAVA 3TNUB 1SQXK 4U7JA 3RL0g 3RL0D 1QQ3A 1YA7O 1NTKD 4KT0J 1FFTC 3HNIA 3LLKA 1GL2A 1IFDA 1ORJA 2R7XA 2M3EA 1VF5D 1BE3J 2D5RB 4ZLCA 2CNWD 1EC5A 1DH3A 2UWJE 3FOOA 2KK7A 3H1KG 2QIWA 1T6IA 2I15A 3B0PA 1SQBD 1R4TA 3S27A 2GA1A 1MUUA 2CCYA 2NUTA 4CS9C 2A45G 4HEAJ 1SQXJ 1FBMA 1URQC 3AOUA 2NPUA 2QSIA 3U3FA 1IC2A 2QM8A 5L0DA 3L75G 1G1JA 3D70A 5AVSB 3DD7A 3DM9B 3JYYA 3MGNA 2YMYA 3CXHE 2P1AA 2HZ8A 4CS9A 5E79E 2M4EA 1FZAA 3CMAP 3EFGA 5CCGC 1URQA 1JR8A 2C04A 5T3WA 2J9UA 2J46A 4B6IA 1YZCA 2XL4A 2R44A 1RXQA 1EDKA 1ZU4A 3WUTA 1KU2A 1YJNP 2BASA 3CQZA 1ZHZA 3JCUQ 3JSZA 2IFNA 1IJDB 3GHGB 2AEJA 3Q5RA 1GS9A 1SLQA 3E1RA 1M57C 2OYIA 1G2CA 3M0DC 4AUWA 1QSPA 2KZIA 4K3AA 1WGWA 1PPJG 3G4SP 4U3FJ 2KIKA 2AXTH 2GDCA 4MVSA 5E3CA 4A2NB 3DI5A 3CAXA 3I56P 4C7NB 2H7VC 4LGDE 2XM4A 4N06A 3U2LA 3ZC4A 3V7OA 4EIJA 4JJFA 1JTHB 2YXQB 3HE4A 1KQFB 1DIPA 3BRVB 1ORYA 2IYPA 3VYWA 1J8YF 1M1JC 3L4FA 3GWLA 3T4RA 3H1JE 1IFNA 1S9KE 5APTA 3IAOA 1QL1A 1NGMB 3FVYA 3AE6C 3EG9B 5KYWA 2RMZA 3TQOA 1Z56A 5AVVB 3OA7A 2FFDB 4B86A 4C3DA 4DRIB 4DJ9A 2CPSA 4EBJA 2ZXRA 1M1JA 2W6AA 2LKMA 2LFDA 2W8ZA 4JF7A 4U9EA 3TK1A 4JJGA 3L74J 1XTCC 2HR3A 4I6MC 2CNWA 2ETSA 5KKZC 1MKMA 2YLDA 2WSFJ 3CCEP 3V2QA 2V26A 2O01N 1T3UA 3CEXA 4PJMA 3CXHH 1KB9D 2GUVA 2EIMC 2J9BA 5AVXB 3GEHA 2GAQA 2QG4A 1BCCE 1JRAA 5E79H 2KB7P 2KNHA 1HTLC 3KYJA 4W80A 3GORA 1GQAA 5F28E 3CXHD 3ZDMA 3KL4A 1A7EA 2L91A 2WWWA 5F5FA 2EILC 4MN4C 1ZMEC 1A02F 2IBZD 2FYNC 5L0IA 1AUEA 5BQIA 2CDQA 1D7MA 4RD9A 3H65A 1KQSO 2PFXA 1AA0A 2C9LY 1N7SB 2WQYC 2YIUC 5L0JA 3AEDC 2DW3A 1R8EA 1IO4A 1H6GA 4U5EE 3T6GB 2DYSC 3AECC 4N6CA 1D0XA 2JR8A 3SP1A 2R7TA 1BE3G 1VQ9P 2PFDA 2LQGA 1RKEA 4W7ZA 5KAIE 4L76A 5D91A 2LCHA 4XE5B 2M8RA 2QM7A 5KLVK 4PJJA 5KYXB 4OIOF 3BASA 2G3AA 4NPEA 2CPBA 2YKZA 3II6A 3DAFA 3IQCA 4KNWA 2QJKC 2J58A 3Q2YA 2E76C 5B3SC 1SQXG 1LE4A 3CWBD 3H1JD 1MNEA 1S9KD 2W6JH 2VCCA 4GDOA 3WU2E 2P58A 4XLNF 2L6FA 4GQHA 1KMIZ 4YL1A 4YT2A 3GLMA 4FESA 3RQGA 1NTME 5CI8A 1NSGB 3QMKA 4R32A 4YTPC 3AG2C 4GKGA 1O3UA 3S9OA 2DYRC 2VCBA 3RQFA 4BXLA 5KLVJ 3CMEP 2RKLA 2QNLA 4D6TE 4L75A 1QKRA 4LLCA 3FAPB 4AX2A 5APYA 1ZU5A 1TWCA 2D2CB 4RESB 2R7UA 3GW6A 1I5NA 3RVYA 4RBNA 1FNTc 1LT9A 1BCCD 1K04A 1WTYA 4IOIH 3S28A 1OCOC 2K9YA 3A0HE 1GMJA 4IFDK 2R7QA 2Y9YA 2FXMA 2Q9CA 4QI0A 4XEKA 4BJ1A 3JCUE 4MVUA 5EGYA 4U3FG 4N3YB 2WZLA 4P6IC 3V5XA 2BC5A 4H44C 3EGDA 1YJGA 3O8ZA 2XS1A 1T2KD 2L6GA 3H1KE 4JKVA 1N86A 4H0LD 1U7MA 3U9JA 3KQGA 3LIEA 2WVQA 1GDTA 4XWJA 1VYIA 3AEEC 3N7NA 4H13B 1GD2E 2OTJP 1L0LK 1EZVG 1AQTA 5AVUB 5KAIH 1ZZPA 1V54C 1NTZK 1IFMA 5DJUB 3A0BE 1LTBC 4C7OB 1DD4A 3Q5PA 1MMNA 1M1KQ 1PP9J 1HGZA 1DOVA 1OXBA 1N7LA 1T8ZA 4YN0B 2Z15A 3MZWB 3X2QC 3L74G 4U5HA 3RVZA 2E74D 1T6QA 2KP8A 4BWNA 3OA1A 3B4SA 5T3TA 3WU2H 5KKZB 1VYKA 3C1LA 1NFOA 2QE7H 1L0LJ 3VYIA 2EPLX 2AEMA 1CGNA 3UMHA 4Q5SF 3E9VA 1SQVE 1NTZJ 2NZ2A 3VMAA 2YL7A 2XXAB 2J9VA 1F1MA 4EBBA 1NU1E 2PNOA 1NTMD 1QPUA 1JPNA 1JPJA 5CHXA 1N73C 2XU6A 3DKAA 3QW0A 1FMWA 2FYNB 3ITKA 1FZCC 3A0HH 3KHUA 5APQA 5JRAA 2YRFA 2Q9BA 3O55A 1FZBA 4DBQA 2HFIA 1VQ8P 1BR2A 3JCUH 3U3BA 1JB0J 4YK5A 2YIUB 2V7QH 1QX8A 4K1OA 3DWWA 3TYYA 3SZRA 256BA 4Q4ZF 3NTNA 2JDIH 1BGYE 2MJZA 4Z9HA 4YWQA 1ZHYA 1FZCA 3EJNA 1G4WR 2IBFA 4BJ6A 3C8VA 4L74A 5APWA 3Q6NA 5DQTA 1T2KC 4E17A 2IYOA 3P8CD 2F22A 2K37A 1W2BO 3BCCE 2ITAA 4NTFA 2A45H 3AEFC 4XPWA 1CGOA 4GOEA 3ZTMA 3CCVP 3JSEO 3L37A 5HSWA 1JM0A 3KPHA 5DVWA 4GIFA 1WOLA 3TULA 1H0TA 3A0BH 4FWVA 2QJKB 2RH0A 2Y9ZA 4I3MA 2Q1KA 2J0XA 1NLXA 4IL6H 1YJWP 1C02A 2KYHA 1XTGB 2FFHA 1CW5A 1GK4A 1LTAC 1SMYF 4XPYA 2O01H 2GA0A 5F5HA 2P1JA 3V2NA 5JVEA 3D6ZA 1VQ5P 1IW7F 3H2VA 5KLVG 1EI7A 3B5NB 1V74B 4PACA 4D4NA 3S90A 3ZVRA 4XPXA 2ZXEB 2HSQA 3T6JA 4AL1A 2H8PD 1DOWA 5BU8B 5EHHA 4J7YA 4PJ0E 1S5LE 2HFED 1LPEA 4LACB 1SQVD 1HF9A 4L73A 1O87A 1JOGA 1IZMA 2WVRA 2HPCB 3EPVA 2J7PD 3K33A 1KILB 1NU1D 1NZEA 1PCXA 3V4QA 1Z5ZA 1RMVA 3TNUA 2YKPA 4H44B 1HJBA 5FCLA 2R7SA 2WVOA 1Z23A 4ZLDA 2FYZA 3CCJP 4C3BA 2G62A 3C7JA 4IFMA 3L73J 3KYQA 1KB9I 1X0TA 1X9VA 3EFFK 2M0BA 5TISE 2I1KA 3UIAA 3PTZA 2DI3A 1VLTA 1SQXE 4Y99C 4DOJA 2WTYA 2W6BA 3CCLP 3CXHI 2ZAEB 2BCCD 2MHRA 2IPPA 5H2FE 1BGYD 2WL8A 3ASNC 3G6EP 1AV1A 3TF5A 2G3VA 1OVRA 3C8GB 2FY8A 2O1KA 1IFJA 2IBZI 3P8MC 3BCCD 4HE8D 2LIGA 4JYCA 3DMDA 1HW2A 2JKVA 4L6RA 2P0NA 2QJPB 4MQ9F 1BDJB 2YEVA 5CI9A 3V4WA 3MX3A 4JTAB 1P84E 3CZ6A 2IX7C 4BPMA 1XZQA 4IAQA 4AQRD 1AEPA 3GHGC 2JO1A 1L0LG 2XNXA 3BVHA 1FDMA 3L72G 1N7SD 3NKEA 1YA9A 3KH2A 1NTZG 3SNHA 3VP9A 3NG1A 2FYUK 2HYNA 3QH9A 2KZJA 5JUAA 2QTVA 4NPFX 3GHGA 4HFFB 2POHA 1H88A 4IB4A 4PV1B 1N73B 3H1LE 3SWYA 4PJ0H 1S5LH 1OKKD 3HKKA 3ZSUA 3HUSC 3GANA 3I5QA 1LKXA 3NYLA 1Y9BA 3FWNA 1KYOE 3TJ5A 1R5LA 1K73Q 2KLUA 2R9RB 4AL0A 2YHSA 3AG4C 1JY3N 2M64A 2YNYA 1D1BA 2FYUJ 2WSCJ 3L71E 3FGAD 2OTKE 1W2EA 2FFDC 1LGHB 3CCSP 5AW0B 1LIHA 4LDRA 3EH1A 5TISH 3BRJA 1H0TB 4MTFA 3OWTA 2MWQA 3L74E 3EG9A 4PK4A 4IARA 3WUUA 4JVSA 3J06A 5CCGD 2FFDA 3O10A 3B0UX 1JMWA 5H2FH 1RE3C 1Q82Q 3NMKA 5DS4A 3RBXA 1SQXD 2J8WA 3G9RA 2D2CD 3NMDA 4JRZA 1RJ9B 2WITA 1LI5A 2QJYB 4DRHB 1HE1A 1RY3A 5B1BC 1FR0A 3LW5J 4AYCA 2A69F 1G1IA 4Z9IA 1P84H 5E2QA 1NAFA 2AWYA 3C9IA 1GTWA 1NG1A 3V2PA 4MVRA 1AJYA 4DT0A 3LJBA 3L70E 2Q5UA 5JT4A 1RF0A 3P32A 1MQVA 4H13D 1KORA 3NKDA 2XZRA 3TGUD 5KJ7C 3RK3C 3LNRA 5CMZA 1N7SA 2EIJC 1KYOH 1ZP0C 1KD1Q 1NH4A 2KSFA 2WSEH 1ORSC 1PGOA 3H1LD 1ZRTE 5AC5A 4I1OB 5KJ7A 1Y47A 3M06A 2PP4A 1Y8AA 2Q00A 2P10A 5CBNA 2E42A 4OWFA 1KYOD 1RF1C 4H54A 1PIXA 3PRJA 1Z6AA 3H1HJ 5C39A 2KYVA 1OKKA 1NJIQ 2G3KA 1LJ2A 4Y99B 5GTIE 3AE2C 3T9OA 2G8YA 2IOQA 5KYXA 1U0BB 1M56D 2B9BA 1HW1A 4JCHA 2HSBA 4JPZB 3L71D 1APCA 2KI7B 5APXA 1KNYA 2WSFH 4RO0A 3N4XA 2VC9A 2YZSA 2HV6A 3U1AA 4EDFA 1NU9C 1KILE 5KLVE 2HJMA 2N9BA 4JTCB 3L74D 3VAYA 5APSA 2UUHA 1JO5A 3AE9C 1VQOP 4TLFA 2RSEB 2D2CC 2A06G 5CIVA 4WGYA 1NTKK 3U2MA 1GZLA 3HNKA 5CCGA 3WUVA 3CX5E 3C18A 3I4UA 1D0YA 3DZAA 5AVYB 1FZGA 2L5GB 4JTDB 4JIOA 3CSKA 4XLPF 1OVUA 4LERA 2B0HA 4FAPB 4DCKA 1SQBK 1USDA 3NFQA 4IFFA 2Y3GA 5BQGA 3PHF2 1YZAA 2YL0A 2XLVA 1ZHTA 3M0DA 3EHNA 2NRGA 3HUSB 1H8AA 3SXMA 5AC4A 4DOZA 2C9NY 1FDIA 3L70D 1NTKJ 1QEXA 4H13C 2Y0EA 3GG2A 1VQNP 2PX3A 4IL6X 1SQQE 1MFTA 3KZIE 3IHUA 4BJ5C 2Q4FA 2E76D 2FYUG 2R05A 2VCAA 4HKZH 2Y69C 2GFHA 3RH3A 5DS5A 3SEOA 2QY9A 3F5HA 1UIXA 2HKVA 3OW2O 1HY5A 1Y4CA 3G4XA 3I5PA 1QVXA 4OIPF 1SQBJ 1R5SA 2HMQA 2Y0DA 4QI2A 1ZRTD 5GTIH 3USSA 4BJ5A 4KC9A 4O79A 1OCZC 4MNDA 2AWCA 1PD1A 4WABA 4C7OA 1V55C 1KFNA 2M3BA 3L8JA 2KUBA 1L0LE 1M56C 1LVKA 3L72E 1HJ0A 2IXPA 1E85A 1X8YA 2FAPB 1NTZE 4AK9A 1RCPA 2AEFA 2IZ1A 4MVQA 1OW7A 1GGQA 2ZYGA 3CPWO 2WZGA 3BEHA 1S1CX 1SQPE 4KJMA 2KLVA 3EZHA 3ITFA 3HRNA 1RKCA 3C8ZA 5DLJA 2LK4A 4EI2A 2IXOA 1E2XA 4TT3H 3SYNA 1U57A 4H44D 4ANJA 2XXAA 4O6NA 1M7LA 3CX5H 1M2OA 2H88C 3GF3A 2FBWC 2Z5HA 3OAKA 3W68A 3NDBB 2E5YA 2HMZA 1BZ4A 3B0VC 1O5HA 3CX5D 4BEMJ 4ASWA 2A1DD 1S4XA 3LS1A 3RK3B 3LESA 1OWAA 3U8VA 1T6UA 2XL6A 2L7AA 4MTOA 3MD0A 2Q3EA 5AW4B 4OD5A 3C8GD 1OZHA 4G0HA 2DGJA 1BBHA 1SFCB 3GODA 1VQ4P 3K1IC 1SP4A 1U6HA 3MTUE 1U89A 2WZFA 3U5SA 3KZIH 3W4YA 5E3AA 3UMIA 4WWIA 3EH2A 1RF1B 1Q0KA 3H1HG 1J1EB 4WY4B 5AW5B 5AW1B 1BDDA 1GU5A 1M2VB 1SQQD 3L34A 2ZT9C 3EFOB 2XM0A 1DD3A 1SYQA 2OG2A 3L1MA 1E86A 3KKBA 3LEOA 1L0NE 1FE6A 2OU6A 1EDLA 2E75C 2ZJSE 1DEEG 3B8EB 5KYYA 4ZMDA 5TJ5E 1OCCC 1S5LX 5BUOA 1S2EA 2YLGA 3JRMO 4K35A 2IDBA 3B5NC 1YYCA 1KTMA 2OYHB 4PV1D 1KC8Q 1CPRA 1CZQA 5AGFA 2HV7A 4J7TA 1SZIA 1AVOB 3DM5A 3L72D 3PP5A 1NTZD 2QE9A 3B5NA 2XLOA 2EIKC 3AGUA 1KILC 4N4WA 1PV3A 1FZFA 1HUCA 1FZEA 4MVZA 1SQPD 3FXHA 3FMSA 2Q3TA 3O39A 1DEBA 4E0HA 2H7OA 3HLZA 1FAPB 1Y6DA 4EHPA 1WWPA 2HPCA 1LP1A 1KILA 4NQFA 3CC7P 1EA8A 4I44A 1NTKG 2VH3A 5TJHA 3AQBA 3RK2C 1NFNA 4W7YA 3L75E 2OEXA 4PFPA 5KTBA 1ZVZA 2ZVNB 5A69A 4CDAA 5BU5A 1PGQA 1JOCA 4JQ0D 1WT6A 2TMVP 1NO4A 1U7JA 2QJPC 1Q7YQ 1SQBG 1E79H 1JY3O 4KBLA 3NMIA 4LLEA 3A9CA 5COGA 3F47A 2A06E 4U5FE 4RKUJ 1UIIA 3C8GA 3CWBJ 1K05A 3H1JJ 2LXBA 4DVYP 2LD6A 2HUJA 3WMM0 2Q7CA 5B3IA 3C62A 1GK6A 3JTLO 3L36A 2ICWG 3VN0A 2WT7B 2I8DA 3UGPA 2OQQA 4JEAA 3G4ZA 4YT5A 1JCCA 5CCHD 1JY3P 1L0ND 1PPJE 5L0FA 5KLIC 1YHQP 3IEEA 2Y3HA 1FDOA 1OX3A 1OCRC 3IR9A 4PV1C 3G50A 1OR2A 1AVYA 2OJED 4IRUA 1YTZT 1J1DC 3HD7C 4D6TD 2JX0A 2XNDH 3UNGC 1BCCJ 4HH2A 2Y0CA 3SXZA 2B0JA 3ZDLA 3MYIA 2Y39A 1JEKA 3R4YA 4PFOA 1N73A 1LTJB 1FMVA 3A3YB 1NBBA 2EPKX 4IGGA 2FYUE 2AVKA 4OVNF 3JYHA 2Y3BA 1ZN5A 3ABVC 3B71A 2FKWB 4CIHA 2Z5IA 5GTHE 1H89A 1RQVA 3PH0A 4U9DA 3DAGA 4JE9A 3K1HA 1MMDA 3AEGC 2NSFA 1VQKP 3H1KD 1YITP 4HYTB 4CJGA 2LFFA 3Q6MA 3UR3C 1YBKA 4Z9JA 1D0ZA 3ECSA 2LR2A 1D1CA 4MVOA 4I7ZC 3TJ6A 5KYYB 4I1MA 3V5BA 3M91A 2OTLP 2XDJA 3ZWIA 2QJYC 3L75D 1K8AQ 3VMYA 2A6EF 4CIPA 5D92A 2ZT9B 1T3JA 2HODB 3W2WA 5AW6B 3PJSK 3M4CA 3RK3E 3I5CA 3KPEA 2H8AA 4DBRA 3EGXB 2E75B 2W4MA 5DJTB 1EDJA 3GWNA 1RJ9A 1L4AC 3RF3A 1EXIA 1SS1A 4GT1A 1QZXA 4BRYB 3FOPA 1GU4A 2PBEA 1BR1A 5AW2B 3MYFA 2L81A 4NY3A 2XSEA 2PX0A 1G5ZA 1EKYA 2P7JA 3CD6P 5CCHC 4YXDC 3V5ZA 1BR4A 2PRRA 3BATA 2O9XA 3VTPC 1BE3E 1PPJD 1LP1B 4K0DA 2OCCC 2YL3A 4OH8B 4DVZA 4YXWH 2IBZG 4XTKA 1VMAA 3RBZA 2BEQD 1UG7A 4Q7CA 3TOMA 5CCHA 1VPCA 4U5CE 3RGUA 2ZXOA 1QGKB 1SR2A 1VK5A 2XRHA 4WB4A
chains in the Genus database with same CATH topology
2E75C 2E76D 5M1BA 3AEFC 4XEKA 1UFBA 4XEVA 1VF5B 3AE3C 4R4MA 3AE7C 4OGQC 2JX0A 1S5LX 3IN6A 2E74C 1KORA 1UIXA 2FXPA 4H13D 3K7DA 4H44C 3SFDC 2IDBA 2JO1A 5F28E 1KTMA 3U3FA 2QSIA 1QVXA 4PV1D 2L6GA 3R4YA 1WOLA 3MFNA 3GF7A 4H0LD 3D70A 1ZOYC 3JYYA 3TULA 3H25A 1ZMEC 3U0CA 2JP3A 1ZP0C 3AE5C 2H89C 3AE8C 2YMKA 3ABVC 3B71A 1RQVA 2FYNC 1ZRTE 3L8JA 3AEBC 3AEEC 4H13B 3EWKA 3JZ0A 1KQGB 1HJ0A 2Q00A 2P10A 4PV1B 3AEGC 2WQYC 1PV3A 1ZZPA 1PIXA 2YIUC 4H0LB 3D6ZA 3AEDC 3AJMA 2J5UA 2ZT9D 4IL6X 1Y9BA 3AE2C 1OW7A 1DD4A 3Q5PA 1R8EA 2G8YA 2V7QJ 1Q90D 4XEFA 1S1CX 2L6HA 1WMKA 3AECC 3D71A 3RQEA 3GMAA 1WWPA 2HSBA 2E75D 4I7ZC 3Q5RA 1KNYA 2WSEJ 2LK4A 4NQFA 4OGQD 4EBKA 2E74D 4TT3H 2WSCJ 4Z1MH 2QJYC 1VF5C 1U57A 4H44D 1OW8A 3FGAD 1KILE 1IK7A 2ZT9B 4XFJA 3Q3DA 2H88C 2O01J 3GF3A 1HF9A 2FBWC 3D6YA 1JOGA 2G3AA 3BRJA 3RK3E 3AE9C 2E75B 2D2CC 2QJKC 3Q2YA 1EXIA 2E76C 4OGQB 2NZ2A 4R4LA 1KQFB 2E74B 1DIPA 4H44B 2YWAA 3O10A 3O6QA 2QJPC 3Q1MA 4GDOA 2PBEA 1TU3F 3C18A 1OW6A 2L6FA 1KMIZ 3GLMA 3IAOA 3G9RA 3RQGA 2D2CD 4H0LC 3C8GD 4Y28J 1NGMB 1OMIA 4RKUJ 3C8GA 3AEAC 1NYHA 1K05A 1YQ3C 2BEZF 2WPVB 3AE6C 4YTPC 4YXDC 3Q5SA 4R32A 3GM3A 1VL2A 4U7JA 3RL0g 3S9OA 1O3UA 1V4AA 3RQFA 4KT0J 3LW5J 2KK1A 4EBJA 1EXJA 1K40A 1JB0J 1VF5D 2OQQA 2JPUA 2BEQD 2D2CB 3T97B 3C8GB 1FDIA 5KLIC 2E76B 1PL5A 3GM1A 3AE1C 3L8IA 4H13C 5L8RJ 5KKZC 1YQ4C 1MKMA 1K04A 2ZT9C 2WSFJ 1FDOA 1RQUA 3GM2A 1DD3A 2MKVA 3AE4C 3C8VA 1AJYA 3SFEC 1WTYA 4PV1C 2K9YA 4I7ZB 1GMJA 2QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEF C;  4XEK A;  1UFB A;  4XEV A;  3AE3 C;  3AE7 C;  2JX0 A;  3K7D A;  3SFD C;  3U3F A;  5F28 E;  1KTM A;  1QVX A;  2L6G A;  1WOL A;  3MFN A;  3JYY A;  3TUL A;  1ZOY C;  3U0C A;  1ZP0 C;  3AE5 C;  2H89 C;  3AE8 C;  3ABV C;  3B71 A;  3L8J A;  3AEB C;  3AEE C;  3JZ0 A;  2Q00 A;  3AEG C;  2WQY C;  1PV3 A;  1ZZP A;  3AED C;  3AJM A;  3AE2 C;  1OW7 A;  4XEF A;  2L6H A;  3AEC C;  3RQE A;  1WWP A;  2HSB A;  1KNY A;  2LK4 A;  4NQF A;  4EBK A;  1OW8 A;  2H88 C;  2FBW C;  1JOG A;  2G3A A;  3BRJ A;  3AE9 C;  2YWA A;  3O10 A;  2PBE A;  3C18 A;  1OW6 A;  2L6F A;  3RQG A;  3C8G D;  3C8G A;  3AEA C;  1YQ3 C;  1K05 A;  3AE6 C;  4YXD C;  4YTP C;  4R32 A;  3GM3 A;  1O3U A;  3S9O A;  3RQF A;  1V4A A;  2KK1 A;  4EBJ A;  1K40 A;  2JPU A;  3C8G B;  3GM1 A;  3AE1 C;  3L8I A;  1YQ4 C;  1K04 A;  3GM2 A;  3AE4 C;  1WTY A;  3SFE C; 
#chains in the Genus database with same CATH topology
 2GWW A;  2ZPA A;  4P9F A;  2KS1 B;  5GTH H;  2L9J A;  2M5A B;  2KW3 C;  4C46 A;  3K7D A;  3RK2 B;  3SFD C;  3WHN A;  1LS4 A;  4NCQ A;  4U5D E;  4WJ0 A;  2XLD A;  2R3S A;  2K88 A;  1PP9 G;  2WMM A;  4YJW A;  1K9M Q;  4WBA A;  1HVV A;  4KNV A;  4P9T A;  2VRS A;  3AG3 C;  3F46 A;  2WPR A;  3GEI A;  4DRJ B;  3CWB G;  3CX5 I;  3JSV C;  4LC1 A;  1C03 A;  1SQV K;  3G71 P;  2R25 A;  1ZR2 A;  1HGV A;  3LS0 A;  3N2Z B;  1Z63 A;  2Q6Q A;  4W8P A;  4A4A A;  3OJA B;  2NPS C;  1NU1 K;  4G7Z F;  1Z7Q c;  4U3F E;  5KLI B;  2LXC B;  5KJ7 D;  4CSA C;  3RK3 D;  2YXR B;  3LNM B;  3R7C A;  3Q3D A;  5JLI A;  5APV A;  2O01 J;  1Q81 Q;  4W8K A;  3D6Y A;  4GYT A;  4C7R A;  2JJL A;  1DX7 A;  2P61 A;  1J1D B;  3HD7 B;  1J8M F;  4MTG A;  1SFC D;  1BCC G;  4R4L A;  2WPS A;  2R7W A;  4CSA A;  1SQV J;  2AXC A;  4O6M A;  4MW8 A;  1EZV E;  1IFI A;  2XLH A;  2IFM A;  1T9K A;  5L3V A;  3S0X A;  1WN0 A;  1NU1 J;  3HUS A;  2YVK A;  1ZW0 A;  1M90 Q;  4UDV A;  1NYH A;  2WPV B;  2OQM A;  1BE3 D;  2ZXP A;  3QW1 A;  5CJ0 A;  1V4A A;  1SQB E;  1VQ7 P;  3WG7 C;  1D1A A;  3RIP A;  3N0T A;  5L0C A;  2W83 C;  2CGE A;  1A0B A;  1PL5 A;  2QUP A;  2HG5 D;  1YQ4 C;  2BCC J;  2K9J B;  2CK3 H;  3M9Q A;  1BGY J;  4I7Z B;  4N78 E;  5AVW B;  3DXJ F;  3HE5 B;  4JEB A;  2LSE A;  3L35 A;  5KYU B;  1QLE C;  1JUN A;  3BCC J;  4OGQ C;  3N24 A;  2FXP A;  2GUS A;  2YKO A;  3FHD A;  1RE3 A;  2D4U A;  2R5B A;  3MFN A;  3R2P A;  2YKQ A;  4ASV A;  5AW9 B;  3KDP B;  1LTT C;  3RFY A;  1M6T A;  3AE5 C;  1L4A B;  2UUI A;  1P84 D;  2FGY A;  3AEB C;  1VDF A;  2OYO A;  2XLE A;  2WB7 A;  4N6H A;  4JC7 A;  3FWL A;  1TFK B;  3M1C B;  2KOG A;  3JC2 2;  2J9W A;  5A6K A;  1CI6 B;  3Q7L A;  3DE8 A;  1E83 A;  2L6H A;  3LAY A;  4U3F D;  4FX5 A;  3G3Z A;  3LEV A;  4NTA A;  4YL0 A;  1NKZ B;  1VQM P;  3H1I J;  4CJO A;  4EBK A;  1SFC C;  2VAS A;  5JSL A;  3FDQ A;  3L73 G;  1N1C A;  1TWG A;  3IF4 A;  3IQ5 A;  2NSG A;  1J1E C;  4WY4 C;  3ZG1 A;  3IPM O;  3W2V A;  4EYY Q;  2QVA A;  2WPQ A;  4NC3 A;  1EZV D;  2JWA A;  4G7O F;  1SFC A;  3CI9 A;  2B88 A;  4PD4 E;  2BE5 F;  1YYJ A;  1AQ5 A;  3JRT A;  4K7B A;  1RF1 A;  4WVZ A;  2C0W A;  4WY4 A;  1MND A;  4OIQ F;  5FZT A;  4RJT A;  1XZP A;  2W27 A;  1J2J B;  2A0B A;  3AEA C;  3A5T A;  1M2V A;  1ZW3 A;  1KB9 E;  2HLO A;  4PJL A;  3EFO A;  1VL2 A;  2OYH C;  1LT1 A;  3LUT B;  1K40 A;  3K66 A;  1W2W A;  2Q7R A;  4JBZ A;  3AG1 C;  3QWO C;  4N78 D;  4I1L A;  2OYH A;  4QMA A;  2HS5 A;  4ER9 A;  5EFW B;  3ATP A;  4M3L A;  2NPS B;  1S3J A;  3ZQY A;  1AVO A;  4JZA A;  1EQ1 A;  2IBZ E;  4ZKU A;  3AQC A;  2OYI C;  2N1T C;  1LTG C;  3RKO F;  3IN6 A;  2C03 A;  5CBO A;  2OAR A;  3QTH A;  2OGU A;  3LLI A;  2A45 I;  3H2U A;  3K5B A;  3GF7 A;  1I4Y A;  3TD7 A;  1FU1 A;  5JP7 A;  2EPO A;  1SQV G;  1VTM P;  2N1T A;  3TGU J;  2A0U A;  1HE9 A;  5A6B D;  1RH5 B;  2EIN C;  2XS8 A;  4ULV A;  1S72 P;  3MHV A;  1NU1 G;  2KGO A;  1KN7 A;  1OXK A;  4X0R A;  3V5Y A;  3OEO A;  2KNC B;  1QL2 A;  1PP9 E;  2XV5 A;  3M9H A;  3H1L J;  3AJM A;  4GEH A;  2ZT9 D;  3U9M A;  2AU5 A;  4AE4 B;  5T1D B;  2I1J A;  2K1A A;  1WMK A;  3SWF A;  1PZQ A;  3RL0 C;  1LWU B;  2E75 D;  3IQT A;  3C63 A;  2B87 B;  2WSE J;  3TOL A;  3MBG A;  3CWB E;  4PD4 H;  1VOM A;  3U59 A;  1JNM A;  4Z1M H;  1VF5 C;  2JWD A;  2BCC G;  2W90 A;  3B5N D;  2O1J A;  1BGY G;  2N9Y B;  3L71 J;  4C3E A;  5HV9 A;  1BSH A;  4PD4 D;  1IZN B;  4LLH A;  4MW3 A;  1YLM A;  3BCC G;  1W5C E;  3VMZ A;  1KB9 H;  4OGQ B;  1CGM E;  2ZFC A;  5AVR B;  5KAF E;  2KSJ A;  2RN0 A;  3P7K A;  4NPD A;  2HJ3 A;  1YDI A;  3VP8 A;  1KIL D;  1OW6 A;  4F4B A;  5KLV D;  2WVN A;  2WT7 A;  3PCV A;  1NWQ A;  4U5G A;  4H4K C;  2E43 A;  1KV4 A;  3GM3 A;  2QA4 P;  1EDI A;  4YL3 A;  1WAT A;  3KMI A;  1RHZ B;  1LTJ C;  1LNQ A;  3UGO A;  1MFZ A;  1EXJ A;  4O7G A;  5COM A;  1FFH A;  3X1O A;  3TDK A;  3T97 B;  3DE9 A;  2IZ0 A;  4UB8 E;  3RK2 D;  1Q0D A;  2NUP A;  3CLQ A;  3GM2 A;  3HTK C;  3SFE C;  4XQ1 A;  4ZNC A;  1LTJ A;  1GL2 B;  1HBW A;  3H1I G;  3L0I A;  3LID A;  3L70 J;  4LDK A;  4XEV A;  4DZO A;  1NU7 D;  2JEE A;  3ASO C;  4HFK B;  3E1I A;  2EPM X;  2LP4 A;  1I4Z A;  3HTK A;  1HWT C;  1E84 A;  1Q86 Q;  1YYX A;  4U5B E;  2Q9I A;  1USE A;  1WAS A;  3KYI A;  2H89 C;  2NUT B;  3K1I A;  2ZVO B;  1PGP A;  1FS0 E;  1GW3 A;  3E7K A;  5KYN A;  4BG0 A;  5A6B A;  4G7H F;  1LM3 B;  2PF4 E;  1PP9 D;  1KQG B;  1LS1 A;  4YT8 A;  5CJ4 A;  2R03 A;  4OD4 A;  2H7H A;  3W67 A;  3MLG A;  1JY2 N;  2E87 A;  3M79 A;  2EPN A;  3PDM P;  1MMA A;  4E7S A;  2HOD A;  1Q90 D;  3D71 A;  1URQ B;  3ZIB A;  1YI2 P;  3MP7 B;  3RYL A;  1TKN A;  3RW0 A;  3EGX A;  3HD7 D;  3S29 A;  1L0L D;  1A7D A;  5AVT B;  1E5W A;  5KAF H;  2R7V A;  1PD0 A;  3M9B A;  1OW8 A;  5DS6 A;  4BRY A;  2OEV A;  3NYM A;  1LT9 C;  3PHL A;  4I2L C;  2XLW A;  2J59 M;  4O9B A;  2BL2 A;  1VQ6 P;  3EQ2 A;  3A2A A;  4PR9 A;  1A7V A;  2OYI B;  5COF A;  1G2C B;  2N1T B;  3L73 E;  3O6Q A;  5L3Q A;  3CCR P;  3B29 A;  1GM5 A;  2WSS H;  1SF8 A;  1N2D C;  1NOH A;  3NYJ A;  4UB8 H;  1T6A A;  2XL8 A;  3B9Q A;  3TGU G;  1ZV8 A;  1OMI A;  5E33 A;  1SQQ K;  3WOD F;  3HE4 B;  3P8C E;  4A7P A;  5AW8 B;  3EQL F;  3ABK C;  2KK1 A;  1NKN A;  1XWJ A;  2W4B A;  1ZHW A;  1OXZ A;  5APU A;  3S1K A;  2KS1 A;  1GW4 A;  4PJN A;  3H1L G;  2ZYA A;  1X79 B;  2M5A A;  1LTS C;  5KYW B;  1P84 I;  3GM1 A;  1FJP A;  5L8R J;  3VRC A;  4CDY A;  3EZI A;  3AE4 C;  2Z4E A;  3RL0 B;  3SXY A;  5A6A A;  2R02 A;  3ABM C;  1ZW2 A;  1M1J B;  1L4A D;  2XLM A;  5M1B A;  1OR3 A;  1VF5 B;  3AE3 C;  1SQQ J;  4CPG A;  2Y3D A;  3H6P A;  4CX9 A;  1Z3I X;  3L71 G;  1H7I A;  5K5G B;  1L7C A;  3KXD A;  4GOD A;  2QEX P;  3E70 C;  3ZQV A;  2PGD A;  2IXN A;  3VM6 A;  1SQP K;  1ZOY C;  4IL6 E;  1ZHX A;  1G8X A;  2KJG A;  3K6B A;  3VF0 A;  5A6J A;  4J30 B;  2JP3 A;  2ASR A;  3IFM A;  2IM8 A;  3I55 P;  4O6Y A;  3O6X A;  1YTZ I;  2ZYD A;  1TR2 A;  3JZ0 A;  1KYO I;  3S4R A;  1QVF O;  2X0C A;  5JS5 A;  2VB6 A;  2Q9A A;  3CL3 D;  4BJT A;  3L72 J;  1EZV I;  4G78 A;  4CDV A;  4E0I A;  2J5U A;  1MZ9 A;  4KHX A;  2J0W A;  1VQL P;  4ULW A;  2NUP B;  1FOS F;  4JUR I;  3DJU B;  1JCD A;  3GMA A;  1SQP J;  2CW0 F;  3HD7 A;  3CCU P;  4EOT A;  1N8R Q;  4JYB A;  4IWB A;  1MV8 A;  3VMX A;  1IFP A;  3SSU A;  1IK7 A;  3FX0 A;  5BVZ A;  2QRX A;  1Q0M A;  3HTK B;  1RE4 C;  2YQY A;  4BJ6 C;  1JMB A;  1IK9 A;  1WRG A;  3M4B A;  4UB6 E;  3SWK A;  3L73 D;  4IAO A;  3L70 G;  2OKU A;  1TFO B;  3FAJ A;  5B1A C;  1RKE B;  2BCC E;  5B66 E;  1ZLL A;  1TQG A;  3Q1M A;  3VOP A;  1RE4 A;  3H32 A;  5B5E E;  3HNL A;  1L0N K;  4H0L C;  1VLS A;  2BEZ F;  3Q5S A;  1NTM K;  4ZKP A;  2K9J A;  3FXE A;  3T6B A;  3US6 A;  1PGJ A;  2NPS D;  4OIN F;  2XKM A;  1BDC A;  1TWH A;  3HE5 A;  3QVZ A;  1Q2N A;  2AP3 A;  4CS8 C;  1EQ7 A;  5KYU A;  1HMO A;  2E76 B;  2ZD9 A;  3AE1 C;  3L8I A;  3W8H A;  5L0G A;  1ST6 A;  1ZYR F;  2P6V A;  2A06 D;  2H43 A;  5AW7 B;  3V6I A;  1HH0 A;  4KI2 A;  1L0N J;  1L4A A;  4CS8 A;  4HB1 A;  4XA4 A;  1Q0F A;  1ZR4 A;  4R4M A;  3AE7 C;  1NTM J;  3IQ6 A;  2E74 C;  3O6Q B;  1LT9 B;  1LTI C;  1HMD A;  2R3C A;  3A11 A;  1H9G A;  3H1I E;  1OVV A;  4D6T J;  2QLA A;  3POV A;  2NG1 A;  1QVG O;  3AE8 C;  1MMG A;  2A6H F;  4CS7 A;  1CI6 A;  1FOS E;  5AVZ B;  4DXW A;  3EGD B;  2WSC H;  2IXM A;  4RDA A;  3H1H E;  1A41 A;  4PD4 I;  1YVI A;  3ABL C;  2W45 A;  4JW1 A;  1A02 J;  1FJK A;  1FTS A;  3F89 A;  2ZXW C;  4CBE A;  2CYD A;  4LDQ A;  4IJJ A;  2FYU D;  4UB6 H;  2V7Q J;  2KQ9 A;  1Q0G A;  1JMM A;  4XEF A;  3TSI A;  3QZC A;  1KZU B;  2K3R A;  4ONS A;  3RQE A;  3EHM A;  3H1K J;  1QLE D;  1LI7 A;  1NHL A;  4OGQ D;  4E18 A;  5B66 H;  5AVQ B;  2WZ7 A;  1M8O B;  3U8P A;  1T01 A;  2RD9 A;  2J45 A;  1KFM A;  4JCZ A;  5B5E H;  3M0A A;  3Q7G A;  1YAU O;  2OOC A;  3ZTZ A;  5L0H A;  3NMJ A;  3NXS A;  5K0I A;  1G4U S;  1OQC A;  1TWA A;  3H1J G;  1KQL A;  2E5T A;  3LW5 H;  1SQQ G;  3L75 J;  2P67 A;  2R5D A;  3SXK A;  2R7O A;  4NTB A;  1FC2 C;  2YWA A;  4YT4 A;  3AGT A;  4EIY A;  1BSN A;  1L3P A;  4N6J A;  4QDL A;  1X22 A;  2KXP B;  3CCQ P;  1C17 M;  4MVM A;  2FXO A;  4EUK B;  2A68 F;  2YL1 A;  4M63 A;  4Y28 J;  1YQ3 C;  3NRH A;  3A7O A;  2ZXX A;  2B89 A;  1S7Z A;  3WAQ A;  1GL2 D;  1CPQ A;  3UMK A;  1YJ9 P;  1SVF A;  2NPS A;  2YLI A;  3CC4 P;  2SPZ A;  5AW3 B;  1NTK E;  2JPU A;  1OFC X;  3TGU E;  4E7Z A;  1L2P A;  1OIP A;  2W9Y A;  1RQU A;  4WY4 D;  3V2R A;  2MKV A;  1VQP P;  1NVO A;  3JT1 A;  3QVY A;  4OIR F;  1SQP G;  1H9T A;  2R32 A;  3GEE A;  4YPC A;  2GM4 A;  4DJG A;  1S05 A;  1T5O A;  4BEJ A;  1UFB A;  2P2U A;  2R7R A;  1VB5 A;  3H1I D;  1FZC B;  3M15 A;  4WGZ A;  1LWU C;  2YO3 A;  3H32 B;  5DQZ A;  1ZXG A;  3PMR A;  4GOF A;  5IY5 C;  3PLN A;  3U1C A;  3H25 A;  4C7N A;  3HJC A;  2KNC A;  3U0C A;  3HNJ A;  2OJQ A;  2YMK A;  2P7V A;  3H1H D;  3MIW A;  2DB4 A;  1PFI A;  4AE4 A;  1JTH A;  2KSE A;  1URQ D;  3CCM P;  2PP6 A;  5BQH A;  2O3J A;  2JD3 A;  3EWK A;  1LWU A;  2X51 A;  2B87 A;  4H0L B;  3W8I A;  4J32 B;  2J7P A;  3DJN B;  4D4X A;  5EK0 A;  2KC3 A;  3S84 A;  2V4H A;  2N1T D;  2C0X A;  2V3C C;  3BRT B;  2PAJ A;  1YAR O;  3MUD C;  5GPG B;  4EWC A;  4XFJ A;  1JAF A;  4EKW A;  2H7B A;  1JY2 O;  1R5I D;  4MS2 A;  1L0N G;  2MYS A;  2IYL D;  1M57 D;  2I8B A;  1YIJ P;  1NTM G;  1RF0 C;  3TK0 A;  1NAY A;  1LE2 A;  2E74 B;  3MUD A;  3FXD A;  3CC2 P;  4HJG H;  2Q3I A;  2YO2 A;  1TU3 F;  1GL2 C;  4D6T G;  1B68 A;  2AXT E;  1N7S C;  1AFO A;  3T97 A;  1JY2 P;  1CSB A;  1FAV A;  3TNU B;  1SQX K;  4U7J A;  3RL0 g;  3RL0 D;  1QQ3 A;  1YA7 O;  1NTK D;  4KT0 J;  1FFT C;  3HNI A;  3LLK A;  1GL2 A;  1IFD A;  1ORJ A;  2R7X A;  2M3E A;  1VF5 D;  1BE3 J;  2D5R B;  4ZLC A;  2CNW D;  1EC5 A;  1DH3 A;  2UWJ E;  3FOO A;  2KK7 A;  3H1K G;  2QIW A;  1T6I A;  2I15 A;  3B0P A;  1SQB D;  1R4T A;  3S27 A;  2GA1 A;  1MUU A;  2CCY A;  2NUT A;  4CS9 C;  2A45 G;  4HEA J;  1SQX J;  1FBM A;  1URQ C;  3AOU A;  2NPU A;  2QSI A;  3U3F A;  1IC2 A;  2QM8 A;  5L0D A;  3L75 G;  1G1J A;  3D70 A;  5AVS B;  3DD7 A;  3DM9 B;  3JYY A;  3MGN A;  2YMY A;  3CXH E;  2P1A A;  2HZ8 A;  4CS9 A;  5E79 E;  2M4E A;  1FZA A;  3CMA P;  3EFG A;  5CCG C;  1URQ A;  1JR8 A;  2C04 A;  5T3W A;  2J9U A;  2J46 A;  4B6I A;  1YZC A;  2XL4 A;  2R44 A;  1RXQ A;  1EDK A;  1ZU4 A;  3WUT A;  1KU2 A;  1YJN P;  2BAS A;  3CQZ A;  1ZHZ A;  3JCU Q;  3JSZ A;  2IFN A;  1IJD B;  3GHG B;  2AEJ A;  3Q5R A;  1GS9 A;  1SLQ A;  3E1R A;  1M57 C;  2OYI A;  1G2C A;  3M0D C;  4AUW A;  1QSP A;  2KZI A;  4K3A A;  1WGW A;  1PPJ G;  3G4S P;  4U3F J;  2KIK A;  2AXT H;  2GDC A;  4MVS A;  5E3C A;  4A2N B;  3DI5 A;  3CAX A;  3I56 P;  4C7N B;  2H7V C;  4LGD E;  2XM4 A;  4N06 A;  3U2L A;  3ZC4 A;  3V7O A;  4EIJ A;  4JJF A;  1JTH B;  2YXQ B;  3HE4 A;  1KQF B;  1DIP A;  3BRV B;  1ORY A;  2IYP A;  3VYW A;  1J8Y F;  1M1J C;  3L4F A;  3GWL A;  3T4R A;  3H1J E;  1IFN A;  1S9K E;  5APT A;  3IAO A;  1QL1 A;  1NGM B;  3FVY A;  3AE6 C;  3EG9 B;  5KYW A;  2RMZ A;  3TQO A;  1Z56 A;  5AVV B;  3OA7 A;  2FFD B;  4B86 A;  4C3D A;  4DRI B;  4DJ9 A;  2CPS A;  4EBJ A;  2ZXR A;  1M1J A;  2W6A A;  2LKM A;  2LFD A;  2W8Z A;  4JF7 A;  4U9E A;  3TK1 A;  4JJG A;  3L74 J;  1XTC C;  2HR3 A;  4I6M C;  2CNW A;  2ETS A;  5KKZ C;  1MKM A;  2YLD A;  2WSF J;  3CCE P;  3V2Q A;  2V26 A;  2O01 N;  1T3U A;  3CEX A;  4PJM A;  3CXH H;  1KB9 D;  2GUV A;  2EIM C;  2J9B A;  5AVX B;  3GEH A;  2GAQ A;  2QG4 A;  1BCC E;  1JRA A;  5E79 H;  2KB7 P;  2KNH A;  1HTL C;  3KYJ A;  4W80 A;  3GOR A;  1GQA A;  5F28 E;  3CXH D;  3ZDM A;  3KL4 A;  1A7E A;  2L91 A;  2WWW A;  5F5F A;  2EIL C;  4MN4 C;  1ZME C;  1A02 F;  2IBZ D;  2FYN C;  5L0I A;  1AUE A;  5BQI A;  2CDQ A;  1D7M A;  4RD9 A;  3H65 A;  1KQS O;  2PFX A;  1AA0 A;  2C9L Y;  1N7S B;  2WQY C;  2YIU C;  5L0J A;  3AED C;  2DW3 A;  1R8E A;  1IO4 A;  1H6G A;  4U5E E;  3T6G B;  2DYS C;  3AEC C;  4N6C A;  1D0X A;  2JR8 A;  3SP1 A;  2R7T A;  1BE3 G;  1VQ9 P;  2PFD A;  2LQG A;  1RKE A;  4W7Z A;  5KAI E;  4L76 A;  5D91 A;  2LCH A;  4XE5 B;  2M8R A;  2QM7 A;  5KLV K;  4PJJ A;  5KYX B;  4OIO F;  3BAS A;  2G3A A;  4NPE A;  2CPB A;  2YKZ A;  3II6 A;  3DAF A;  3IQC A;  4KNW A;  2QJK C;  2J58 A;  3Q2Y A;  2E76 C;  5B3S C;  1SQX G;  1LE4 A;  3CWB D;  3H1J D;  1MNE A;  1S9K D;  2W6J H;  2VCC A;  4GDO A;  3WU2 E;  2P58 A;  4XLN F;  2L6F A;  4GQH A;  1KMI Z;  4YL1 A;  4YT2 A;  3GLM A;  4FES A;  3RQG A;  1NTM E;  5CI8 A;  1NSG B;  3QMK A;  4R32 A;  4YTP C;  3AG2 C;  4GKG A;  1O3U A;  3S9O A;  2DYR C;  2VCB A;  3RQF A;  4BXL A;  5KLV J;  3CME P;  2RKL A;  2QNL A;  4D6T E;  4L75 A;  1QKR A;  4LLC A;  3FAP B;  4AX2 A;  5APY A;  1ZU5 A;  1TWC A;  2D2C B;  4RES B;  2R7U A;  3GW6 A;  1I5N A;  3RVY A;  4RBN A;  1FNT c;  1LT9 A;  1BCC D;  1K04 A;  1WTY A;  4IOI H;  3S28 A;  1OCO C;  2K9Y A;  3A0H E;  1GMJ A;  4IFD K;  2R7Q A;  2Y9Y A;  2FXM A;  2Q9C A;  4QI0 A;  4XEK A;  4BJ1 A;  3JCU E;  4MVU A;  5EGY A;  4U3F G;  4N3Y B;  2WZL A;  4P6I C;  3V5X A;  2BC5 A;  4H44 C;  3EGD A;  1YJG A;  3O8Z A;  2XS1 A;  1T2K D;  2L6G A;  3H1K E;  4JKV A;  1N86 A;  4H0L D;  1U7M A;  3U9J A;  3KQG A;  3LIE A;  2WVQ A;  1GDT A;  4XWJ A;  1VYI A;  3AEE C;  3N7N A;  4H13 B;  1GD2 E;  2OTJ P;  1L0L K;  1EZV G;  1AQT A;  5AVU B;  5KAI H;  1ZZP A;  1V54 C;  1NTZ K;  1IFM A;  5DJU B;  3A0B E;  1LTB C;  4C7O B;  1DD4 A;  3Q5P A;  1MMN A;  1M1K Q;  1PP9 J;  1HGZ A;  1DOV A;  1OXB A;  1N7L A;  1T8Z A;  4YN0 B;  2Z15 A;  3MZW B;  3X2Q C;  3L74 G;  4U5H A;  3RVZ A;  2E74 D;  1T6Q A;  2KP8 A;  4BWN A;  3OA1 A;  3B4S A;  5T3T A;  3WU2 H;  5KKZ B;  1VYK A;  3C1L A;  1NFO A;  2QE7 H;  1L0L J;  3VYI A;  2EPL X;  2AEM A;  1CGN A;  3UMH A;  4Q5S F;  3E9V A;  1SQV E;  1NTZ J;  2NZ2 A;  3VMA A;  2YL7 A;  2XXA B;  2J9V A;  1F1M A;  4EBB A;  1NU1 E;  2PNO A;  1NTM D;  1QPU A;  1JPN A;  1JPJ A;  5CHX A;  1N73 C;  2XU6 A;  3DKA A;  3QW0 A;  1FMW A;  2FYN B;  3ITK A;  1FZC C;  3A0H H;  3KHU A;  5APQ A;  5JRA A;  2YRF A;  2Q9B A;  3O55 A;  1FZB A;  4DBQ A;  2HFI A;  1VQ8 P;  1BR2 A;  3JCU H;  3U3B A;  1JB0 J;  4YK5 A;  2YIU B;  2V7Q H;  1QX8 A;  4K1O A;  3DWW A;  3TYY A;  3SZR A;  256B A;  4Q4Z F;  3NTN A;  2JDI H;  1BGY E;  2MJZ A;  4Z9H A;  4YWQ A;  1ZHY A;  1FZC A;  3EJN A;  1G4W R;  2IBF A;  4BJ6 A;  3C8V A;  4L74 A;  5APW A;  3Q6N A;  5DQT A;  1T2K C;  4E17 A;  2IYO A;  3P8C D;  2F22 A;  2K37 A;  1W2B O;  3BCC E;  2ITA A;  4NTF A;  2A45 H;  3AEF C;  4XPW A;  1CGO A;  4GOE A;  3ZTM A;  3CCV P;  3JSE O;  3L37 A;  5HSW A;  1JM0 A;  3KPH A;  5DVW A;  4GIF A;  1WOL A;  3TUL A;  1H0T A;  3A0B H;  4FWV A;  2QJK B;  2RH0 A;  2Y9Z A;  4I3M A;  2Q1K A;  2J0X A;  1NLX A;  4IL6 H;  1YJW P;  1C02 A;  2KYH A;  1XTG B;  2FFH A;  1CW5 A;  1GK4 A;  1LTA C;  1SMY F;  4XPY A;  2O01 H;  2GA0 A;  5F5H A;  2P1J A;  3V2N A;  5JVE A;  3D6Z A;  1VQ5 P;  1IW7 F;  3H2V A;  5KLV G;  1EI7 A;  3B5N B;  1V74 B;  4PAC A;  4D4N A;  3S90 A;  3ZVR A;  4XPX A;  2ZXE B;  2HSQ A;  3T6J A;  4AL1 A;  2H8P D;  1DOW A;  5BU8 B;  5EHH A;  4J7Y A;  4PJ0 E;  1S5L E;  2HFE D;  1LPE A;  4LAC B;  1SQV D;  1HF9 A;  4L73 A;  1O87 A;  1JOG A;  1IZM A;  2WVR A;  2HPC B;  3EPV A;  2J7P D;  3K33 A;  1KIL B;  1NU1 D;  1NZE A;  1PCX A;  3V4Q A;  1Z5Z A;  1RMV A;  3TNU A;  2YKP A;  4H44 B;  1HJB A;  5FCL A;  2R7S A;  2WVO A;  1Z23 A;  4ZLD A;  2FYZ A;  3CCJ P;  4C3B A;  2G62 A;  3C7J A;  4IFM A;  3L73 J;  3KYQ A;  1KB9 I;  1X0T A;  1X9V A;  3EFF K;  2M0B A;  5TIS E;  2I1K A;  3UIA A;  3PTZ A;  2DI3 A;  1VLT A;  1SQX E;  4Y99 C;  4DOJ A;  2WTY A;  2W6B A;  3CCL P;  3CXH I;  2ZAE B;  2BCC D;  2MHR A;  2IPP A;  5H2F E;  1BGY D;  2WL8 A;  3ASN C;  3G6E P;  1AV1 A;  3TF5 A;  2G3V A;  1OVR A;  3C8G B;  2FY8 A;  2O1K A;  1IFJ A;  2IBZ I;  3P8M C;  3BCC D;  4HE8 D;  2LIG A;  4JYC A;  3DMD A;  1HW2 A;  2JKV A;  4L6R A;  2P0N A;  2QJP B;  4MQ9 F;  1BDJ B;  2YEV A;  5CI9 A;  3V4W A;  3MX3 A;  4JTA B;  1P84 E;  3CZ6 A;  2IX7 C;  4BPM A;  1XZQ A;  4IAQ A;  4AQR D;  1AEP A;  3GHG C;  2JO1 A;  1L0L G;  2XNX A;  3BVH A;  1FDM A;  3L72 G;  1N7S D;  3NKE A;  1YA9 A;  3KH2 A;  1NTZ G;  3SNH A;  3VP9 A;  3NG1 A;  2FYU K;  2HYN A;  3QH9 A;  2KZJ A;  5JUA A;  2QTV A;  4NPF X;  3GHG A;  4HFF B;  2POH A;  1H88 A;  4IB4 A;  4PV1 B;  1N73 B;  3H1L E;  3SWY A;  4PJ0 H;  1S5L H;  1OKK D;  3HKK A;  3ZSU A;  3HUS C;  3GAN A;  3I5Q A;  1LKX A;  3NYL A;  1Y9B A;  3FWN A;  1KYO E;  3TJ5 A;  1R5L A;  1K73 Q;  2KLU A;  2R9R B;  4AL0 A;  2YHS A;  3AG4 C;  1JY3 N;  2M64 A;  2YNY A;  1D1B A;  2FYU J;  2WSC J;  3L71 E;  3FGA D;  2OTK E;  1W2E A;  2FFD C;  1LGH B;  3CCS P;  5AW0 B;  1LIH A;  4LDR A;  3EH1 A;  5TIS H;  3BRJ A;  1H0T B;  4MTF A;  3OWT A;  2MWQ A;  3L74 E;  3EG9 A;  4PK4 A;  4IAR A;  3WUU A;  4JVS A;  3J06 A;  5CCG D;  2FFD A;  3O10 A;  3B0U X;  1JMW A;  5H2F H;  1RE3 C;  1Q82 Q;  3NMK A;  5DS4 A;  3RBX A;  1SQX D;  2J8W A;  3G9R A;  2D2C D;  3NMD A;  4JRZ A;  1RJ9 B;  2WIT A;  1LI5 A;  2QJY B;  4DRH B;  1HE1 A;  1RY3 A;  5B1B C;  1FR0 A;  3LW5 J;  4AYC A;  2A69 F;  1G1I A;  4Z9I A;  1P84 H;  5E2Q A;  1NAF A;  2AWY A;  3C9I A;  1GTW A;  1NG1 A;  3V2P A;  4MVR A;  1AJY A;  4DT0 A;  3LJB A;  3L70 E;  2Q5U A;  5JT4 A;  1RF0 A;  3P32 A;  1MQV A;  4H13 D;  1KOR A;  3NKD A;  2XZR A;  3TGU D;  5KJ7 C;  3RK3 C;  3LNR A;  5CMZ A;  1N7S A;  2EIJ C;  1KYO H;  1ZP0 C;  1KD1 Q;  1NH4 A;  2KSF A;  2WSE H;  1ORS C;  1PGO A;  3H1L D;  1ZRT E;  5AC5 A;  4I1O B;  5KJ7 A;  1Y47 A;  3M06 A;  2PP4 A;  1Y8A A;  2Q00 A;  2P10 A;  5CBN A;  2E42 A;  4OWF A;  1KYO D;  1RF1 C;  4H54 A;  1PIX A;  3PRJ A;  1Z6A A;  3H1H J;  5C39 A;  2KYV A;  1OKK A;  1NJI Q;  2G3K A;  1LJ2 A;  4Y99 B;  5GTI E;  3AE2 C;  3T9O A;  2G8Y A;  2IOQ A;  5KYX A;  1U0B B;  1M56 D;  2B9B A;  1HW1 A;  4JCH A;  2HSB A;  4JPZ B;  3L71 D;  1APC A;  2KI7 B;  5APX A;  1KNY A;  2WSF H;  4RO0 A;  3N4X A;  2VC9 A;  2YZS A;  2HV6 A;  3U1A A;  4EDF A;  1NU9 C;  1KIL E;  5KLV E;  2HJM A;  2N9B A;  4JTC B;  3L74 D;  3VAY A;  5APS A;  2UUH A;  1JO5 A;  3AE9 C;  1VQO P;  4TLF A;  2RSE B;  2D2C C;  2A06 G;  5CIV A;  4WGY A;  1NTK K;  3U2M A;  1GZL A;  3HNK A;  5CCG A;  3WUV A;  3CX5 E;  3C18 A;  3I4U A;  1D0Y A;  3DZA A;  5AVY B;  1FZG A;  2L5G B;  4JTD B;  4JIO A;  3CSK A;  4XLP F;  1OVU A;  4LER A;  2B0H A;  4FAP B;  4DCK A;  1SQB K;  1USD A;  3NFQ A;  4IFF A;  2Y3G A;  5BQG A;  3PHF 2;  1YZA A;  2YL0 A;  2XLV A;  1ZHT A;  3M0D A;  3EHN A;  2NRG A;  3HUS B;  1H8A A;  3SXM A;  5AC4 A;  4DOZ A;  2C9N Y;  1FDI A;  3L70 D;  1NTK J;  1QEX A;  4H13 C;  2Y0E A;  3GG2 A;  1VQN P;  2PX3 A;  4IL6 X;  1SQQ E;  1MFT A;  3KZI E;  3IHU A;  4BJ5 C;  2Q4F A;  2E76 D;  2FYU G;  2R05 A;  2VCA A;  4HKZ H;  2Y69 C;  2GFH A;  3RH3 A;  5DS5 A;  3SEO A;  2QY9 A;  3F5H A;  1UIX A;  2HKV A;  3OW2 O;  1HY5 A;  1Y4C A;  3G4X A;  3I5P A;  1QVX A;  4OIP F;  1SQB J;  1R5S A;  2HMQ A;  2Y0D A;  4QI2 A;  1ZRT D;  5GTI H;  3USS A;  4BJ5 A;  4KC9 A;  4O79 A;  1OCZ C;  4MND A;  2AWC A;  1PD1 A;  4WAB A;  4C7O A;  1V55 C;  1KFN A;  2M3B A;  3L8J A;  2KUB A;  1L0L E;  1M56 C;  1LVK A;  3L72 E;  1HJ0 A;  2IXP A;  1E85 A;  1X8Y A;  2FAP B;  1NTZ E;  4AK9 A;  1RCP A;  2AEF A;  2IZ1 A;  4MVQ A;  1OW7 A;  1GGQ A;  2ZYG A;  3CPW O;  2WZG A;  3BEH A;  1S1C X;  1SQP E;  4KJM A;  2KLV A;  3EZH A;  3ITF A;  3HRN A;  1RKC A;  3C8Z A;  5DLJ A;  2LK4 A;  4EI2 A;  2IXO A;  1E2X A;  4TT3 H;  3SYN A;  1U57 A;  4H44 D;  4ANJ A;  2XXA A;  4O6N A;  1M7L A;  3CX5 H;  1M2O A;  2H88 C;  3GF3 A;  2FBW C;  2Z5H A;  3OAK A;  3W68 A;  3NDB B;  2E5Y A;  2HMZ A;  1BZ4 A;  3B0V C;  1O5H A;  3CX5 D;  4BEM J;  4ASW A;  2A1D D;  1S4X A;  3LS1 A;  3RK3 B;  3LES A;  1OWA A;  3U8V A;  1T6U A;  2XL6 A;  2L7A A;  4MTO A;  3MD0 A;  2Q3E A;  5AW4 B;  4OD5 A;  3C8G D;  1OZH A;  4G0H A;  2DGJ A;  1BBH A;  1SFC B;  3GOD A;  1VQ4 P;  3K1I C;  1SP4 A;  1U6H A;  3MTU E;  1U89 A;  2WZF A;  3U5S A;  3KZI H;  3W4Y A;  5E3A A;  3UMI A;  4WWI A;  3EH2 A;  1RF1 B;  1Q0K A;  3H1H G;  1J1E B;  4WY4 B;  5AW5 B;  5AW1 B;  1BDD A;  1GU5 A;  1M2V B;  1SQQ D;  3L34 A;  2ZT9 C;  3EFO B;  2XM0 A;  1DD3 A;  1SYQ A;  2OG2 A;  3L1M A;  1E86 A;  3KKB A;  3LEO A;  1L0N E;  1FE6 A;  2OU6 A;  1EDL A;  2E75 C;  2ZJS E;  1DEE G;  3B8E B;  5KYY A;  4ZMD A;  5TJ5 E;  1OCC C;  1S5L X;  5BUO A;  1S2E A;  2YLG A;  3JRM O;  4K35 A;  2IDB A;  3B5N C;  1YYC A;  1KTM A;  2OYH B;  4PV1 D;  1KC8 Q;  1CPR A;  1CZQ A;  5AGF A;  2HV7 A;  4J7T A;  1SZI A;  1AVO B;  3DM5 A;  3L72 D;  3PP5 A;  1NTZ D;  2QE9 A;  3B5N A;  2XLO A;  2EIK C;  3AGU A;  1KIL C;  4N4W A;  1PV3 A;  1FZF A;  1HUC A;  1FZE A;  4MVZ A;  1SQP D;  3FXH A;  3FMS A;  2Q3T A;  3O39 A;  1DEB A;  4E0H A;  2H7O A;  3HLZ A;  1FAP B;  1Y6D A;  4EHP A;  1WWP A;  2HPC A;  1LP1 A;  1KIL A;  4NQF A;  3CC7 P;  1EA8 A;  4I44 A;  1NTK G;  2VH3 A;  5TJH A;  3AQB A;  3RK2 C;  1NFN A;  4W7Y A;  3L75 E;  2OEX A;  4PFP A;  5KTB A;  1ZVZ A;  2ZVN B;  5A69 A;  4CDA A;  5BU5 A;  1PGQ A;  1JOC A;  4JQ0 D;  1WT6 A;  2TMV P;  1NO4 A;  1U7J A;  2QJP C;  1Q7Y Q;  1SQB G;  1E79 H;  1JY3 O;  4KBL A;  3NMI A;  4LLE A;  3A9C A;  5COG A;  3F47 A;  2A06 E;  4U5F E;  4RKU J;  1UII A;  3C8G A;  3CWB J;  1K05 A;  3H1J J;  2LXB A;  4DVY P;  2LD6 A;  2HUJ A;  3WMM 0;  2Q7C A;  5B3I A;  3C62 A;  1GK6 A;  3JTL O;  3L36 A;  2ICW G;  3VN0 A;  2WT7 B;  2I8D A;  3UGP A;  2OQQ A;  4JEA A;  3G4Z A;  4YT5 A;  1JCC A;  5CCH D;  1JY3 P;  1L0N D;  1PPJ E;  5L0F A;  5KLI C;  1YHQ P;  3IEE A;  2Y3H A;  1FDO A;  1OX3 A;  1OCR C;  3IR9 A;  4PV1 C;  3G50 A;  1OR2 A;  1AVY A;  2OJE D;  4IRU A;  1YTZ T;  1J1D C;  3HD7 C;  4D6T D;  2JX0 A;  2XND H;  3UNG C;  1BCC J;  4HH2 A;  2Y0C A;  3SXZ A;  2B0J A;  3ZDL A;  3MYI A;  2Y39 A;  1JEK A;  3R4Y A;  4PFO A;  1N73 A;  1LTJ B;  1FMV A;  3A3Y B;  1NBB A;  2EPK X;  4IGG A;  2FYU E;  2AVK A;  4OVN F;  3JYH A;  2Y3B A;  1ZN5 A;  3ABV C;  3B71 A;  2FKW B;  4CIH A;  2Z5I A;  5GTH E;  1H89 A;  1RQV A;  3PH0 A;  4U9D A;  3DAG A;  4JE9 A;  3K1H A;  1MMD A;  3AEG C;  2NSF A;  1VQK P;  3H1K D;  1YIT P;  4HYT B;  4CJG A;  2LFF A;  3Q6M A;  3UR3 C;  1YBK A;  4Z9J A;  1D0Z A;  3ECS A;  2LR2 A;  1D1C A;  4MVO A;  4I7Z C;  3TJ6 A;  5KYY B;  4I1M A;  3V5B A;  3M91 A;  2OTL P;  2XDJ A;  3ZWI A;  2QJY C;  3L75 D;  1K8A Q;  3VMY A;  2A6E F;  4CIP A;  5D92 A;  2ZT9 B;  1T3J A;  2HOD B;  3W2W A;  5AW6 B;  3PJS K;  3M4C A;  3RK3 E;  3I5C A;  3KPE A;  2H8A A;  4DBR A;  3EGX B;  2E75 B;  2W4M A;  5DJT B;  1EDJ A;  3GWN A;  1RJ9 A;  1L4A C;  3RF3 A;  1EXI A;  1SS1 A;  4GT1 A;  1QZX A;  4BRY B;  3FOP A;  1GU4 A;  2PBE A;  1BR1 A;  5AW2 B;  3MYF A;  2L81 A;  4NY3 A;  2XSE A;  2PX0 A;  1G5Z A;  1EKY A;  2P7J A;  3CD6 P;  5CCH C;  4YXD C;  3V5Z A;  1BR4 A;  2PRR A;  3BAT A;  2O9X A;  3VTP C;  1BE3 E;  1PPJ D;  1LP1 B;  4K0D A;  2OCC C;  2YL3 A;  4OH8 B;  4DVZ A;  4YXW H;  2IBZ G;  4XTK A;  1VMA A;  3RBZ A;  2BEQ D;  1UG7 A;  4Q7C A;  3TOM A;  5CCH A;  1VPC A;  4U5C E;  3RGU A;  2ZXO A;  1QGK B;  1SR2 A;  1VK5 A;  2XRH A;  4WB4 A; 
#chains in the Genus database with same CATH homology
 2E75 C;  2E76 D;  5M1B A;  3AEF C;  4XEK A;  1UFB A;  4XEV A;  1VF5 B;  3AE3 C;  4R4M A;  3AE7 C;  4OGQ C;  2JX0 A;  1S5L X;  3IN6 A;  2E74 C;  1KOR A;  1UIX A;  2FXP A;  4H13 D;  3K7D A;  4H44 C;  3SFD C;  2IDB A;  2JO1 A;  5F28 E;  1KTM A;  3U3F A;  2QSI A;  1QVX A;  4PV1 D;  2L6G A;  3R4Y A;  1WOL A;  3MFN A;  3GF7 A;  4H0L D;  3D70 A;  1ZOY C;  3JYY A;  3TUL A;  3H25 A;  1ZME C;  3U0C A;  2JP3 A;  1ZP0 C;  3AE5 C;  2H89 C;  3AE8 C;  2YMK A;  3ABV C;  3B71 A;  1RQV A;  2FYN C;  1ZRT E;  3L8J A;  3AEB C;  3AEE C;  4H13 B;  3EWK A;  3JZ0 A;  1KQG B;  1HJ0 A;  2Q00 A;  2P10 A;  4PV1 B;  3AEG C;  2WQY C;  1PV3 A;  1ZZP A;  1PIX A;  2YIU C;  4H0L B;  3D6Z A;  3AED C;  3AJM A;  2J5U A;  2ZT9 D;  4IL6 X;  1Y9B A;  3AE2 C;  1OW7 A;  1DD4 A;  3Q5P A;  1R8E A;  2G8Y A;  2V7Q J;  1Q90 D;  4XEF A;  1S1C X;  2L6H A;  1WMK A;  3AEC C;  3D71 A;  3RQE A;  3GMA A;  1WWP A;  2HSB A;  2E75 D;  4I7Z C;  3Q5R A;  1KNY A;  2WSE J;  2LK4 A;  4NQF A;  4OGQ D;  4EBK A;  2E74 D;  4TT3 H;  2WSC J;  4Z1M H;  2QJY C;  1VF5 C;  1U57 A;  4H44 D;  1OW8 A;  3FGA D;  1KIL E;  1IK7 A;  2ZT9 B;  4XFJ A;  3Q3D A;  2H88 C;  2O01 J;  3GF3 A;  1HF9 A;  2FBW C;  3D6Y A;  1JOG A;  2G3A A;  3BRJ A;  3RK3 E;  3AE9 C;  2E75 B;  2D2C C;  2QJK C;  3Q2Y A;  1EXI A;  2E76 C;  4OGQ B;  2NZ2 A;  4R4L A;  1KQF B;  2E74 B;  1DIP A;  4H44 B;  2YWA A;  3O10 A;  3O6Q A;  2QJP C;  3Q1M A;  4GDO A;  2PBE A;  1TU3 F;  3C18 A;  1OW6 A;  2L6F A;  1KMI Z;  3GLM A;  3IAO A;  3G9R A;  3RQG A;  2D2C D;  4H0L C;  3C8G D;  4Y28 J;  1NGM B;  1OMI A;  4RKU J;  3C8G A;  3AEA C;  1NYH A;  1K05 A;  1YQ3 C;  2BEZ F;  2WPV B;  3AE6 C;  4YTP C;  4YXD C;  3Q5S A;  4R32 A;  3GM3 A;  1VL2 A;  4U7J A;  3RL0 g;  3S9O A;  1O3U A;  1V4A A;  3RQF A;  4KT0 J;  3LW5 J;  2KK1 A;  4EBJ A;  1EXJ A;  1K40 A;  1JB0 J;  1VF5 D;  2OQQ A;  2JPU A;  2BEQ D;  2D2C B;  3T97 B;  3C8G B;  1FDI A;  5KLI C;  2E76 B;  1PL5 A;  3GM1 A;  3AE1 C;  3L8I A;  4H13 C;  5L8R J;  5KKZ C;  1YQ4 C;  1MKM A;  1K04 A;  2ZT9 C;  2WSF J;  1FDO A;  1RQU A;  3GM2 A;  1DD3 A;  2MKV A;  3AE4 C;  3C8V A;  1AJY A;  3SFE C;  1WTY A;  4PV1 C;  2K9Y A;  4I7Z B;  1GMJ A;  2QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...