1OW6A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 58
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6A02
4EBKA 3RQEA 1K04A 3AJMA 1OW6A 3C8GD 3MFNA 3AE2C 1UFBA 3RQGA 3ABVC 1WTYA 2YWAA 1ZOYC 1OW8A 3AE3C 1K40A 3AEBC 3RQFA 4EBJA 2Q00A 2HSBA 3AEGC 1WOLA 1YQ3C 1K05A 3U0CA 3B71A 2PBEA 4XEKA 2H88C 4XEFA 1PV3A 3AE5C 3U3FA 2LK4A 3JZ0A 3AE7C 1O3UA 3GM1A 3AE6C 3AE4C 1V4AA 2WQYC 5F28E 1KNYA 4R32A 2L6GA 2JX0A 2L6FA 3C18A 1JOGA 1WWPA 3AE1C 1KTMA 1ZZPA 3L8JA 3AECC 3L8IA 1OW7A 3AEFC 3AEDC 2L6HA 3GM3A 3AE9C 3JYYA 3AEAC 3SFDC 3AEEC 3TULA 2FBWC 3SFEC 2KK1A 4XEVA 3S9OA 1QVXA 2G3AA 3AE8C 1YQ4C 4NQFA 4YXDC 3C8GA 3K7DA 1ZP0C 2H89C 2JPUA 4YTPC 3C8GB 3O10A 3GM2A 3BRJA
chains in the Genus database with same CATH superfamily
1NTMK 2LCHA 2TMVP 3H1KE 2KP8A 3WUVA 3U5SA 5D91A 4U3FD 4XFJA 4UB6H 1KB9H 2F22A 2GUVA 4YN0B 3A0HE 1RCPA 2WZ7A 1H9TA 2HSQA 1FDMA 4B6IA 1VB5A 3FXEA 3HNJA 3OEOA 2FYUD 2QRXA 5B3IA 4IL6H 5E79H 2A0BA 1VQMP 3CPWO 3CAXA 1JY3N 3CZ6A 3B71A 3II6A 3SWYA 3IF4A 4MVRA 2PBEA 4G7ZF 4WY4D 3B9QA 3H2VA 4DOJA 3WHNA 3B8EB 3AE5C 1RF1C 1NYHA 5CCGD 3Q7GA 4O6NA 1GL2D 2YKZA 3H1HJ 2BCCJ 5JP7A 1BSNA 1SQQE 1DX7A 1BR1A 3IQTA 1I5NA 3N7NA 1FAPB 1N7SC 2YMYA 1LTJB 2H8AA 2XS8A 3L75E 1ZHYA 1HBWA 1NVOA 3S84A 2Q6QA 4ZKUA 1VYIA 3X2QC 3IQ6A 3GWLA 1OCRC 1L2PA 3GF3A 2YZSA 3HD7A 1SYQA 4B86A 2XL8A 1EDIA 2AXTE 3ZQVA 2FYZA 3AECC 2R3CA 1SQQJ 4YL0A 4AK9A 4JKVA 3UMHA 3JSEO 3GHGC 4LDQA 1LI7A 2M3EA 1T2KD 2OJED 2AP3A 2EILC 2XM0A 2B89A 1J1DB 4HKZH 1M2OA 2KK1A 1ZMEC 1S9KD 4MVOA 3AE8C 3U1AA 5D92A 3RVZA 3B4SA 3ZDMA 1IFIA 2LSEA 4NTBA 4PFPA 2SPZA 1ZR2A 2OYHB 2XNXA 5BQGA 4Q7CA 3CCQP 5A69A 2ZXRA 3RYLA 1M56D 3CC7P 1PD0A 2VB6A 4MVQA 3L71E 5JLIA 3AG2C 2HMZA 1OCCC 3CWBE 4BG0A 2OKUA 1NSGB 1ZOYC 2CDQA 3NMKA 4CS9A 1JAFA 3RIPA 3TQOA 4KI2A 2HODA 4N6HA 2Z15A 1K9MQ 3DJUB 1T5OA 3RFYA 2W6JH 3QMKA 5FCLA 3L0IA 3W68A 3MTUE 2Y69C 3MZWB 5L0GA 1NTKG 2RH0A 2WVOA 2HS5A 2VCBA 2IBZE 3V5XA 5JUAA 5C39A 3J06A 2Q4FA 1FZAA 2CNWD 1CGNA 2H8PD 2W83C 3S28A 1VQ6P 3O6QA 5L3QA 1RMVA 2IM8A 1SFCB 3WMM0 3Q3DA 2EINC 2DW3A 3KL4A 1U7JA 4DXWA 4OGQB 1Y9BA 5APTA 4PFOA 5AW6B 1ZU4A 1T3JA 3TSIA 1L4AB 3FAPB 2I15A 1P84E 4CIPA 2FFHA 4IL6E 1L4AA 3R4YA 4U3FE 3EZHA 3EQLF 1CI6B 4D6TJ 1VQPP 1EQ1A 3L37A 2K9JB 1VQ7P 2V4HA 2HV7A 4IRUA 4CS9C 4MVMA 2XLDA 1C03A 2NG1A 1PGJA 3E70C 2Q7CA 3DKAA 2NPSD 1WWPA 3GF7A 1FDOA 2D2CD 4U5FE 1RXQA 1G2CB 4IFDK 1MNDA 3BCCJ 1J8MF 4DRHB 2J5UA 1TFKB 3FAJA 3CLQA 1X8YA 2WSEH 1D1BA 4JEAA 4QMAA 3EH1A 2I1JA 3VP8A 1HW1A 3CMEP 4KNVA 1YARO 2ZXPA 5IY5C 1DH3A 4C3EA 3BRVB 3DM9B 4H13C 4JZAA 1URQD 3TGUG 3L73G 3G6EP 1BDDA 1HE9A 3F46A 3K7DA 1SLQA 2WSSH 2E74C 3IQ5A 2OEVA 1V54C 3V5ZA 2P1AA 2YIUC 3M15A 3GLMA 5L0CA 2P7VA 2I8BA 2WWWA 4OGQC 2KSJA 1GMJA 3P8CE 1FOSE 1SQXE 1EZVE 1SQVG 4H44C 3CCSP 1BCCJ 4JJGA 4MTOA 4EHPA 5AVSB 3BRTB 3A5TA 2R7QA 3ITKA 2QVAA 2R7XA 3ATPA 3GWNA 1E85A 1S7ZA 1OQCA 2ZD9A 4JEBA 2PRRA 1G2CA 2KGOA 2YEVA 1NU1D 3D71A 3JRTA 2ZYGA 2RD9A 2M5AA 3IEEA 1M57D 4ONSA 3CWBD 2I8DA 3AG1C 1OR3A 1OFCX 1A41A 4PV1C 3EHMA 2PGDA 1BE3D 1N1CA 5AW1B 3S1KA 3KH2A 1NTKE 2BASA 3S27A 2D2CB 2W27A 1YYJA 1ZHWA 2BEZF 1AVOA 1KQGB 5TJ5E 2W9YA 1ZYRF 3FOPA 4WY4C 4Z1MH 1AVOB 1KTMA 1IC2A 3CCLP 3JYHA 2X0CA 1B68A 1P84H 1OKKA 1OVRA 4CS8A 1S05A 2KOGA 2XS1A 2J0XA 3B0PA 5BU5A 1W2WA 2FBWC 2OU6A 4FAPB 3ZTMA 2FYUK 3Q6MA 1QVXA 3QZCA 3LESA 4W8PA 2ZFCA 1EKYA 3L70D 1P84I 5L8RJ 1M1JC 2LXCB 2L9JA 3A0BE 1N7SB 2NRGA 3M06A 4C7NA 4K7BA 1VTMP 4W7YA 3RQEA 3GODA 1K04A 3EWKA 1FU1A 3V7OA 2XV5A 5BQIA 2OOCA 1QKRA 2B87B 4R4MA 1PD1A 1GK4A 2IBZI 3ABMC 3FXHA 1JOCA 3PDMP 3OW2O 2GWWA 4UDVA 2IZ1A 1FE6A 1SFCC 1GQAA 4D4XA 3KZIH 1BSHA 1BCCE 1RE4A 3ZQYA 4RDAA 3M0AA 3DE8A 3VM6A 3EFOA 2IFNA 1NG1A 1KD1Q 1VK5A 1SS1A 2XNDH 3HE4B 5KJ7D 3QH9A 2WPVB 3G50A 2B88A 1HWTC 1R5SA 4OVNF 1YA7O 3C8ZA 1CI6A 3CWBJ 3RL0D 1K73Q 1VQ4P 5DJTB 1S5LH 1IK7A 1SQPG 2PFDA 2UUIA 3HLZA 1N7LA 1S3JA 1VL2A 1ZHTA 2Q3IA 2DB4A 3EFOB 2AEJA 3FX0A 4MVSA 3KHUA 2O3JA 4WWIA 2M64A 2R5DA 3SZRA 1H9GA 1ZRTD 1XTCC 3H1JG 1JUNA 3CXHI 1GK6A 5CBOA 1NTMJ 1SQXD 1M2VA 2PNOA 1JPNA 5DS6A 2RSEB 2J9UA 3GORA 1PPJE 4GQHA 2H7BA 2YXQB 1JNMA 5KKZB 1S1CX 2LFFA 4IB4A 3WU2E 3H1JE 5KAFE 3MIWA 3L8JA 1TR2A 3T97B 1FZGA 4D6TE 4YT5A 3PP5A 3JYYA 3M0DA 4U5DE 3AEEC 4GIFA 5E2QA 1PP9G 2V3CC 1FZFA 3RK3E 3S9OA 1U57A 2GDCA 1TU3F 3IQCA 4BPMA 2QJPC 5T3TA 1L0LD 1NTKK 4L76A 1EDLA 3DMDA 1GGQA 4QI0A 1SVFA 4E7SA 1YQ4C 3JC22 1CGME 1OCOC 3OJAB 1KILB 1KB9I 4J32B 1LTGC 2J45A 4PJ0E 4I7ZB 1TWCA 2M3BA 1LNQA 5CMZA 4BJ5C 4EBKA 2KZIA 3RL0C 3FMSA 3OAKA 3MFNA 5B1AC 2A45I 1GS9A 1IJDB 4WY4A 1YHQP 4MTGA 4RBNA 4EBBA 2OJQA 1SR2A 2FYNC 5E3CA 2HFED 3S4RA 2KSFA 2R05A 4TLFA 1BE3G 4P6IC 3M9QA 1IW7F 2RKLA 5F5HA 1I4YA 4PV1B 1VF5D 2A45H 3L74J 3O39A 1ZR4A 4WABA 5KLVD 3US6A 1KYOE 2B0HA 3JTLO 4C3DA 1IFNA 4EWCA 4LLCA 1AQTA 2OQQA 5AW4B 1OXZA 1JCCA 2EIKC 2GA1A 1ZVZA 4CIHA 3RBZA 1QVFO 3L75D 1O87A 3IFMA 1LVKA 1LWUA 3CCJP 1L0LJ 4I2LC 2LK4A 3L74G 1HF9A 2IBFA 1RE3C 3CSKA 1O3UA 4LLEA 1PGOA 2E5TA 4EYYQ 1WMKA 4O79A 4AL0A 5A6AA 1SQBE 1V4AA 1NH4A 3B0UX 3D6ZA 1KNYA 2R7WA 1Y47A 1GM5A 3BCCG 2LD6A 1A7DA 3BASA 4R32A 1FJKA 1ORYA 3NYMA 3L73E 4I6MC 2EPMX 4CPGA 3L72E 1P84D 3C62A 4N6JA 1S9KE 2R7SA 1ZZPA 4JW1A 3PCVA 2K37A 1N73C 1R5ID 2MWQA 2N1TA 1KMIZ 4E17A 1DD4A 4LGDE 1VDFA 4XA4A 1QX8A 2PF4E 3NDBB 3CCVP 3KYQA 4CX9A 3L70J 2HUJA 4XLNF 4IL6X 2FYNB 2L5GB 2QTVA 4LERA 2O01J 1WGWA 3EZIA 1S5LE 2O1KA 4N78D 3ZSUA 1L0NG 2FXPA 1YBKA 1KC8Q 1FTSA 1MMAA 1ZP0C 3HKKA 3ZWIA 4H13D 3GW6A 1VOMA 2OYIC 1CZQA 3W8HA 4MTFA 2O01H 3GM2A 5KYWA 3L35A 3Q5PA 3VRCA 1YDIA 4NC3A 2XXAA 1SQPE 1JTHA 1OCZC 4C46A 5APQA 1FS0E 1LWUC 3CI9A 2H7VC 2LFDA 1A02J 4DBRA 1Z5ZA 1N2DC 1RKEA 3MUDA 1CW5A 1MNEA 3O55A 4PJLA 3DD7A 3VYWA 5M1BA 2MKVA 1T8ZA 1BCCG 3GEHA 1L7CA 3T6BA 2A06G 2IYPA 4R4LA 3EHNA 3SWFA 2KXPB 3TF5A 1ZW3A 2P58A 3DWWA 1N8RQ 4MVUA 3G9RA 2A45G 3HD7B 4P9TA 2A06D 4CJOA 1BE3E 3M9BA 3H25A 1L0LK 1NTKD 4JCZA 5TISH 2O1JA 1W2EA 1AJYA 1V74B 2AWCA 4E7ZA 4N6CA 1ZV8A 5CI9A 1PP9E 3RK3B 1RF1A 3MGNA 4HFFB 3HUSA 5KYUA 1SQXK 2M8RA 4E0IA 1G1IA 2A06E 4DBQA 3H1JJ 2GM4A 3S90A 2GAQA 1WT6A 1C17M 3O8ZA 1LWUB 3CCMP 1EC5A 3USSA 3B5NA 2OYHA 5KLVE 2WZFA 2P10A 2J0WA 3M0DC 2RMZA 5AVRB 3AE9C 3NKEA 3QVZA 2QA4P 4W80A 3PRJA 1NKZB 3TULA 3CX5I 5KYUB 5DVWA 3EGXB 2WVRA 5K5GB 1XZQA 3SXMA 5APWA 2B87A 3LW5J 1R5LA 5AGFA 1MFZA 4M63A 4MW3A 1RQUA 5A6BA 3IPMO 4NQFA 5DQTA 4ZLDA 3E1IA 5AVQB 2FXOA 3L72D 2OTKE 1EDKA 2WITA 1PZQA 4J7YA 2IZ0A 3CX5H 3H1KD 1RF0C 1JY2O 2BCCD 1MV8A 4YL1A 2E87A 1G8XA 3JSZA 1HJBA 1T2KC 3L36A 1FC2C 5APVA 2FFDB 1EXJA 1BZ4A 5L0IA 3SNHA 4JRZA 5JT4A 3UR3C 3RGUA 1T6IA 4I1MA 3NYJA 1ST6A 2DYSC 3NMJA 1D7MA 5CCHA 2ZT9D 1FR0A 2OTJP 1JRAA 3WODF 4P9FA 1KORA 3RK3C 2Q5UA 4PK4A 4FESA 2HZ8A 2WTYA 4DVZA 4CSAA 3AEGC 3KDPB 3SXZA 1R4TA 2QM8A 3IAOA 1O5HA 4NY3A 4K0DA 4WGZA 4H54A 1GL2A 4EDFA 1YLMA 4EIYA 4WGYA 1UIXA 2HODB 3U3FA 1NFOA 2HR3A 4Z9IA 2LP4A 3H1IJ 1ZRTE 3ECSA 1HJ0A 1PGPA 4Y99C 5T3WA 4U9EA 1GD2E 3T6GB 1Z56A 3AOUA 1AA0A 1FMWA 1NGMB 2LQGA 1LTTC 2YXRB 3C9IA 4FWVA 1H89A 5COMA 4WB4A 2AXTH 3U1CA 1RKCA 3TJ6A 4IAQA 5COGA 2Y9YA 1E5WA 4WJ0A 3AE1C 3WUUA 1IZMA 2JJLA 3JSVC 5A6KA 1AEPA 2VRSA 1OW7A 4LLHA 1Z3IX 2H7OA 2E75D 5AW3B 3OA1A 4IGGA 5AW8B 3TGUJ 3H1HE 2XRHA 4MVZA 3DZAA 2ZAEB 4PJNA 1QZXA 1PPJD 1U89A 4JJFA 1U7MA 3K6BA 3TNUB 3K66A 2IBZG 5T1DB 4NPFX 1LKXA 5BU8B 3TK0A 2XZRA 2KNCA 2DI3A 1EQ7A 3LIEA 1SQPK 3ASOC 2QJPB 1NJIQ 3H1KJ 3H1HG 3C8GA 3H1HD 1HY5A 2CPSA 4BXLA 4OWFA 2GA0A 1PPJG 4Z9HA 3CD6P 5KJ7C 2E74B 4ER9A 3I5QA 1YIJP 5GTIH 3Q5RA 1UIIA 4U9DA 1M1JA 3QW0A 5L0HA 3ASNC 3GMAA 1LTJA 5KLIC 3U2MA 4G7HF 1PFIA 1Q0MA 1RF1B 3TK1A 5AW7B 1EI7A 5KTBA 1GL2C 1KILE 4JPZB 2HPCA 1Q0DA 2PAJA 1KU2A 3FXDA 3S29A 2P1JA 1Q81Q 2QM7A 2R3SA 3RK2C 3KQGA 4GDOA 2R9RB 1HUCA 2JEEA 5HSWA 4NTFA 1L3PA 1AFOA 3TD7A 4XEFA 3G4ZA 3CXHH 4YK5A 2Q3EA 4CDAA 1A7EA 1AQ5A 1OKKD 2D4UA 1J2JB 1BBHA 1MKMA 1NTKJ 1JMMA 5F5FA 2KIKA 1KYOD 2N9BA 3M1CB 4CBEA 5B66H 2KB7P 1QLED 2A1DD 5KYXA 1GU4A 3K1HA 3LIDA 3Q1MA 2OG2A 4U5BE 5DS5A 4I3MA 3H6PA 4U5HA 2R03A 2IX7C 2A6EF 3LW5H 1Z6AA 1TQGA 1KFMA 1HGVA 5BVZA 1YZCA 2FKWB 1SQBJ 2Y3GA 3RK3D 3JCUQ 3CC4P 1GZLA 2L7AA 1JY2P 1SQVD 2W90A 4PD4E 4PJJA 3H32B 2R7RA 4KNWA 2V26A 2A6HF 4PJ0H 3VMYA 3KYIA 1Y8AA 2I1KA 2PFXA 3FVYA 4ZLCA 3PHLA 4GODA 3HRNA 4ZKPA 5KAIH 4PD4I 3L75G 5KKZC 3B0VC 1JPJA 1LM3B 4ULVA 3V2NA 1NU7D 2FGYA 3QW1A 3GG2A 4H0LC 4AYCA 3VN0A 1VQ8P 1BDJB 2N1TC 1D1CA 1GDTA 2KQ9A 4PD4H 1Z63A 3AJMA 1HH0A 1VPCA 4GT1A 3M79A 3MUDC 2XU6A 5KAFH 1EA8A 1LI5A 1PCXA 3D6YA 2EIJC 5AVZB 2IOQA 4YJWA 3BATA 2Z4EA 3RH3A 3MYFA 3L71J 5AW2B 3EH2A 1E79H 2IXMA 1X79B 4DJ9A 1NLXA 4XWJA 1N73B 2JO1A 1YQ3C 2AWYA 4KT0J 3U3BA 4QI2A 1G4US 2E76C 3RK2B 3B5NC 1TWHA 5AW9B 5KYYB 4XEKA 3VAYA 1RE4C 1VF5B 3JRMO 3WAQA 1WRGA 5KLVJ 1SZIA 5KYYA 1NHLA 2AEMA 2FYUG 4LDKA 1Z7Qc 4MNDA 2WSCH 1ORSC 1LTJC 3CXHE 3P8MC 4Q5SF 2NUTB 3PH0A 1FFTC 1T6UA 4WVZA 3UMKA 1T9KA 3TJ5A 3ABLC 1G4WR 1VQ5P 3BCCE 1KV4A 3MBGA 4F4BA 5E3AA 3L72J 2Z5HA 4OIRF 5APYA 3KYJA 1NTZE 1LIHA 1URQC 1EXIA 2NPSC 3JCUH 3LLKA 4GOFA 3FWNA 4UB8E 4JE9A 1BE3J 4H44B 4XPWA 2IYOA 5JRAA 1H88A 2W6BA 2WZLA 2LXBA 4U3FJ 1VYKA 2QG4A 3WG7C 4CDVA 2QE9A 2OEXA 2P2UA 1RF0A 2JKVA 1KILA 3E9VA 1NTMG 1KFNA 4JIOA 4JYCA 4EI2A 5L3VA 2A69F 2HKVA 3W2WA 3UGOA 5B5EE 1L0NE 1USEA 3I5CA 3SFEC 2Y0DA 1SFCA 1W2BO 2R7VA 2E75C 4WY4B 2YO2A 4TT3H 5APUA 4WBAA 3H1ID 3L74E 3RK2D 4JC7A 4X0RA 5AC5A 1NO4A 2FY8A 4PJMA 3EFGA 1FNTc 2PX3A 4YTPC 1L0NK 1DOVA 2B0JA 2JWDA 1PIXA 2KUBA 3M4CA 4U3FG 4Y99B 2E42A 3P8CD 1GTWA 4EUKB 4D6TD 3C8GD 3UGPA 1QSPA 4ULWA 4JBZA 4YWQA 2C0WA 3V5YA 1OWAA 1SQXJ 1OW8A 1J8YF 2WVNA 1TWGA 4E0HA 1HMOA 3HUSC 4IWBA 1IFPA 2QEXP 3PMRA 3DAFA 4RO0A 2ZT9C 2Q00A 1OXBA 3AGUA 3V4QA 2OTLP 1YYXA 5AW0B 3RBXA 5CCGC 1NU1K 4BEJA 1A0BA 3HD7C 1LT9C 4BWNA 2Y0EA 4L6RA 5DQZA 2NPSB 1IFDA 2WSFH 2YLGA 3RL0g 1L4AD 3LS1A 4DJGA 1WATA 5KAIE 3SSUA 5BQHA 3N0TA 5CCGA 3GM1A 5CBNA 3AE6C 3HJCA 2ICWG 2QNLA 1SQPD 2Y39A 5F28E 1RH5B 4O6YA 5CIVA 3T6JA 4YT4A 3MX3A 1KQSO 3L71G 4UB6E 2K3RA 5DS4A 1AVYA 4BEMJ 2JX0A 2Y0CA 2ZYDA 1MMDA 2L6FA 4NPEA 2KNHA 2MJZA 5E33A 1JY3O 5L0FA 1OVUA 3C8VA 5H2FE 4AUWA 3W4YA 2EIMC 1KQLA 4J30B 3S0XA 2H7HA 4CSAC 4U5EE 5EFWB 3V2PA 2WPRA 4RKUJ 1NOHA 3G3ZA 3SFDC 4JTCB 4JYBA 5CJ4A 2XLOA 4O7GA 3VF0A 2ASRA 1FZCC 1NU9C 3NYLA 3UMIA 4XEVA 2J59M 5DLJA 3LNMB 4IFFA 1H8AA 4JTDB 1RJ9A 1Q0GA 1NTZK 2IXNA 1YYCA 2VCAA 3X1OA 4HFKB 1YZAA 2QJKB 4MQ9F 1ORJA 2R32A 4OD5A 1OIPA 1PP9J 4EOTA 2E76D 4I7ZC 2NZ2A 3EGDA 3R2PA 2QSIA 2C9NY 1YITP 2VASA 1SQBG 2CYDA 3FGAD 1Y4CA 1OZHA 1FZEA 2ZXWC 2V7QJ 1YTZI 1LGHB 3LJBA 4KC9A 2O9XA 2YL3A 3EFFK 2AXCA 1E86A 2HMQA 1EDJA 4J7TA 2K1AA 1C02A 1JM0A 4L75A 2Q7RA 3Q7LA 1K05A 2G3VA 3VMXA 2N9YB 2ZJSE 5AVVB 5B66E 1GW3A 4JURI 5B3SC 3A0BH 4OD4A 2ZVOB 5EK0A 1A02F 1D0XA 3ZC4A 2WZGA 1FZBA 3B29A 2J7PD 1VF5C 1BR4A 1VQNP 1NU1J 1YVIA 1MMNA 3RKOF 1YJGA 4OIOF 1QVGO 3C1LA 1FAVA 3H1LG 4A7PA 1RJ9B 3JZ0A 1SQPJ 5KLVG 1OMIA 3H1LD 1E83A 1T6AA 1Q7YQ 3I55P 1VQKP 1NKNA 2Q9AA 3SEOA 4XTKA 4CS8C 4GEHA 3HE5A 4I1LA 2QJYC 2WT7B 4EKWA 4NTAA 4DOZA 5JSLA 1HW2A 5GTHH 4KHXA 2EPKX 1SP4A 2QJKC 3K1IC 3HUSB 2YVKA 4AQRD 2XSEA 2R7UA 2BE5F 256BA 2C9LY 4PD4D 2CNWA 1FFHA 4BJ5A 1X22A 1VLTA 2WVQA 3CWBG 2KJGA 4ZMDA 2BC5A 5HV9A 1BR2A 2WT7A 3VMAA 4HH2A 2XM4A 4I1OB 3DE9A 1OVVA 1WASA 2IYLD 2QIWA 2OQMA 1NAYA 3SXKA 4HJGH 1RQVA 5AVTB 4GKGA 4ANJA 3G71P 3FHDA 4W7ZA 4RESB 4JTAB 3V5BA 4YXDC 3L75J 3EGDB 1N7SA 1LS4A 1Q90D 2JD3A 1BDCA 3TOLA 1QL1A 2R02A 2CPBA 3P7KA 2HJMA 4BJ1A 2M0BA 3BRJA 2Y3DA 5KYNA 5AC4A 1YA9A 3D70A 3AE2C 3RQGA 3NMDA 1VQOP 2J9VA 2DYRC 4BJ6C 1IFJA 2V7QH 3DM5A 3JCUE 4OIQF 1S2EA 2X51A 1ZXGA 5JVEA 3VYIA 3IHUA 3ZDLA 3U2LA 1IFMA 2GUSA 1SQQD 3MLGA 4Z9JA 2YRFA 1SQBK 4C3BA 4D6TG 1MZ9A 2NUTA 4H44D 3ZVRA 3CMAP 5B1BC 1SMYF 4C7RA 1LP1B 3K5BA 4Y28J 3V6IA 1NTZG 3H1LE 3A9CA 3H32A 5KYWB 3Q6NA 2IXOA 4M3LA 3TGUD 4AX2A 2H88C 2XXAB 2K9JA 1DIPA 3L70E 3L1MA 4AE4B 4G7OF 4YT2A 5GPGB 2KK7A 3HTKC 1CSBA 3SYNA 4PACA 3VOPA 2PX0A 2FAPB 5APSA 2NPSA 2ZPAA 1T3UA 1YJWP 3HNIA 2IXPA 3DAGA 1PP9D 1ZN5A 1Q2NA 2L91A 5CJ0A 2M4EA 1E84A 3CL3D 3TYYA 3U59A 2RN0A 2CGEA 2A68F 1ZHXA 1DEBA 1SQQG 1QEXA 1Z23A 1BCCD 2LR2A 1KB9E 3AQCA 2C04A 3E1RA 2KYVA 3BCCD 1NZEA 2E75B 2YKPA 3CCUP 3W8IA 4IFMA 4YXWH 1BGYE 5AW5B 3MD0A 1IO4A 2QY9A 1X0TA 2IDBA 2ZXEB 2VC9A 1SQVK 3HNLA 1M90Q 3AEFC 1J1EB 3AEDC 1VMAA 3CCRP 3GHGB 3H1KG 2VH3A 1G1JA 1M1JB 4DVYP 5FZTA 1DD3A 1X9VA 4GOEA 1DOWA 3G4SP 1M2VB 3JT1A 3EG9A 3HTKA 4D4NA 2HPCB 3VMZA 5KLVK 2E5YA 2E74D 1TWAA 3AQBA 2UWJE 1Y6DA 2J9WA 1USDA 1ZW0A 2C0XA 2R44A 2JPUA 4FX5A 4H4KC 1L0ND 3SWKA 1S4XA 2KI7B 1M1KQ 4C7OA 3GHGA 1MMGA 2YLIA 4HEAJ 3TDKA 2YO3A 2ITAA 5CCHD 2NSFA 4QDLA 3U8PA 3KPEA 3H1IE 1D0YA 2K88A 3EG9B 1FBMA 5CCHC 3DXJF 3FOOA 1CPRA 3KPHA 4BJ6A 5EGYA 3H2UA 2B9BA 1URQA 3SP1A 1ZLLA 1RKEB 4PV1D 2JR8A 2YLDA 1T01A 3GANA 2D2CC 1YAUO 5AVWB 3CX5E 3GEEA 1Q0FA 4DCKA 1QLEC 1XZPA 1M57C 2QJYB 1E2XA 2CCYA 1RE3A 5L0DA 2R7OA 2YL1A 3O6XA 4HE8D 3CCEP 3H1IG 2FFDA 2IPPA 3W67A 2NPUA 2XL4A 1URQB 2YL7A 3LNRA 3UNGC 1VLSA 4K3AA 3N2ZB 2Y3BA 5APXA 4U7JA 3C7JA 2QE7H 1KILD 1L4AC 3UIAA 3BVHA 3L4FA 1FMVA 4I44A 3A11A 1L0NJ 1LP1A 4OGQD 4C7OB 2P67A 2YMKA 1W5CE 2KS1B 4NCQA 2JP3A 4DRIB 1NTME 2L6GA 1XWJA 1LT9B 2Q9IA 3PTZA 5JS5A 3TGUE 2GFHA 3I5PA 2D5RB 3QTHA 2OYOA 2YIUB 3RW0A 2PP6A 1YJ9P 3L8IA 2WB7A 3LAYA 3H1JD 2ZT9B 2Q1KA 4ASVA 3AEAC 2G8YA 4NPDA 3TNUA 1RY3A 2XLVA 4AL1A 3MP7B 3LEOA 4RD9A 4N06A 3AG4C 2WPQA 1LTAC 2IBZD 1JY3P 4RJTA 4H13B 2P0NA 4A4AA 2W8ZA 1IZNB 2H89C 1T6QA 4K35A 3C63A 3H1LJ 2WMMA 3QWOC 1JMWA 1ZU5A 3H65A 1NU1G 1G5ZA 5KJ7A 2OYHC 4N4WA 3HE4A 1APCA 3IN6A 1EZVG 1SQVE 1OW6A 1WN0A 1WTYA 4K1OA 3A0HH 4N3YB 1M56C 2EPNA 2YQYA 1M6TA 2KNCB 1K40A 1IK9A 3BEHA 1SQQK 2WL8A 3KMIA 1H6GA 4EBJA 1VQLP 5AVXB 1J1EC 3DI5A 5GTIE 1QPUA 3V4WA 4XE5B 2ZXOA 1HTLC 1L0LG 4DZOA 2BCCG 2FXMA 1FOSF 3L74D 1ZW2A 3MYIA 3NFQA 1BGYD 2YL0A 1NAFA 3EPVA 3NTNA 4U5GA 3CQZA 3ITFA 1NTZJ 2L81A 1JY2N 5EHHA 1OXKA 3CC2P 1KYOH 2YHSA 1SF8A 3Q2YA 5AVYB 4BJTA 4XLPF 3NG1A 3CX5D 4CDYA 3E7KA 5H2FH 2ZYAA 2BCCE 3B5ND 1D1AA 2EPOA 2ETSA 1GW4A 2ZXXA 2NSGA 1AUEA 2AEFA 1GU5A 2M5AB 3C18A 1DEEG 1Q86Q 4MW8A 5GTHE 4OIPF 1NFNA 2R25A 1FZCA 1KYOI 4ZNCA 1NBBA 2PP4A 3L73D 4OINF 3PHF2 4U5CE 3TOMA 1JB0J 2N1TB 1FZCB 2HG5D 1FJPA 2OYIA 5TISE 3GM3A 3VP9A 1XTGB 2XKMA 4O9BA 1HE1A 5A6BD 3M9HA 2OYIB 1U6HA 4O6MA 3WUTA 1HGZA 3EQ2A 3T9OA 2C03A 1CPQA 1NU1E 5A6JA 2MYSA 2G3AA 2CK3H 2OGUA 3I56P 5DJUB 2FYUE 3HNKA 3K33A 1BGYG 3A2AA 3C8GB 5COFA 4Q4ZF 1VQ9P 4XPXA 3KXDA 3KKBA 2OARA 1LT1A 2YNYA 1NTMD 2W45A 2W4MA 3HE5B 2NUPB 2AU5A 2XL6A 3ABVC 3F47A 2N1TD 2YWAA 2YKOA 3FDQA 3AE3C 1K8AQ 2YKQA 3I4UA 1A7VA 3PLNA 2Y9ZA 4IJJA 2P61A 1MFTA 1WOLA 4C7NB 2BEQD 2W4BA 1HMDA 4G78A 3M4BA 1SQXG 2J58A 1F1MA 4JQ0D 2NUPA 2VCCA 1D0ZA 2OCCC 3LUTB 3CEXA 2DGJA 2Q9CA 2KW3C 2MHRA 3EJNA 3CXHD 3F89A 3EGXA 3NRHA 4GYTA 4XQ1A 4YL3A 1UG7A 4CS7A 1Q82Q 2KZJA 1R8EA 3Q5SA 3AE7C 3DJNB 2WPSA 2XLHA 3LLIA 1MUUA 2E76B 3AE4C 3VTPC 1H0TB 1V55C 1QL2A 3QVYA 2LIGA 3OA7A 2R7TA 4EIJA 3IR9A 1LJ2A 2A0UA 3NMIA 3SXYA 1L0LE 1QQ3A 3OWTA 1SQBD 5KYXB 1TFOB 1GL2B 1S72P 4AE4A 1SFCD 2J46A 1I4ZA 3ZTZA 3KZIE 1Q0KA 1LT9A 2BL2A 4G0HA 3A7OA 2LKMA 4ASWA 1AV1A 2ZVNB 4LACB 2L6HA 3RVYA 1KILC 3FWLA 1KQFB 3N4XA 2AVKA 5BUOA 1KB9D 2XLMA 3L34A 2HV6A 5CI8A 1YTZT 3NKDA 1JTHB 3W2VA 1JR8A 4YT8A 2KYHA 2CW0F 4XPYA 2HYNA 3AGTA 1EZVI 3T97A 4BRYB 3ZIBA 1J1DC 1S5LX 2G3KA 1TKNA 3A3YB 3O10A 2KC3A 2KSEA 4IARA 4L74A 4A2NB 2WSEJ 1UFBA 3G4XA 2HLOA 2G62A 1PGQA 1JCDA 1JO5A 2Q9BA 1NWQA 4MN4C 1PL5A 1KZUB 3L72G 3AEBC 3RQFA 1EZVD 2JWAA 2KLUA 2XDJA 2HSBA 3L70G 1LTBC 2P6VA 1SQVJ 3M91A 4KBLA 3RF3A 3U9MA 5L0JA 3U0CA 2QUPA 4JF7A 1N73A 4W8KA 1M8OB 1JEKA 3O6QB 2FYUJ 3NXSA 2UUHA 2E43A 3LS0A 1JMBA 3K1IA 2POHA 1PV3A 1KN7A 3HTKB 2XLEA 4H0LD 1MQVA 4LDRA 5B5EH 2HJ3A 3P32A 1H0TA 4PR9A 3R7CA 3B5NB 4CJGA 3N24A 4IAOA 1NTZD 5E79E 2K9YA 4YPCA 2WQYC 3PJSK 3ABKC 4DRJB 2R5BA 4N78E 3V2RA 2Q3TA 1N86A 3L71D 1N7SD 2KLVA 4LC1A 3WU2H 2HFIA 2WSCJ 2FFDC 2O01N 2QLAA 1CGOA 4UB8H 5KLIB 4OH8B 1OX3A 3HD7D 3ZG1A 1JOGA 1LPEA 4KJMA 2XLWA 4HYTB 2Y3HA 1U0BB 1YI2P 4DT0A 1YJNP 3RL0B 2J7PA 2EPLX 2Z5IA 1ZHZA 3T4RA 1LTSC 4E18A 3L73J 1QGKB 4IOIH 1RHZB 4H0LB 2H43A 1BGYJ 5CHXA 5K0IA 4JVSA 2KS1A 2P7JA 2WSFJ 3V2QA 3AG3C 1LTIC 1FDIA 3GEIA 5AVUB 1LS1A 4JCHA 4HB1A 4BRYA 1LE2A 3U9JA 4L73A 1HVVA 2J9BA 2IFMA 3F5HA 1M7LA 4MS2A 1H7IA 1OR2A 2W6AA 3U8VA 2J8WA 3POVA 3MHVA 2JDIH 3LEVA 5TJHA 1LE4A
chains in the Genus database with same CATH topology
4EBKA 3RQEA 1K04A 3IN6A 3EWKA 1OW6A 3FGAD 3GLMA 3AJMA 3C8GD 3MFNA 3D70A 2WSEJ 3AE2C 3GMAA 1UFBA 3RQGA 3ABVC 1WTYA 5KLIC 4OGQC 4R4MA 3D6YA 1EXJA 2YWAA 1GMJA 1ZOYC 2V7QJ 1OW8A 2FYNC 3AE3C 4XFJA 1KILE 4H44C 1K40A 2ZT9D 4PV1D 1PL5A 2D2CC 3AEBC 3RQFA 4EBJA 4H44D 1KORA 2Q00A 2ZT9C 5M1BA 4GDOA 2MKVA 2HSBA 3AEGC 4PV1B 1VF5D 4Y28J 1WOLA 2JO1A 1YQ3C 1K05A 2BEQD 4KT0J 3U0CA 2WPVB 3IAOA 4R4LA 2E76C 3B71A 3D71A 2PBEA 4XEKA 2H88C 1VF5B 4XEFA 2OQQA 1DIPA 1IK7A 3O6QA 1VF5C 1UIXA 3Q3DA 1PV3A 1VL2A 3AE5C 3U3FA 1MKMA 3RL0g 4H0LD 3G9RA 1R8EA 1NYHA 2LK4A 3JZ0A 3Q5SA 3AE7C 4OGQB 1HF9A 1Y9BA 1OMIA 1O3UA 3GM1A 4PV1C 4U7JA 1ZRTE 1HJ0A 3AE6C 2E76B 3AE4C 1WMKA 3H25A 2QJYC 1V4AA 2K9YA 2WQYC 3Q2YA 1AJYA 1NGMB 5F28E 3R4YA 4OGQD 2YMKA 3D6ZA 1KNYA 3Q1MA 1EXIA 2JP3A 2D2CB 2L6GA 2QJKC 4R32A 2WSCJ 2BEZF 2JX0A 4H44B 1KQGB 2L6FA 3C18A 3GF3A 1S1CX 4Z1MH 1JOGA 2E75B 1WWPA 3AE1C 1KTMA 3GF7A 1ZZPA 1FDOA 2D2CD 3C8VA 3L8JA 1JB0J 3AECC 2IDBA 3T97B 3L8IA 2P10A 2ZT9B 1OW7A 3AEFC 2E75D 3AEDC 2L6HA 1KMIZ 2J5UA 1DD4A 3AE9C 4RKUJ 1KQFB 3AEAC 3GM3A 3SFDC 3JYYA 2G8YA 3AEEC 3TULA 4H0LB 1DD3A 2FBWC 3SFEC 4IL6X 2KK1A 4XEVA 3RK3E 2WSFJ 3S9OA 1ZMEC 2QIWA 1U57A 2E75C 1TU3F 2O01J 3LW5J 1QVXA 4TT3H 1FDIA 5KKZC 2QJPC 1RQVA 2G3AA 3AE8C 4H13B 2FXPA 4H13C 1RQUA 5L8RJ 2E74D 1YQ4C 4NQFA 4YXDC 3C8GA 3K7DA 1ZP0C 2H89C 2JPUA 1Q90D 1S5LX 4H13D 2E76D 4H0LC 4I7ZC 2E74C 2NZ2A 4YTPC 3C8GB 2E74B 4I7ZB 3O10A 2QSIA 3Q5RA 3GM2A 2YIUC 3BRJA 1PIXA 3Q5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBK A;  3RQE A;  1K04 A;  3AJM A;  1OW6 A;  3C8G D;  3MFN A;  3AE2 C;  1UFB A;  3RQG A;  3ABV C;  1WTY A;  2YWA A;  1ZOY C;  1OW8 A;  3AE3 C;  1K40 A;  3AEB C;  3RQF A;  4EBJ A;  2Q00 A;  2HSB A;  3AEG C;  1WOL A;  1YQ3 C;  1K05 A;  3U0C A;  3B71 A;  2PBE A;  4XEK A;  2H88 C;  4XEF A;  1PV3 A;  3AE5 C;  3U3F A;  2LK4 A;  3JZ0 A;  3AE7 C;  1O3U A;  3GM1 A;  3AE6 C;  3AE4 C;  1V4A A;  2WQY C;  5F28 E;  1KNY A;  4R32 A;  2L6G A;  2JX0 A;  2L6F A;  3C18 A;  1JOG A;  1WWP A;  3AE1 C;  1KTM A;  1ZZP A;  3L8J A;  3AEC C;  3L8I A;  1OW7 A;  3AEF C;  3AED C;  2L6H A;  3GM3 A;  3AE9 C;  3JYY A;  3AEA C;  3SFD C;  3AEE C;  3TUL A;  2FBW C;  3SFE C;  2KK1 A;  4XEV A;  3S9O A;  1QVX A;  2G3A A;  3AE8 C;  1YQ4 C;  4NQF A;  4YXD C;  3C8G A;  3K7D A;  1ZP0 C;  2H89 C;  2JPU A;  4YTP C;  3C8G B;  3O10 A;  3GM2 A;  3BRJ A; 
#chains in the Genus database with same CATH topology
 1NTM K;  2LCH A;  2TMV P;  3H1K E;  2KP8 A;  3WUV A;  3U5S A;  5D91 A;  4U3F D;  4XFJ A;  4UB6 H;  1KB9 H;  2F22 A;  2GUV A;  4YN0 B;  3A0H E;  1RCP A;  2WZ7 A;  1H9T A;  2HSQ A;  1FDM A;  4B6I A;  1VB5 A;  3FXE A;  3HNJ A;  3OEO A;  2FYU D;  2QRX A;  5B3I A;  4IL6 H;  5E79 H;  2A0B A;  1VQM P;  3CPW O;  3CAX A;  1JY3 N;  3CZ6 A;  3B71 A;  3II6 A;  3SWY A;  3IF4 A;  4MVR A;  2PBE A;  4G7Z F;  4WY4 D;  3B9Q A;  3H2V A;  4DOJ A;  3WHN A;  3B8E B;  3AE5 C;  1RF1 C;  1NYH A;  5CCG D;  3Q7G A;  4O6N A;  1GL2 D;  2YKZ A;  3H1H J;  2BCC J;  5JP7 A;  1BSN A;  1SQQ E;  1DX7 A;  1BR1 A;  3IQT A;  1I5N A;  3N7N A;  1FAP B;  1N7S C;  2YMY A;  1LTJ B;  2H8A A;  2XS8 A;  3L75 E;  1ZHY A;  1HBW A;  1NVO A;  3S84 A;  2Q6Q A;  4ZKU A;  1VYI A;  3X2Q C;  3IQ6 A;  3GWL A;  1OCR C;  1L2P A;  3GF3 A;  2YZS A;  3HD7 A;  1SYQ A;  4B86 A;  2XL8 A;  1EDI A;  2AXT E;  3ZQV A;  2FYZ A;  3AEC C;  2R3C A;  1SQQ J;  4YL0 A;  4AK9 A;  4JKV A;  3UMH A;  3JSE O;  3GHG C;  4LDQ A;  1LI7 A;  2M3E A;  1T2K D;  2OJE D;  2AP3 A;  2EIL C;  2XM0 A;  2B89 A;  1J1D B;  4HKZ H;  1M2O A;  2KK1 A;  1ZME C;  1S9K D;  4MVO A;  3AE8 C;  3U1A A;  5D92 A;  3RVZ A;  3B4S A;  3ZDM A;  1IFI A;  2LSE A;  4NTB A;  4PFP A;  2SPZ A;  1ZR2 A;  2OYH B;  2XNX A;  5BQG A;  4Q7C A;  3CCQ P;  5A69 A;  2ZXR A;  3RYL A;  1M56 D;  3CC7 P;  1PD0 A;  2VB6 A;  4MVQ A;  3L71 E;  5JLI A;  3AG2 C;  2HMZ A;  1OCC C;  3CWB E;  4BG0 A;  2OKU A;  1NSG B;  1ZOY C;  2CDQ A;  3NMK A;  4CS9 A;  1JAF A;  3RIP A;  3TQO A;  4KI2 A;  2HOD A;  4N6H A;  2Z15 A;  1K9M Q;  3DJU B;  1T5O A;  3RFY A;  2W6J H;  3QMK A;  5FCL A;  3L0I A;  3W68 A;  3MTU E;  2Y69 C;  3MZW B;  5L0G A;  1NTK G;  2RH0 A;  2WVO A;  2HS5 A;  2VCB A;  2IBZ E;  3V5X A;  5JUA A;  5C39 A;  3J06 A;  2Q4F A;  1FZA A;  2CNW D;  1CGN A;  2H8P D;  2W83 C;  3S28 A;  1VQ6 P;  3O6Q A;  5L3Q A;  1RMV A;  2IM8 A;  1SFC B;  3WMM 0;  3Q3D A;  2EIN C;  2DW3 A;  3KL4 A;  1U7J A;  4DXW A;  4OGQ B;  1Y9B A;  5APT A;  4PFO A;  5AW6 B;  1ZU4 A;  1T3J A;  3TSI A;  1L4A B;  3FAP B;  2I15 A;  1P84 E;  4CIP A;  2FFH A;  4IL6 E;  1L4A A;  3R4Y A;  4U3F E;  3EZH A;  3EQL F;  1CI6 B;  4D6T J;  1VQP P;  1EQ1 A;  3L37 A;  2K9J B;  1VQ7 P;  2V4H A;  2HV7 A;  4IRU A;  4CS9 C;  4MVM A;  2XLD A;  1C03 A;  2NG1 A;  1PGJ A;  3E70 C;  2Q7C A;  3DKA A;  2NPS D;  1WWP A;  3GF7 A;  1FDO A;  2D2C D;  4U5F E;  1RXQ A;  1G2C B;  4IFD K;  1MND A;  3BCC J;  1J8M F;  4DRH B;  2J5U A;  1TFK B;  3FAJ A;  3CLQ A;  1X8Y A;  2WSE H;  1D1B A;  4JEA A;  4QMA A;  3EH1 A;  2I1J A;  3VP8 A;  1HW1 A;  3CME P;  4KNV A;  1YAR O;  2ZXP A;  5IY5 C;  1DH3 A;  4C3E A;  3BRV B;  3DM9 B;  4H13 C;  4JZA A;  1URQ D;  3TGU G;  3L73 G;  3G6E P;  1BDD A;  1HE9 A;  3F46 A;  3K7D A;  1SLQ A;  2WSS H;  2E74 C;  3IQ5 A;  2OEV A;  1V54 C;  3V5Z A;  2P1A A;  2YIU C;  3M15 A;  3GLM A;  5L0C A;  2P7V A;  2I8B A;  2WWW A;  4OGQ C;  2KSJ A;  1GMJ A;  3P8C E;  1FOS E;  1SQX E;  1EZV E;  1SQV G;  4H44 C;  3CCS P;  1BCC J;  4JJG A;  4MTO A;  4EHP A;  5AVS B;  3BRT B;  3A5T A;  2R7Q A;  3ITK A;  2QVA A;  2R7X A;  3ATP A;  3GWN A;  1E85 A;  1S7Z A;  1OQC A;  2ZD9 A;  4JEB A;  2PRR A;  1G2C A;  2KGO A;  2YEV A;  1NU1 D;  3D71 A;  3JRT A;  2ZYG A;  2RD9 A;  2M5A A;  3IEE A;  1M57 D;  4ONS A;  3CWB D;  2I8D A;  3AG1 C;  1OR3 A;  1OFC X;  1A41 A;  4PV1 C;  3EHM A;  2PGD A;  1BE3 D;  1N1C A;  5AW1 B;  3S1K A;  3KH2 A;  1NTK E;  2BAS A;  3S27 A;  2D2C B;  2W27 A;  1YYJ A;  1ZHW A;  2BEZ F;  1AVO A;  1KQG B;  5TJ5 E;  2W9Y A;  1ZYR F;  3FOP A;  4WY4 C;  4Z1M H;  1AVO B;  1KTM A;  1IC2 A;  3CCL P;  3JYH A;  2X0C A;  1B68 A;  1P84 H;  1OKK A;  1OVR A;  4CS8 A;  1S05 A;  2KOG A;  2XS1 A;  2J0X A;  3B0P A;  5BU5 A;  1W2W A;  2FBW C;  2OU6 A;  4FAP B;  3ZTM A;  2FYU K;  3Q6M A;  1QVX A;  3QZC A;  3LES A;  4W8P A;  2ZFC A;  1EKY A;  3L70 D;  1P84 I;  5L8R J;  1M1J C;  2LXC B;  2L9J A;  3A0B E;  1N7S B;  2NRG A;  3M06 A;  4C7N A;  4K7B A;  1VTM P;  4W7Y A;  3RQE A;  3GOD A;  1K04 A;  3EWK A;  1FU1 A;  3V7O A;  2XV5 A;  5BQI A;  2OOC A;  1QKR A;  2B87 B;  4R4M A;  1PD1 A;  1GK4 A;  2IBZ I;  3ABM C;  3FXH A;  1JOC A;  3PDM P;  3OW2 O;  2GWW A;  4UDV A;  2IZ1 A;  1FE6 A;  1SFC C;  1GQA A;  4D4X A;  3KZI H;  1BSH A;  1BCC E;  1RE4 A;  3ZQY A;  4RDA A;  3M0A A;  3DE8 A;  3VM6 A;  3EFO A;  2IFN A;  1NG1 A;  1KD1 Q;  1VK5 A;  1SS1 A;  2XND H;  3HE4 B;  5KJ7 D;  3QH9 A;  2WPV B;  3G50 A;  2B88 A;  1HWT C;  1R5S A;  4OVN F;  1YA7 O;  3C8Z A;  1CI6 A;  3CWB J;  3RL0 D;  1K73 Q;  1VQ4 P;  5DJT B;  1S5L H;  1IK7 A;  1SQP G;  2PFD A;  2UUI A;  3HLZ A;  1N7L A;  1S3J A;  1VL2 A;  1ZHT A;  2Q3I A;  2DB4 A;  3EFO B;  2AEJ A;  3FX0 A;  4MVS A;  3KHU A;  2O3J A;  4WWI A;  2M64 A;  2R5D A;  3SZR A;  1H9G A;  1ZRT D;  1XTC C;  3H1J G;  1JUN A;  3CXH I;  1GK6 A;  5CBO A;  1NTM J;  1SQX D;  1M2V A;  2PNO A;  1JPN A;  5DS6 A;  2RSE B;  2J9U A;  3GOR A;  1PPJ E;  4GQH A;  2H7B A;  2YXQ B;  1JNM A;  5KKZ B;  1S1C X;  2LFF A;  4IB4 A;  3WU2 E;  3H1J E;  5KAF E;  3MIW A;  3L8J A;  1TR2 A;  3T97 B;  1FZG A;  4D6T E;  4YT5 A;  3PP5 A;  3JYY A;  3M0D A;  4U5D E;  3AEE C;  4GIF A;  5E2Q A;  1PP9 G;  2V3C C;  1FZF A;  3RK3 E;  3S9O A;  1U57 A;  2GDC A;  1TU3 F;  3IQC A;  4BPM A;  2QJP C;  5T3T A;  1L0L D;  1NTK K;  4L76 A;  1EDL A;  3DMD A;  1GGQ A;  4QI0 A;  1SVF A;  4E7S A;  1YQ4 C;  3JC2 2;  1CGM E;  1OCO C;  3OJA B;  1KIL B;  1KB9 I;  4J32 B;  1LTG C;  2J45 A;  4PJ0 E;  4I7Z B;  1TWC A;  2M3B A;  1LNQ A;  5CMZ A;  4BJ5 C;  4EBK A;  2KZI A;  3RL0 C;  3FMS A;  3OAK A;  3MFN A;  5B1A C;  2A45 I;  1GS9 A;  1IJD B;  4WY4 A;  1YHQ P;  4MTG A;  4RBN A;  4EBB A;  2OJQ A;  1SR2 A;  2FYN C;  5E3C A;  2HFE D;  3S4R A;  2KSF A;  2R05 A;  4TLF A;  1BE3 G;  4P6I C;  3M9Q A;  1IW7 F;  2RKL A;  5F5H A;  1I4Y A;  4PV1 B;  1VF5 D;  2A45 H;  3L74 J;  3O39 A;  1ZR4 A;  4WAB A;  5KLV D;  3US6 A;  1KYO E;  2B0H A;  3JTL O;  4C3D A;  1IFN A;  4EWC A;  4LLC A;  1AQT A;  2OQQ A;  5AW4 B;  1OXZ A;  1JCC A;  2EIK C;  2GA1 A;  1ZVZ A;  4CIH A;  3RBZ A;  1QVF O;  3L75 D;  1O87 A;  3IFM A;  1LVK A;  1LWU A;  3CCJ P;  1L0L J;  4I2L C;  2LK4 A;  3L74 G;  1HF9 A;  2IBF A;  1RE3 C;  3CSK A;  1O3U A;  4LLE A;  1PGO A;  2E5T A;  4EYY Q;  1WMK A;  4O79 A;  4AL0 A;  5A6A A;  1SQB E;  1V4A A;  1NH4 A;  3B0U X;  3D6Z A;  1KNY A;  2R7W A;  1Y47 A;  1GM5 A;  3BCC G;  2LD6 A;  1A7D A;  3BAS A;  4R32 A;  1FJK A;  1ORY A;  3NYM A;  3L73 E;  4I6M C;  2EPM X;  4CPG A;  3L72 E;  1P84 D;  3C62 A;  4N6J A;  1S9K E;  2R7S A;  1ZZP A;  4JW1 A;  3PCV A;  2K37 A;  1N73 C;  1R5I D;  2MWQ A;  2N1T A;  1KMI Z;  4E17 A;  1DD4 A;  4LGD E;  1VDF A;  4XA4 A;  1QX8 A;  2PF4 E;  3NDB B;  3CCV P;  3KYQ A;  4CX9 A;  3L70 J;  2HUJ A;  4XLN F;  4IL6 X;  2FYN B;  2L5G B;  2QTV A;  4LER A;  2O01 J;  1WGW A;  3EZI A;  1S5L E;  2O1K A;  4N78 D;  3ZSU A;  1L0N G;  2FXP A;  1YBK A;  1KC8 Q;  1FTS A;  1MMA A;  1ZP0 C;  3HKK A;  3ZWI A;  4H13 D;  3GW6 A;  1VOM A;  2OYI C;  1CZQ A;  3W8H A;  4MTF A;  2O01 H;  3GM2 A;  5KYW A;  3L35 A;  3Q5P A;  3VRC A;  1YDI A;  4NC3 A;  2XXA A;  1SQP E;  1JTH A;  1OCZ C;  4C46 A;  5APQ A;  1FS0 E;  1LWU C;  3CI9 A;  2H7V C;  2LFD A;  1A02 J;  4DBR A;  1Z5Z A;  1N2D C;  1RKE A;  3MUD A;  1CW5 A;  1MNE A;  3O55 A;  4PJL A;  3DD7 A;  3VYW A;  5M1B A;  2MKV A;  1T8Z A;  1BCC G;  3GEH A;  1L7C A;  3T6B A;  2A06 G;  2IYP A;  4R4L A;  3EHN A;  3SWF A;  2KXP B;  3TF5 A;  1ZW3 A;  2P58 A;  3DWW A;  1N8R Q;  4MVU A;  3G9R A;  2A45 G;  3HD7 B;  4P9T A;  2A06 D;  4CJO A;  1BE3 E;  3M9B A;  3H25 A;  1L0L K;  1NTK D;  4JCZ A;  5TIS H;  2O1J A;  1W2E A;  1AJY A;  1V74 B;  2AWC A;  4E7Z A;  4N6C A;  1ZV8 A;  5CI9 A;  1PP9 E;  3RK3 B;  1RF1 A;  3MGN A;  4HFF B;  3HUS A;  5KYU A;  1SQX K;  2M8R A;  4E0I A;  1G1I A;  2A06 E;  4DBQ A;  3H1J J;  2GM4 A;  3S90 A;  2GAQ A;  1WT6 A;  1C17 M;  3O8Z A;  1LWU B;  3CCM P;  1EC5 A;  3USS A;  3B5N A;  2OYH A;  5KLV E;  2WZF A;  2P10 A;  2J0W A;  3M0D C;  2RMZ A;  5AVR B;  3AE9 C;  3NKE A;  3QVZ A;  2QA4 P;  4W80 A;  3PRJ A;  1NKZ B;  3TUL A;  3CX5 I;  5KYU B;  5DVW A;  3EGX B;  2WVR A;  5K5G B;  1XZQ A;  3SXM A;  5APW A;  2B87 A;  3LW5 J;  1R5L A;  5AGF A;  1MFZ A;  4M63 A;  4MW3 A;  1RQU A;  5A6B A;  3IPM O;  4NQF A;  5DQT A;  4ZLD A;  3E1I A;  5AVQ B;  2FXO A;  3L72 D;  2OTK E;  1EDK A;  2WIT A;  1PZQ A;  4J7Y A;  2IZ0 A;  3CX5 H;  3H1K D;  1RF0 C;  1JY2 O;  2BCC D;  1MV8 A;  4YL1 A;  2E87 A;  1G8X A;  3JSZ A;  1HJB A;  1T2K C;  3L36 A;  1FC2 C;  5APV A;  2FFD B;  1EXJ A;  1BZ4 A;  5L0I A;  3SNH A;  4JRZ A;  5JT4 A;  3UR3 C;  3RGU A;  1T6I A;  4I1M A;  3NYJ A;  1ST6 A;  2DYS C;  3NMJ A;  1D7M A;  5CCH A;  2ZT9 D;  1FR0 A;  2OTJ P;  1JRA A;  3WOD F;  4P9F A;  1KOR A;  3RK3 C;  2Q5U A;  4PK4 A;  4FES A;  2HZ8 A;  2WTY A;  4DVZ A;  4CSA A;  3AEG C;  3KDP B;  3SXZ A;  1R4T A;  2QM8 A;  3IAO A;  1O5H A;  4NY3 A;  4K0D A;  4WGZ A;  4H54 A;  1GL2 A;  4EDF A;  1YLM A;  4EIY A;  4WGY A;  1UIX A;  2HOD B;  3U3F A;  1NFO A;  2HR3 A;  4Z9I A;  2LP4 A;  3H1I J;  1ZRT E;  3ECS A;  1HJ0 A;  1PGP A;  4Y99 C;  5T3W A;  4U9E A;  1GD2 E;  3T6G B;  1Z56 A;  3AOU A;  1AA0 A;  1FMW A;  1NGM B;  2LQG A;  1LTT C;  2YXR B;  3C9I A;  4FWV A;  1H89 A;  5COM A;  4WB4 A;  2AXT H;  3U1C A;  1RKC A;  3TJ6 A;  4IAQ A;  5COG A;  2Y9Y A;  1E5W A;  4WJ0 A;  3AE1 C;  3WUU A;  1IZM A;  2JJL A;  3JSV C;  5A6K A;  1AEP A;  2VRS A;  1OW7 A;  4LLH A;  1Z3I X;  2H7O A;  2E75 D;  5AW3 B;  3OA1 A;  4IGG A;  5AW8 B;  3TGU J;  3H1H E;  2XRH A;  4MVZ A;  3DZA A;  2ZAE B;  4PJN A;  1QZX A;  1PPJ D;  1U89 A;  4JJF A;  1U7M A;  3K6B A;  3TNU B;  3K66 A;  2IBZ G;  5T1D B;  4NPF X;  1LKX A;  5BU8 B;  3TK0 A;  2XZR A;  2KNC A;  2DI3 A;  1EQ7 A;  3LIE A;  1SQP K;  3ASO C;  2QJP B;  1NJI Q;  3H1K J;  3H1H G;  3C8G A;  3H1H D;  1HY5 A;  2CPS A;  4BXL A;  4OWF A;  2GA0 A;  1PPJ G;  4Z9H A;  3CD6 P;  5KJ7 C;  2E74 B;  4ER9 A;  3I5Q A;  1YIJ P;  5GTI H;  3Q5R A;  1UII A;  4U9D A;  1M1J A;  3QW0 A;  5L0H A;  3ASN C;  3GMA A;  1LTJ A;  5KLI C;  3U2M A;  4G7H F;  1PFI A;  1Q0M A;  1RF1 B;  3TK1 A;  5AW7 B;  1EI7 A;  5KTB A;  1GL2 C;  1KIL E;  4JPZ B;  2HPC A;  1Q0D A;  2PAJ A;  1KU2 A;  3FXD A;  3S29 A;  2P1J A;  1Q81 Q;  2QM7 A;  2R3S A;  3RK2 C;  3KQG A;  4GDO A;  2R9R B;  1HUC A;  2JEE A;  5HSW A;  4NTF A;  1L3P A;  1AFO A;  3TD7 A;  4XEF A;  3G4Z A;  3CXH H;  4YK5 A;  2Q3E A;  4CDA A;  1A7E A;  1AQ5 A;  1OKK D;  2D4U A;  1J2J B;  1BBH A;  1MKM A;  1NTK J;  1JMM A;  5F5F A;  2KIK A;  1KYO D;  2N9B A;  3M1C B;  4CBE A;  5B66 H;  2KB7 P;  1QLE D;  2A1D D;  5KYX A;  1GU4 A;  3K1H A;  3LID A;  3Q1M A;  2OG2 A;  4U5B E;  5DS5 A;  4I3M A;  3H6P A;  4U5H A;  2R03 A;  2IX7 C;  2A6E F;  3LW5 H;  1Z6A A;  1TQG A;  1KFM A;  1HGV A;  5BVZ A;  1YZC A;  2FKW B;  1SQB J;  2Y3G A;  3RK3 D;  3JCU Q;  3CC4 P;  1GZL A;  2L7A A;  1JY2 P;  1SQV D;  2W90 A;  4PD4 E;  4PJJ A;  3H32 B;  2R7R A;  4KNW A;  2V26 A;  2A6H F;  4PJ0 H;  3VMY A;  3KYI A;  1Y8A A;  2I1K A;  2PFX A;  3FVY A;  4ZLC A;  3PHL A;  4GOD A;  3HRN A;  4ZKP A;  5KAI H;  4PD4 I;  3L75 G;  5KKZ C;  3B0V C;  1JPJ A;  1LM3 B;  4ULV A;  3V2N A;  1NU7 D;  2FGY A;  3QW1 A;  3GG2 A;  4H0L C;  4AYC A;  3VN0 A;  1VQ8 P;  1BDJ B;  2N1T C;  1D1C A;  1GDT A;  2KQ9 A;  4PD4 H;  1Z63 A;  3AJM A;  1HH0 A;  1VPC A;  4GT1 A;  3M79 A;  3MUD C;  2XU6 A;  5KAF H;  1EA8 A;  1LI5 A;  1PCX A;  3D6Y A;  2EIJ C;  5AVZ B;  2IOQ A;  4YJW A;  3BAT A;  2Z4E A;  3RH3 A;  3MYF A;  3L71 J;  5AW2 B;  3EH2 A;  1E79 H;  2IXM A;  1X79 B;  4DJ9 A;  1NLX A;  4XWJ A;  1N73 B;  2JO1 A;  1YQ3 C;  2AWY A;  4KT0 J;  3U3B A;  4QI2 A;  1G4U S;  2E76 C;  3RK2 B;  3B5N C;  1TWH A;  5AW9 B;  5KYY B;  4XEK A;  3VAY A;  1RE4 C;  1VF5 B;  3JRM O;  3WAQ A;  1WRG A;  5KLV J;  1SZI A;  5KYY A;  1NHL A;  2AEM A;  2FYU G;  4LDK A;  1Z7Q c;  4MND A;  2WSC H;  1ORS C;  1LTJ C;  3CXH E;  3P8M C;  4Q5S F;  2NUT B;  3PH0 A;  1FFT C;  1T6U A;  4WVZ A;  3UMK A;  1T9K A;  3TJ5 A;  3ABL C;  1G4W R;  1VQ5 P;  3BCC E;  1KV4 A;  3MBG A;  4F4B A;  5E3A A;  3L72 J;  2Z5H A;  4OIR F;  5APY A;  3KYJ A;  1NTZ E;  1LIH A;  1URQ C;  1EXI A;  2NPS C;  3JCU H;  3LLK A;  4GOF A;  3FWN A;  4UB8 E;  4JE9 A;  1BE3 J;  4H44 B;  4XPW A;  2IYO A;  5JRA A;  1H88 A;  2W6B A;  2WZL A;  2LXB A;  4U3F J;  1VYK A;  2QG4 A;  3WG7 C;  4CDV A;  2QE9 A;  2OEX A;  2P2U A;  1RF0 A;  2JKV A;  1KIL A;  3E9V A;  1NTM G;  1KFN A;  4JIO A;  4JYC A;  4EI2 A;  5L3V A;  2A69 F;  2HKV A;  3W2W A;  3UGO A;  5B5E E;  1L0N E;  1USE A;  3I5C A;  3SFE C;  2Y0D A;  1SFC A;  1W2B O;  2R7V A;  2E75 C;  4WY4 B;  2YO2 A;  4TT3 H;  5APU A;  4WBA A;  3H1I D;  3L74 E;  3RK2 D;  4JC7 A;  4X0R A;  5AC5 A;  1NO4 A;  2FY8 A;  4PJM A;  3EFG A;  1FNT c;  2PX3 A;  4YTP C;  1L0N K;  1DOV A;  2B0J A;  2JWD A;  1PIX A;  2KUB A;  3M4C A;  4U3F G;  4Y99 B;  2E42 A;  3P8C D;  1GTW A;  4EUK B;  4D6T D;  3C8G D;  3UGP A;  1QSP A;  4ULW A;  4JBZ A;  4YWQ A;  2C0W A;  3V5Y A;  1OWA A;  1SQX J;  1OW8 A;  1J8Y F;  2WVN A;  1TWG A;  4E0H A;  1HMO A;  3HUS C;  4IWB A;  1IFP A;  2QEX P;  3PMR A;  3DAF A;  4RO0 A;  2ZT9 C;  2Q00 A;  1OXB A;  3AGU A;  3V4Q A;  2OTL P;  1YYX A;  5AW0 B;  3RBX A;  5CCG C;  1NU1 K;  4BEJ A;  1A0B A;  3HD7 C;  1LT9 C;  4BWN A;  2Y0E A;  4L6R A;  5DQZ A;  2NPS B;  1IFD A;  2WSF H;  2YLG A;  3RL0 g;  1L4A D;  3LS1 A;  4DJG A;  1WAT A;  5KAI E;  3SSU A;  5BQH A;  3N0T A;  5CCG A;  3GM1 A;  5CBN A;  3AE6 C;  3HJC A;  2ICW G;  2QNL A;  1SQP D;  2Y39 A;  5F28 E;  1RH5 B;  4O6Y A;  5CIV A;  3T6J A;  4YT4 A;  3MX3 A;  1KQS O;  3L71 G;  4UB6 E;  2K3R A;  5DS4 A;  1AVY A;  4BEM J;  2JX0 A;  2Y0C A;  2ZYD A;  1MMD A;  2L6F A;  4NPE A;  2KNH A;  2MJZ A;  5E33 A;  1JY3 O;  5L0F A;  1OVU A;  3C8V A;  5H2F E;  4AUW A;  3W4Y A;  2EIM C;  1KQL A;  4J30 B;  3S0X A;  2H7H A;  4CSA C;  4U5E E;  5EFW B;  3V2P A;  2WPR A;  4RKU J;  1NOH A;  3G3Z A;  3SFD C;  4JTC B;  4JYB A;  5CJ4 A;  2XLO A;  4O7G A;  3VF0 A;  2ASR A;  1FZC C;  1NU9 C;  3NYL A;  3UMI A;  4XEV A;  2J59 M;  5DLJ A;  3LNM B;  4IFF A;  1H8A A;  4JTD B;  1RJ9 A;  1Q0G A;  1NTZ K;  2IXN A;  1YYC A;  2VCA A;  3X1O A;  4HFK B;  1YZA A;  2QJK B;  4MQ9 F;  1ORJ A;  2R32 A;  4OD5 A;  1OIP A;  1PP9 J;  4EOT A;  2E76 D;  4I7Z C;  2NZ2 A;  3EGD A;  3R2P A;  2QSI A;  2C9N Y;  1YIT P;  2VAS A;  1SQB G;  2CYD A;  3FGA D;  1Y4C A;  1OZH A;  1FZE A;  2ZXW C;  2V7Q J;  1YTZ I;  1LGH B;  3LJB A;  4KC9 A;  2O9X A;  2YL3 A;  3EFF K;  2AXC A;  1E86 A;  2HMQ A;  1EDJ A;  4J7T A;  2K1A A;  1C02 A;  1JM0 A;  4L75 A;  2Q7R A;  3Q7L A;  1K05 A;  2G3V A;  3VMX A;  2N9Y B;  2ZJS E;  5AVV B;  5B66 E;  1GW3 A;  4JUR I;  5B3S C;  3A0B H;  4OD4 A;  2ZVO B;  5EK0 A;  1A02 F;  1D0X A;  3ZC4 A;  2WZG A;  1FZB A;  3B29 A;  2J7P D;  1VF5 C;  1BR4 A;  1VQN P;  1NU1 J;  1YVI A;  1MMN A;  3RKO F;  1YJG A;  4OIO F;  1QVG O;  3C1L A;  1FAV A;  3H1L G;  4A7P A;  1RJ9 B;  3JZ0 A;  1SQP J;  5KLV G;  1OMI A;  3H1L D;  1E83 A;  1T6A A;  1Q7Y Q;  3I55 P;  1VQK P;  1NKN A;  2Q9A A;  3SEO A;  4XTK A;  4CS8 C;  4GEH A;  3HE5 A;  4I1L A;  2QJY C;  2WT7 B;  4EKW A;  4NTA A;  4DOZ A;  5JSL A;  1HW2 A;  5GTH H;  4KHX A;  2EPK X;  1SP4 A;  2QJK C;  3K1I C;  3HUS B;  2YVK A;  4AQR D;  2XSE A;  2R7U A;  2BE5 F;  256B A;  2C9L Y;  4PD4 D;  2CNW A;  1FFH A;  4BJ5 A;  1X22 A;  1VLT A;  2WVQ A;  3CWB G;  2KJG A;  4ZMD A;  2BC5 A;  5HV9 A;  1BR2 A;  2WT7 A;  3VMA A;  4HH2 A;  2XM4 A;  4I1O B;  3DE9 A;  1OVV A;  1WAS A;  2IYL D;  2QIW A;  2OQM A;  1NAY A;  3SXK A;  4HJG H;  1RQV A;  5AVT B;  4GKG A;  4ANJ A;  3G71 P;  3FHD A;  4W7Z A;  4RES B;  4JTA B;  3V5B A;  4YXD C;  3L75 J;  3EGD B;  1N7S A;  1LS4 A;  1Q90 D;  2JD3 A;  1BDC A;  3TOL A;  1QL1 A;  2R02 A;  2CPB A;  3P7K A;  2HJM A;  4BJ1 A;  2M0B A;  3BRJ A;  2Y3D A;  5KYN A;  5AC4 A;  1YA9 A;  3D70 A;  3AE2 C;  3RQG A;  3NMD A;  1VQO P;  2J9V A;  2DYR C;  4BJ6 C;  1IFJ A;  2V7Q H;  3DM5 A;  3JCU E;  4OIQ F;  1S2E A;  2X51 A;  1ZXG A;  5JVE A;  3VYI A;  3IHU A;  3ZDL A;  3U2L A;  1IFM A;  2GUS A;  1SQQ D;  3MLG A;  4Z9J A;  2YRF A;  1SQB K;  4C3B A;  4D6T G;  1MZ9 A;  2NUT A;  4H44 D;  3ZVR A;  3CMA P;  5B1B C;  1SMY F;  4C7R A;  1LP1 B;  3K5B A;  4Y28 J;  3V6I A;  1NTZ G;  3H1L E;  3A9C A;  3H32 A;  5KYW B;  3Q6N A;  2IXO A;  4M3L A;  3TGU D;  4AX2 A;  2H88 C;  2XXA B;  2K9J A;  1DIP A;  3L70 E;  3L1M A;  4AE4 B;  4G7O F;  4YT2 A;  5GPG B;  2KK7 A;  3HTK C;  1CSB A;  3SYN A;  4PAC A;  3VOP A;  2PX0 A;  2FAP B;  5APS A;  2NPS A;  2ZPA A;  1T3U A;  1YJW P;  3HNI A;  2IXP A;  3DAG A;  1PP9 D;  1ZN5 A;  1Q2N A;  2L91 A;  5CJ0 A;  2M4E A;  1E84 A;  3CL3 D;  3TYY A;  3U59 A;  2RN0 A;  2CGE A;  2A68 F;  1ZHX A;  1DEB A;  1SQQ G;  1QEX A;  1Z23 A;  1BCC D;  2LR2 A;  1KB9 E;  3AQC A;  2C04 A;  3E1R A;  2KYV A;  3BCC D;  1NZE A;  2E75 B;  2YKP A;  3CCU P;  3W8I A;  4IFM A;  4YXW H;  1BGY E;  5AW5 B;  3MD0 A;  1IO4 A;  2QY9 A;  1X0T A;  2IDB A;  2ZXE B;  2VC9 A;  1SQV K;  3HNL A;  1M90 Q;  3AEF C;  1J1E B;  3AED C;  1VMA A;  3CCR P;  3GHG B;  3H1K G;  2VH3 A;  1G1J A;  1M1J B;  4DVY P;  5FZT A;  1DD3 A;  1X9V A;  4GOE A;  1DOW A;  3G4S P;  1M2V B;  3JT1 A;  3EG9 A;  3HTK A;  4D4N A;  2HPC B;  3VMZ A;  5KLV K;  2E5Y A;  2E74 D;  1TWA A;  3AQB A;  2UWJ E;  1Y6D A;  2J9W A;  1USD A;  1ZW0 A;  2C0X A;  2R44 A;  2JPU A;  4FX5 A;  4H4K C;  1L0N D;  3SWK A;  1S4X A;  2KI7 B;  1M1K Q;  4C7O A;  3GHG A;  1MMG A;  2YLI A;  4HEA J;  3TDK A;  2YO3 A;  2ITA A;  5CCH D;  2NSF A;  4QDL A;  3U8P A;  3KPE A;  3H1I E;  1D0Y A;  2K88 A;  3EG9 B;  1FBM A;  5CCH C;  3DXJ F;  3FOO A;  1CPR A;  3KPH A;  4BJ6 A;  5EGY A;  3H2U A;  2B9B A;  1URQ A;  3SP1 A;  1ZLL A;  1RKE B;  4PV1 D;  2JR8 A;  2YLD A;  1T01 A;  3GAN A;  2D2C C;  1YAU O;  5AVW B;  3CX5 E;  3GEE A;  1Q0F A;  4DCK A;  1QLE C;  1XZP A;  1M57 C;  2QJY B;  1E2X A;  2CCY A;  1RE3 A;  5L0D A;  2R7O A;  2YL1 A;  3O6X A;  4HE8 D;  3CCE P;  3H1I G;  2FFD A;  2IPP A;  3W67 A;  2NPU A;  2XL4 A;  1URQ B;  2YL7 A;  3LNR A;  3UNG C;  1VLS A;  4K3A A;  3N2Z B;  2Y3B A;  5APX A;  4U7J A;  3C7J A;  2QE7 H;  1KIL D;  1L4A C;  3UIA A;  3BVH A;  3L4F A;  1FMV A;  4I44 A;  3A11 A;  1L0N J;  1LP1 A;  4OGQ D;  4C7O B;  2P67 A;  2YMK A;  1W5C E;  2KS1 B;  4NCQ A;  2JP3 A;  4DRI B;  1NTM E;  2L6G A;  1XWJ A;  1LT9 B;  2Q9I A;  3PTZ A;  5JS5 A;  3TGU E;  2GFH A;  3I5P A;  2D5R B;  3QTH A;  2OYO A;  2YIU B;  3RW0 A;  2PP6 A;  1YJ9 P;  3L8I A;  2WB7 A;  3LAY A;  3H1J D;  2ZT9 B;  2Q1K A;  4ASV A;  3AEA C;  2G8Y A;  4NPD A;  3TNU A;  1RY3 A;  2XLV A;  4AL1 A;  3MP7 B;  3LEO A;  4RD9 A;  4N06 A;  3AG4 C;  2WPQ A;  1LTA C;  2IBZ D;  1JY3 P;  4RJT A;  4H13 B;  2P0N A;  4A4A A;  2W8Z A;  1IZN B;  2H89 C;  1T6Q A;  4K35 A;  3C63 A;  3H1L J;  2WMM A;  3QWO C;  1JMW A;  1ZU5 A;  3H65 A;  1NU1 G;  1G5Z A;  5KJ7 A;  2OYH C;  4N4W A;  3HE4 A;  1APC A;  3IN6 A;  1EZV G;  1SQV E;  1OW6 A;  1WN0 A;  1WTY A;  4K1O A;  3A0H H;  4N3Y B;  1M56 C;  2EPN A;  2YQY A;  1M6T A;  2KNC B;  1K40 A;  1IK9 A;  3BEH A;  1SQQ K;  2WL8 A;  3KMI A;  1H6G A;  4EBJ A;  1VQL P;  5AVX B;  1J1E C;  3DI5 A;  5GTI E;  1QPU A;  3V4W A;  4XE5 B;  2ZXO A;  1HTL C;  1L0L G;  4DZO A;  2BCC G;  2FXM A;  1FOS F;  3L74 D;  1ZW2 A;  3MYI A;  3NFQ A;  1BGY D;  2YL0 A;  1NAF A;  3EPV A;  3NTN A;  4U5G A;  3CQZ A;  3ITF A;  1NTZ J;  2L81 A;  1JY2 N;  5EHH A;  1OXK A;  3CC2 P;  1KYO H;  2YHS A;  1SF8 A;  3Q2Y A;  5AVY B;  4BJT A;  4XLP F;  3NG1 A;  3CX5 D;  4CDY A;  3E7K A;  5H2F H;  2ZYA A;  2BCC E;  3B5N D;  1D1A A;  2EPO A;  2ETS A;  1GW4 A;  2ZXX A;  2NSG A;  1AUE A;  2AEF A;  1GU5 A;  2M5A B;  3C18 A;  1DEE G;  1Q86 Q;  4MW8 A;  5GTH E;  4OIP F;  1NFN A;  2R25 A;  1FZC A;  1KYO I;  4ZNC A;  1NBB A;  2PP4 A;  3L73 D;  4OIN F;  3PHF 2;  4U5C E;  3TOM A;  1JB0 J;  2N1T B;  1FZC B;  2HG5 D;  1FJP A;  2OYI A;  5TIS E;  3GM3 A;  3VP9 A;  1XTG B;  2XKM A;  4O9B A;  1HE1 A;  5A6B D;  3M9H A;  2OYI B;  1U6H A;  4O6M A;  3WUT A;  1HGZ A;  3EQ2 A;  3T9O A;  2C03 A;  1CPQ A;  1NU1 E;  5A6J A;  2MYS A;  2G3A A;  2CK3 H;  2OGU A;  3I56 P;  5DJU B;  2FYU E;  3HNK A;  3K33 A;  1BGY G;  3A2A A;  3C8G B;  5COF A;  4Q4Z F;  1VQ9 P;  4XPX A;  3KXD A;  3KKB A;  2OAR A;  1LT1 A;  2YNY A;  1NTM D;  2W45 A;  2W4M A;  3HE5 B;  2NUP B;  2AU5 A;  2XL6 A;  3ABV C;  3F47 A;  2N1T D;  2YWA A;  2YKO A;  3FDQ A;  3AE3 C;  1K8A Q;  2YKQ A;  3I4U A;  1A7V A;  3PLN A;  2Y9Z A;  4IJJ A;  2P61 A;  1MFT A;  1WOL A;  4C7N B;  2BEQ D;  2W4B A;  1HMD A;  4G78 A;  3M4B A;  1SQX G;  2J58 A;  1F1M A;  4JQ0 D;  2NUP A;  2VCC A;  1D0Z A;  2OCC C;  3LUT B;  3CEX A;  2DGJ A;  2Q9C A;  2KW3 C;  2MHR A;  3EJN A;  3CXH D;  3F89 A;  3EGX A;  3NRH A;  4GYT A;  4XQ1 A;  4YL3 A;  1UG7 A;  4CS7 A;  1Q82 Q;  2KZJ A;  1R8E A;  3Q5S A;  3AE7 C;  3DJN B;  2WPS A;  2XLH A;  3LLI A;  1MUU A;  2E76 B;  3AE4 C;  3VTP C;  1H0T B;  1V55 C;  1QL2 A;  3QVY A;  2LIG A;  3OA7 A;  2R7T A;  4EIJ A;  3IR9 A;  1LJ2 A;  2A0U A;  3NMI A;  3SXY A;  1L0L E;  1QQ3 A;  3OWT A;  1SQB D;  5KYX B;  1TFO B;  1GL2 B;  1S72 P;  4AE4 A;  1SFC D;  2J46 A;  1I4Z A;  3ZTZ A;  3KZI E;  1Q0K A;  1LT9 A;  2BL2 A;  4G0H A;  3A7O A;  2LKM A;  4ASW A;  1AV1 A;  2ZVN B;  4LAC B;  2L6H A;  3RVY A;  1KIL C;  3FWL A;  1KQF B;  3N4X A;  2AVK A;  5BUO A;  1KB9 D;  2XLM A;  3L34 A;  2HV6 A;  5CI8 A;  1YTZ T;  3NKD A;  1JTH B;  3W2V A;  1JR8 A;  4YT8 A;  2KYH A;  2CW0 F;  4XPY A;  2HYN A;  3AGT A;  1EZV I;  3T97 A;  4BRY B;  3ZIB A;  1J1D C;  1S5L X;  2G3K A;  1TKN A;  3A3Y B;  3O10 A;  2KC3 A;  2KSE A;  4IAR A;  4L74 A;  4A2N B;  2WSE J;  1UFB A;  3G4X A;  2HLO A;  2G62 A;  1PGQ A;  1JCD A;  1JO5 A;  2Q9B A;  1NWQ A;  4MN4 C;  1PL5 A;  1KZU B;  3L72 G;  3AEB C;  3RQF A;  1EZV D;  2JWA A;  2KLU A;  2XDJ A;  2HSB A;  3L70 G;  1LTB C;  2P6V A;  1SQV J;  3M91 A;  4KBL A;  3RF3 A;  3U9M A;  5L0J A;  3U0C A;  2QUP A;  4JF7 A;  1N73 A;  4W8K A;  1M8O B;  1JEK A;  3O6Q B;  2FYU J;  3NXS A;  2UUH A;  2E43 A;  3LS0 A;  1JMB A;  3K1I A;  2POH A;  1PV3 A;  1KN7 A;  3HTK B;  2XLE A;  4H0L D;  1MQV A;  4LDR A;  5B5E H;  2HJ3 A;  3P32 A;  1H0T A;  4PR9 A;  3R7C A;  3B5N B;  4CJG A;  3N24 A;  4IAO A;  1NTZ D;  5E79 E;  2K9Y A;  4YPC A;  2WQY C;  3PJS K;  3ABK C;  4DRJ B;  2R5B A;  4N78 E;  3V2R A;  2Q3T A;  1N86 A;  3L71 D;  1N7S D;  2KLV A;  4LC1 A;  3WU2 H;  2HFI A;  2WSC J;  2FFD C;  2O01 N;  2QLA A;  1CGO A;  4UB8 H;  5KLI B;  4OH8 B;  1OX3 A;  3HD7 D;  3ZG1 A;  1JOG A;  1LPE A;  4KJM A;  2XLW A;  4HYT B;  2Y3H A;  1U0B B;  1YI2 P;  4DT0 A;  1YJN P;  3RL0 B;  2J7P A;  2EPL X;  2Z5I A;  1ZHZ A;  3T4R A;  1LTS C;  4E18 A;  3L73 J;  1QGK B;  4IOI H;  1RHZ B;  4H0L B;  2H43 A;  1BGY J;  5CHX A;  5K0I A;  4JVS A;  2KS1 A;  2P7J A;  2WSF J;  3V2Q A;  3AG3 C;  1LTI C;  1FDI A;  3GEI A;  5AVU B;  1LS1 A;  4JCH A;  4HB1 A;  4BRY A;  1LE2 A;  3U9J A;  4L73 A;  1HVV A;  2J9B A;  2IFM A;  3F5H A;  1M7L A;  4MS2 A;  1H7I A;  1OR2 A;  2W6A A;  3U8V A;  2J8W A;  3POV A;  3MHV A;  2JDI H;  3LEV A;  5TJH A;  1LE4 A; 
#chains in the Genus database with same CATH homology
 4EBK A;  3RQE A;  1K04 A;  3IN6 A;  3EWK A;  1OW6 A;  3FGA D;  3GLM A;  3AJM A;  3C8G D;  3MFN A;  3D70 A;  2WSE J;  3AE2 C;  3GMA A;  1UFB A;  3RQG A;  3ABV C;  1WTY A;  5KLI C;  4OGQ C;  4R4M A;  3D6Y A;  1EXJ A;  2YWA A;  1GMJ A;  1ZOY C;  2V7Q J;  1OW8 A;  2FYN C;  3AE3 C;  4XFJ A;  1KIL E;  4H44 C;  1K40 A;  2ZT9 D;  4PV1 D;  1PL5 A;  2D2C C;  3AEB C;  3RQF A;  4EBJ A;  4H44 D;  1KOR A;  2Q00 A;  2ZT9 C;  5M1B A;  4GDO A;  2MKV A;  2HSB A;  3AEG C;  4PV1 B;  1VF5 D;  4Y28 J;  1WOL A;  2JO1 A;  1YQ3 C;  1K05 A;  2BEQ D;  4KT0 J;  3U0C A;  2WPV B;  3IAO A;  4R4L A;  2E76 C;  3B71 A;  3D71 A;  2PBE A;  4XEK A;  2H88 C;  1VF5 B;  4XEF A;  2OQQ A;  1DIP A;  1IK7 A;  3O6Q A;  1VF5 C;  1UIX A;  3Q3D A;  1PV3 A;  1VL2 A;  3AE5 C;  3U3F A;  1MKM A;  3RL0 g;  4H0L D;  3G9R A;  1R8E A;  1NYH A;  2LK4 A;  3JZ0 A;  3Q5S A;  3AE7 C;  4OGQ B;  1HF9 A;  1Y9B A;  1OMI A;  1O3U A;  3GM1 A;  4PV1 C;  4U7J A;  1ZRT E;  1HJ0 A;  3AE6 C;  2E76 B;  3AE4 C;  1WMK A;  3H25 A;  2QJY C;  1V4A A;  2K9Y A;  2WQY C;  3Q2Y A;  1AJY A;  1NGM B;  5F28 E;  3R4Y A;  4OGQ D;  2YMK A;  3D6Z A;  1KNY A;  3Q1M A;  1EXI A;  2JP3 A;  2D2C B;  2L6G A;  2QJK C;  4R32 A;  2WSC J;  2BEZ F;  2JX0 A;  4H44 B;  1KQG B;  2L6F A;  3C18 A;  3GF3 A;  1S1C X;  4Z1M H;  1JOG A;  2E75 B;  1WWP A;  3AE1 C;  1KTM A;  3GF7 A;  1ZZP A;  1FDO A;  2D2C D;  3C8V A;  3L8J A;  1JB0 J;  3AEC C;  2IDB A;  3T97 B;  3L8I A;  2P10 A;  2ZT9 B;  1OW7 A;  3AEF C;  2E75 D;  3AED C;  2L6H A;  1KMI Z;  2J5U A;  1DD4 A;  3AE9 C;  4RKU J;  1KQF B;  3AEA C;  3GM3 A;  3SFD C;  3JYY A;  2G8Y A;  3AEE C;  3TUL A;  4H0L B;  1DD3 A;  2FBW C;  3SFE C;  4IL6 X;  2KK1 A;  4XEV A;  3RK3 E;  2WSF J;  3S9O A;  1ZME C;  2QIW A;  1U57 A;  2E75 C;  1TU3 F;  2O01 J;  3LW5 J;  1QVX A;  4TT3 H;  1FDI A;  5KKZ C;  2QJP C;  1RQV A;  2G3A A;  3AE8 C;  4H13 B;  2FXP A;  4H13 C;  1RQU A;  5L8R J;  2E74 D;  1YQ4 C;  4NQF A;  4YXD C;  3C8G A;  3K7D A;  1ZP0 C;  2H89 C;  2JPU A;  1Q90 D;  1S5L X;  4H13 D;  2E76 D;  4H0L C;  4I7Z C;  2E74 C;  2NZ2 A;  4YTP C;  3C8G B;  2E74 B;  4I7Z B;  3O10 A;  2QSI A;  3Q5R A;  3GM2 A;  2YIU C;  3BRJ A;  1PIX A;  3Q5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...