1OW6A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 58
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6A02
1ZOYC 2JX0A 3B71A 4R32A 3AE4C 3GM2A 3RQFA 2L6GA 1WOLA 3JZ0A 1ZP0C 3BRJA 1OW6A 3GM3A 3MFNA 2YWAA 3SFDC 1UFBA 3S9OA 3ABVC 4XEFA 1KTMA 3TULA 4XEVA 2H89C 3U3FA 1QVXA 3L8IA 3AE7C 2KK1A 1K40A 4EBJA 4YXDC 1ZZPA 2L6FA 2G3AA 2L6HA 2HSBA 2WQYC 4YTPC 2LK4A 5F28E 3C18A 3RQEA 1OW7A 1WTYA 1V4AA 3AE3C 3RQGA 2Q00A 2H88C 3AEFC 1WWPA 1O3UA 4NQFA 3AE5C 3JYYA 3AEGC 3C8GB 3AEEC 3AJMA 3AEBC 3L8JA 3SFEC 1YQ4C 2JPUA 3O10A 1JOGA 1PV3A 1K04A 3AEAC 3K7DA 3AEDC 2FBWC 4XEKA 3AE9C 3AE1C 3GM1A 3AECC 1KNYA 4EBKA 1YQ3C 1OW8A 3AE8C 3AE2C 3AE6C 3C8GA 3C8GD 3U0CA 2PBEA 1K05A
chains in the Genus database with same CATH superfamily
3KPEA 4W8KA 3CQZA 1PIXA 3N0TA 2XL4A 2POHA 1R5SA 1RE4C 4GDOA 3SWYA 1M57C 3GM2A 2JDIH 2L6GA 4Z9IA 1N1CA 1WOLA 4G7ZF 3IQCA 1T6AA 3A7OA 5CBOA 4NC3A 3A11A 1KORA 2EINC 3RKOF 3W8IA 3WUTA 1EXIA 4D6TJ 4M3LA 4LDQA 2FXOA 2A45I 1YITP 1TR2A 2W8ZA 3WUVA 2YWAA 1LS4A 2M8RA 2Y3HA 3FWLA 2A45H 3M9BA 2ZT9C 1GL2A 4I6MC 1NTKG 5KYUA 2V4HA 4JBZA 1AFOA 2FYUD 4D6TG 2X51A 1SQXJ 3ITFA 3MX3A 4JE9A 2EPMX 2J9VA 3U59A 2QRXA 4C7RA 2LIGA 4G0HA 2A06G 1LI7A 2IBZG 3VMXA 1RF1C 1YAUO 2P7VA 1RJ9A 3AQCA 2YLGA 2DW3A 2KB7P 5CI8A 3N4XA 3EFOB 3POVA 1SQXG 3RQGA 3DJUB 1BE3G 4WY4B 2NG1A 3IEEA 3L0IA 4DRIB 2J9UA 4C3EA 2HMQA 5AVYB 2WVOA 3N2ZB 1S9KE 5A69A 2N9BA 1RQVA 4H4KC 4CX9A 1DD4A 2CK3H 3F46A 1BR1A 3MTUE 4PFOA 1NU1J 4C7NA 4IRUA 3S1KA 3HUSA 5CCGC 4GIFA 2Z5IA 1CZQA 1LWUB 5JSLA 5KLIB 4DRJB 1YQ3C 5AVQB 4KI2A 3A0BH 1OCOC 2WL8A 4D6TD 1Q7YQ 1QX8A 2E75C 2FYZA 2YKZA 1KQSO 3IAOA 1VQ9P 2YL0A 3U0CA 1E86A 3H1ID 1K05A 2EPNA 1Q90D 5DS5A 1ZOYC 4YT4A 2HV6A 1BCCG 1YYCA 3QH9A 3A3YB 3OEOA 3CWBG 3PHLA 2KYVA 1FU1A 1ZHWA 2I1JA 5D91A 4L76A 3TD7A 3SNHA 2HUJA 2HR3A 3FVYA 3NG1A 3AG3C 5E3AA 5IY5C 4PJ0H 4K0DA 2Q6QA 3CXHI 3WG7C 1VPCA 1SF8A 3CWBJ 4XEVA 2P0NA 4HYTB 1ZHYA 1GDTA 2A69F 5DLJA 2YIUC 1T6QA 2KW3C 2P1JA 2Z5HA 4EBJA 1R5LA 4E7SA 1IFPA 4JURI 3ABKC 1YDIA 3W67A 4HFKB 3TQOA 3EQ2A 1G1JA 4WY4A 3RVYA 3HNIA 2G62A 5COGA 1XZPA 2BEZF 3Q7GA 1NO4A 3U5SA 2IXMA 2V7QJ 1NTZE 5T3WA 2C9LY 4JCHA 3WAQA 1NYHA 5TJHA 4P9TA 2XLOA 2H88C 4MTGA 1QKRA 2R7WA 4CDYA 4MNDA 4JEAA 4GOFA 3VF0A 3T6BA 1FDIA 5E3CA 1YLMA 3DE8A 1EZVI 3CX5I 1PGJA 3GG2A 3TK0A 2KNCB 1NTKK 2WVQA 3X1OA 1MMGA 1UIIA 4H44D 5AC5A 2KSFA 1WASA 3CC7P 1NGMB 1NTZK 2J9WA 5KTBA 4QDLA 3CEXA 4L75A 2IXNA 1SQVJ 1LS1A 1Z23A 4PACA 3C8VA 2IBZE 4L73A 3O6QA 3L4FA 1SQVD 5AW5B 2YO3A 2YL3A 2V7QH 1JY3N 2Q4FA 4NPDA 1LTJA 2V3CC 1JAFA 3G4XA 3UR3C 4H0LC 3S27A 3ZWIA 1VL2A 3TNUB 4MS2A 3B5ND 2B89A 2WPQA 3JSVC 3NMJA 2B0HA 2ICWG 1MFTA 2W4BA 3SXKA 3K1IC 3JZ0A 5H2FH 1EZVD 2Q1KA 1L4AA 2XRHA 1AVYA 3QW1A 4TT3H 3CXHE 1KB9E 1L0NK 2R03A 4LGDE 2PX3A 3H1HE 4UB8H 1LVKA 3KYIA 1T9KA 4A2NB 1F1MA 1U7MA 1FZCA 3M1CB 1CPRA 3RW0A 1BGYJ 4CJOA 3EFFK 2KOGA 3USSA 1N73B 1IFIA 4BXLA 2AVKA 5CMZA 2YKQA 3RL0C 2FYUE 2P6VA 1SLQA 3MUDC 3U3BA 1BCCJ 1X0TA 1J2JB 1URQD 1YVIA 5T1DB 4U5DE 4BJ5A 4OH8B 3K5BA 2ZT9B 2B9BA 2A0UA 3M79A 2WZLA 1URQB 4NPFX 2E74B 5KLVG 5COMA 2LK4A 3ZSUA 1N7SC 2D2CB 3CI9A 1OXKA 4JJGA 1WTYA 2H8AA 2P2UA 5KAIE 1ZV8A 1EKYA 4NTBA 1NTMG 1YZAA 3U2LA 2QM8A 1V74B 2E74C 5AVUB 5JUAA 1CGME 2IXPA 4NY3A 3L72E 3DAGA 1OVRA 3U8VA 4BPMA 1NTZJ 5L8RJ 2R02A 4MVZA 1L0LG 1FOSF 2AXTE 3AEDC 2DGJA 2M0BA 2QY9A 4EBKA 4H0LB 3E7KA 2LP4A 2MWQA 4TLFA 4YPCA 4KNWA 3RYLA 4WJ0A 5KYYA 3U2MA 1SQVE 4EYYQ 2Y39A 1SQPJ 4OVNF 4E17A 3CCEP 2HSQA 4EIJA 1YJ9P 3H1JE 3EPVA 4EUKB 3E1IA 2IFMA 1P84E 3GMAA 1RF0A 4I44A 1JY2P 5EFWB 3JCUE 3B5NA 1KB9H 1SFCA 1LT9C 3CCMP 1A7DA 2EIKC 5B1AC 3RQFA 5KYYB 3CWBD 1HJBA 1HVVA 3RH3A 4CSAA 1SQPE 3C9IA 3KXDA 4ONSA 2YL7A 3EH1A 5D92A 3CCJP 3GM3A 4H44C 2R44A 1N7LA 1LJ2A 2F22A 2KUBA 4XE5B 1C03A 2IPPA 3PLNA 4IL6E 1NTZG 2KZIA 2EPKX 2X0CA 2E75D 3B0VC 1GGQA 5JRAA 1K73Q 2P1AA 2Y0CA 1JTHA 3H1IJ 2QG4A 1OXBA 1EC5A 4YL0A 4FESA 1USEA 2ETSA 1Y6DA 3TF5A 1ZZPA 2HJMA 3HTKA 4ZLDA 5AVVB 4EI2A 4OIPF 2RD9A 3HD7A 3D6YA 4YXWH 1EQ7A 1Z56A 3PP5A 1CSBA 1ZN5A 4WVZA 2C0WA 3B5NC 1R4TA 1SQPK 2XXAB 1RKCA 1JY2O 1PFIA 3U9MA 3W2WA 1X22A 4Q4ZF 3H1LD 3V2RA 2WZFA 1KZUB 4O79A 1I5NA 1NU1D 2Q7RA 1LI5A 4CBEA 5L3QA 1G1IA 2ZXOA 5F5FA 4YWQA 2E43A 2Y3BA 1QLED 1JCCA 1N73A 1YARO 2A6EF 1A0BA 4N4WA 2H7BA 1W2BO 4PD4H 3HNLA 3AJMA 5A6AA 3JT1A 1KILA 1JO5A 2Y3GA 5A6KA 2WSSH 2O1JA 4EWCA 4XPYA 4IAOA 1URQC 3L75G 3L34A 1KNYA 3JSEO 1HBWA 1HJ0A 4H44B 4OD5A 2KYHA 1WGWA 5APUA 3L1MA 3AE2C 4A7PA 4XQ1A 1U57A 5A6BD 4DOZA 2QA4P 3T97B 3I5PA 3QZCA 1SS1A 4FX5A 1MMDA 2J45A 3Q5PA 1S7ZA 4QMAA 5KYXB 3PDMP 2R7QA 4HFFB 1HTLC 1LTJB 2O01N 4MVRA 2GFHA 3UNGC 2K3RA 3CL3D 3I56P 2CPBA 3Q3DA 3L70D 4AE4B 2QUPA 1KYOD 3L73E 4BEJA 1L0LK 3I5CA 2WPVB 3WHNA 1FE6A 1IZMA 1PGPA 4LERA 1ZW0A 2UUHA 3ZVRA 1D0YA 2OEXA 3AGTA 1WMKA 3EH2A 4DJ9A 1GM5A 3NDBB 5GTIE 4Q7CA 2M3EA 5B3SC 3ABVC 1PPJG 4ZMDA 2SPZA 2I8BA 5DQTA 4EOTA 3SEOA 3QTHA 4J7YA 3U9JA 1LNQA 3B0UX 3KDPB 2NPSA 2G3VA 3CAXA 4RDAA 3Q7LA 1LTIC 2GA0A 2FAPB 1HW2A 3VP9A 4YK5A 1SQBJ 2PP6A 1CW5A 2I1KA 2GM4A 1IZNB 1T2KD 1PGQA 1IFDA 3UIAA 2CYDA 5KYWB 2EIMC 4ASWA 1LKXA 2E42A 5KJ7D 2L81A 2YKPA 2GAQA 2OU6A 2C9NY 1NU1K 4HB1A 3OWTA 1L0LD 2RSEB 1T2KC 3GWNA 1JMWA 3GF3A 2HFED 1FOSE 2Q9BA 3H1JD 2AEMA 1BBHA 1KB9D 3L72J 1Y47A 4IARA 3L72D 2H7VC 1L7CA 3ECSA 4CS9C 3HNJA 3AEEC 2QLAA 1Q86Q 2J8WA 2ZT9D 1C17M 1KFMA 3NYJA 2IXOA 4JVSA 1D1AA 1VQPP 4XWJA 5KLVD 4ZLCA 5APWA 1LTTC 2FBWC 4PJLA 1CI6B 3K6BA 3L74J 2Q7CA 3RK3B 4BJ1A 2J7PA 1SR2A 1L0NE 4JYCA 1KV4A 3JCUQ 3LEVA 3T4RA 1SQBK 2NRGA 4W7ZA 5AW9B 4BRYB 1M1JA 2L91A 1D0XA 2L5GB 4H54A 1R8EA 2LR2A 2W4MA 3ATPA 5GTHE 2OTJP 2YVKA 1YHQP 4N78E 2WT7A 1RF0C 1PGOA 3ZDLA 2K9JA 4AL1A 5AW8B 3B0PA 1OX3A 3DD7A 1S5LX 3B9QA 2R3CA 1D7MA 1JUNA 4N6CA 2B0JA 4NPEA 1YZCA 2LXBA 1LTJC 4O6MA 5HV9A 4M63A 1NTKJ 4Z9HA 2FYNC 1LE2A 5KKZC 2KGOA 3S84A 3FOPA 1PZQA 4MW8A 4U5CE 2R7VA 2C03A 4K3AA 2H89C 2FFHA 3IHUA 1GTWA 3G3ZA 4B86A 3MGNA 5E79H 2N1TD 2L7AA 1BDDA 2WWWA 1RHZB 2MYSA 3H25A 1K40A 2YLDA 1N7SB 3BRVB 2AU5A 5JP7A 2OYOA 1M1JC 2ZVNB 4PV1C 1MQVA 1E84A 2QJPC 5AW4B 1N7SD 1NFNA 1U6HA 2PP4A 3HE4B 1FFTC 4HJGH 3GEIA 4PJNA 1H9TA 4Z9JA 1MKMA 1KYOE 3L73D 1Z5ZA 3BEHA 5CCHC 1NFOA 1FS0E 3O8ZA 1UIXA 3H65A 3KZIH 3DJNB 4B6IA 2W6AA 1USDA 3VTPC 4BJ5C 2BCCD 1QQ3A 1VK5A 1DIPA 3BCCD 1QSPA 3JRTA 2RKLA 1NU9C 1VF5C 2Q5UA 3GHGC 1H0TA 2K9JB 1GQAA 1FBMA 2XL8A 1ORSC 4G78A 1DEBA 5AW2B 4I7ZC 3SFEC 3S29A 4EKWA 3AG4C 3S0XA 4K1OA 2XLDA 4I3MA 5BU8B 3CCLP 1CPQA 2XNXA 2IBZI 1YJGA 3BCCE 3G71P 2ZXXA 3B29A 1CI6A 4Y99B 5DVWA 1FZCC 1EDLA 3C63A 4GODA 2R25A 1VMAA 4ULVA 2BASA 4IFMA 4U5BE 3C8ZA 3LUTB 1RY3A 3LIEA 5L0DA 1Y9BA 1FMWA 2GUVA 1SQXK 2PFDA 2D2CD 3AG1C 1FAVA 3GHGB 4MN4C 2JX0A 3B71A 1T6IA 3AE4C 3I5QA 2Y0EA 1JPJA 4C3BA 3M9QA 1I4ZA 4CS8A 3LNMB 3RK2C 1M2VB 4QI0A 3L70E 1T5OA 3RK3D 3M0DA 4OINF 3V6IA 2OYHB 1BSNA 1RJ9B 1J8MF 3KHUA 2A6HF 1VQNP 3US6A 4PJJA 3H1JJ 1A02J 4XLNF 5B5EE 1SMYF 3NKEA 2YHSA 1YJNP 2XLWA 1JY3P 2K1AA 4P9FA 1AVOB 1SQXE 5DS6A 3W8HA 1QVXA 4YL3A 3VRCA 1GL2C 3NRHA 4X0RA 1J1EB 3L35A 1TWHA 3ZQYA 3BRTB 2K9YA 4PFPA 1EZVE 1E2XA 2FFDA 1HMDA 2L6FA 1AUEA 1LWUC 1SQQE 1M1KQ 3O55A 3BCCJ 1E79H 1KN7A 3NMKA 3G6EP 1VB5A 2Q00A 1RKEB 3IPMO 5L0JA 2VCCA 4E18A 1FZGA 3M0DC 4XPXA 1KYOH 1RCPA 2P10A 5KAFH 2XLMA 4N06A 2OEVA 1OR3A 3L75J 1G5ZA 4F4BA 3AE5C 4AE4A 1HMOA 1L0NG 2H8PD 2XU6A 3T97A 3L70J 5B3IA 2N1TC 3TOLA 3DI5A 1SQBD 2OTLP 5KYXA 1FMVA 3DE9A 2AEFA 3PRJA 2KLUA 1J8YF 2NPSD 5E79E 4NTFA 2WMMA 3KPHA 1BCCE 2CPSA 1KILD 1JR8A 1ZHZA 3JC22 4DJGA 4WABA 3LNRA 1S05A 1KILB 4JW1A 5KLVK 1ZR2A 5CBNA 3GWLA 5AW7B 4NTAA 2YMKA 4EHPA 1JM0A 1VF5B 3F89A 4C3DA 4QI2A 3K66A 4HH2A 2ASRA 4U3FE 2ITAA 2WZ7A 3TJ6A 4UB6H 2NSFA 2OCCC 4IL6X 2HODB 4JIOA 1OR2A 1LP1A 2O3JA 5KAIH 1MNEA 5E2QA 4JTCB 1IW7F 1ZP0C 3ZDMA 1FAPB 3BVHA 5BU5A 1HUCA 4JEBA 3EWKA 3QVZA 2QJPB 4U5EE 3WODF 3A0BE 3NKDA 4JPZB 3P32A 1OCRC 2JWAA 2OOCA 2P58A 5APVA 1U0BB 3HTKB 1MMAA 1GZLA 1GW4A 2ZFCA 3BASA 2HPCB 1JPNA 1VLTA 3H1HD 2M5AA 2AP3A 2ZJSE 1JRAA 2CGEA 3H2UA 1OVVA 4IGGA 1NLXA 1ZW2A 2OYIC 2IM8A 1G4US 5EHHA 3GW6A 2VRSA 1OFCX 4WB4A 4YTPC 2VB6A 3D70A 1L0ND 3C62A 2CDQA 2OQMA 1QLEC 5KYNA 1NAFA 3OA1A 3LAYA 3FOOA 1BE3D 2PFXA 1L0LJ 2OG2A 3DM5A 3EZHA 4DVZA 2XZRA 4MW3A 4AK9A 1LP1B 4LC1A 4LLEA 5DJUB 2HODA 1D0ZA 3M15A 1SFCB 4J30B 1G8XA 4I2LC 2HZ8A 3RBZA 3AQBA 1JOGA 1M2OA 3AEAC 3H1LE 4XEKA 4U5HA 3AE9C 3VMYA 3AECC 2A68F 1HWTC 2FYUG 2OJQA 3IN6A 1S5LH 2PRRA 1H6GA 2YKOA 1ST6A 1FJKA 3WMM0 5GTIH 1RE3A 3SXZA 4GEHA 4W80A 2QJKB 1T01A 4MVUA 1ZLLA 3MIWA 4RBNA 2R5DA 2IOQA 2VCBA 1AJYA 1NVOA 1NWQA 4Y99C 4GKGA 1J1EC 3UGPA 1H7IA 2Y0DA 1OKKD 1QVFO 3C1LA 3L73J 3EFGA 1OCCC 2ZXRA 3M4CA 3L71J 5BVZA 4KHXA 2UUIA 2P61A 1VLSA 3M4BA 1FDOA 3RGUA 1N73C 3ASNC 4XA4A 1SQPD 3RL0g 2NPSC 3VN0A 2NUPB 3LW5H 2AEJA 4CS9A 5CJ0A 2LXCB 1WATA 3VAYA 2XS1A 1L0LE 1Z7Qc 1M90Q 5AC4A 1Q82Q 1QL2A 3ABMC 2E76D 3A0HE 5KJ7C 1NTME 1TFKB 4YXDC 3KL4A 3U1AA 4MVQA 4JYBA 2E76B 2XV5A 2M4EA 5AW1B 1A7EA 1M57D 4IAQA 1L4AB 3DZAA 4O9BA 1MV8A 2KIKA 3V2PA 4C7OA 1NOHA 2W6BA 1FZCB 3RK3C 3EQLF 1BGYD 2ZPAA 4MQ9F 3PTZA 3Q1MA 1OW7A 2YLIA 3TYYA 2W27A 2OYIA 4Q5SF 1H89A 1E5WA 3G4ZA 3CPWO 5JS5A 2N9YB 3MZWB 3X2QC 4E0HA 1B68A 4UB6E 3C8GB 1NKZB 1FZAA 3M06A 1AQ5A 1LT9A 2KZJA 3TNUA 3D6ZA 1AEPA 1RXQA 3G4SP 3CC4P 2OJED 4G7OF 2JPUA 1GMJA 3ZTMA 2QM7A 5TJ5E 2HYNA 4U7JA 4JF7A 1RF1B 5FCLA 4H13D 2WSCH 3HLZA 2IZ1A 2RN0A 3TGUD 3PHF2 1LTAC 3KKBA 4YT2A 3SWFA 3M9HA 3O6QB 4U3FJ 4CS7A 3VOPA 3NXSA 2KNCA 1Y8AA 5KKZB 1TWCA 2FGYA 2O9XA 1M7LA 3ZG1A 1EDKA 2R05A 2JWDA 1VYKA 4W8PA 3F5HA 4LDRA 2BCCJ 2KS1A 3OJAB 4IOIH 4KNVA 4JC7A 3ITKA 4JQ0D 1Q2NA 3JTLO 2YNYA 1AQTA 2KS1B 3TK1A 1Q0FA 1A02F 1P84H 3ZIBA 3R2PA 1H0TB 3HD7C 3RF3A 1Q0MA 1QGKB 2JKVA 5APSA 4D4NA 1NTMD 1N2DC 3H1KD 3PMRA 1BR2A 2EILC 4ULWA 3MFNA 3L36A 2BL2A 1HH0A 2A06D 4PV1D 3W68A 3B8EB 2BEQD 3ASOC 1Q0GA 3Q5RA 4FWVA 3FXDA 4EBBA 2W83C 1VOMA 2KK1A 4CDAA 4KBLA 1IC2A 3TGUG 1Q0DA 2PAJA 1NTKD 5AVXB 4IB4A 1VDFA 4ZKPA 2HLOA 3L75D 1U89A 2BCCE 3NYMA 5APYA 1NAYA 1VQ8P 4I1OB 2HSBA 1RMVA 1GK6A 4UB8E 3LS1A 5B1BC 1WN0A 2V26A 1VF5D 1NTMK 1V4AA 1BZ4A 1SQPG 4YT5A 4C7OB 1NZEA 3N24A 5CIVA 4AQRD 2XDJA 5H2FE 3U1CA 3JRMO 4CIPA 3K1IA 4L6RA 2YQYA 4ANJA 4DT0A 1RH5B 1X9VA 4ER9A 2Q9CA 3Q2YA 2M64A 3CX5D 3FMSA 3GEEA 2E76C 5K5GB 1PV3A 2OARA 3FAPB 1Z6AA 2RMZA 2QTVA 2Q3TA 2JO1A 2DYSC 1S5LE 2OYHC 5A6BA 3VP8A 3PJSK 4GYTA 1L0NJ 2D2CC 2EPOA 5B5EH 1ZRTD 1KFNA 2R32A 2GDCA 3UMHA 5AW3B 3H1HJ 1OWAA 3M91A 3C8GD 4WBAA 2KP8A 1I4YA 3LEOA 1KQGB 3CSKA 5AW6B 3RK2D 3K33A 5A6JA 2WSFJ 3UMKA 3RL0B 2DI3A 2BC5A 1N7SA 1JNMA 3D71A 1GK4A 2HJ3A 1ZRTE 3R4YA 4DBQA 2P67A 1W2WA 4O6YA 5DQZA 2J59M 1HW1A 3EFOA 1JY2N 3H32A 2Z4EA 4OIRF 2D4UA 4A4AA 1HE9A 1LM3B 3BRJA 2HG5D 4N3YB 1FZFA 1FNTc 4U3FG 3IF4A 4JTDB 1L4AD 4H13C 3AG2C 3E1RA 2IYLD 1OZHA 3JCUH 1NH4A 2QJKC 3SXMA 2HS5A 2FFDC 1BDCA 1U7JA 2QNLA 1V54C 5KYUB 2WT7B 2B87A 1C02A 4CSAC 5C39A 3CCQP 5M1BA 1PP9E 5KJ7A 1ZR4A 3F47A 5KLVJ 5B66E 4YN0B 1J1DB 2IZ0A 3HUSC 5CCGA 3GF7A 2YRFA 1PCXA 1GL2B 4GT1A 5DJTB 3EG9B 3C18A 2QVAA 3RQEA 256BA 2XM4A 1PL5A 3EHMA 2FKWB 3WU2E 2JJLA 1D1BA 1H9GA 1NU1G 1D1CA 2R7OA 2YMYA 4OGQD 1OIPA 1PPJE 2KI7B 2LQGA 2A06E 2Z15A 4MTOA 1BCCD 5JVEA 1NTMJ 2WPRA 2QIWA 3BATA 5L0FA 4OWFA 3CCSP 4XFJA 1LTGC 5APXA 1GU4A 2LFDA 2E5YA 3CZ6A 2L9JA 2WSEH 2OYIB 1BE3E 1EI7A 1AA0A 4W7YA 2W45A 3TGUE 1VQOP 4XTKA 4D6TE 5K0IA 1P84D 1LTBC 5COFA 4I1LA 2JEEA 1MNDA 1GW3A 1NTZD 1V55C 3AE8C 1JY3O 3P8CE 5T3TA 5BQHA 5KYWA 3FXEA 2VASA 3G9RA 3DM9B 1GU5A 3DAFA 4XPWA 3EGXA 2FY8A 1EA8A 1KC8Q 1PD1A 3EHNA 4U5GA 1HF9A 1NJIQ 1YTZI 4MVSA 1K8AQ 3CMAP 1XWJA 4CIHA 2Q9IA 1KB9I 3CX5E 4JTAB 2ZXEB 3VYIA 1ZW3A 1BR4A 2ZXWC 1MUUA 5L0CA 1MZ9A 2W9YA 5APQA 1OCZC 1YIJP 2I15A 3RFYA 2NSGA 5E33A 3H1KJ 1TU3F 2VCAA 2N1TA 3MBGA 1A7VA 2YO2A 3NMDA 1PP9G 1M6TA 2YZSA 1KILC 1GS9A 2HV7A 2AWCA 1ORJA 1SQQD 2XXAA 1P84I 1N8RQ 4ZKUA 2XSEA 4EDFA 3RK3E 2D5RB 3L8IA 2RH0A 4E0IA 4OIQF 1SQVK 1QZXA 2KSEA 2O1KA 1YYXA 2KQ9A 4JZAA 3H1IE 3L71D 2LD6A 2OKUA 4J7TA 2GWWA 1NU1E 1JOCA 1TKNA 5F5HA 2R5BA 3RL0D 5GPGB 3EZIA 3II6A 1KQLA 1T8ZA 1SFCC 2WITA 3LLKA 4IFFA 2IYPA 3BCCG 5L3VA 4YJWA 1DEEG 3DMDA 2CCYA 3B4SA 3L70G 5FZTA 3EGXB 3RVZA 3JYYA 3Q6MA 5CJ4A 2PX0A 4DRHB 2B87B 1XZQA 2DB4A 2DYRC 1TWGA 3W4YA 5AVZB 2J5UA 3O10A 4PD4I 4U9EA 4RKUJ 3S90A 3UGOA 4DXWA 3K7DA 4BJ6C 2E74D 1MFZA 3O6XA 3PCVA 1DD3A 2J46A 1YA7O 2CNWD 2OYHA 1IJDB 4O6NA 1H88A 3KH2A 3E70C 2XLVA 3SXYA 1VQKP 4E7ZA 4RO0A 1S1CX 1SQQG 2K37A 3VMZA 1Z63A 2KLVA 3J06A 1PP9D 5L0GA 1EZVG 3V5BA 4IFDK 4RD9A 2QE7H 4Y28J 1R5ID 2WB7A 4L74A 2QEXP 4YL1A 3SZRA 3KZIE 3GORA 4RESB 1VQLP 2XLEA 4PJ0E 2LKMA 5BUOA 3R7CA 2HMZA 4CPGA 3EG9A 3CCRP 4AX2A 3G50A 1SVFA 2Y3DA 1YYJA 3T9OA 1KQFB 3EGDA 4GQHA 2R7RA 5GTHH 4R4LA 1DOWA 1URQA 3U3FA 3TSIA 2QSIA 3B5NB 1L3PA 2W90A 3A2AA 1YBKA 3U8PA 1BGYE 3N7NA 1S72P 2XLHA 2I8DA 4OD4A 1S2EA 3V5YA 1QVGO 5CCHD 3LESA 1FTSA 2G3AA 1JCDA 3FDQA 1VQ5P 4HE8D 1OMIA 4P6IC 1OXZA 1IK9A 1SQBG 2WQYC 3MLGA 2YXQB 4R4MA 1EQ1A 3H32B 5F28E 3H1KG 2YXRB 3SWKA 2XS8A 1DH3A 3AE3C 1SQQJ 3W2VA 3NFQA 2BCCG 3SYNA 4JRZA 3HE4A 3V2NA 3QWOC 3H1JG 1LPEA 3OW2O 2IX7C 4MTFA 3KYJA 3CD6P 2EPLX 1KMIZ 1SQXD 4LACB 3AEBC 2NPUA 5AVTB 4AUWA 3TOMA 3LS0A 1K04A 4JJFA 3H1HG 2Y9ZA 3FXHA 3V2QA 3E9VA 1UG7A 2H7OA 1KILE 3CXHD 4Z1MH 1PD0A 5AVRB 2C04A 4WWIA 1FJPA 4H13B 1RE4A 5AVWB 4LLHA 1OW8A 3HE5A 3MYIA 2OTKE 1QL1A 3AE6C 3Q5SA 2IDBA 2KSJA 2FYUJ 2LFFA 5AW0B 2B88A 2MJZA 3ZTZA 3IQTA 4U3FD 2OGUA 1NU7D 1M1JB 1FFHA 4BJTA 4BRYA 1JMMA 4EIYA 2FXMA 3JSZA 3VYWA 3L74D 3HRNA 1FDMA 2IYOA 4DBRA 1T3JA 2KJGA 3TDKA 1ORYA 1EXJA 2R7TA 2NZ2A 4BG0A 1NTKE 1OQCA 3H1IG 1GL2D 1OW6A 4ASVA 1BGYG 5AGFA 2O01J 2UWJE 2HKVA 1RF1A 1KTMA 1M2VA 3K1HA 3TULA 1YTZT 1ZMEC 2NUTA 2QJYC 1ZHXA 3HNKA 2R7XA 1SZIA 1NG1A 4CS8C 3ZC4A 5B66H 1GD2E 1SQBE 2Q9AA 4D4XA 1S3JA 2AXTH 2R7SA 1M56D 3H1KE 2VH3A 3TJ5A 1FZBA 1SQQK 3L71E 2J9BA 1MMNA 4YT8A 4WGZA 5EK0A 3MD0A 2Q3EA 1VQ7P 1L2PA 1CGOA 1IFJA 3S4RA 2ZAEB 1M56C 3DXJF 3QMKA 2AXCA 1BSHA 3QW0A 4JCZA 2Y9YA 2A45G 5KAFE 2J0XA 2NUTB 4PJMA 2KXPB 1N86A 3O39A 4K7BA 1LE4A 2KC3A 4CDVA 3Q6NA 3LW5J 1Q81Q 1EDIA 3NYLA 1HY5A 1O3UA 1TWAA 4CJGA 4NQFA 4OIOF 2JD3A 2VC9A 4BEMJ 3AOUA 1LIHA 3AEGC 1K9MQ 3A9CA 1XTCC 2O01H 4KJMA 1JEKA 4BWNA 1NHLA 4O7GA 2YL1A 1BE3J 3I4UA 4DVYP 5TISH 2FYUK 4PD4D 2WVRA 4HEAJ 4PK4A 2G8YA 3AE1C 3GM1A 3IFMA 1CGNA 2WZGA 2WTYA 3V5XA 2R7UA 5CI9A 3HE5B 3I55P 2WPSA 4JKVA 4LDKA 3CXHH 1DX7A 3P8CD 3PH0A 2EIJC 5AVSB 1LT9B 1KU2A 3C8GA 4PD4E 3LJBA 5TISE 1LT1A 5KLIC 2PBEA 4C7NB 2ZD9A 2IBFA 2GUSA 2H7HA 1A41A 3MYFA 1QEXA 4NCQA 1S4XA 1NSGB 1WT6A 3EJNA 3H6PA 4GOEA 1XTGB 3CC2P 2J58A 1IFNA 3GODA 3H1LG 4H0LD 4WGYA 2KK7A 2YIUB 1JB0J 3L37A 3L75E 2TMVP 1OVUA 4DOJA 4N6HA 2ZYGA 3UMIA 3S9OA 3CCVP 1ZVZA 4WY4C 2AWYA 3H2VA 1LGHB 3L71G 3FWNA 3CCUP 5DS4A 2ZYDA 3MP7B 2PNOA 2R3SA 2M3BA 2G3KA 4DCKA 4U9DA 4WY4D 1SP4A 3AE7C 1X79B 3H1LJ 4AYCA 3WUUA 1T6UA 3KMIA 3M0AA 2R9RB 2ZXPA 4IL6H 1VQMP 2MHRA 3RBXA 2NUPA 1FC2C 5CCGD 2L6HA 2K88A 4I1MA 2WSFH 3HD7D 3LIDA 3IQ6A 3V5ZA 1IFMA 4OGQC 1YI2P 3NTNA 1TQGA 3EGDB 3FGAD 3KQGA 3CX5H 2E5TA 1KYOI 1LTSC 1Z3IX 1LWUA 2E75B 3HUSB 2M5AB 1L4AC 2QJYB 2XKMA 4XLPF 2MKVA 1YA9A 2P7JA 3L74G 3S28A 5L0HA 2H43A 1S9KD 1KD1Q 2LCHA 3L73G 1JMBA 4N6JA 1JTHB 1O87A 3AGUA 1W5CE 1VQ4P 2W6JH 2HFIA 1W2EA 3L8JA 3LLIA 3WU2H 4PV1B 3HKKA 4FAPB 3KYQA 1AV1A 4UDVA 1H8AA 4LLCA 4KC9A 1HGZA 5EGYA 4G7HF 2YEVA 1PP9J 1ZHTA 5CHXA 3P8MC 2OQQA 4KT0J 1EDJA 3DKAA 1RQUA 2FXPA 3FX0A 2GA1A 3OA7A 4J32B 3P7KA 3SSUA 2BE5F 4C46A 3IR9A 3NMIA 3RIPA 1SYQA 2E87A 4K35A 4IWBA 1E83A 2XL6A 4AL0A 1ZU5A 1G4WR 4DZOA 1HGVA 4N78D 1DOVA 3MHVA 3HJCA 1NBBA 1ZU4A 1VQ6P 5BQIA 4R32A 2NPSB 1WRGA 3CMEP 2J0WA 3T6JA 1IK7A 3GLMA 4OGQB 3MUDA 2Y69C 3SFDC 1UFBA 2HPCA 3JYHA 2IFNA 4XEFA 5JT4A 2WSEJ 3RK2B 1TFOB 3V7OA 2IBZD 3CWBE 4MVMA 4U5FE 2CNWA 3FAJA 4RJTA 1G2CA 4BJ6A 5KLVE 3GEHA 1FR0A 1T3UA 2PF4E 2FYNB 2A1DD 2KNHA 3VMAA 1VYIA 3A0HH 1OKKA 1G2CB 1PPJD 3DWWA 4MVOA 1X8YA 1APCA 3QVYA 4PR9A 2WSCJ 2JR8A 1RKEA 3L74E 1M8OB 5CCHA 3HTKC 2QE9A 3L72G 2Q3IA 2ZYAA 3TGUJ 1NKNA 2PGDA 3AEFC 4HKZH 2N1TB 1Y4CA 1WWPA 3VM6A 1VTMP 2FFDB 1ZYRF 1O5HA 1HE1A 1IO4A 5HSWA 4IJJA 3SP1A 3C7JA 5L0IA 3CLQA 1FZEA 1Q0KA 4ZNCA 5BQGA 2A0BA 1AVOA 3OAKA 1YQ4C 2CW0F 3FHDA 3V4WA 3ABLC 3T6GB 3ZQVA 1J1DC 1RE3C 1BDJB 1SQVG 1E85A 2JP3A 2WVNA 2ZVOB 2J7PD 2XM0A 4I7ZB 1ZXGA 2C0XA 1QPUA 3GANA 2LSEA 3IQ5A 1YJWP 2XNDH 3HD7B 1SFCD 5JLIA 5APTA 3V4QA 3A5TA 3GHGA
chains in the Genus database with same CATH topology
1Q90D 4Y28J 4H0LC 1ZOYC 2JX0A 1PIXA 3GMAA 3B71A 1VL2A 3D71A 1HF9A 1ZRTE 3AE4C 3R4YA 4R32A 4GDOA 4IL6X 3GM2A 3RQFA 2L6GA 1WOLA 3Q3DA 1KORA 1IK7A 1S5LX 3JZ0A 3GLMA 1EXJA 4OGQB 2WPVB 1EXIA 2NZ2A 4H0LD 1FDOA 1ZP0C 1VF5B 3BRJA 1OW6A 1JB0J 1TU3F 3RL0g 1WMKA 4H13C 4H44C 3GM3A 3MFNA 2YWAA 4TT3H 3SFDC 1UFBA 2FYNC 2O01J 3EWKA 3S9OA 5KKZC 3ABVC 1KQFB 2QJKC 2WSEJ 1KTMA 4XEFA 4PV1D 3TULA 1ZMEC 4XEVA 2QJYC 2BEQD 2H89C 4R4LA 2ZT9C 2E75D 3Q5RA 3RK3E 3U3FA 1QVXA 2QSIA 3L8IA 3AE7C 2KK1A 2YIUC 2E76D 3H25A 1K40A 4EBJA 4YXDC 2K9YA 5M1BA 4PV1C 1ZZPA 2L6FA 2E76B 2QJPC 2G3AA 2L6HA 2WSCJ 3GF7A 3D6YA 2ZT9B 2BEZF 2HSBA 1OMIA 2E74B 2WQYC 4YTPC 2LK4A 4OGQC 4R4MA 3D70A 2V7QJ 5F28E 3C18A 2D2CB 3RQEA 1MKMA 1VF5D 3Q1MA 1OW7A 3FGAD 1WTYA 1V4AA 1PL5A 3AE3C 3RQGA 2Q00A 1NYHA 1UIXA 2H88C 3AEFC 1WWPA 2E75B 3GF3A 3LW5J 2P10A 1O3UA 2MKVA 4NQFA 4OGQD 2E74C 1DIPA 1FDIA 3AE5C 1VF5C 3JYYA 3AEGC 1RQVA 3C8GB 3AEEC 1KMIZ 2QIWA 5L8RJ 2ZT9D 1DD4A 3AJMA 3AEBC 4I7ZC 3D6ZA 3L8JA 3SFEC 3Q2YA 4PV1B 4XFJA 1YQ4C 2JPUA 2J5UA 2E76C 1GMJA 3O10A 1PV3A 1K04A 4RKUJ 1JOGA 3AEAC 3K7DA 4U7JA 2E74D 3AEDC 2FBWC 4H13D 4H44D 2G8YA 4XEKA 3AE9C 1DD3A 1KILE 2JO1A 3AE1C 3GM1A 2JP3A 3AECC 4Z1MH 1NGMB 1KNYA 4EBKA 3IN6A 1HJ0A 1YQ3C 2D2CC 4H13B 4H44B 2OQQA 4KT0J 4H0LB 4I7ZB 1OW8A 1RQUA 2FXPA 3C8VA 3O6QA 3AE8C 3AE2C 3AE6C 3Q5SA 1U57A 2IDBA 2E75C 1S1CX 3T97B 3IAOA 1Y9BA 3C8GA 2YMKA 3G9RA 1AJYA 3C8GD 1KQGB 3U0CA 5KLIC 2D2CD 1R8EA 2PBEA 2WSFJ 3Q5PA 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY C;  2JX0 A;  3B71 A;  4R32 A;  3AE4 C;  3GM2 A;  3RQF A;  2L6G A;  1WOL A;  3JZ0 A;  1ZP0 C;  3BRJ A;  1OW6 A;  3GM3 A;  3MFN A;  2YWA A;  3SFD C;  1UFB A;  3S9O A;  3ABV C;  4XEF A;  1KTM A;  3TUL A;  4XEV A;  2H89 C;  3U3F A;  1QVX A;  3L8I A;  3AE7 C;  2KK1 A;  1K40 A;  4EBJ A;  4YXD C;  1ZZP A;  2L6F A;  2G3A A;  2L6H A;  2HSB A;  2WQY C;  4YTP C;  2LK4 A;  5F28 E;  3C18 A;  3RQE A;  1OW7 A;  1WTY A;  1V4A A;  3AE3 C;  3RQG A;  2Q00 A;  2H88 C;  3AEF C;  1WWP A;  1O3U A;  4NQF A;  3AE5 C;  3JYY A;  3AEG C;  3C8G B;  3AEE C;  3AJM A;  3AEB C;  3L8J A;  3SFE C;  1YQ4 C;  2JPU A;  3O10 A;  1JOG A;  1PV3 A;  1K04 A;  3AEA C;  3K7D A;  3AED C;  2FBW C;  4XEK A;  3AE9 C;  3AE1 C;  3GM1 A;  3AEC C;  1KNY A;  4EBK A;  1YQ3 C;  1OW8 A;  3AE8 C;  3AE2 C;  3AE6 C;  3C8G A;  3C8G D;  3U0C A;  2PBE A;  1K05 A; 
#chains in the Genus database with same CATH topology
 3KPE A;  4W8K A;  3CQZ A;  1PIX A;  3N0T A;  2XL4 A;  2POH A;  1R5S A;  1RE4 C;  4GDO A;  3SWY A;  1M57 C;  3GM2 A;  2JDI H;  2L6G A;  4Z9I A;  1N1C A;  1WOL A;  4G7Z F;  3IQC A;  1T6A A;  3A7O A;  5CBO A;  4NC3 A;  3A11 A;  1KOR A;  2EIN C;  3RKO F;  3W8I A;  3WUT A;  1EXI A;  4D6T J;  4M3L A;  4LDQ A;  2FXO A;  2A45 I;  1YIT P;  1TR2 A;  2W8Z A;  3WUV A;  2YWA A;  1LS4 A;  2M8R A;  2Y3H A;  3FWL A;  2A45 H;  3M9B A;  2ZT9 C;  1GL2 A;  4I6M C;  1NTK G;  5KYU A;  2V4H A;  4JBZ A;  1AFO A;  2FYU D;  4D6T G;  2X51 A;  1SQX J;  3ITF A;  3MX3 A;  4JE9 A;  2EPM X;  2J9V A;  3U59 A;  2QRX A;  4C7R A;  2LIG A;  4G0H A;  2A06 G;  1LI7 A;  2IBZ G;  3VMX A;  1RF1 C;  1YAU O;  2P7V A;  1RJ9 A;  3AQC A;  2YLG A;  2DW3 A;  2KB7 P;  5CI8 A;  3N4X A;  3EFO B;  3POV A;  1SQX G;  3RQG A;  3DJU B;  1BE3 G;  4WY4 B;  2NG1 A;  3IEE A;  3L0I A;  4DRI B;  2J9U A;  4C3E A;  2HMQ A;  5AVY B;  2WVO A;  3N2Z B;  1S9K E;  5A69 A;  2N9B A;  1RQV A;  4H4K C;  4CX9 A;  1DD4 A;  2CK3 H;  3F46 A;  1BR1 A;  3MTU E;  4PFO A;  1NU1 J;  4C7N A;  4IRU A;  3S1K A;  3HUS A;  5CCG C;  4GIF A;  2Z5I A;  1CZQ A;  1LWU B;  5JSL A;  5KLI B;  4DRJ B;  1YQ3 C;  5AVQ B;  4KI2 A;  3A0B H;  1OCO C;  2WL8 A;  4D6T D;  1Q7Y Q;  1QX8 A;  2E75 C;  2FYZ A;  2YKZ A;  1KQS O;  3IAO A;  1VQ9 P;  2YL0 A;  3U0C A;  1E86 A;  3H1I D;  1K05 A;  2EPN A;  1Q90 D;  5DS5 A;  1ZOY C;  4YT4 A;  2HV6 A;  1BCC G;  1YYC A;  3QH9 A;  3A3Y B;  3OEO A;  3CWB G;  3PHL A;  2KYV A;  1FU1 A;  1ZHW A;  2I1J A;  5D91 A;  4L76 A;  3TD7 A;  3SNH A;  2HUJ A;  2HR3 A;  3FVY A;  3NG1 A;  3AG3 C;  5E3A A;  5IY5 C;  4PJ0 H;  4K0D A;  2Q6Q A;  3CXH I;  3WG7 C;  1VPC A;  1SF8 A;  3CWB J;  4XEV A;  2P0N A;  4HYT B;  1ZHY A;  1GDT A;  2A69 F;  5DLJ A;  2YIU C;  1T6Q A;  2KW3 C;  2P1J A;  2Z5H A;  4EBJ A;  1R5L A;  4E7S A;  1IFP A;  4JUR I;  3ABK C;  1YDI A;  3W67 A;  4HFK B;  3TQO A;  3EQ2 A;  1G1J A;  4WY4 A;  3RVY A;  3HNI A;  2G62 A;  5COG A;  1XZP A;  2BEZ F;  3Q7G A;  1NO4 A;  3U5S A;  2IXM A;  2V7Q J;  1NTZ E;  5T3W A;  2C9L Y;  4JCH A;  3WAQ A;  1NYH A;  5TJH A;  4P9T A;  2XLO A;  2H88 C;  4MTG A;  1QKR A;  2R7W A;  4CDY A;  4MND A;  4JEA A;  4GOF A;  3VF0 A;  3T6B A;  1FDI A;  5E3C A;  1YLM A;  3DE8 A;  1EZV I;  3CX5 I;  1PGJ A;  3GG2 A;  3TK0 A;  2KNC B;  1NTK K;  2WVQ A;  3X1O A;  1MMG A;  1UII A;  4H44 D;  5AC5 A;  2KSF A;  1WAS A;  3CC7 P;  1NGM B;  1NTZ K;  2J9W A;  5KTB A;  4QDL A;  3CEX A;  4L75 A;  2IXN A;  1SQV J;  1LS1 A;  1Z23 A;  4PAC A;  3C8V A;  2IBZ E;  4L73 A;  3O6Q A;  3L4F A;  1SQV D;  5AW5 B;  2YO3 A;  2YL3 A;  2V7Q H;  1JY3 N;  2Q4F A;  4NPD A;  1LTJ A;  2V3C C;  1JAF A;  3G4X A;  3UR3 C;  4H0L C;  3S27 A;  3ZWI A;  1VL2 A;  3TNU B;  4MS2 A;  3B5N D;  2B89 A;  2WPQ A;  3JSV C;  3NMJ A;  2B0H A;  2ICW G;  1MFT A;  2W4B A;  3SXK A;  3K1I C;  3JZ0 A;  5H2F H;  1EZV D;  2Q1K A;  1L4A A;  2XRH A;  1AVY A;  3QW1 A;  4TT3 H;  3CXH E;  1KB9 E;  1L0N K;  2R03 A;  4LGD E;  2PX3 A;  3H1H E;  4UB8 H;  1LVK A;  3KYI A;  1T9K A;  4A2N B;  1F1M A;  1U7M A;  1FZC A;  3M1C B;  1CPR A;  3RW0 A;  1BGY J;  4CJO A;  3EFF K;  2KOG A;  3USS A;  1N73 B;  1IFI A;  4BXL A;  2AVK A;  5CMZ A;  2YKQ A;  3RL0 C;  2FYU E;  2P6V A;  1SLQ A;  3MUD C;  3U3B A;  1BCC J;  1X0T A;  1J2J B;  1URQ D;  1YVI A;  5T1D B;  4U5D E;  4BJ5 A;  4OH8 B;  3K5B A;  2ZT9 B;  2B9B A;  2A0U A;  3M79 A;  2WZL A;  1URQ B;  4NPF X;  2E74 B;  5KLV G;  5COM A;  2LK4 A;  3ZSU A;  1N7S C;  2D2C B;  3CI9 A;  1OXK A;  4JJG A;  1WTY A;  2H8A A;  2P2U A;  5KAI E;  1ZV8 A;  1EKY A;  4NTB A;  1NTM G;  1YZA A;  3U2L A;  2QM8 A;  1V74 B;  2E74 C;  5AVU B;  5JUA A;  1CGM E;  2IXP A;  4NY3 A;  3L72 E;  3DAG A;  1OVR A;  3U8V A;  4BPM A;  1NTZ J;  5L8R J;  2R02 A;  4MVZ A;  1L0L G;  1FOS F;  2AXT E;  3AED C;  2DGJ A;  2M0B A;  2QY9 A;  4EBK A;  4H0L B;  3E7K A;  2LP4 A;  2MWQ A;  4TLF A;  4YPC A;  4KNW A;  3RYL A;  4WJ0 A;  5KYY A;  3U2M A;  1SQV E;  4EYY Q;  2Y39 A;  1SQP J;  4OVN F;  4E17 A;  3CCE P;  2HSQ A;  4EIJ A;  1YJ9 P;  3H1J E;  3EPV A;  4EUK B;  3E1I A;  2IFM A;  1P84 E;  3GMA A;  1RF0 A;  4I44 A;  1JY2 P;  5EFW B;  3JCU E;  3B5N A;  1KB9 H;  1SFC A;  1LT9 C;  3CCM P;  1A7D A;  2EIK C;  5B1A C;  3RQF A;  5KYY B;  3CWB D;  1HJB A;  1HVV A;  3RH3 A;  4CSA A;  1SQP E;  3C9I A;  3KXD A;  4ONS A;  2YL7 A;  3EH1 A;  5D92 A;  3CCJ P;  3GM3 A;  4H44 C;  2R44 A;  1N7L A;  1LJ2 A;  2F22 A;  2KUB A;  4XE5 B;  1C03 A;  2IPP A;  3PLN A;  4IL6 E;  1NTZ G;  2KZI A;  2EPK X;  2X0C A;  2E75 D;  3B0V C;  1GGQ A;  5JRA A;  1K73 Q;  2P1A A;  2Y0C A;  1JTH A;  3H1I J;  2QG4 A;  1OXB A;  1EC5 A;  4YL0 A;  4FES A;  1USE A;  2ETS A;  1Y6D A;  3TF5 A;  1ZZP A;  2HJM A;  3HTK A;  4ZLD A;  5AVV B;  4EI2 A;  4OIP F;  2RD9 A;  3HD7 A;  3D6Y A;  4YXW H;  1EQ7 A;  1Z56 A;  3PP5 A;  1CSB A;  1ZN5 A;  4WVZ A;  2C0W A;  3B5N C;  1R4T A;  1SQP K;  2XXA B;  1RKC A;  1JY2 O;  1PFI A;  3U9M A;  3W2W A;  1X22 A;  4Q4Z F;  3H1L D;  3V2R A;  2WZF A;  1KZU B;  4O79 A;  1I5N A;  1NU1 D;  2Q7R A;  1LI5 A;  4CBE A;  5L3Q A;  1G1I A;  2ZXO A;  5F5F A;  4YWQ A;  2E43 A;  2Y3B A;  1QLE D;  1JCC A;  1N73 A;  1YAR O;  2A6E F;  1A0B A;  4N4W A;  2H7B A;  1W2B O;  4PD4 H;  3HNL A;  3AJM A;  5A6A A;  3JT1 A;  1KIL A;  1JO5 A;  2Y3G A;  5A6K A;  2WSS H;  2O1J A;  4EWC A;  4XPY A;  4IAO A;  1URQ C;  3L75 G;  3L34 A;  1KNY A;  3JSE O;  1HBW A;  1HJ0 A;  4H44 B;  4OD5 A;  2KYH A;  1WGW A;  5APU A;  3L1M A;  3AE2 C;  4A7P A;  4XQ1 A;  1U57 A;  5A6B D;  4DOZ A;  2QA4 P;  3T97 B;  3I5P A;  3QZC A;  1SS1 A;  4FX5 A;  1MMD A;  2J45 A;  3Q5P A;  1S7Z A;  4QMA A;  5KYX B;  3PDM P;  2R7Q A;  4HFF B;  1HTL C;  1LTJ B;  2O01 N;  4MVR A;  2GFH A;  3UNG C;  2K3R A;  3CL3 D;  3I56 P;  2CPB A;  3Q3D A;  3L70 D;  4AE4 B;  2QUP A;  1KYO D;  3L73 E;  4BEJ A;  1L0L K;  3I5C A;  2WPV B;  3WHN A;  1FE6 A;  1IZM A;  1PGP A;  4LER A;  1ZW0 A;  2UUH A;  3ZVR A;  1D0Y A;  2OEX A;  3AGT A;  1WMK A;  3EH2 A;  4DJ9 A;  1GM5 A;  3NDB B;  5GTI E;  4Q7C A;  2M3E A;  5B3S C;  3ABV C;  1PPJ G;  4ZMD A;  2SPZ A;  2I8B A;  5DQT A;  4EOT A;  3SEO A;  3QTH A;  4J7Y A;  3U9J A;  1LNQ A;  3B0U X;  3KDP B;  2NPS A;  2G3V A;  3CAX A;  4RDA A;  3Q7L A;  1LTI C;  2GA0 A;  2FAP B;  1HW2 A;  3VP9 A;  4YK5 A;  1SQB J;  2PP6 A;  1CW5 A;  2I1K A;  2GM4 A;  1IZN B;  1T2K D;  1PGQ A;  1IFD A;  3UIA A;  2CYD A;  5KYW B;  2EIM C;  4ASW A;  1LKX A;  2E42 A;  5KJ7 D;  2L81 A;  2YKP A;  2GAQ A;  2OU6 A;  2C9N Y;  1NU1 K;  4HB1 A;  3OWT A;  1L0L D;  2RSE B;  1T2K C;  3GWN A;  1JMW A;  3GF3 A;  2HFE D;  1FOS E;  2Q9B A;  3H1J D;  2AEM A;  1BBH A;  1KB9 D;  3L72 J;  1Y47 A;  4IAR A;  3L72 D;  2H7V C;  1L7C A;  3ECS A;  4CS9 C;  3HNJ A;  3AEE C;  2QLA A;  1Q86 Q;  2J8W A;  2ZT9 D;  1C17 M;  1KFM A;  3NYJ A;  2IXO A;  4JVS A;  1D1A A;  1VQP P;  4XWJ A;  5KLV D;  4ZLC A;  5APW A;  1LTT C;  2FBW C;  4PJL A;  1CI6 B;  3K6B A;  3L74 J;  2Q7C A;  3RK3 B;  4BJ1 A;  2J7P A;  1SR2 A;  1L0N E;  4JYC A;  1KV4 A;  3JCU Q;  3LEV A;  3T4R A;  1SQB K;  2NRG A;  4W7Z A;  5AW9 B;  4BRY B;  1M1J A;  2L91 A;  1D0X A;  2L5G B;  4H54 A;  1R8E A;  2LR2 A;  2W4M A;  3ATP A;  5GTH E;  2OTJ P;  2YVK A;  1YHQ P;  4N78 E;  2WT7 A;  1RF0 C;  1PGO A;  3ZDL A;  2K9J A;  4AL1 A;  5AW8 B;  3B0P A;  1OX3 A;  3DD7 A;  1S5L X;  3B9Q A;  2R3C A;  1D7M A;  1JUN A;  4N6C A;  2B0J A;  4NPE A;  1YZC A;  2LXB A;  1LTJ C;  4O6M A;  5HV9 A;  4M63 A;  1NTK J;  4Z9H A;  2FYN C;  1LE2 A;  5KKZ C;  2KGO A;  3S84 A;  3FOP A;  1PZQ A;  4MW8 A;  4U5C E;  2R7V A;  2C03 A;  4K3A A;  2H89 C;  2FFH A;  3IHU A;  1GTW A;  3G3Z A;  4B86 A;  3MGN A;  5E79 H;  2N1T D;  2L7A A;  1BDD A;  2WWW A;  1RHZ B;  2MYS A;  3H25 A;  1K40 A;  2YLD A;  1N7S B;  3BRV B;  2AU5 A;  5JP7 A;  2OYO A;  1M1J C;  2ZVN B;  4PV1 C;  1MQV A;  1E84 A;  2QJP C;  5AW4 B;  1N7S D;  1NFN A;  1U6H A;  2PP4 A;  3HE4 B;  1FFT C;  4HJG H;  3GEI A;  4PJN A;  1H9T A;  4Z9J A;  1MKM A;  1KYO E;  3L73 D;  1Z5Z A;  3BEH A;  5CCH C;  1NFO A;  1FS0 E;  3O8Z A;  1UIX A;  3H65 A;  3KZI H;  3DJN B;  4B6I A;  2W6A A;  1USD A;  3VTP C;  4BJ5 C;  2BCC D;  1QQ3 A;  1VK5 A;  1DIP A;  3BCC D;  1QSP A;  3JRT A;  2RKL A;  1NU9 C;  1VF5 C;  2Q5U A;  3GHG C;  1H0T A;  2K9J B;  1GQA A;  1FBM A;  2XL8 A;  1ORS C;  4G78 A;  1DEB A;  5AW2 B;  4I7Z C;  3SFE C;  3S29 A;  4EKW A;  3AG4 C;  3S0X A;  4K1O A;  2XLD A;  4I3M A;  5BU8 B;  3CCL P;  1CPQ A;  2XNX A;  2IBZ I;  1YJG A;  3BCC E;  3G71 P;  2ZXX A;  3B29 A;  1CI6 A;  4Y99 B;  5DVW A;  1FZC C;  1EDL A;  3C63 A;  4GOD A;  2R25 A;  1VMA A;  4ULV A;  2BAS A;  4IFM A;  4U5B E;  3C8Z A;  3LUT B;  1RY3 A;  3LIE A;  5L0D A;  1Y9B A;  1FMW A;  2GUV A;  1SQX K;  2PFD A;  2D2C D;  3AG1 C;  1FAV A;  3GHG B;  4MN4 C;  2JX0 A;  3B71 A;  1T6I A;  3AE4 C;  3I5Q A;  2Y0E A;  1JPJ A;  4C3B A;  3M9Q A;  1I4Z A;  4CS8 A;  3LNM B;  3RK2 C;  1M2V B;  4QI0 A;  3L70 E;  1T5O A;  3RK3 D;  3M0D A;  4OIN F;  3V6I A;  2OYH B;  1BSN A;  1RJ9 B;  1J8M F;  3KHU A;  2A6H F;  1VQN P;  3US6 A;  4PJJ A;  3H1J J;  1A02 J;  4XLN F;  5B5E E;  1SMY F;  3NKE A;  2YHS A;  1YJN P;  2XLW A;  1JY3 P;  2K1A A;  4P9F A;  1AVO B;  1SQX E;  5DS6 A;  3W8H A;  1QVX A;  4YL3 A;  3VRC A;  1GL2 C;  3NRH A;  4X0R A;  1J1E B;  3L35 A;  1TWH A;  3ZQY A;  3BRT B;  2K9Y A;  4PFP A;  1EZV E;  1E2X A;  2FFD A;  1HMD A;  2L6F A;  1AUE A;  1LWU C;  1SQQ E;  1M1K Q;  3O55 A;  3BCC J;  1E79 H;  1KN7 A;  3NMK A;  3G6E P;  1VB5 A;  2Q00 A;  1RKE B;  3IPM O;  5L0J A;  2VCC A;  4E18 A;  1FZG A;  3M0D C;  4XPX A;  1KYO H;  1RCP A;  2P10 A;  5KAF H;  2XLM A;  4N06 A;  2OEV A;  1OR3 A;  3L75 J;  1G5Z A;  4F4B A;  3AE5 C;  4AE4 A;  1HMO A;  1L0N G;  2H8P D;  2XU6 A;  3T97 A;  3L70 J;  5B3I A;  2N1T C;  3TOL A;  3DI5 A;  1SQB D;  2OTL P;  5KYX A;  1FMV A;  3DE9 A;  2AEF A;  3PRJ A;  2KLU A;  1J8Y F;  2NPS D;  5E79 E;  4NTF A;  2WMM A;  3KPH A;  1BCC E;  2CPS A;  1KIL D;  1JR8 A;  1ZHZ A;  3JC2 2;  4DJG A;  4WAB A;  3LNR A;  1S05 A;  1KIL B;  4JW1 A;  5KLV K;  1ZR2 A;  5CBN A;  3GWL A;  5AW7 B;  4NTA A;  2YMK A;  4EHP A;  1JM0 A;  1VF5 B;  3F89 A;  4C3D A;  4QI2 A;  3K66 A;  4HH2 A;  2ASR A;  4U3F E;  2ITA A;  2WZ7 A;  3TJ6 A;  4UB6 H;  2NSF A;  2OCC C;  4IL6 X;  2HOD B;  4JIO A;  1OR2 A;  1LP1 A;  2O3J A;  5KAI H;  1MNE A;  5E2Q A;  4JTC B;  1IW7 F;  1ZP0 C;  3ZDM A;  1FAP B;  3BVH A;  5BU5 A;  1HUC A;  4JEB A;  3EWK A;  3QVZ A;  2QJP B;  4U5E E;  3WOD F;  3A0B E;  3NKD A;  4JPZ B;  3P32 A;  1OCR C;  2JWA A;  2OOC A;  2P58 A;  5APV A;  1U0B B;  3HTK B;  1MMA A;  1GZL A;  1GW4 A;  2ZFC A;  3BAS A;  2HPC B;  1JPN A;  1VLT A;  3H1H D;  2M5A A;  2AP3 A;  2ZJS E;  1JRA A;  2CGE A;  3H2U A;  1OVV A;  4IGG A;  1NLX A;  1ZW2 A;  2OYI C;  2IM8 A;  1G4U S;  5EHH A;  3GW6 A;  2VRS A;  1OFC X;  4WB4 A;  4YTP C;  2VB6 A;  3D70 A;  1L0N D;  3C62 A;  2CDQ A;  2OQM A;  1QLE C;  5KYN A;  1NAF A;  3OA1 A;  3LAY A;  3FOO A;  1BE3 D;  2PFX A;  1L0L J;  2OG2 A;  3DM5 A;  3EZH A;  4DVZ A;  2XZR A;  4MW3 A;  4AK9 A;  1LP1 B;  4LC1 A;  4LLE A;  5DJU B;  2HOD A;  1D0Z A;  3M15 A;  1SFC B;  4J30 B;  1G8X A;  4I2L C;  2HZ8 A;  3RBZ A;  3AQB A;  1JOG A;  1M2O A;  3AEA C;  3H1L E;  4XEK A;  4U5H A;  3AE9 C;  3VMY A;  3AEC C;  2A68 F;  1HWT C;  2FYU G;  2OJQ A;  3IN6 A;  1S5L H;  2PRR A;  1H6G A;  2YKO A;  1ST6 A;  1FJK A;  3WMM 0;  5GTI H;  1RE3 A;  3SXZ A;  4GEH A;  4W80 A;  2QJK B;  1T01 A;  4MVU A;  1ZLL A;  3MIW A;  4RBN A;  2R5D A;  2IOQ A;  2VCB A;  1AJY A;  1NVO A;  1NWQ A;  4Y99 C;  4GKG A;  1J1E C;  3UGP A;  1H7I A;  2Y0D A;  1OKK D;  1QVF O;  3C1L A;  3L73 J;  3EFG A;  1OCC C;  2ZXR A;  3M4C A;  3L71 J;  5BVZ A;  4KHX A;  2UUI A;  2P61 A;  1VLS A;  3M4B A;  1FDO A;  3RGU A;  1N73 C;  3ASN C;  4XA4 A;  1SQP D;  3RL0 g;  2NPS C;  3VN0 A;  2NUP B;  3LW5 H;  2AEJ A;  4CS9 A;  5CJ0 A;  2LXC B;  1WAT A;  3VAY A;  2XS1 A;  1L0L E;  1Z7Q c;  1M90 Q;  5AC4 A;  1Q82 Q;  1QL2 A;  3ABM C;  2E76 D;  3A0H E;  5KJ7 C;  1NTM E;  1TFK B;  4YXD C;  3KL4 A;  3U1A A;  4MVQ A;  4JYB A;  2E76 B;  2XV5 A;  2M4E A;  5AW1 B;  1A7E A;  1M57 D;  4IAQ A;  1L4A B;  3DZA A;  4O9B A;  1MV8 A;  2KIK A;  3V2P A;  4C7O A;  1NOH A;  2W6B A;  1FZC B;  3RK3 C;  3EQL F;  1BGY D;  2ZPA A;  4MQ9 F;  3PTZ A;  3Q1M A;  1OW7 A;  2YLI A;  3TYY A;  2W27 A;  2OYI A;  4Q5S F;  1H89 A;  1E5W A;  3G4Z A;  3CPW O;  5JS5 A;  2N9Y B;  3MZW B;  3X2Q C;  4E0H A;  1B68 A;  4UB6 E;  3C8G B;  1NKZ B;  1FZA A;  3M06 A;  1AQ5 A;  1LT9 A;  2KZJ A;  3TNU A;  3D6Z A;  1AEP A;  1RXQ A;  3G4S P;  3CC4 P;  2OJE D;  4G7O F;  2JPU A;  1GMJ A;  3ZTM A;  2QM7 A;  5TJ5 E;  2HYN A;  4U7J A;  4JF7 A;  1RF1 B;  5FCL A;  4H13 D;  2WSC H;  3HLZ A;  2IZ1 A;  2RN0 A;  3TGU D;  3PHF 2;  1LTA C;  3KKB A;  4YT2 A;  3SWF A;  3M9H A;  3O6Q B;  4U3F J;  4CS7 A;  3VOP A;  3NXS A;  2KNC A;  1Y8A A;  5KKZ B;  1TWC A;  2FGY A;  2O9X A;  1M7L A;  3ZG1 A;  1EDK A;  2R05 A;  2JWD A;  1VYK A;  4W8P A;  3F5H A;  4LDR A;  2BCC J;  2KS1 A;  3OJA B;  4IOI H;  4KNV A;  4JC7 A;  3ITK A;  4JQ0 D;  1Q2N A;  3JTL O;  2YNY A;  1AQT A;  2KS1 B;  3TK1 A;  1Q0F A;  1A02 F;  1P84 H;  3ZIB A;  3R2P A;  1H0T B;  3HD7 C;  3RF3 A;  1Q0M A;  1QGK B;  2JKV A;  5APS A;  4D4N A;  1NTM D;  1N2D C;  3H1K D;  3PMR A;  1BR2 A;  2EIL C;  4ULW A;  3MFN A;  3L36 A;  2BL2 A;  1HH0 A;  2A06 D;  4PV1 D;  3W68 A;  3B8E B;  2BEQ D;  3ASO C;  1Q0G A;  3Q5R A;  4FWV A;  3FXD A;  4EBB A;  2W83 C;  1VOM A;  2KK1 A;  4CDA A;  4KBL A;  1IC2 A;  3TGU G;  1Q0D A;  2PAJ A;  1NTK D;  5AVX B;  4IB4 A;  1VDF A;  4ZKP A;  2HLO A;  3L75 D;  1U89 A;  2BCC E;  3NYM A;  5APY A;  1NAY A;  1VQ8 P;  4I1O B;  2HSB A;  1RMV A;  1GK6 A;  4UB8 E;  3LS1 A;  5B1B C;  1WN0 A;  2V26 A;  1VF5 D;  1NTM K;  1V4A A;  1BZ4 A;  1SQP G;  4YT5 A;  4C7O B;  1NZE A;  3N24 A;  5CIV A;  4AQR D;  2XDJ A;  5H2F E;  3U1C A;  3JRM O;  4CIP A;  3K1I A;  4L6R A;  2YQY A;  4ANJ A;  4DT0 A;  1RH5 B;  1X9V A;  4ER9 A;  2Q9C A;  3Q2Y A;  2M64 A;  3CX5 D;  3FMS A;  3GEE A;  2E76 C;  5K5G B;  1PV3 A;  2OAR A;  3FAP B;  1Z6A A;  2RMZ A;  2QTV A;  2Q3T A;  2JO1 A;  2DYS C;  1S5L E;  2OYH C;  5A6B A;  3VP8 A;  3PJS K;  4GYT A;  1L0N J;  2D2C C;  2EPO A;  5B5E H;  1ZRT D;  1KFN A;  2R32 A;  2GDC A;  3UMH A;  5AW3 B;  3H1H J;  1OWA A;  3M91 A;  3C8G D;  4WBA A;  2KP8 A;  1I4Y A;  3LEO A;  1KQG B;  3CSK A;  5AW6 B;  3RK2 D;  3K33 A;  5A6J A;  2WSF J;  3UMK A;  3RL0 B;  2DI3 A;  2BC5 A;  1N7S A;  1JNM A;  3D71 A;  1GK4 A;  2HJ3 A;  1ZRT E;  3R4Y A;  4DBQ A;  2P67 A;  1W2W A;  4O6Y A;  5DQZ A;  2J59 M;  1HW1 A;  3EFO A;  1JY2 N;  3H32 A;  2Z4E A;  4OIR F;  2D4U A;  4A4A A;  1HE9 A;  1LM3 B;  3BRJ A;  2HG5 D;  4N3Y B;  1FZF A;  1FNT c;  4U3F G;  3IF4 A;  4JTD B;  1L4A D;  4H13 C;  3AG2 C;  3E1R A;  2IYL D;  1OZH A;  3JCU H;  1NH4 A;  2QJK C;  3SXM A;  2HS5 A;  2FFD C;  1BDC A;  1U7J A;  2QNL A;  1V54 C;  5KYU B;  2WT7 B;  2B87 A;  1C02 A;  4CSA C;  5C39 A;  3CCQ P;  5M1B A;  1PP9 E;  5KJ7 A;  1ZR4 A;  3F47 A;  5KLV J;  5B66 E;  4YN0 B;  1J1D B;  2IZ0 A;  3HUS C;  5CCG A;  3GF7 A;  2YRF A;  1PCX A;  1GL2 B;  4GT1 A;  5DJT B;  3EG9 B;  3C18 A;  2QVA A;  3RQE A;  256B A;  2XM4 A;  1PL5 A;  3EHM A;  2FKW B;  3WU2 E;  2JJL A;  1D1B A;  1H9G A;  1NU1 G;  1D1C A;  2R7O A;  2YMY A;  4OGQ D;  1OIP A;  1PPJ E;  2KI7 B;  2LQG A;  2A06 E;  2Z15 A;  4MTO A;  1BCC D;  5JVE A;  1NTM J;  2WPR A;  2QIW A;  3BAT A;  5L0F A;  4OWF A;  3CCS P;  4XFJ A;  1LTG C;  5APX A;  1GU4 A;  2LFD A;  2E5Y A;  3CZ6 A;  2L9J A;  2WSE H;  2OYI B;  1BE3 E;  1EI7 A;  1AA0 A;  4W7Y A;  2W45 A;  3TGU E;  1VQO P;  4XTK A;  4D6T E;  5K0I A;  1P84 D;  1LTB C;  5COF A;  4I1L A;  2JEE A;  1MND A;  1GW3 A;  1NTZ D;  1V55 C;  3AE8 C;  1JY3 O;  3P8C E;  5T3T A;  5BQH A;  5KYW A;  3FXE A;  2VAS A;  3G9R A;  3DM9 B;  1GU5 A;  3DAF A;  4XPW A;  3EGX A;  2FY8 A;  1EA8 A;  1KC8 Q;  1PD1 A;  3EHN A;  4U5G A;  1HF9 A;  1NJI Q;  1YTZ I;  4MVS A;  1K8A Q;  3CMA P;  1XWJ A;  4CIH A;  2Q9I A;  1KB9 I;  3CX5 E;  4JTA B;  2ZXE B;  3VYI A;  1ZW3 A;  1BR4 A;  2ZXW C;  1MUU A;  5L0C A;  1MZ9 A;  2W9Y A;  5APQ A;  1OCZ C;  1YIJ P;  2I15 A;  3RFY A;  2NSG A;  5E33 A;  3H1K J;  1TU3 F;  2VCA A;  2N1T A;  3MBG A;  1A7V A;  2YO2 A;  3NMD A;  1PP9 G;  1M6T A;  2YZS A;  1KIL C;  1GS9 A;  2HV7 A;  2AWC A;  1ORJ A;  1SQQ D;  2XXA A;  1P84 I;  1N8R Q;  4ZKU A;  2XSE A;  4EDF A;  3RK3 E;  2D5R B;  3L8I A;  2RH0 A;  4E0I A;  4OIQ F;  1SQV K;  1QZX A;  2KSE A;  2O1K A;  1YYX A;  2KQ9 A;  4JZA A;  3H1I E;  3L71 D;  2LD6 A;  2OKU A;  4J7T A;  2GWW A;  1NU1 E;  1JOC A;  1TKN A;  5F5H A;  2R5B A;  3RL0 D;  5GPG B;  3EZI A;  3II6 A;  1KQL A;  1T8Z A;  1SFC C;  2WIT A;  3LLK A;  4IFF A;  2IYP A;  3BCC G;  5L3V A;  4YJW A;  1DEE G;  3DMD A;  2CCY A;  3B4S A;  3L70 G;  5FZT A;  3EGX B;  3RVZ A;  3JYY A;  3Q6M A;  5CJ4 A;  2PX0 A;  4DRH B;  2B87 B;  1XZQ A;  2DB4 A;  2DYR C;  1TWG A;  3W4Y A;  5AVZ B;  2J5U A;  3O10 A;  4PD4 I;  4U9E A;  4RKU J;  3S90 A;  3UGO A;  4DXW A;  3K7D A;  4BJ6 C;  2E74 D;  1MFZ A;  3O6X A;  3PCV A;  1DD3 A;  2J46 A;  1YA7 O;  2CNW D;  2OYH A;  1IJD B;  4O6N A;  1H88 A;  3KH2 A;  3E70 C;  2XLV A;  3SXY A;  1VQK P;  4E7Z A;  4RO0 A;  1S1C X;  1SQQ G;  2K37 A;  3VMZ A;  1Z63 A;  2KLV A;  3J06 A;  1PP9 D;  5L0G A;  1EZV G;  3V5B A;  4IFD K;  4RD9 A;  2QE7 H;  4Y28 J;  1R5I D;  2WB7 A;  4L74 A;  2QEX P;  4YL1 A;  3SZR A;  3KZI E;  3GOR A;  4RES B;  1VQL P;  2XLE A;  4PJ0 E;  2LKM A;  5BUO A;  3R7C A;  2HMZ A;  4CPG A;  3EG9 A;  3CCR P;  4AX2 A;  3G50 A;  1SVF A;  2Y3D A;  1YYJ A;  3T9O A;  1KQF B;  3EGD A;  4GQH A;  2R7R A;  5GTH H;  4R4L A;  1DOW A;  1URQ A;  3U3F A;  3TSI A;  2QSI A;  3B5N B;  1L3P A;  2W90 A;  3A2A A;  1YBK A;  3U8P A;  1BGY E;  3N7N A;  1S72 P;  2XLH A;  2I8D A;  4OD4 A;  1S2E A;  3V5Y A;  1QVG O;  5CCH D;  3LES A;  1FTS A;  2G3A A;  1JCD A;  3FDQ A;  1VQ5 P;  4HE8 D;  1OMI A;  4P6I C;  1OXZ A;  1IK9 A;  1SQB G;  2WQY C;  3MLG A;  2YXQ B;  4R4M A;  1EQ1 A;  3H32 B;  5F28 E;  3H1K G;  2YXR B;  3SWK A;  2XS8 A;  1DH3 A;  3AE3 C;  1SQQ J;  3W2V A;  3NFQ A;  2BCC G;  3SYN A;  4JRZ A;  3HE4 A;  3V2N A;  3QWO C;  3H1J G;  1LPE A;  3OW2 O;  2IX7 C;  4MTF A;  3KYJ A;  3CD6 P;  2EPL X;  1KMI Z;  1SQX D;  4LAC B;  3AEB C;  2NPU A;  5AVT B;  4AUW A;  3TOM A;  3LS0 A;  1K04 A;  4JJF A;  3H1H G;  2Y9Z A;  3FXH A;  3V2Q A;  3E9V A;  1UG7 A;  2H7O A;  1KIL E;  3CXH D;  4Z1M H;  1PD0 A;  5AVR B;  2C04 A;  4WWI A;  1FJP A;  4H13 B;  1RE4 A;  5AVW B;  4LLH A;  1OW8 A;  3HE5 A;  3MYI A;  2OTK E;  1QL1 A;  3AE6 C;  3Q5S A;  2IDB A;  2KSJ A;  2FYU J;  2LFF A;  5AW0 B;  2B88 A;  2MJZ A;  3ZTZ A;  3IQT A;  4U3F D;  2OGU A;  1NU7 D;  1M1J B;  1FFH A;  4BJT A;  4BRY A;  1JMM A;  4EIY A;  2FXM A;  3JSZ A;  3VYW A;  3L74 D;  3HRN A;  1FDM A;  2IYO A;  4DBR A;  1T3J A;  2KJG A;  3TDK A;  1ORY A;  1EXJ A;  2R7T A;  2NZ2 A;  4BG0 A;  1NTK E;  1OQC A;  3H1I G;  1GL2 D;  1OW6 A;  4ASV A;  1BGY G;  5AGF A;  2O01 J;  2UWJ E;  2HKV A;  1RF1 A;  1KTM A;  1M2V A;  3K1H A;  3TUL A;  1YTZ T;  1ZME C;  2NUT A;  2QJY C;  1ZHX A;  3HNK A;  2R7X A;  1SZI A;  1NG1 A;  4CS8 C;  3ZC4 A;  5B66 H;  1GD2 E;  1SQB E;  2Q9A A;  4D4X A;  1S3J A;  2AXT H;  2R7S A;  1M56 D;  3H1K E;  2VH3 A;  3TJ5 A;  1FZB A;  1SQQ K;  3L71 E;  2J9B A;  1MMN A;  4YT8 A;  4WGZ A;  5EK0 A;  3MD0 A;  2Q3E A;  1VQ7 P;  1L2P A;  1CGO A;  1IFJ A;  3S4R A;  2ZAE B;  1M56 C;  3DXJ F;  3QMK A;  2AXC A;  1BSH A;  3QW0 A;  4JCZ A;  2Y9Y A;  2A45 G;  5KAF E;  2J0X A;  2NUT B;  4PJM A;  2KXP B;  1N86 A;  3O39 A;  4K7B A;  1LE4 A;  2KC3 A;  4CDV A;  3Q6N A;  3LW5 J;  1Q81 Q;  1EDI A;  3NYL A;  1HY5 A;  1O3U A;  1TWA A;  4CJG A;  4NQF A;  4OIO F;  2JD3 A;  2VC9 A;  4BEM J;  3AOU A;  1LIH A;  3AEG C;  1K9M Q;  3A9C A;  1XTC C;  2O01 H;  4KJM A;  1JEK A;  4BWN A;  1NHL A;  4O7G A;  2YL1 A;  1BE3 J;  3I4U A;  4DVY P;  5TIS H;  2FYU K;  4PD4 D;  2WVR A;  4HEA J;  4PK4 A;  2G8Y A;  3AE1 C;  3GM1 A;  3IFM A;  1CGN A;  2WZG A;  2WTY A;  3V5X A;  2R7U A;  5CI9 A;  3HE5 B;  3I55 P;  2WPS A;  4JKV A;  4LDK A;  3CXH H;  1DX7 A;  3P8C D;  3PH0 A;  2EIJ C;  5AVS B;  1LT9 B;  1KU2 A;  3C8G A;  4PD4 E;  3LJB A;  5TIS E;  1LT1 A;  5KLI C;  2PBE A;  4C7N B;  2ZD9 A;  2IBF A;  2GUS A;  2H7H A;  1A41 A;  3MYF A;  1QEX A;  4NCQ A;  1S4X A;  1NSG B;  1WT6 A;  3EJN A;  3H6P A;  4GOE A;  1XTG B;  3CC2 P;  2J58 A;  1IFN A;  3GOD A;  3H1L G;  4H0L D;  4WGY A;  2KK7 A;  2YIU B;  1JB0 J;  3L37 A;  3L75 E;  2TMV P;  1OVU A;  4DOJ A;  4N6H A;  2ZYG A;  3UMI A;  3S9O A;  3CCV P;  1ZVZ A;  4WY4 C;  2AWY A;  3H2V A;  1LGH B;  3L71 G;  3FWN A;  3CCU P;  5DS4 A;  2ZYD A;  3MP7 B;  2PNO A;  2R3S A;  2M3B A;  2G3K A;  4DCK A;  4U9D A;  4WY4 D;  1SP4 A;  3AE7 C;  1X79 B;  3H1L J;  4AYC A;  3WUU A;  1T6U A;  3KMI A;  3M0A A;  2R9R B;  2ZXP A;  4IL6 H;  1VQM P;  2MHR A;  3RBX A;  2NUP A;  1FC2 C;  5CCG D;  2L6H A;  2K88 A;  4I1M A;  2WSF H;  3HD7 D;  3LID A;  3IQ6 A;  3V5Z A;  1IFM A;  4OGQ C;  1YI2 P;  3NTN A;  1TQG A;  3EGD B;  3FGA D;  3KQG A;  3CX5 H;  2E5T A;  1KYO I;  1LTS C;  1Z3I X;  1LWU A;  2E75 B;  3HUS B;  2M5A B;  1L4A C;  2QJY B;  2XKM A;  4XLP F;  2MKV A;  1YA9 A;  2P7J A;  3L74 G;  3S28 A;  5L0H A;  2H43 A;  1S9K D;  1KD1 Q;  2LCH A;  3L73 G;  1JMB A;  4N6J A;  1JTH B;  1O87 A;  3AGU A;  1W5C E;  1VQ4 P;  2W6J H;  2HFI A;  1W2E A;  3L8J A;  3LLI A;  3WU2 H;  4PV1 B;  3HKK A;  4FAP B;  3KYQ A;  1AV1 A;  4UDV A;  1H8A A;  4LLC A;  4KC9 A;  1HGZ A;  5EGY A;  4G7H F;  2YEV A;  1PP9 J;  1ZHT A;  5CHX A;  3P8M C;  2OQQ A;  4KT0 J;  1EDJ A;  3DKA A;  1RQU A;  2FXP A;  3FX0 A;  2GA1 A;  3OA7 A;  4J32 B;  3P7K A;  3SSU A;  2BE5 F;  4C46 A;  3IR9 A;  3NMI A;  3RIP A;  1SYQ A;  2E87 A;  4K35 A;  4IWB A;  1E83 A;  2XL6 A;  4AL0 A;  1ZU5 A;  1G4W R;  4DZO A;  1HGV A;  4N78 D;  1DOV A;  3MHV A;  3HJC A;  1NBB A;  1ZU4 A;  1VQ6 P;  5BQI A;  4R32 A;  2NPS B;  1WRG A;  3CME P;  2J0W A;  3T6J A;  1IK7 A;  3GLM A;  4OGQ B;  3MUD A;  2Y69 C;  3SFD C;  1UFB A;  2HPC A;  3JYH A;  2IFN A;  4XEF A;  5JT4 A;  2WSE J;  3RK2 B;  1TFO B;  3V7O A;  2IBZ D;  3CWB E;  4MVM A;  4U5F E;  2CNW A;  3FAJ A;  4RJT A;  1G2C A;  4BJ6 A;  5KLV E;  3GEH A;  1FR0 A;  1T3U A;  2PF4 E;  2FYN B;  2A1D D;  2KNH A;  3VMA A;  1VYI A;  3A0H H;  1OKK A;  1G2C B;  1PPJ D;  3DWW A;  4MVO A;  1X8Y A;  1APC A;  3QVY A;  4PR9 A;  2WSC J;  2JR8 A;  1RKE A;  3L74 E;  1M8O B;  5CCH A;  3HTK C;  2QE9 A;  3L72 G;  2Q3I A;  2ZYA A;  3TGU J;  1NKN A;  2PGD A;  3AEF C;  4HKZ H;  2N1T B;  1Y4C A;  1WWP A;  3VM6 A;  1VTM P;  2FFD B;  1ZYR F;  1O5H A;  1HE1 A;  1IO4 A;  5HSW A;  4IJJ A;  3SP1 A;  3C7J A;  5L0I A;  3CLQ A;  1FZE A;  1Q0K A;  4ZNC A;  5BQG A;  2A0B A;  1AVO A;  3OAK A;  1YQ4 C;  2CW0 F;  3FHD A;  3V4W A;  3ABL C;  3T6G B;  3ZQV A;  1J1D C;  1RE3 C;  1BDJ B;  1SQV G;  1E85 A;  2JP3 A;  2WVN A;  2ZVO B;  2J7P D;  2XM0 A;  4I7Z B;  1ZXG A;  2C0X A;  1QPU A;  3GAN A;  2LSE A;  3IQ5 A;  1YJW P;  2XND H;  3HD7 B;  1SFC D;  5JLI A;  5APT A;  3V4Q A;  3A5T A;  3GHG A; 
#chains in the Genus database with same CATH homology
 1Q90 D;  4Y28 J;  4H0L C;  1ZOY C;  2JX0 A;  1PIX A;  3GMA A;  3B71 A;  1VL2 A;  3D71 A;  1HF9 A;  1ZRT E;  3AE4 C;  3R4Y A;  4R32 A;  4GDO A;  4IL6 X;  3GM2 A;  3RQF A;  2L6G A;  1WOL A;  3Q3D A;  1KOR A;  1IK7 A;  1S5L X;  3JZ0 A;  3GLM A;  1EXJ A;  4OGQ B;  2WPV B;  1EXI A;  2NZ2 A;  4H0L D;  1FDO A;  1ZP0 C;  1VF5 B;  3BRJ A;  1OW6 A;  1JB0 J;  1TU3 F;  3RL0 g;  1WMK A;  4H13 C;  4H44 C;  3GM3 A;  3MFN A;  2YWA A;  4TT3 H;  3SFD C;  1UFB A;  2FYN C;  2O01 J;  3EWK A;  3S9O A;  5KKZ C;  3ABV C;  1KQF B;  2QJK C;  2WSE J;  1KTM A;  4XEF A;  4PV1 D;  3TUL A;  1ZME C;  4XEV A;  2QJY C;  2BEQ D;  2H89 C;  4R4L A;  2ZT9 C;  2E75 D;  3Q5R A;  3RK3 E;  3U3F A;  1QVX A;  2QSI A;  3L8I A;  3AE7 C;  2KK1 A;  2YIU C;  2E76 D;  3H25 A;  1K40 A;  4EBJ A;  4YXD C;  2K9Y A;  5M1B A;  4PV1 C;  1ZZP A;  2L6F A;  2E76 B;  2QJP C;  2G3A A;  2L6H A;  2WSC J;  3GF7 A;  3D6Y A;  2ZT9 B;  2BEZ F;  2HSB A;  1OMI A;  2E74 B;  2WQY C;  4YTP C;  2LK4 A;  4OGQ C;  4R4M A;  3D70 A;  2V7Q J;  5F28 E;  3C18 A;  2D2C B;  3RQE A;  1MKM A;  1VF5 D;  3Q1M A;  1OW7 A;  3FGA D;  1WTY A;  1V4A A;  1PL5 A;  3AE3 C;  3RQG A;  2Q00 A;  1NYH A;  1UIX A;  2H88 C;  3AEF C;  1WWP A;  2E75 B;  3GF3 A;  3LW5 J;  2P10 A;  1O3U A;  2MKV A;  4NQF A;  4OGQ D;  2E74 C;  1DIP A;  1FDI A;  3AE5 C;  1VF5 C;  3JYY A;  3AEG C;  1RQV A;  3C8G B;  3AEE C;  1KMI Z;  2QIW A;  5L8R J;  2ZT9 D;  1DD4 A;  3AJM A;  3AEB C;  4I7Z C;  3D6Z A;  3L8J A;  3SFE C;  3Q2Y A;  4PV1 B;  4XFJ A;  1YQ4 C;  2JPU A;  2J5U A;  2E76 C;  1GMJ A;  3O10 A;  1PV3 A;  1K04 A;  4RKU J;  1JOG A;  3AEA C;  3K7D A;  4U7J A;  2E74 D;  3AED C;  2FBW C;  4H13 D;  4H44 D;  2G8Y A;  4XEK A;  3AE9 C;  1DD3 A;  1KIL E;  2JO1 A;  3AE1 C;  3GM1 A;  2JP3 A;  3AEC C;  4Z1M H;  1NGM B;  1KNY A;  4EBK A;  3IN6 A;  1HJ0 A;  1YQ3 C;  2D2C C;  4H13 B;  4H44 B;  2OQQ A;  4KT0 J;  4H0L B;  4I7Z B;  1OW8 A;  1RQU A;  2FXP A;  3C8V A;  3O6Q A;  3AE8 C;  3AE2 C;  3AE6 C;  3Q5S A;  1U57 A;  2IDB A;  2E75 C;  1S1C X;  3T97 B;  3IAO A;  1Y9B A;  3C8G A;  2YMK A;  3G9R A;  1AJY A;  3C8G D;  1KQG B;  3U0C A;  5KLI C;  2D2C D;  1R8E A;  2PBE A;  2WSF J;  3Q5P A;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...