1OWDA

Substituted 2-naphthamidine inhibitors of urokinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Novel Binding Interactions in the Development of Potent, Selective 2-Naphthamidine Inhibitors of Urokinase. Synthesis, Structural Analysis, and SAR of N-Phenyl Amide 6-Substitution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1owdA01
2BD9A 3K65B 1TMBH 1SGCA 2GP9B 3ATIA 3RLWH 3FAOA 4AG1A 3P95A 2CJIA 1V2UT 3FZDA 1ZZZA 3OYPA 1MBMA 2AIQA 1KLIH 1C1SA 1O2LA 1FQ3A 1C1NA 2VIOA 5JBAS 5JBTA 2HWLB 1C4Y2 1T32A 2PSYA 3MU0A 3SV8A 6CHAB 5DGJA 3Q00A 2XC5A 1L1JA 1TPPA 3LJOA 3TJUA 4OS7A 1CT4E 3MWIU 2BY5X 7GCHG 4AFQA 3BG4C 3DHKH 3ZZ5A 2H9EH 4IMQA 1C2FA 1LVYA 1QTFA 2J2UA 1F5RA 1AD8H 5L6NH 2VH6A 3PV4A 4YOGA 1DVAH 1ZMNA 1X7AC 9ESTA 2F9PA 3QZQA 4AOQA 2BHGA 2WINI 1SGEE 2ZEBA 1HAVA 2CHAC 3OU0A 3F9GA 3QDZB 2Z9LA 2ZDLA 1YCPK 3NPSA 3ZZ7A 1HAYB 2AMQA 3DFLA 3A89A 3ZVBA 1MU6B 1THRH 2ZDNA 1WSSH 1O3FA 1GBEA 2ZU1A 2B7DH 1BBRK 2G55A 1O3BA 3U98H 3KN2A 4WWYA 2AFQB 1MTVA 1Y8TA 2GVFA 1A4WH 4H42U 4ZROA 1TWXB 3IG6B 1TX6A 2Z9KA 4NA8A 4TWYA 1QRZA 4X1QU 1AE8H 4K1SA 4DCDA 1QBNA 2P95A 3FVFB 1OWJA 1J14A 1VR1H 5EXLA 5GCHG 5BRRE 1B0EA 2V3OH 1O2MA 3FP6E 4WVPE 2A5KA 4Y11E 3ESTA 4MLFB 1GJDB 1DOJA 1NRQH 4JYTA 3FZZA 2PKSB 3ODFA 1C5TA 5I25A 1E37B 1S85A 3FANA 2J9NA 2FYQA 4K5ZA 5DO4H 4UEHH 1GI0A 1UTNA 1O3KA 1BB0B 2XRCA 3L6PA 2BD3A 3VGCC 5E2PA 3QTOH 1EZUC 1EKBB 4GPGA 1SPJA 1E34B 1XX9A 2R0LA 3MNSA 1BIOA 5FXLA 1TALA 4YO9A 1Y59T 4VGCC 3O8RA 1K1IA 3GDVA 1AFQC 3UFAA 3NWUA 4A1VA 2FXRA 3RXMA 1CE5A 1C2HA 1V2PT 1LPKB 3K6YA 3UWJH 1LO6A 1TLDA 2BQWB 3RM2H 3SU6A 3HPTB 2VWOA 1C1RA 2BLVA 2GZ9A 3LC3A 3W94A 1UHBB 4UD9H 1IQEA 1QHRB 3B23B 1RGQA 5CHAB 4MNYA 4Z0KA 3BN9A 1GBLA 1NT1A 4X8VH 4CRDA 1GDNA 3SOSA 1YGCH 1A0LA 3RXBA 1NFWA 2FOAA 2GGVB 1GI1A 1Y3WA 4X8SH 2XNIA 4ZHMU 3ZVAA 4ABBA 1TONA 5DP9A 2J38A 1T7CA 3RXUA 3PLKA 4TY7A 1NRRH 1SLUB 3B9FH 1TPSA 1YYY1 1MD8A 5TJXA 5HGGA 5C5NA 1DSTA 4K1EA 1C5YB 1ZJDA 2XWBI 4GHQA 5EOKA 3QTVH 1TRYA 3TNTA 1UVPA 1C2JA 2VIVA 4NWKA 2BZ6H 3OSYA 2ZNKH 1O2IA 1UTLM 1QY6A 4HZHA 3ZZ8A 4SGAE 3RXSA 1MKXH 1P2KA 1ZMJA 4D7FA 2OD3B 3DA9B 1HAHH 1AB9B 3A82A 3A8CA 1ZRBA 4INKA 1HRTH 3MMGA 4ISNA 3K9XB 4IC6A 5F8XA 2XCNA 1F0TA 1PJPA 2FTMA 2OBQA 1UVUH 3PYHA 1G2MA 2ZFQH 4NSYA 1GI2A 3V0XA 4MNVA 1EPTB 1QURH 1GBBA 3GY4A 3MU1A 1SGFA 1MKWK 4NIYA 1IQFA 4ZH8A 4XOJA 4JK6A 4ZKOU 3ZV8A 1W8BH 3TK5A 1C2DA 1OWHA 2YNBA 1ZSLA 4B74A 2AMPA 1RIWC 3SU4A 1QB1A 2G81E 3KHVA 2OTVA 1ARCA 3SNCA 1O5BB 5L2ZH 2ZFPH 3LH1A 4OS2A 5DP3A 1A61H 4CHAB 4A5TS 1O2ZA 1GBCA 1LHCH 2ZTYA 3DT0H 2O8UA 3VXEH 3SGBE 1SFQB 2Y5GA 1GI9B 1SG8B 2UUFB 2Y7XA 1KIGH 5LPEA 1BCUH 1O2YA 2Y7ZA 4FUBA 1A2CH 3SV6A 5EQRA 1YKTA 3MH5A 1GJBB 1KXAA 2FS9A 2FOHA 3STIA 3TLOA 2OC7A 4A1XA 2I6SA 3E6PH 1KXBA 1P03A 6GCHG 2Y6TA 1PPFE 4NFEA 2KAIA 1HIAB 2WPHS 3SU3A 1IAUA 2BD5A 2STBE 4FU8A 2Y5FA 1GMCF 2JH6D 2O8MA 1O2UA 2ZU5A 4I33A 3T5FH 1T4VH 1AU8A 1HNEE 1Z1IA 2Q6DA 1PPHE 1AY6H 1TRMA 2HALA 4WJG2 1O39A 1BMLA 2PSXA 4CRBA 2FM2A 1LKBA 1FUJA 1MCTA 5JBBS 3GYLB 3TGJE 1GI3A 4J2YB 2BVSH 4ABHA 5EXNA 3BV9B 1IQMA 1DWEH 2ZGJA 4YT6H 2WPMS 4X1RU 4ISIH 2BZAA 3H7TA 3TITA 2BYAX 1YM0A 5DPAA 2ZGBH 1H9LB 1PYTD 4B2CA 4RKOB 1ELDE 5HM2A 2W26A 1LHEH 4AB8A 3F68H 4Z6AH 3K6ZA 1ZPBA 1CBWB 2A4QA 2F3CE 2LNCA 1K21H 2BTCE 5FHTA 3KF2A 3UQOA 2PHBA 3RXFA 4O9VA 3MHWU 5T6DA 1CU1A 1O3OA 1GI7B 1ZR0A 4JCNA 1GHAG 1ETSH 1S84A 2A0QB 2ILNA 4OGYA 1HXEH 1V2KT 2ZFRH 3P6ZB 3QZRA 3A87A 1GG6C 2ZGHA 2ESTE 4DJZB 1ZHMA 2EC9H 1J16A 1P0SH 1GHXH 1YPEH 5EQQA 1HJ8A 2EI7A 1H9HE 3OY6U 1P2NA 3RXCA 3PMBB 1TABE 3Q77A 2V0BA 1BTUA 1DITH 1O2VA 1TBQH 1ELAA 3TGKE 2SGFE 3RMMH 4NFFA 4JZEH 1VJAU 1SI5H 2G5NA 9LPRA 1AMHA 1O2KA 2A7HA 2O8TA 2XW9A 1ZOMA 1ZPZA 2A5IA 3TH4H 1WUNH 2AGGX 5F03A 1Z8IB 3BTTE 3PB1E 2YOLA 4SGBE 1C5RA 1LHDH 1QNJA 2EA3A 1YPKH 1Z8GA 1AO5A 2OCVB 3RXRA 3RXJA 3M37A 1BJVA 4BTUB 2RDLA 2DE8A 1CGJE 5CMXH 4B2AA 2G5VA 2PWXA 3BTKE 2Z3DA 2BDAA 1NC6A 2ZFTA 1O3NA 2BD8A 1K1JA 3LU9B 1FY8E 1O37A 2ZDKA 3S7KB 2P8OC 3HKJB 2B0FA 1TX7A 4ABDA 1HXFH 1YLDA 1TA2A 2BB4A 1WAYB 1MTWA 5AFZH 3MO3A 1A3BH 4Y79A 2O9QA 2Y5HA 5G4BA 1IQNA 1THPB 1HJ9A 2HNTF 3EQ0H 3LGIA 4K60A 3SV7A 2JKHA 1SGTA 5B6OA 1O5FH 4UONA 1JRTA 1SGYE 2ZDVH 8LPRA 3R3GB 1W0YH 3LDXH 1EZSC 2GV6A 1T8NA 3A84A 1V2ST 2F91A 2FESH 2VIPA 3HK3B 1D9IA 3LC5A 5AF9H 1O5EH 4U32A 1LVOA 1O3CA 1DUAA 1XKAC 3KQBA 1VCWA 1G9IE 7GCHF 2FI4E 2LPRA 4ABGA 1F5LA 4X6MA 1G37A 3U8OH 4XBCA 2P3TB 1G32B 1K9OE 1BRAA 1SFIA 3BTDE 1H4WA 1YCPH 1N6YA 2ZCLP 5C20A 1BTHH 2AERH 2TPIZ 1GBTA 2C8ZB 1ESTA 3D62A 1UTKA 4LZ1H 2CMYA 1NTPA 2ZHQH 4B75A 1Q2WA 1AIXH 3GCTG 3M3VA 4AN7A 2A4OA 1ZGVA 1C5NH 1C5XB 1AVXA 1NO9H 1L0ZA 2OQ5A 2GT7A 1C5WB 4JK5A 5A0AE 1WU1A 1P8VC 2H9TH 3E0PB 1B0FA 1S5SA 2ZI2H 1GJ8B 1GMDF 1KSNA 2GCTC 4ABFA 1K28D 1OPHB 4YOJA 3A8DA 4I8GA 5ESTE 1Z71A 1LKAA 1L4ZA 2Q1JA 2ZTXA 2Y82A 1JMOH 1A3EH 3VB7A 1SGNE 2UUJB 1GBKA 1O36A 2FMJA 1Y5UT 1YCPM 1ESAA 4CRAA 1BBRE 3SW2B 8ESTE 2VIWA 2RG3A 4XDEA 8KME2 1GJ6A 5GXPA 5FAHA 3PO1B 2VU8E 5IDKA 1OWKA 2BVRH 1D3TB 3OX7U 1C5LH 2P3FH 5DP7A 5LPRA 1KXCA 3ZZ3A 1P02A 1ANDA 2UUYA 4UFEH 1V2NT 3KL6A 2BQ7B 1GCTC 3SJ9A 2FOMB 1P05A 1TMTH 3ZZDA 1OP0A 2BLWA 2UWOA 1CA0B 1C5UA 1TFXA 1HAGE 3M3TA 2SGQE 1M9UA 3S9BA 2GCHG 5F6MA 4NIWA 3E1XB 2ULLA 3F6UH 2GDEH 2WPJS 3VB4A 1N8OB 1ZHRA 1BRCE 3KQCA 1DXWA 1RS0A 1AWFH 1XM1A 1ESBA 1Z8JB 2PFEA 5C1UA 3RU4T 1KXDA 3MH4A 3E91A 1NFYA 3SO3A 2HVXA 3MI4A 1TAWA 1UTJA 3LPRA 5F8TA 4AFSA 1AKSB 1XUJA 2H5CA 3BF6H 4Y76A 3R0FA 3UNQA 1S0RA 3RM0H 3EYDA 1P12E 4AYVB 1FI8A 3CS7A 2BMGB 1W3CA 1XVMA 1F0RA 2SFAA 2WV5A 1MAYA 1GHAF 1FNIA 1E0FD 4ZAEA 4TWWA 3VFEA 3GY3A 1VGCC 4GVUA 2FLBH 2G52A 3E0NB 4Q7XA 3Q3XA 2XYAA 2CF8H 2JH5D 1NZQH 1EP6A 2A7CA 2C3SA 3ZZBA 2JETB 3M5NA 3RXEA 2GKVE 1T31A 1NS3A 4B2BA 2FIRH 5GJ4B 1AVWA 3RXVA 1A0HB 1GI8B 1EAIA 1VCPA 4DY7B 4ISLA 3SI4H 5EPYA 3QN7A 1BMAA 2R0KA 5EW2H 2GD4B 1PPBH 3I78A 1C5ZB 2BOHB 1GJ7B 3LIWA 1BQYA 3LKWA 3PLPA 2OUAA 4JYVH 4HFPB 1E38B 1FMGA 1H1BA 2ZDAH 1AQ7A 1GI5A 2H9HA 1CHOF 3CENA 1PFXC 2XBVA 1EJAA 1KLJH 2R9PA 1EX3A 1UK4A 2BX4A 3SJIA 1MTSA 2FLRH 5DP5A 3P8GA 2R3YA 4UFGH 1UVSH 1A7SA 2GDDA 1XUKA 1WCZA 2P16A 3SV2H 3ZZAA 3BIVH 1VITF 3ATMA 1AN1E 2GV7A 4GSOA 1O31A 1BHXB 4YTAA 1GJAB 4CH2B 3SUDA 1P09A 2F9VA 1HCGA 2ANKH 4FVDA 1GCDA 4IN2A 3ITIA 3ZZ4A 3P8OA 3ZYEA 3HGPA 1GBAA 1IQLA 1UCYH 1SL3A 1V2MT 3V7TA 3Q3KA 2C8YB 1EASA 4BAKB 4Q7YA 3PLBA 1JXPA 2SNWA 5ABWA 1BBRH 2CXVA 1TQ0B 2ZQ2A 2ZIQH 4Y71A 1HDTH 3RXAA 2W5EA 2WPIS 1HIAA 1SLXB 2G8TA 1C1UH 3M7UA 5ETXA 1YPJH 3UY9A 4X8TH 1L1GA 1Y3XA 1EP5A 2D2DA 1WOFA 1TRNA 4FUCA 4NZLA 2PV9B 4JZDH 3SJ8A 3KQEA 3I29A 1W12U 1KLTA 2HNTC 1AFEH 1TOMH 3ENSB 1SHHB 2XXLA 1MUEB 1BZXE 3ODDA 3UTUH 3SNBA 1GL0E 1HAIH 1A5IA 2FEQH 3KEEA 4TPYA 1KXFA 2XBYA 3K2UA 1TNGA 3SJKA 1MTUA 4JZIA 4A6LA 4CBOA 2ZA5A 1EB1H 2BDCA 4AX9H 1C1QA 2IOTA 2F9NA 1K1NA 1NFXA 1PQ8A 1TE0A 1FAKH 2FOCA 1CGHA 2C4FH 2BD7A 4JYUH 1XUIA 1PQ5A 1VCQA 5A0BA 2ANWA 3OTJE 2VVVA 4K1TA 1JWTA 1UVTH 1P3EA 1RIWB 2IN2A 3PWBA 3RXHA 2D8WA 4X2WA 7LPRA 2BD2A 1QIXB 2Z7FE 4ISOA 4X2XA 1UCYK 3TJVA 4XE4A 2ZECA 2H6MA 2QN5T 5F8ZA 1O3IA 3KQDA 2ZPRA 4ISHH 1ZHPA 4X8UH 2M5TA 4MPUA 1P9UA 5ESBA 3MH6A 1FONA 2QV1A 1A5GH 1GBMA 3A7TA 4ZMAH 5L2YH 1O2WA 3MU5A 4GCHG 2J34A 4U01A 5K0HA 2WUCA 4BAOB 1ABJH 1PPZA 3F9FA 1SC8U 1MTNC 1DLEA 1C5QA 2B5TB 4KELA 3GYMA 3SZNA 4FUGA 4BAMB 5A0CA 4UDWH 1C1MA 1QGFA 4MPWA 1MKWH 2PR3A 6LPRA 1CHOG 2P3UB 2GCHF 4NA7A 1RXPA 4HTCH 2ZGCA 4X1PU 1SOTA 5EXMA 1SOZA 2H2ZA 1IQKA 5JDUB 3JZ2B 4GLYA 2A45B 1GDQA 1HV7A 1XUGA 1V2WT 3M5MA 3D65E 1HJAB 3MFJA 1NM6A 4OS5A 2VNTA 3LH3A 1H8IH 4O97A 1DANH 4A92A 1IQGA 1WYKA 3EE0B 3GDSA 4CRFA 1YPHE 2ZO3H 2V6NA 3RMNH 2NU1E 2VINA 2ZF0H 1PPEE 1E36B 5JB9S 3RXKA 2ZHEH 2FI3E 2A32A 3AVZA 3MNBA 4O3TA 1AUJA 4UE7H 2WYJA 1BMMH 3T25A 1SQTA 5C67A 1JBUH 1SQAA 4RSPA 2TGAA 1BTYA 3TK6A 2HLCA 1BJUA 1FAXA 2DE9A 2SGPE 1C1TA 1QL7A 2R3UA 1O2RA 2ODYB 1GWAA 1SGPE 1C2LA 1CA0C 4RN6A 1O2NA 1TNIA 1S0QA 1FV9A 3BTME 1O3GA 3RC4A 1YLCA 2FX6A 3SGAE 3SORA 1KTSB 2BXTH 3VXFH 4Q2KA 2PTCE 1S81A 4E05H 1EUFA 2FYRA 3F9EA 4AFUA 1KTTB 4X0WU 1B5GH 1CT0E 1T8MA 3VB5A 3O8DA 1GJCB 1HAZB 1UTOA 3KNXA 1UK3A 1EB2A 1AE5A 1JRSA 1C5OH 1C9PA 2ZG0H 3EAJA 4D9RA 2FODA 3BTEE 1DSUA 2A7JA 1MMJN 1ZPCA 3RXLA 1TGBA 3SUFA 3MU8A 4WH6A 4DT7B 4BTIB 3SGQE 2F83A 2BLOA 5C1YA 3QO6A 2XTTB 3A8AA 2BDBA 5T6GA 1QCPA 2ANYA 3CS0A 1ELEE 1DPOA 3EA9A 2FOGA 3GISB 1GJ9B 3SBKA 3TIUA 1OS8A 4IS5A 1MZAA 1ABIH 1BRBE 3UR9A 1Z8RA 2RCEA 4DIIH 5IYTA 3BEIB 2ZC9H 1O3LA 1ELGA 1GGDC 3GCOA 1SMFE 2HRVA 1CBWC 4Y7AA 4Y10E 1LDTT 4YM9A 2J4IA 3G01A 3PMHB 3AW0A 1DS2E 2UWLA 5A09A 1LQEA 1LPGB 1O3HA 3NXPA 8GCHF 3ZVCA 3A7VA 1G30B 1V2JT 2ALPA 4KTUA 1SGRE 2G4UA 1BT7A 3LT3A 2W3IA 1V2OT 2J92A 2FDAA 4FU7A 1GMHG 4THNH 2P59A 2BD4A 1GVLA 3RC6A 2VB0A 4B71A 2UWPA 2VGCB 1C5SA 1GHYH 2VIQA 1GBJA 1F92A 1NU7B 1NY22 3A7YA 3T27A 1NRSH 2XWAA 2WUBA 5DK1A 3U1IB 1CVWH 2VVUA 1IQIA 2OP9A 2AS9A 4XSKU 1O3PB 1J15A 1L2EA 4LOYH 3F1SB 2EEKA 2ZFFH 2Y80A 4KTCA 2ODQA 1SGQE 4MVNA 2Z9IA 1BOQA 3RXQA 3ZVEA 1ELBA 3FP8E 1A5HA 1AGJA 2ANMH 1WQSA 1TB6H 3UUZA 1GHBF 1OYQA 2XC0A 3FFGA 1C1PA 5DJ7A 3S9AA 5A8XA 1QQUA 3ZVDA 1EJMA 2V3HH 2A31A 4CR9A 1AVGH 2QXHA 3FP7E 2ZHFH 5K7RA 1GVKB 1ZMLA 4B1TA 3BEFB 6ESTA 1DICA 3D23A 4I8KA 3MOCA 1ANEA 1VZQH 3JZ1B 1QL9A 1BUIA 2VWMA 2P8OB 2AMDA 1NRNH 2Z9JA 3PMJA 3A83A 3SV9A 4MQAA 4OGXA 2GCTB 7KMEH 4Y8XA 1QA0A 4R8TB 2F9UA 4WF8A 4JZ1A 1AI8H 4DW2U 3DUXH 5E0JA 1EAUA 3T62A 3LGTA 2NU2E 2F9OA 3GDUA 1BHXF 2O8LA 2HPQH 4ZKRU 1EZQA 5BPEA 5FBIA 1O2JA 1ID5H 1AZZA 1FPHH 3KCGH 4GHTA 1SBWA 1QB9A 2ZQ1A 2STAE 1FY4A 3PTBA 1UTMA 5AFYH 3PO1C 2AYWA 1O5GH 2QF3A 3SNEA 4K8YA 4FUHA 4ZHLU 2QAAA 1QFKH 1C4V2 1FJSA 1SHYA 3GY8A 4K2YA 4Y6DA 5EPNA 2Z3CA 4H6SB 1FDPA 1W11U 2VJ1A 1S82A 3QGJA 2C93B 3WY8A 4U30A 3UQVA 1IQJA 1V2LT 3EGKH 5EG4A 4CRCA 4M7GA 1YBWA 2BY8X 3LGYA 4ZHAA 4XBDA 1DWCH 1DDJA 1P01A 1ZTKA 1SQOA 1N8OC 2G4TA 3QK1A 4YLQH 1Y3UA 3ZZ9A 4KTSA 4R0IA 1AZ8A 1LPZB 1NFUA 1O38A 3O8BA 1HLTH 1UJ1A 1FN6A 1TBRH 3MH7A 1QJ6B 1Z7KA 2A2XH 1RJXB 4D76A 3VPKA 1VITG 3ZVGA 1ANCA 4WMDA 5FPSA 2QXIA 1CGIE 1O5AB 4LK4A 1EZXC 1OWDA 1PQAA 3VB6A 2Y81A 1ELFA 2TGTA 2GMTB 3M5LA 4IGDA 2TGPZ 5C1XA 3MO6A 1KY9A 1K1LA 3RLYH 2RA0A 1ETTH 4H6TA 4A7IB 1GMHF 1C4U2 5A2MH 1FY3A 1UO6A 2JH0D 2BOKA 1G2LA 2WPKS 1K2I1 1LTOA 3MYWA 5HMAA 1LVMA 3RDZA 3DFJA 3GY7A 3ATWA 3HATH 1DWBH 1HJAC 1DY8A 1O3EA 4X6OA 2JETC 1THSH 3RXGA 4UFDH 1BTWA 1YPGH 1AWHB 2CF9H 1OP2A 3SQHE 5JYIA 1YF4A 2ZGXH 1O3AA 2H5DA 3N7OA 2GX4A 5E8EH 1G36A 3LOXA 3RP2A 2QY0B 2FP7B 1TGSZ 2P93A 1GCTB 4YT7H 4LXBH 1OSSA 1C2GA 5GIBA 2ZCKP 1GL1A 4WMEA 2OLGA 1W10U 3ZZ6A 5LGOA 1HAVB 3GCTF 3UNRA 1IHSH 3AW1A 1B7XB 5E0GA 1O2GH 1P2OA 1HAXB 3KIDU 3TH3H 3PROA 2B8OH 2Z6BD 3PM3A 1C2KA 3M35A 3S0NA 2KAIB 3S7HB 2PKAB 3U1JB 3U8RH 5J4SA 1GMDG 3BTQE 2R2MB 2AGEX 5DKMA 3ELAH 2XBWA 3NKKA 1LHFH 2UUKB 1CSOE 2FZZA 2AEIH 2ZFSA 3LONA 4Q7ZA 4BAHB 4J1YA 1MQ5A 5LH8A 3E90B 5AVDA 4CR5A 2ZKSA 1SR5C 3T2NA 4GAWA 4Y7BA 2FS8A 1C1VH 3ZZCA 1VGCB 2ASUB 2G51A 2OXSA 1HB0B 3Q76A 4DGJA 4AB9A 1VITH 3BG8A 4FUFA 2BY7X 3GICB 1L1NA 1V6DA 3OY5U 1GBDA 1MBQA 3P8NA 5GPIB 2XCFA 4I8HA 4AYYB 4K8BA 1INCA 2W7SA 2A4GA 1QBOA 4D8NA 4I7YH 5C5OA 1TNHA 3UR6A 1O3DA 1YPHC 3KGPA 1OXGA 1W13U 4Y0ZE 1BDAA 4NWLA 3RU4D 1EQ9A 3DD2H 3P92A 2FOEA 4ZKNU 3AAVA 3L33A 4INLA 6CHAC 1ZYOA 1GGDB 4IN1A 1UMAH 4ZUHA 1H8DH 1C5PA 2D1JA 1P11E 4ZXYH 1TA6A 3IWMA 3UIRA 3RXIA 1C9TA 1TGCA 3L3TA 3HK6B 1QBVH 1A0JA 4B76A 3UOPA 1QR3E 1CQQA 3A86A 3GCHB 1XMNB 2Q6FA 3M36A 1K1PA 4Q80A 1J17T 4JMYA 1UTPA 1SLWB 1T8OA 4E06H 1C5VA 4NGAH 4Y8ZA 2GZ8A 4WMFA 2AGIX 2IPHA 1QJ7B 3BTWE 4H4FA 3U69H 2ZHDA 3TJNA 2NU3E 2G00A 5SGAE 3ZYDA 1OOKB 4FVBA 1WQVH 4I32A 1F0UA 3AAUA 1RRKA 4D7GA 4E7NA 5DP6A 1RTFB 1SVPA 1ZSKA 1HPGA 3RC5A 2ZZUH 1TPAE 1JIMA 3RU4E 1KYNA 4PROA 1BA8B 1L4DA 3TGIE 4X2YA 1AKSA 4UFFH 4A1TA 4TPIZ 1V2QT 1V3XA 2FX4A 2OC0A 1H9IE 3GY6A 1MTNB 4DOQA 1Z1JA 4YZUA 1Z6EA 1VJ9U 7ESTE 1Y5BT 2CV3A 3GCNA 3SNDA 1ELVA 2PKSC 1TX8A 2BY6X 5E0HA 5FPTA 1G3EA 1HYLA 1MQ6A 1KDQA 1TYNA 2BXUH 3SU0A 4BXSA 3E3TA 5A8ZA 1V2TT 1MKXK 3B8JA 4DIHH 2PGQB 1D3DB 2OBOA 5JPMH 4X2VA 3UREA 2SGEE 1T4UH 3M7QA 3SQEE 4IC5A 3MNXA 4BNRA 5E2OA 1QL8A 2FTLE 6GCHF 1HAOH 1FLEE 5H4IB 1P57B 1LVBA 3LGUA 2TBSA 1AHTH 3SUEA 2F9BH 2FPZA 2BDIA 1BTZA 4BAQB 1O3MA 3URCA 3GOVB 2R2WU 1DWDH 3TK9A 2A2QH 2VGCC 2VWLA 4FXGH 3BTHE 1XVOA 4MPVA 1DFPA 3QX5H 1DT2A 3H5CB 2H1UA 1T8LA 3GY2A 2PGBB 1P2IA 2OC1A 5EGMA 3M7TA 4OS1A 3BIUH 1W2KH 2NWNA 3SNAA 1LHGH 4JZFH 1QA7A 1WV7H 2TGDA 1MAXA 3MTYA 4MDSA 4NIVA 3UPEA 1DUEA 4ZXXH 4BOHA 2Z94A 1LQDB 4KGAA 2ZDMA 2RA3A 4QT8C 3SUGA 1HAPH 1YPLH 1DM4B 1K1MA 1RD3B 2ZU4A 3BTGE 2K1QA 1MU8B 1PYTC 1GHZA 3P8FA 3RXPA 1C2MA 2EI8A 1DX5M 1Q3XA 1MH0A 4FUEA 1ZGIA 2HGTH 3RUOA 3V3MA 4OS6A 1E35B 5EQSA 3SHCH 5JB8S 1IQHA 2A5AA 3IITA 4AFZA 1GI6A 4NA9H 1AB9C 2VIDA 1ANBA 4AGKA 2XC4A 4AG2A 3URDA 2AIPA 1TNKA 3SI3H 4LZ4B 1ETRH 1NRPH 4NG9H 3MU4A 3F9HA 5TCCA 1EPTC 4ABAA 4MNWA 2PUXB 4WXIA 1UK2A 3LGVA 1O5DH 4TYDA 5J4QA 1F0SA 1YPMH 1GHWH 1O2HA 2FWWA 3MO9A 5FCKA 2QCYA 2WYGA 1CHGA 1P06A 1IHTH 3RXTA 4CH8B 1PPCE 3U9AH 3Q3YA 1EATA 1NROH 1TQ7B 3UOUA 2VWNA 4MG3A 3ZVFA 2FOBA 5PTPA 4HGCA 1ZTLA 1OWEA 4I8LA 5TCAA 3A80A 3T26A 2YNAA 1O32A 1Q31A 1XUHA 4DVAU 2VH0A 3RXDA 5AHGH 1GJ5H 2BM2A 3TVJB 3VEQB 1P2QA 2PLXA 3HGNA 1TMUH 1GVZA 3P17H 2SGDE 3NZIA 1O33A 3QWCH 2V35A 5C2ZA 1SSXA 1G3BA 2C8WB 2QC2A 2OINA 2THFB 3E16B 1ZSJA 2PKAA 3HKIB 5FX6A 5EODA 5EU8A 4GUXA 4I8JA 1IOEA 1ZJKA 4FUIA 3EA7A 3RXOA 1JOUB 1W14U 1NESE 1DXPA 2QA9E 5EW1H 2A1DB 3T29A 1GBHA 5I46H 3BTFE 1LMWB 1D4PB 1G3DA 1Y5AT 5DG6A 1TNLA 5GCHF 4F49A 1TGTA 1QQ4A 1O2OA 1BMNH 1NU9A 1C2EA 2ZU3A 1XXFA 4CBNA 2ZCHP 1ZLRA 2OC8A 2QGRA 2ZP0H 1XUFA 3SU2A 2ZPSA 3SU1A 1A46H 1AUTC 3S9CA 4YLUA 3A81A 3QGNB 1OKXA 4GCHF 2XBXA 1YP9A 3RMLH 3S69A 3BG4B 4WXVA 1N6XA 3I77A 1C5MD 2BLQA 3TNSA 2OQUA 4X6NA 1UHBA 3M61U 4CHAC 3D49H 2ZPQA 3C27B 2QF0A 4YOIA 4RKJB 1J9CH 1U6QA 1GBIA 2IJOB 1K22H 4AORA 5HXFA 1P9SA 3STJA 2WPLS 2ZTZA 5T3HA 2CHAB 3GCHC 1GPZA 3UWIA 2FI5E 3A85A 5FBEA 4D9QA 1NPMA 1D3QB 1LCYA 3ATLA 1WTGH 4INHA 5CHAC 3ATKA 1EOJA 3EDXB 1GG6B 5FX5A 1GMCG 1FPCH 1S83A 2GT8A 2QYIA 2ZWLH 1W7GH 1FXYA 2WV4A 2A4RA 4KP0A 4NZQA 2TRMA 4DG4A 1SLVB 2SGAA 1O5CB 3QLPH 1GBFA 4CRGA 1YC0A 4OS4A 1OX1A 4KKDA 1FY5A 2HPPH 4NIXA 1CT2E 2Z3EA 1ACBE 3GY5A 1O2TA 2QIQA 2BX3A 2HNTE 1F7ZA 4ABJA 1PPGE 4MTBA 1K1OA 1O0DH 5JBCS 2BVXH 2FO9A 5A8YA 1SGDE 3VB3A 1P3CA 3VGCB 1HBTH 3AASA 1OWIA 1EXFA 2GMTC 4FUJA 3A8BA 1TOCB 1ARBA 1UCYE 3QUMP 1O3JA 5LPFA 2NU0E 2PUQH 3A7WA 3LJJA 2ZHWH 3TJOA 1BTPA 4VGCB 1G3CA 2W7UA 1BRUP 1V2VT 1Y3YA 1J8AA 1AFQB 3O8CA 4MPXA 1BTXA 1XXDA 1A1RA 1RFNA 4Y8YA 1QRXA 1TNJA 1WTHD 1HFDA 4B73A 4ABIA 3PTNA 2W3KA 2ZU2A 5T6FA 4BANB 1O2PA 1EAXA 3P70B 1KDQB 1QRWA 4I31A 2ALVA 4X1SU 1BITA 1V2RT 3SU5A 3A88A 1O30A 1HGTH 2EI6A 2C90B 3LGWA 1ELTA 4X6PA 1D3PB 4U2WA 3C1KA 1TPOA 1P04A 2FOFA 1O2QA 2B9LA 3PMAB 2BY9X 3TU7H 2I6QA 1ELCA 5HM9A 1SB1H 1P2JA 3TH2H 1EPTA 8GCHG 1TBZH 1S6HA 5C3NA 1SGIB 1W0ZU 3EA8A 4K69A 1DLKB 2PW8H 3V13A 4IW4E 4CREA 1RTLA 3A7ZA 3SHAH 1NN6A 1O2SA 1TIOA 1C1OA 5HYOA 3RMOH 1F2SE 1P2MA 1MCVA 3MNCA 1HUTH 4AZ2B 1N1LA 2TIOA 3BSQA 3M3SA 2BDGA 2BDYA 2SNVA 4ASHA 4NSVA 2VVCA 1GHVH 1MZDA 4Y0YE 4IMZA 2ODPA 5GWZA 3UNSA 1S6FA 4WH8A 1OP8A 3E8LA 2Q6GA 1D6RA 2HOBA 3NUMA 3PWCA 4X1NU 5L30H 4YESB 1P10A 5FPYA 3W95A 1UTQA 1O2XA 1O34A 4E7RG 4TY6A 4F4OC 4IBLH 1W7XH 1JIRA 3V12A 4FU9A 1WBGB 2CGAA 3SJOA 4AGJA 1GDUA 1C1WH 2GZ7A 4FUDA 1GI4A 1GHBG 3CP7A 5DP4A 1UVOA 3SN8A 4NCYA 2CN0H 1D6WA 2D26C 1EAWA 1CO7E 2DUCA 2P94A 2QXJA 3T28A 3A7XA 4ABEA 1Y3VA 2C8XB 4BTTB 5FCRA 4ZKSU 5GDSH 1FY1A 2GTBA 2PTNA 3H7OA 4O03A 4O3UA 1XKBC 1ZTJA 1Z6JH 4XFQA 1RTKA 1F5KU 1CA8B 2Z9GA 1TGNA 4WY3A 1FIZA 1FZZA 2J94A 1EJNA 4XBBA 5CE1A 1SGFG 4K3JA 1FIWA 2J95A 3ZV9A 1EOLA 3BEUA 1OYTH 4MNXA 4BXWA 3NK8A 1PQ7A 2O8WA 1ZRKA 3M5OA 2AH4X 3NCLA 2BDHA 1GJ4H 1MD7A 1O35A 2QXGA 1C2IA 3TPIZ 3U8TH 2BQ6B 4HI3A 4DURA 4ESTE 1QJ1B 1ORFA 1FN8A 1DE7H 5DP8A 1DY9A 1QB6A 2NU4E 1KXEA
chains in the Genus database with same CATH superfamily
2BD9A 3K65B 1TMBH 1SGCA 2GP9B 3ATIA 3RLWH 3FAOA 4AG1A 3P95A 2CJIA 1V2UT 3FZDA 1ZZZA 3OYPA 1MBMA 2AIQA 1KLIH 1C1SA 1O2LA 2IJD1 1FQ3A 1C1NA 2VIOA 5JBAS 5JBTA 2HWLB 1C4Y2 1T32A 2PSYA 3MU0A 3SV8A 6CHAB 5DGJA 3Q00A 2XC5A 1L1JA 1TPPA 3LJOA 3TJUA 2EQNA 4OS7A 1CT4E 3MWIU 2BY5X 7GCHG 4AFQA 3BG4C 3DHKH 3ZZ5A 2H9EH 4IMQA 1C2FA 1LVYA 1QTFA 4P00A 2J2UA 5DN6D 1F5RA 1AD8H 3FN8A 5L6NH 1BMFD 2VH6A 3PV4A 1WDIA 4YOGA 1DVAH 1ZMNA 1X7AC 2M2AA 9ESTA 2F9PA 3QZQA 4AOQA 2BHGA 2WINI 1SGEE 2ZEBA 1HAVA 2CHAC 3OU0A 3F9GA 3QDZB 2Z9LA 2ZDLA 1YCPK 1H8ED 3NPSA 3ZZ7A 1HAYB 2AMQA 3DFLA 3A89A 3ZVBA 2J5UA 3CNRA 1MU6B 1THRH 1E1QD 2ZDNA 1WSSH 1O3FA 1GBEA 2ZU1A 2B7DH 4B6EA 1BBRK 2K0QA 2G55A 1O3BA 2KFWA 3U98H 3KN2A 4WWYA 2AFQB 1MTVA 1Y8TA 2GVFA 1A4WH 4H42U 4ZROA 1TWXB 3IG6B 1TX6A 2Z9KA 4NA8A 4TWYA 1QRZA 4X1QU 1AE8H 4K1SA 4DCDA 1QBNA 4FETA 2P95A 3FVFB 1OWJA 2EY4C 1J14A 1VR1H 5EXLA 5GCHG 5BRRE 1B0EA 2V3OH 1H8HD 1O2MA 3FP6E 4WVPE 2A5KA 4Y11E 3ESTA 4MLFB 1GJDB 1DOJA 1NRQH 4JYTA 3FZZA 2KX4A 2PKSB 3ODFA 1EFRD 1C5TA 2W6JD 5I25A 1E37B 1S85A 3FANA 2J9NA 2FYQA 4K5ZA 5DO4H 4UEHH 1GI0A 1UTNA 1O3KA 1BB0B 2XRCA 3L6PA 2BD3A 2CK3D 3VGCC 5E2PA 3QTOH 1EZUC 1EKBB 4GPGA 1SPJA 1E34B 1XX9A 2R0LA 3MNSA 1BIOA 5FXLA 1TALA 4YO9A 1Y59T 3UAIC 4VGCC 3O8RA 1K1IA 3GDVA 1AFQC 3UFAA 3NWUA 3N7EA 2FXRA 4A1VA 3RXMA 1CE5A 1C2HA 1V2PT 1LPKB 3K6YA 3UWJH 1LO6A 1TLDA 2BQWB 2JIZD 1YLNA 3RM2H 3SU6A 3HPTB 2VWOA 1C1RA 2BLVA 2GZ9A 3LC3A 3W94A 1UHBB 4UD9H 1IQEA 1QHRB 3B23B 1RGQA 5HIZA 5CHAB 4MNYA 4Z0KA 3BN9A 1GBLA 1NT1A 4X8VH 4CRDA 1GDNA 3SOSA 1YGCH 1A0LA 3RXBA 1NFWA 2FOAA 2GGVB 1GI1A 1Y3WA 4X8SH 2XNIA 4ZHMU 3ZVAA 4ABBA 1TONA 5DP9A 2J38A 1T7CA 3RXUA 3PLKA 4TY7A 1NRRH 1SLUB 3B9FH 1TPSA 1YYY1 4P02A 1MD8A 5TJXA 5HGGA 5C5NA 1DSTA 4K1EA 1C5YB 1ZJDA 2XWBI 3DSGA 4GHQA 5EOKA 3QTVH 1TRYA 3TNTA 4Z1MD 1UVPA 1C2JA 2VIVA 4NWKA 2BZ6H 3OSYA 2ZNKH 1O2IA 1UTLM 1QY6A 4HZHA 4YXWD 3ZZ8A 3FO8D 4SGAE 3RXSA 1MKXH 1P2KA 1ZMJA 4D7FA 2OD3B 3DA9B 1HAHH 1AB9B 3A82A 3A8CA 1ZRBA 4INKA 1HRTH 3MMGA 4ISNA 3K9XB 4IC6A 5F8XA 2XCNA 5CDFE 1F0TA 1PJPA 2FTMA 2OBQA 2V3MA 1UVUH 3PYHA 1G2MA 2ZFQH 4NSYA 5HKKD 1GI2A 3V0XA 4MNVA 1EPTB 1QURH 1GBBA 3GY4A 3MU1A 1SGFA 1MKWK 4NIYA 3OEED 1IQFA 4ZH8A 4XOJA 4JK6A 4ZKOU 3ZV8A 1W8BH 3TK5A 1C2DA 1OWHA 2YNBA 1ZSLA 4B74A 2AMPA 1RIWC 3SU4A 1QB1A 2G81E 3KHVA 2OTVA 1ARCA 3SNCA 1O5BB 5L2ZH 2ZFPH 3LH1A 4OS2A 5DP3A 1A61H 4CHAB 4A5TS 1O2ZA 1GBCA 1LHCH 2ZTYA 3DT0H 2O8UA 3VXEH 3SGBE 1SFQB 2Y5GA 1GI9B 1SG8B 2UUFB 2Y7XA 1KIGH 3N7DA 1BCUH 1O2YA 2Y7ZA 4FUBA 1A2CH 5LPEA 2YMSB 3SV6A 5EQRA 2KCYA 1YKTA 3MH5A 1GJBB 1KXAA 2FS9A 2FOHA 3STIA 3TLOA 2OC7A 4A1XA 2I6SA 3E6PH 1KXBA 1P03A 6GCHG 2Y6TA 1PPFE 4NFEA 2K8IA 2KAIA 1HIAB 5CHBA 2WPHS 3SU3A 1IAUA 2BD5A 2STBE 4FU8A 2Y5FA 1GMCF 2JH6D 2O8MA 1O2UA 2ZU5A 4I33A 3T5FH 1T4VH 1AU8A 1HNEE 1Z1IA 2Q6DA 1PPHE 1AY6H 1TRMA 2HALA 4WJG2 1O39A 1BMLA 2PSXA 4CRBA 2QE7D 2FM2A 1LKBA 3AK5A 1FUJA 1MCTA 5JBBS 3GYLB 2WZQA 3TGJE 1GI3A 4J2YB 3WWFA 2BVSH 4ABHA 5EXNA 3BV9B 1IQMA 1DWEH 2ZGJA 4YT6H 2WPMS 4X1RU 4ISIH 2BZAA 3H7TA 3TITA 2BYAX 1YM0A 5DPAA 2ZGBH 1H9LB 1PYTD 4B2CA 4RKOB 2VBCA 1VKYA 1ELDE 5HM2A 2W26A 1LHEH 4AB8A 2GJGA 3F68H 4Z6AH 3K6ZA 1ZPBA 1CBWB 4Q63A 2A4QA 2F3CE 2LNCA 1K21H 2BTCE 5FHTA 3KF2A 3UQOA 2PHBA 3RXFA 2F43B 4O9VA 3MHWU 5T6DA 1CU1A 1O3OA 1GI7B 5GNDA 1ZR0A 4JCNA 1GHAG 1ETSH 1S84A 2A0QB 2ILNA 4OGYA 1HXEH 1V2KT 2ZFRH 3P6ZB 3QZRA 3A87A 1GG6C 2ZGHA 2ESTE 4DJZB 1ZHMA 2EC9H 1J16A 1P0SH 1GHXH 1YPEH 5EQQA 1HJ8A 2EI7A 1H9HE 3OY6U 1P2NA 3RXCA 3PMBB 1TABE 3Q77A 2V0BA 1BTUA 1DITH 1O2VA 1TBQH 1ELAA 3TGKE 2SGFE 3RMMH 4NFFA 1SQRA 4JZEH 1VJAU 1SI5H 2G5NA 9LPRA 1AMHA 1O2KA 2A7HA 2O8TA 2XW9A 1ZOMA 1ZPZA 2A5IA 3TH4H 1WUNH 1NBMD 2AGGX 5F03A 1Z8IB 3BTTE 3PB1E 2RFKC 2YOLA 4SGBE 1C5RA 1LHDH 1QNJA 2EA3A 1YPKH 1Z8GA 1AO5A 2OCVB 3RXRA 3F2GA 3RXJA 3M37A 1BJVA 4BTUB 2RDLA 2DE8A 1CGJE 5CMXH 4B2AA 2G5VA 2PWXA 3BTKE 2Z3DA 2BDAA 1NC6A 2ZFTA 1O3NA 2BD8A 1K1JA 3LU9B 1FY8E 1O37A 2ZDKA 3S7KB 1FX0B 2P8OC 3HKJB 2B0FA 1TX7A 4ABDA 1HXFH 1YLDA 1TA2A 2BB4A 5C0TA 1WAYB 1MTWA 5AFZH 3MO3A 1A3BH 4Y79A 2O9QA 2Y5HA 5B6LA 5G4BA 1IQNA 1THPB 5EIYA 1HJ9A 2HNTF 3EQ0H 3LGIA 1WXRA 4K60A 3SV7A 2JKHA 1SGTA 4ACBA 5B6OA 5HIYA 1O5FH 4UONA 3F2HA 1JRTA 1SGYE 2ZDVH 8LPRA 3R3GB 1W0YH 3LDXH 1EZSC 2GV6A 1T8NA 3A84A 1V2ST 2F91A 2FESH 2VIPA 3HK3B 1D9IA 3LC5A 5AF9H 3PV5A 1O5EH 4U32A 1LVOA 1O3CA 1DUAA 1XKAC 3KQBA 4HG6A 1VCWA 1G9IE 7GCHF 2FI4E 2LPRA 4ABGA 1F5LA 4X6MA 1G37A 3PV2A 4M9FA 3U8OH 4XBCA 2P3TB 1G32B 1K9OE 1BRAA 1SFIA 3BTDE 1H4WA 1YCPH 1N6YA 2ZCLP 5C20A 1BTHH 2AERH 2TPIZ 1GBTA 2C8ZB 1ESTA 3D62A 1UTKA 4LZ1H 2CMYA 1NTPA 2ZHQH 4B75A 1Q2WA 1AIXH 3GCTG 3M3VA 4AN7A 2A4OA 1ZGVA 1C5NH 1C5XB 1AVXA 1NO9H 1L0ZA 2OQ5A 2GT7A 1C5WB 4JK5A 5A0AE 1WU1A 1P8VC 2H9TH 3E0PB 1B0FA 1S5SA 2ZI2H 1GJ8B 1GMDF 1KSNA 2GCTC 4ABFA 1K28D 1OPHB 4YOJA 3A8DA 4I8GA 5ESTE 1Z71A 1LKAA 1L4ZA 2Q1JA 2ZTXA 2Y82A 1JMOH 1A3EH 3VB7A 1SGNE 2UUJB 1GBKA 2FMJA 1O36A 1Y5UT 1YCPM 1ESAA 4CRAA 1BBRE 3SW2B 8ESTE 2VIWA 2RG3A 4XDEA 8KME2 1GJ6A 5GXPA 2WHXA 5FAHA 3PO1B 3F0PA 2VU8E 5IDKA 1OWKA 2BVRH 1D3TB 3OX7U 1C5LH 2P3FH 5DP7A 5LPRA 1KXCA 3ZZ3A 1P02A 1ANDA 4FOUC 2UUYA 4UFEH 1V2NT 3KL6A 2BQ7B 2KR7A 1GCTC 3SJ9A 2FOMB 1P05A 1TMTH 3ZZDA 1OP0A 2BLWA 2UWOA 1CA0B 1C5UA 1TFXA 1HAGE 3M3TA 2SGQE 1M9UA 3S9BA 2GCHG 5F6MA 3GS9A 4NIWA 3E1XB 2ULLA 3F6UH 2GDEH 2LP6A 2WPJS 3VB4A 1N8OB 1ZHRA 1BRCE 3KQCA 1DXWA 1RS0A 1AWFH 1XM1A 1ESBA 1Z8JB 2PFEA 5C1UA 3RU4T 1KXDA 3MH4A 3E91A 1NFYA 3NRLA 2HVXA 3MI4A 1TAWA 3SO3A 1UTJA 3LPRA 5F8TA 4AFSA 1AKSB 1XUJA 2H5CA 3BF6H 4Y76A 3R0FA 3UNQA 1S0RA 3RM0H 3EYDA 1P12E 4AYVB 1FI8A 3CS7A 2BMGB 2SFAA 1W3CA 1F0RA 1XVMA 2WV5A 1MAYA 1GHAF 1FNIA 1E0FD 2KCOA 4TWWA 4ZAEA 3VFEA 2WSSD 3GY3A 1VGCC 4GVUA 2FLBH 2G52A 3E0NB 4Q7XA 1S6LA 3Q3XA 2XYAA 2CF8H 2YMSD 3N99A 2JH5D 1NZQH 2KM0A 1EP6A 2A7CA 2C3SA 3ZZBA 2JETB 3M5NA 3RXEA 2GKVE 1T31A 5C17A 1NS3A 4B2BA 2FIRH 5GJ4B 1AVWA 3RXVA 1A0HB 1GI8B 1EAIA 1VCPA 4DY7B 4ISLA 3SI4H 5EPYA 2F4LA 1BMAA 2R0KA 3QN7A 5EW2H 3DSPA 2GD4B 1PPBH 3I78A 1C5ZB 2BOHB 1GJ7B 3LIWA 1BQYA 3LKWA 3PLPA 2OUAA 4JYVH 4HFPB 1E38B 1FMGA 1H1BA 2ZDAH 1AQ7A 1GI5A 2H9HA 1CHOF 3CENA 1PFXC 2XBVA 1EJAA 1KLJH 2R9PA 1EX3A 1UK4A 2BX4A 3SJIA 1MTSA 2FLRH 4ZCNA 5DP5A 3P8GA 2R3YA 4UFGH 1UVSH 1A7SA 2GDDA 1XUKA 1WCZA 2P16A 3SV2H 3ZZAA 3BIVH 1VITF 3ATMA 1AN1E 2GV7A 4GSOA 2L74A 1O31A 1BHXB 4YTAA 1GJAB 4CH2B 3SUDA 1P09A 2F9VA 1HCGA 2ANKH 4FVDA 1GCDA 4IN2A 3ITIA 3ZZ4A 3P8OA 3ZYEA 3HGPA 1GBAA 1IQLA 1UCYH 1SL3A 1V2MT 3V7TA 3Q3KA 2C8YB 1EASA 4BAKB 4Q7YA 2XNDD 3PLBA 1JXPA 2SNWA 5ABWA 1BBRH 2CXVA 1TQ0B 2ZQ2A 2ZIQH 4Y71A 1HDTH 2XOKD 3RXAA 2W5EA 2WPIS 1HIAA 1SLXB 2G8TA 1C1UH 3M7UA 5ETXA 1YPJH 3UY9A 3UB0A 4X8TH 1L1GA 1Y3XA 1EP5A 2D2DA 1WOFA 1TRNA 4FUCA 4NZLA 1E79D 2PV9B 4JZDH 3FKSD 3SJ8A 3KQEA 3I29A 4RI0A 1W12U 1KLTA 2HNTC 1AFEH 1TOMH 3ENSB 1SHHB 2XXLA 1MUEB 1BZXE 3ODDA 3UTUH 3SNBA 1GL0E 1HAIH 1A5IA 2FEQH 5DSFA 3KEEA 2WV9A 4TPYA 1KXFA 2XBYA 3K2UA 1TNGA 3SJKA 1MTUA 4JZIA 4A6LA 4CBOA 2ZA5A 3PRBA 1EB1H 2BDCA 4AX9H 2J97A 1C1QA 2IOTA 2F9NA 1K1NA 1NFXA 1PQ8A 1TE0A 3F3BA 1FAKH 2FOCA 1CGHA 2C4FH 1K0HA 2BD7A 4JYUH 1XUIA 1PQ5A 1VCQA 5A0BA 2ANWA 3OTJE 2VVVA 4K1TA 1JWTA 1UVTH 1P3EA 1RIWB 2IN2A 3PWBA 3RXHA 2D8WA 4X2WA 7LPRA 2BD2A 1QIXB 2L6OA 2Z7FE 4ISOA 4X2XA 1UCYK 3TJVA 4XE4A 2ZECA 2H6MA 2QN5T 5F8ZA 1O3IA 3KQDA 2ZPRA 4ISHH 1ZHPA 4X8UH 2M5TA 4MPUA 1P9UA 5ESBA 3MH6A 1FONA 2QV1A 1A5GH 1GBMA 2KCAA 3A7TA 4ZMAH 5L2YH 1O2WA 3MU5A 4GCHG 2J34A 4U01A 5K0HA 2WUCA 4BAOB 1ABJH 1PPZA 3F9FA 1SC8U 1MTNC 1DLEA 1C5QA 2B5TB 4KELA 3GYMA 3SZNA 4FUGA 4BAMB 5A0CA 4UDWH 1C1MA 1QGFA 4MPWA 1MKWH 2PR3A 3ZIAD 6LPRA 1CHOG 2P3UB 2GCHF 4NA7A 1RXPA 4HTCH 2ZGCA 4X1PU 1SOTA 5EXMA 1SOZA 2H2ZA 1IQKA 5JDUB 3JZ2B 4GLYA 2A45B 1GDQA 1HV7A 1XUGA 1V2WT 3M5MA 3D65E 1HJAB 3MFJA 5EJLA 1NM6A 4OS5A 3VG8A 2VNTA 3LH3A 1H8IH 4O97A 1DANH 4A92A 1IQGA 1WYKA 3EE0B 3GDSA 4CRFA 1YPHE 2ZO3H 2V6NA 3RMNH 2NU1E 2VINA 5IK2D 2ZF0H 1PPEE 1YWUA 1E36B 5JB9S 3RXKA 2ZHEH 2FI3E 2A32A 2W6ID 3AVZA 3MNBA 4O3TA 1AUJA 4UE7H 2WYJA 1BMMH 3T25A 1SQTA 5C67A 1JBUH 1SQAA 4RSPA 2TGAA 1BTYA 1W0JD 3TK6A 2HLCA 1BJUA 1FAXA 2DE9A 2SGPE 1C1TA 1QL7A 2R3UA 1O2RA 2ODYB 1GWAA 1SGPE 1C2LA 1CA0C 4RN6A 1O2NA 1TNIA 1S0QA 1FV9A 3BTME 5EJZA 1O3GA 3RC4A 1YLCA 2FX6A 3SGAE 3SORA 4OM9A 1KTSB 2BXTH 3VXFH 4Q2KA 2PTCE 1S81A 4E05H 1EUFA 2FYRA 3F9EA 4AFUA 1KTTB 4X0WU 1B5GH 1CT0E 1T8MA 3VB5A 3O8DA 1GJCB 1HAZB 1UTOA 3KNXA 1UK3A 1EB2A 1AE5A 1JRSA 4ASUD 1C5OH 1C9PA 2ZG0H 3EAJA 4D9RA 2FODA 3BTEE 1DSUA 2A7JA 1MMJN 1ZPCA 3RXLA 1TGBA 3SUFA 3MU8A 4WH6A 4DT7B 4BTIB 3SGQE 2F83A 2BLOA 5C1YA 5T1VA 3QO6A 2XTTB 3A8AA 2BDBA 5T6GA 1QCPA 2ANYA 3CS0A 1ELEE 1DPOA 3EA9A 2FOGA 3GISB 1GJ9B 3KYFA 3SBKA 1OS8A 4IS5A 1MZAA 3TIUA 1ABIH 1BRBE 3SZEA 3UR9A 1Z8RA 2RCEA 4DIIH 5IYTA 3BEIB 2ZC9H 5C94A 3OE7D 1O3LA 1ELGA 1GGDC 3GCOA 1SMFE 2HRVA 1CBWC 4Y7AA 4Y10E 1LDTT 4YM9A 2J4IA 3G01A 3PMHB 3AW0A 1DS2E 2UWLA 5A09A 1LQEA 1LPGB 1O3HA 3NXPA 8GCHF 3ZVCA 3A7VA 1G30B 1V2JT 2ALPA 4KTUA 1SGRE 2G4UA 1BT7A 3LT3A 2W3IA 1V2OT 2J92A 2FDAA 4FU7A 1GMHG 4THNH 2P59A 2BD4A 1KMHB 2KZ4A 1GVLA 3RC6A 2VB0A 4B71A 2UWPA 2VGCB 1C5SA 1GHYH 2VIQA 1MABB 1GBJA 1F92A 1NU7B 1NY22 3A7YA 3T27A 1NRSH 2XWAA 2WUBA 5DK1A 3U1IB 1CVWH 2VVUA 1IQIA 2OP9A 2AS9A 4XSKU 1O3PB 1J15A 3FOAA 1L2EA 4LOYH 3F1SB 2EEKA 2ZFFH 2Y80A 4KTCA 2ODQA 1SGQE 4MVNA 2Z9IA 1BOQA 3RXQA 3ZVEA 5C0UA 1ELBA 3FP8E 1A5HA 4XRNA 1AGJA 2ANMH 1WQSA 1TB6H 3UUZA 1GHBF 1OYQA 2XC0A 3EE7A 3FFGA 1C1PA 5DJ7A 3S9AA 5A8XA 1QQUA 3ZVDA 1EJMA 2V3HH 2A31A 4CR9A 1AVGH 2QXHA 3FP7E 2ZHFH 2JDID 5K7RA 1GVKB 1ZMLA 2PP6A 4B1TA 3BEFB 6ESTA 1DICA 3D23A 4I8KA 3MOCA 1ANEA 1VZQH 3JZ1B 1QL9A 5KEDA 1BUIA 2VWMA 2P8OB 2AMDA 1NRNH 2Z9JA 3PMJA 3A83A 3SV9A 4MQAA 4OGXA 2GCTB 7KMEH 4Y8XA 1QA0A 4R8TB 2F9UA 4WF8A 4JZ1A 1AI8H 4DW2U 3DUXH 5E0JA 1EAUA 4B6FA 3T62A 3LGTA 2NU2E 2F9OA 3GDUA 1BHXF 2O8LA 4ACAA 2HPQH 4ZKRU 1EZQA 5BPEA 5FBIA 1O2JA 1ID5H 1AZZA 1FPHH 3KCGH 4GHTA 1SBWA 1QB9A 2ZQ1A 2STAE 1FY4A 3PTBA 1UTMA 5AFYH 3PO1C 2AYWA 1O5GH 2QF3A 2J98B 3SNEA 4K8YA 2HLDD 4FUHA 2QAAA 1QFKH 4ZHLU 1C4V2 1FJSA 1SHYA 3GY8A 4K2YA 4Y6DA 5EPNA 2Z3CA 4H6SB 1FDPA 1W11U 2VJ1A 1S82A 3QGJA 3WW7A 2C93B 3WY8A 4U30A 3UQVA 1IQJA 1V2LT 3EGKH 5EG4A 4CRCA 4M7GA 1YBWA 2BY8X 3OEHD 3LGYA 4ZHAA 4XBDA 1DWCH 1DDJA 1P01A 1ZTKA 1SQOA 1N8OC 2G4TA 3QK1A 4RT1A 4YLQH 1Y3UA 3ZZ9A 4KTSA 4R0IA 1AZ8A 1LPZB 1NFUA 1O38A 3O8BA 1HLTH 1UJ1A 1FN6A 1TBRH 3MH7A 1QJ6B 1Z7KA 2A2XH 1RJXB 4D76A 3VPKA 1VITG 3ZVGA 3OAAD 1ANCA 4WMDA 5FPSA 2QXIA 1CGIE 1O5AB 4LK4A 1EZXC 1OWDA 1PQAA 3VB6A 2Y81A 1ELFA 2TGTA 2GMTB 3M5LA 4IGDA 2TGPZ 5C1XA 3MO6A 1KY9A 1K1LA 3RLYH 2RA0A 1ETTH 4H6TA 4A7IB 1GMHF 1C4U2 5A2MH 1FY3A 1UO6A 2JH0D 5KECA 2BOKA 1G2LA 2WPKS 1K2I1 1LTOA 3MYWA 5HMAA 1LVMA 3RDZA 3DFJA 3GY7A 3ATWA 3HATH 1DWBH 1HJAC 1DY8A 1O3EA 4X6OA 2JETC 1THSH 3RXGA 4UFDH 1BTWA 1YPGH 2LELA 1AWHB 2CF9H 1OP2A 3SQHE 5JYIA 1YF4A 2ZGXH 1O3AA 2H5DA 3N7OA 2GX4A 5E8EH 3WWBA 1G36A 3LOXA 3RP2A 2QY0B 2FP7B 1TGSZ 2P93A 1GCTB 4YT7H 4LXBH 1OSSA 1C2GA 5GIBA 2ZCKP 1GL1A 4WMEA 2OLGA 1W10U 3ZZ6A 5LGOA 1HAVB 3GCTF 3UNRA 1IHSH 3AW1A 1B7XB 5E0GA 1O2GH 1P2OA 1HAXB 3KIDU 3TH3H 3PROA 2B8OH 2Z6BD 3PM3A 1C2KA 3M35A 3S0NA 2KAIB 3S7HB 2PKAB 3U1JB 3U8RH 5J4SA 1GMDG 3BTQE 2R2MB 2AGEX 5DKMA 4DT4A 3ELAH 2XBWA 3NKKA 1LHFH 2UUKB 1CSOE 3PRDA 2FZZA 4F55A 2AEIH 2ZFSA 3LONA 4Q7ZA 4BAHB 4J1YA 3H09A 1MQ5A 5LH8A 3E90B 5AVDA 4CR5A 2ZKSA 4XD7D 1SR5C 3T2NA 4GAWA 4Y7BA 2FS8A 1C1VH 3ZZCA 1VGCB 2ASUB 2G51A 2OXSA 1HB0B 3Q76A 4DGJA 4AB9A 1VITH 3BG8A 4FUFA 2BY7X 3GICB 1L1NA 1V6DA 3OY5U 1GBDA 2AHME 1MBQA 3P8NA 5GPIB 2XCFA 4I8HA 4AYYB 4K8BA 1INCA 2W7SA 2A4GA 1QBOA 4D8NA 4I7YH 5C5OA 1TNHA 3UR6A 1O3DA 1YPHC 3KGPA 1OXGA 1W13U 4Y0ZE 1BDAA 4NWLA 3RU4D 1EQ9A 3DD2H 2J98A 3P92A 2FOEA 4ZKNU 1NBME 3AAVA 3L33A 4INLA 6CHAC 1ZYOA 1GGDB 4IN1A 1UMAH 4ZUHA 1H8DH 1C5PA 2D1JA 1P11E 4ZXYH 1TA6A 3IWMA 3UIRA 3RXIA 1C9TA 1TGCA 3L3TA 3HK6B 1QBVH 1A0JA 4B76A 2QF4A 3UOPA 1QR3E 1CQQA 3A86A 3GCHB 1XMNB 2Q6FA 3M36A 1K1PA 4Q80A 1J17T 4JMYA 1UTPA 1SLWB 1T8OA 4E06H 1C5VA 4NGAH 4Y8ZA 1W0KD 2GZ8A 4WMFA 2AGIX 2IPHA 1QJ7B 3BTWE 4H4FA 3U69H 2ZHDA 3TJNA 2NU3E 2G00A 5SGAE 3ZYDA 1OOKB 4FVBA 1WQVH 4I32A 1F0UA 3AAUA 1RRKA 4D7GA 4E7NA 5DP6A 1RTFB 1SVPA 5KGOA 1ZSKA 1HPGA 3RC5A 2ZZUH 1TPAE 1JIMA 2RDEA 3RU4E 1KYNA 4I86A 4PROA 1BA8B 1L4DA 3TGIE 4X2YA 1AKSA 4UFFH 4A1TA 4TPIZ 1V2QT 1V3XA 2FX4A 2OC0A 1H9IE 3GY6A 1MTNB 4DOQA 1Z1JA 4YZUA 1Z6EA 1VJ9U 7ESTE 1Y5BT 2CV3A 3GCNA 3SNDA 1ELVA 2PKSC 1TX8A 2BY6X 5E0HA 5FPTA 1QZ8A 1G3EA 1HYLA 1MQ6A 1KDQA 1TYNA 2BXUH 3SU0A 4BXSA 2IPQX 3E3TA 5A8ZA 1V2TT 4RT0A 1MKXK 3B8JA 4DIHH 2PGQB 1D3DB 2OBOA 5JPMH 4X2VA 3UREA 2SGEE 1T4UH 3M7QA 3SQEE 4IC5A 3MNXA 4BNRA 5E2OA 1QL8A 2FTLE 6GCHF 1HAOH 1FLEE 5H4IB 1P57B 1LVBA 3LGUA 2TBSA 1AHTH 3SUEA 2F9BH 2FPZA 2BDIA 1BTZA 4BAQB 1O3MA 3URCA 3GOVB 2R2WU 1DWDH 3TK9A 2A2QH 2VGCC 2VWLA 4FXGH 3BTHE 1XVOA 4MPVA 1DFPA 3QX5H 1DT2A 3H5CB 2H1UA 1T8LA 3GY2A 2PGBB 1P2IA 2OC1A 5EGMA 3M7TA 4OS1A 3BIUH 1W2KH 2NWNA 3SNAA 1LHGH 4JZFH 1QA7A 1WV7H 2TGDA 1MAXA 3MTYA 4MDSA 4NIVA 3UPEA 1DUEA 4ZXXH 4BOHA 2Z94A 1LQDB 4KGAA 2ZDMA 2RA3A 4QT8C 1UW7A 3SUGA 1HAPH 1YPLH 1DM4B 1K1MA 1RD3B 2ZU4A 3BTGE 2K1QA 1MU8B 1PYTC 1GHZA 3P8FA 3RXPA 1C2MA 2EI8A 4F48B 1DX5M 1Q3XA 1MH0A 4FUEA 1ZGIA 2HGTH 3RUOA 3V3MA 4OS6A 3F0OA 1E35B 5EQSA 3SHCH 5JB8S 1IQHA 2A5AA 3IITA 4AFZA 1GI6A 4NA9H 1AB9C 2VIDA 1ANBA 4AGKA 2XC4A 4AG2A 3URDA 2AIPA 1TNKA 3SI3H 1SKYE 4LZ4B 1ETRH 1NRPH 4NG9H 3MU4A 3F9HA 5TCCA 1EPTC 4ABAA 4MNWA 2PUXB 4WXIA 1UK2A 3LGVA 2OK5A 1O5DH 4TYDA 5J4QA 1F0SA 1YPMH 1GHWH 1O2HA 2FWWA 3MO9A 5FCKA 2QCYA 2WYGA 1CHGA 1P06A 3KQ5A 1IHTH 3RXTA 4CH8B 1PPCE 3U9AH 3Q3YA 1EATA 1NROH 3U28C 1TQ7B 3UOUA 2VWNA 4MG3A 3ZVFA 2FOBA 5PTPA 4HGCA 1ZTLA 1OWEA 4I8LA 5TCAA 3A80A 3T26A 2YNAA 1O32A 1Q31A 1XUHA 4DVAU 2VH0A 3W1EA 3RXDA 5AHGH 1GJ5H 2BM2A 1E1RD 3TVJB 3VEQB 1P2QA 4TT3D 2PLXA 3HGNA 1TMUH 1GVZA 3P17H 2SGDE 3NZIA 1O33A 3QWCH 2V35A 5C2ZA 1SSXA 1G3BA 2C8WB 2QC2A 2OINA 2THFB 3E16B 1ZSJA 2PKAA 3HKIB 5FX6A 5EODA 5EU8A 4GUXA 4I8JA 1IOEA 1ZJKA 4FUIA 3EA7A 3RXOA 1JOUB 1W14U 1NESE 1DXPA 2QA9E 5EW1H 2A1DB 3T29A 1GBHA 5FL7D 5I46H 3BTFE 1LMWB 1D4PB 1G3DA 1Y5AT 5DG6A 1TNLA 5GCHF 4F49A 1TGTA 1QQ4A 1O2OA 1BMNH 1NU9A 1C2EA 2ZU3A 1XXFA 4CBNA 2ZCHP 1ZLRA 2OC8A 2QGRA 2KCPA 1XUFA 2ZP0H 3SU2A 2ZPSA 3SU1A 1A46H 1AUTC 3S9CA 4YLUA 3A81A 3QGNB 1OKXA 4GCHF 2XBXA 1YP9A 3RMLH 3S69A 3BG4B 2QF5A 4WXVA 1N6XA 3I77A 2HVYB 1C5MD 2BLQA 3OTPA 3TNSA 2OQUA 4X6NA 1UHBA 3M61U 4CHAC 3D49H 2ZPQA 3C27B 2QF0A 4YOIA 4RKJB 1J9CH 1U6QA 1GBIA 2IJOB 1K22H 4AORA 5HXFA 1P9SA 3STJA 2WPLS 2ZTZA 5T3HA 2CHAB 3SYJA 3GCHC 1GPZA 3UWIA 2FI5E 3A85A 5FBEA 1YY3A 1NPMA 1D3QB 4D9QA 1LCYA 3ATLA 1WTGH 4INHA 5CHAC 3ATKA 1EOJA 3EDXB 1GG6B 5FX5A 1GMCG 2JJ1D 1FPCH 1S83A 2GT8A 3DSOA 2QYIA 3F2FA 2ZWLH 1W7GH 1FXYA 2WV4A 2A4RA 4KP0A 4NZQA 2TRMA 4DG4A 1SLVB 2SGAA 1O5CB 3QLPH 1GBFA 4CRGA 1YC0A 4OS4A 1OX1A 4KKDA 1FY5A 2HPPH 4NIXA 3DCLA 1CT2E 2Z3EA 1ACBE 3GY5A 1O2TA 2QIQA 2BX3A 2HNTE 1F7ZA 4ABJA 1PPGE 4MTBA 1K1OA 1O0DH 2WPDD 2BVXH 2FO9A 5JBCS 5A8YA 1SGDE 5EJ1A 3VB3A 1P3CA 3VGCB 1HBTH 3AASA 1OWIA 1EXFA 2GMTC 4FUJA 3A8BA 1TOCB 1ARBA 1UCYE 3QUMP 1O3JA 5LPFA 2NU0E 2PUQH 3A7WA 3LJJA 2ZHWH 3TJOA 1BTPA 4VGCB 1G3CA 2W7UA 1BRUP 1V2VT 1Y3YA 1J8AA 1AFQB 3KYGA 2JJ2D 3O8CA 4MPXA 1BTXA 1XXDA 1A1RA 1RFNA 4Y8YA 1QRXA 1TNJA 1WTHD 1HFDA 4B73A 4ABIA 3PTNA 2W3KA 2ZU2A 5T6FA 4BANB 1O2PA 1EAXA 3P70B 1KDQB 1QRWA 4I31A 2ALVA 4X1SU 4AC9A 1BITA 1V2RT 3SU5A 3A88A 1O30A 1HGTH 2EI6A 1OHHD 2C90B 3LGWA 1ELTA 4X6PA 1D3PB 4U2WA 3C1KA 1TPOA 1P04A 2FOFA 1O2QA 2B9LA 3PMAB 2BY9X 1COWD 2YMSC 3TU7H 2I6QA 1ELCA 5HM9A 1SB1H 1P2JA 3TH2H 1EPTA 8GCHG 1TBZH 1S6HA 5C3NA 1SGIB 1W0ZU 3EA8A 4K69A 1DLKB 2PW8H 3V13A 4IW4E 4CREA 1RTLA 3A7ZA 3SHAH 1NN6A 1O2SA 1TIOA 1C1OA 5HYOA 3OFND 4TSFD 3RMOH 1F2SE 1P2MA 1MCVA 3MNCA 1HUTH 4AZ2B 1N1LA 2TIOA 3BSQA 3M3SA 2BDGA 2BDYA 2SNVA 4ASHA 4NSVA 2VVCA 1GHVH 1MZDA 4Y0YE 4IMZA 2ODPA 5GWZA 3UNSA 1S6FA 4WH8A 1OP8A 3E8LA 2Q6GA 1D6RA 2HOBA 3NUMA 3PWCA 4X1NU 5L30H 4YESB 4Q4LA 1P10A 5FPYA 3W95A 1UTQA 1O2XA 1O34A 4E7RG 4TY6A 4F4OC 4IBLH 1W7XH 1JIRA 3V12A 4FU9A 1WBGB 2CGAA 3SJOA 4AGJA 1GDUA 1C1WH 2GZ7A 4FUDA 1GI4A 1GHBG 3CP7A 5DP4A 1UVOA 3SN8A 4NCYA 2CN0H 1D6WA 2D26C 1EAWA 1CO7E 2DUCA 2P94A 2QXJA 3T28A 3A7XA 4ABEA 1Y3VA 2C8XB 4BTTB 5FCRA 4ZKSU 5GDSH 1FY1A 2GTBA 2PTNA 3H7OA 4O03A 4O3UA 1XKBC 1ZTJA 1Z6JH 4XFQA 1RTKA 1F5KU 1CA8B 2Z9GA 1TGNA 4WY3A 1FIZA 1FZZA 2J94A 1EJNA 4XBBA 5F53A 5CE1A 1SGFG 4K3JA 1FIWA 2J95A 3ZV9A 1EOLA 3BEUA 1OYTH 4MNXA 4BXWA 3NK8A 1PQ7A 2V7QD 2O8WA 1ZRKA 3M5OA 2AH4X 3NCLA 2BDHA 1GJ4H 1MD7A 1O35A 2QXGA 1C2IA 3TPIZ 3U8TH 2BQ6B 4HI3A 3MQKC 4DURA 4ESTE 1QJ1B 1ORFA 1FN8A 1DE7H 5DP8A 1DY9A 1QB6A 2NU4E 1KXEA
chains in the Genus database with same CATH topology
2BD9A 3K65B 1TMBH 1SGCA 2GP9B 3ATIA 3RLWH 3FAOA 4AG1A 3P95A 2CJIA 1V2UT 3FZDA 1ZZZA 3OYPA 1MBMA 2AIQA 1KLIH 1C1SA 1O2LA 1FQ3A 1C1NA 2VIOA 5JBAS 5JBTA 2HWLB 1C4Y2 1T32A 2PSYA 3MU0A 3SV8A 6CHAB 5DGJA 3Q00A 2XC5A 1L1JA 1TPPA 3LJOA 3TJUA 4OS7A 1CT4E 3MWIU 2BY5X 7GCHG 4AFQA 3BG4C 3DHKH 3ZZ5A 2H9EH 4IMQA 1C2FA 1LVYA 1QTFA 2J2UA 1F5RA 1AD8H 5L6NH 2VH6A 3PV4A 4YOGA 1DVAH 1ZMNA 1X7AC 9ESTA 2F9PA 3QZQA 4AOQA 2BHGA 2WINI 1SGEE 2ZEBA 1HAVA 2CHAC 3OU0A 3F9GA 3QDZB 2Z9LA 2ZDLA 1YCPK 3NPSA 3ZZ7A 1HAYB 2AMQA 3DFLA 3A89A 3ZVBA 1MU6B 1THRH 2ZDNA 1WSSH 1O3FA 1GBEA 2ZU1A 2B7DH 1BBRK 2G55A 1O3BA 3U98H 3KN2A 4WWYA 2AFQB 1MTVA 1Y8TA 2GVFA 1A4WH 4H42U 4ZROA 1TWXB 3IG6B 1TX6A 2Z9KA 4NA8A 4TWYA 1QRZA 4X1QU 1AE8H 4K1SA 4DCDA 1QBNA 2P95A 3FVFB 1OWJA 1J14A 1VR1H 5EXLA 5GCHG 5BRRE 1B0EA 2V3OH 1O2MA 3FP6E 4WVPE 2A5KA 4Y11E 3ESTA 4MLFB 1GJDB 1DOJA 1NRQH 4JYTA 3FZZA 2PKSB 3ODFA 1C5TA 5I25A 1E37B 1S85A 3FANA 2J9NA 2FYQA 4K5ZA 5DO4H 4UEHH 1GI0A 1UTNA 1O3KA 1BB0B 2XRCA 3L6PA 2BD3A 3VGCC 5E2PA 3QTOH 1EZUC 1EKBB 4GPGA 1SPJA 1E34B 1XX9A 2R0LA 3MNSA 1BIOA 5FXLA 1TALA 4YO9A 1Y59T 4VGCC 3O8RA 1K1IA 3GDVA 1AFQC 3UFAA 3NWUA 4A1VA 2FXRA 3RXMA 1CE5A 1C2HA 1V2PT 1LPKB 3K6YA 3UWJH 1LO6A 1TLDA 2BQWB 3RM2H 3SU6A 3HPTB 2VWOA 1C1RA 2BLVA 2GZ9A 3LC3A 3W94A 1UHBB 4UD9H 1IQEA 1QHRB 3B23B 1RGQA 5CHAB 4MNYA 4Z0KA 3BN9A 1GBLA 1NT1A 4X8VH 4CRDA 1GDNA 3SOSA 1YGCH 1A0LA 3RXBA 1NFWA 2FOAA 2GGVB 1GI1A 1Y3WA 4X8SH 2XNIA 4ZHMU 3ZVAA 4ABBA 1TONA 5DP9A 2J38A 1T7CA 3RXUA 3PLKA 4TY7A 1NRRH 1SLUB 3B9FH 1TPSA 1YYY1 1MD8A 5TJXA 5HGGA 5C5NA 1DSTA 4K1EA 1C5YB 1ZJDA 2XWBI 4GHQA 5EOKA 3QTVH 1TRYA 3TNTA 1UVPA 1C2JA 2VIVA 4NWKA 2BZ6H 3OSYA 2ZNKH 1O2IA 1UTLM 1QY6A 4HZHA 3ZZ8A 4SGAE 3RXSA 1MKXH 1P2KA 1ZMJA 4D7FA 2OD3B 3DA9B 1HAHH 1AB9B 3A82A 3A8CA 1ZRBA 4INKA 1HRTH 3MMGA 4ISNA 3K9XB 4IC6A 5F8XA 2XCNA 1F0TA 1PJPA 2FTMA 2OBQA 1UVUH 3PYHA 1G2MA 2ZFQH 4NSYA 1GI2A 3V0XA 4MNVA 1EPTB 1QURH 1GBBA 3GY4A 3MU1A 1SGFA 1MKWK 4NIYA 1IQFA 4ZH8A 4XOJA 4JK6A 4ZKOU 3ZV8A 1W8BH 3TK5A 1C2DA 1OWHA 2YNBA 1ZSLA 4B74A 2AMPA 1RIWC 3SU4A 1QB1A 2G81E 3KHVA 2OTVA 1ARCA 3SNCA 1O5BB 5L2ZH 2ZFPH 3LH1A 4OS2A 5DP3A 1A61H 4CHAB 4A5TS 1O2ZA 1GBCA 1LHCH 2ZTYA 3DT0H 2O8UA 3VXEH 3SGBE 1SFQB 2Y5GA 1GI9B 1SG8B 2UUFB 2Y7XA 1KIGH 5LPEA 1BCUH 1O2YA 2Y7ZA 4FUBA 1A2CH 3SV6A 5EQRA 1YKTA 3MH5A 1GJBB 1KXAA 2FS9A 2FOHA 3STIA 3TLOA 2OC7A 4A1XA 2I6SA 3E6PH 1KXBA 1P03A 6GCHG 2Y6TA 1PPFE 4NFEA 2KAIA 1HIAB 2WPHS 3SU3A 1IAUA 2BD5A 2STBE 4FU8A 2Y5FA 1GMCF 2JH6D 2O8MA 1O2UA 2ZU5A 4I33A 3T5FH 1T4VH 1AU8A 1HNEE 1Z1IA 2Q6DA 1PPHE 1AY6H 1TRMA 2HALA 4WJG2 1O39A 1BMLA 2PSXA 4CRBA 2FM2A 1LKBA 1FUJA 1MCTA 5JBBS 3GYLB 3TGJE 1GI3A 4J2YB 2BVSH 4ABHA 5EXNA 3BV9B 1IQMA 1DWEH 2ZGJA 4YT6H 2WPMS 4X1RU 4ISIH 2BZAA 3H7TA 3TITA 2BYAX 1YM0A 5DPAA 2ZGBH 1H9LB 1PYTD 4B2CA 4RKOB 1ELDE 5HM2A 2W26A 1LHEH 4AB8A 3F68H 4Z6AH 3K6ZA 1ZPBA 1CBWB 2A4QA 2F3CE 2LNCA 1K21H 2BTCE 5FHTA 3KF2A 3UQOA 2PHBA 3RXFA 4O9VA 3MHWU 5T6DA 1CU1A 1O3OA 1GI7B 1ZR0A 4JCNA 1GHAG 1ETSH 1S84A 2A0QB 2ILNA 4OGYA 1HXEH 1V2KT 2ZFRH 3P6ZB 3QZRA 3A87A 1GG6C 2ZGHA 2ESTE 4DJZB 1ZHMA 2EC9H 1J16A 1P0SH 1GHXH 1YPEH 5EQQA 1HJ8A 2EI7A 1H9HE 3OY6U 1P2NA 3RXCA 3PMBB 1TABE 3Q77A 2V0BA 1BTUA 1DITH 1O2VA 1TBQH 1ELAA 3TGKE 2SGFE 3RMMH 4NFFA 4JZEH 1VJAU 1SI5H 2G5NA 9LPRA 1AMHA 1O2KA 2A7HA 2O8TA 2XW9A 1ZOMA 1ZPZA 2A5IA 3TH4H 1WUNH 2AGGX 5F03A 1Z8IB 3BTTE 3PB1E 2YOLA 4SGBE 1C5RA 1LHDH 1QNJA 2EA3A 1YPKH 1Z8GA 1AO5A 2OCVB 3RXRA 3RXJA 3M37A 1BJVA 4BTUB 2RDLA 2DE8A 1CGJE 5CMXH 4B2AA 2G5VA 2PWXA 3BTKE 2Z3DA 2BDAA 1NC6A 2ZFTA 1O3NA 2BD8A 1K1JA 3LU9B 1FY8E 1O37A 2ZDKA 3S7KB 2P8OC 3HKJB 2B0FA 1TX7A 4ABDA 1HXFH 1YLDA 1TA2A 2BB4A 1WAYB 1MTWA 5AFZH 3MO3A 1A3BH 4Y79A 2O9QA 2Y5HA 5G4BA 1IQNA 1THPB 1HJ9A 2HNTF 3EQ0H 3LGIA 4K60A 3SV7A 2JKHA 1SGTA 5B6OA 1O5FH 4UONA 1JRTA 1SGYE 2ZDVH 8LPRA 3R3GB 1W0YH 3LDXH 1EZSC 2GV6A 1T8NA 3A84A 1V2ST 2F91A 2FESH 2VIPA 3HK3B 1D9IA 3LC5A 5AF9H 1O5EH 4U32A 1LVOA 1O3CA 1DUAA 1XKAC 3KQBA 1VCWA 1G9IE 7GCHF 2FI4E 2LPRA 4ABGA 1F5LA 4X6MA 1G37A 3U8OH 4XBCA 2P3TB 1G32B 1K9OE 1BRAA 1SFIA 3BTDE 1H4WA 1YCPH 1N6YA 2ZCLP 5C20A 1BTHH 2AERH 2TPIZ 1GBTA 2C8ZB 1ESTA 3D62A 1UTKA 4LZ1H 2CMYA 1NTPA 2ZHQH 4B75A 1Q2WA 1AIXH 3GCTG 3M3VA 4AN7A 2A4OA 1ZGVA 1C5NH 1C5XB 1AVXA 1NO9H 1L0ZA 2OQ5A 2GT7A 1C5WB 4JK5A 5A0AE 1WU1A 1P8VC 2H9TH 3E0PB 1B0FA 1S5SA 2ZI2H 1GJ8B 1GMDF 1KSNA 2GCTC 4ABFA 1K28D 1OPHB 4YOJA 3A8DA 4I8GA 5ESTE 1Z71A 1LKAA 1L4ZA 2Q1JA 2ZTXA 2Y82A 1JMOH 1A3EH 3VB7A 1SGNE 2UUJB 1GBKA 1O36A 2FMJA 1Y5UT 1YCPM 1ESAA 4CRAA 1BBRE 3SW2B 8ESTE 2VIWA 2RG3A 4XDEA 8KME2 1GJ6A 5GXPA 5FAHA 3PO1B 2VU8E 5IDKA 1OWKA 2BVRH 1D3TB 3OX7U 1C5LH 2P3FH 5DP7A 5LPRA 1KXCA 3ZZ3A 1P02A 1ANDA 2UUYA 4UFEH 1V2NT 3KL6A 2BQ7B 1GCTC 3SJ9A 2FOMB 1P05A 1TMTH 3ZZDA 1OP0A 2BLWA 2UWOA 1CA0B 1C5UA 1TFXA 1HAGE 3M3TA 2SGQE 1M9UA 3S9BA 2GCHG 5F6MA 4NIWA 3E1XB 2ULLA 3F6UH 2GDEH 2WPJS 3VB4A 1N8OB 1ZHRA 1BRCE 3KQCA 1DXWA 1RS0A 1AWFH 1XM1A 1ESBA 1Z8JB 2PFEA 5C1UA 3RU4T 1KXDA 3MH4A 3E91A 1NFYA 3SO3A 2HVXA 3MI4A 1TAWA 1UTJA 3LPRA 5F8TA 4AFSA 1AKSB 1XUJA 2H5CA 3BF6H 4Y76A 3R0FA 3UNQA 1S0RA 3RM0H 3EYDA 1P12E 4AYVB 1FI8A 3CS7A 2BMGB 1W3CA 1XVMA 1F0RA 2SFAA 2WV5A 1MAYA 1GHAF 1FNIA 1E0FD 4ZAEA 4TWWA 3VFEA 3GY3A 1VGCC 4GVUA 2FLBH 2G52A 3E0NB 4Q7XA 3Q3XA 2XYAA 2CF8H 2JH5D 1NZQH 1EP6A 2A7CA 2C3SA 3ZZBA 2JETB 3M5NA 3RXEA 2GKVE 1T31A 1NS3A 4B2BA 2FIRH 5GJ4B 1AVWA 3RXVA 1A0HB 1GI8B 1EAIA 1VCPA 4DY7B 4ISLA 3SI4H 5EPYA 3QN7A 1BMAA 2R0KA 5EW2H 2GD4B 1PPBH 3I78A 1C5ZB 2BOHB 1GJ7B 3LIWA 1BQYA 3LKWA 3PLPA 2OUAA 4JYVH 4HFPB 1E38B 1FMGA 1H1BA 2ZDAH 1AQ7A 1GI5A 2H9HA 1CHOF 3CENA 1PFXC 2XBVA 1EJAA 1KLJH 2R9PA 1EX3A 1UK4A 2BX4A 3SJIA 1MTSA 2FLRH 5DP5A 3P8GA 2R3YA 4UFGH 1UVSH 1A7SA 2GDDA 1XUKA 1WCZA 2P16A 3SV2H 3ZZAA 3BIVH 1VITF 3ATMA 1AN1E 2GV7A 4GSOA 1O31A 1BHXB 4YTAA 1GJAB 4CH2B 3SUDA 1P09A 2F9VA 1HCGA 2ANKH 4FVDA 1GCDA 4IN2A 3ITIA 3ZZ4A 3P8OA 3ZYEA 3HGPA 1GBAA 1IQLA 1UCYH 1SL3A 1V2MT 3V7TA 3Q3KA 2C8YB 1EASA 4BAKB 4Q7YA 3PLBA 1JXPA 2SNWA 5ABWA 1BBRH 2CXVA 1TQ0B 2ZQ2A 2ZIQH 4Y71A 1HDTH 3RXAA 2W5EA 2WPIS 1HIAA 1SLXB 2G8TA 1C1UH 3M7UA 5ETXA 1YPJH 3UY9A 4X8TH 1L1GA 1Y3XA 1EP5A 2D2DA 1WOFA 1TRNA 4FUCA 4NZLA 2PV9B 4JZDH 3SJ8A 3KQEA 3I29A 1W12U 1KLTA 2HNTC 1AFEH 1TOMH 3ENSB 1SHHB 2XXLA 1MUEB 1BZXE 3ODDA 3UTUH 3SNBA 1GL0E 1HAIH 1A5IA 2FEQH 3KEEA 4TPYA 1KXFA 2XBYA 3K2UA 1TNGA 3SJKA 1MTUA 4JZIA 4A6LA 4CBOA 2ZA5A 1EB1H 2BDCA 4AX9H 1C1QA 2IOTA 2F9NA 1K1NA 1NFXA 1PQ8A 1TE0A 1FAKH 2FOCA 1CGHA 2C4FH 2BD7A 4JYUH 1XUIA 1PQ5A 1VCQA 5A0BA 2ANWA 3OTJE 2VVVA 4K1TA 1JWTA 1UVTH 1P3EA 1RIWB 2IN2A 3PWBA 3RXHA 2D8WA 4X2WA 7LPRA 2BD2A 1QIXB 2Z7FE 4ISOA 4X2XA 1UCYK 3TJVA 4XE4A 2ZECA 2H6MA 2QN5T 5F8ZA 1O3IA 3KQDA 2ZPRA 4ISHH 1ZHPA 4X8UH 2M5TA 4MPUA 1P9UA 5ESBA 3MH6A 1FONA 2QV1A 1A5GH 1GBMA 3A7TA 4ZMAH 5L2YH 1O2WA 3MU5A 4GCHG 2J34A 4U01A 5K0HA 2WUCA 4BAOB 1ABJH 1PPZA 3F9FA 1SC8U 1MTNC 1DLEA 1C5QA 2B5TB 4KELA 3GYMA 3SZNA 4FUGA 4BAMB 5A0CA 4UDWH 1C1MA 1QGFA 4MPWA 1MKWH 2PR3A 6LPRA 1CHOG 2P3UB 2GCHF 4NA7A 1RXPA 4HTCH 2ZGCA 4X1PU 1SOTA 5EXMA 1SOZA 2H2ZA 1IQKA 5JDUB 3JZ2B 4GLYA 2A45B 1GDQA 1HV7A 1XUGA 1V2WT 3M5MA 3D65E 1HJAB 3MFJA 1NM6A 4OS5A 2VNTA 3LH3A 1H8IH 4O97A 1DANH 4A92A 1IQGA 1WYKA 3EE0B 3GDSA 4CRFA 1YPHE 2ZO3H 2V6NA 3RMNH 2NU1E 2VINA 2ZF0H 1PPEE 1E36B 5JB9S 3RXKA 2ZHEH 2FI3E 2A32A 3AVZA 3MNBA 4O3TA 1AUJA 4UE7H 2WYJA 1BMMH 3T25A 1SQTA 5C67A 1JBUH 1SQAA 4RSPA 2TGAA 1BTYA 3TK6A 2HLCA 1BJUA 1FAXA 2DE9A 2SGPE 1C1TA 1QL7A 2R3UA 1O2RA 2ODYB 1GWAA 1SGPE 1C2LA 1CA0C 4RN6A 1O2NA 1TNIA 1S0QA 1FV9A 3BTME 1O3GA 3RC4A 1YLCA 2FX6A 3SGAE 3SORA 1KTSB 2BXTH 3VXFH 4Q2KA 2PTCE 1S81A 4E05H 1EUFA 2FYRA 3F9EA 4AFUA 1KTTB 4X0WU 1B5GH 1CT0E 1T8MA 3VB5A 3O8DA 1GJCB 1HAZB 1UTOA 3KNXA 1UK3A 1EB2A 1AE5A 1JRSA 1C5OH 1C9PA 2ZG0H 3EAJA 4D9RA 2FODA 3BTEE 1DSUA 2A7JA 1MMJN 1ZPCA 3RXLA 1TGBA 3SUFA 3MU8A 4WH6A 4DT7B 4BTIB 3SGQE 2F83A 2BLOA 5C1YA 3QO6A 2XTTB 3A8AA 2BDBA 5T6GA 1QCPA