1OWTA

Structure of the alzheimer's disease amyloid precursor protein copper binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
SDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title Structure of the Alzheimer's Disease Amyloid Precursor Protein Copper Binding Domain. A REGULATOR OF NEURONAL COPPER HOMEOSTASIS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 1owtA00
3KTMA 1OWTA 2FK1A 2FMAA 4PWQA 2FK2A 2FK3A 2FKLA 2M05A 2FJZA
chains in the Genus database with same CATH superfamily
1TWHA 5F9LA 1KEEA 5KX5F 1I50A 1Y1WG 4LF6H 4JV0A 3Q8PB 3IN5A 2FPGB 3LMLA 3SI8A 1IOVA 1C3OA 5BMVF 4YR3A 3VPCA 3RB3A 3FDSA 4ECTA 3PN1A 3DF7A 5EWFA 5GONF 4EEYA 4J9LA 1M7JA 1O75A 2GLTA 4Q8FA 2VUMG 4IWYA 4XYLB 4YJ3F 5FLXW 2ZM6H 3BJYA 4FM9A 2ZDHA 3WNZA 3BQ2A 1AUXA 4EEQA 3E5NA 5T14A 5IT9W 2VR1A 4RUAA 1M0TA 4DR1H 3TQ1A 4AQYH 1FKAH 5JH7F 3R5HA 4J0MA 4O4LF 5C44G 3H40A 4HYKA 3PW4A 2UXDH 2R7ZA 1UC9A 2M05A 1WSCA 4Q43A 4EGQA 4JI5H 5KT4A 2YZGA 4Q44A 2FE3A 4ME6A 4A2AA 1I94H 1OWTA 4EGJA 3H0GA 5KFYA 5EDWA 4FBUA 3H3VH 2WB1A 5DGBA 1VBGA 3RBEA 1S0MA 4E4TA 2Q2UA 5C8YF 5KFBA 3QFFA 3Q8RB 2XC9A 3RAQA 3EYYA 4R8UB 4DUYH 4MV4A 3GTOA 5EWGA 2XCPA 3EPIA 4JV5H 2HVSA 2W6OA 3KAKA 4HNVA 2V4QA 2ASLA 1Y1WA 4TV9F 2R93A 1KJQA 4G3IA 4DLKA 2E5LH 1RJRA 2Y0SA 2RDJA 1KJ8A 4J9SA 3H4DA 2YL2A 4QW8A 4OX9H 1L2ZA 2JEFA 4ETSA 2DWCA 2CQYA 4EYIB 5KFUA 3U9TA 3V6HA 2VUMA 2CW8A 2VOBA 4MV1A 1JDBB 3N6XA 4A3GG 1XMOH 2WTFA 1E4EB 1A9XA 5D1OB 1CQIB 3GTJA 2J6UA 1IOWA 2FK1A 4IRCA 1JLLB 3ETHA 2O03A 1GYFA 3T1YH 4X66H 3V4SA 4QWDA 1E4FT 4MV6A 4J9PA 4O4HF 3T1HH 3JRXA 4RNNA 4LF5H 4EG0A 5IWAH 4UCOA 3CQZA 1HR0H 4MA0A 1IBMH 1R9TA 2R7KA 2DPIA 1N33H 2VQFH 4BXXG 4HNTA 3RJ0A 5BR8H 5FJ8G 3MJFA 2Q2TA 4QWAA 3N41B 2JA6G 3OHBA 4RZQA 2MCTA 2FMAA 4QW9A 3I4MG 5C4XG 4A3IG 2C2EA 3OSNA 5A2QW 4JI8H 3I12A 2JEIA 5KG7A 4JI0H 3N43B 3GIPA 1ZQ7A 5FPRA 3RB6A 3H4BA 4F4YA 2PN1A 4GKKH 4K0KH 4TQSA 1BNCA 4QWBA 5JVDF 1N48A 3HOVG 4J9OA 4XX0B 3BQ1A 2C22A 2XCLA 5L9XA 2WDTA 4DL3A 1EHIA 3L2PA 4A3MG 2W9CA 5EZYF 2AGOA 4B3SH 3MFHA 1X9NA 5DQIA 4Y8VB 4ZI7F 3Q2OA 4AYBE 3MR2A 4EBCA 2JA5G 5KFVA 2YYAA 3KHHA 2DIKA 4GC7A 1BJTA 2R92G 1VS0A 2OWOA 4XZ3B 2OLSA 2IBKA 1CQJB 1UC8A 1GSOA 2VPQA 4YAKB 5L1IA 4DV1H 3R5XA 1ZETA 1N56A 3I4NG 5IYCG 2BQUA 2VUGA 3GILA 2QK4A 3HOXG 3HOWG 1VKZA 2SCUB 4DR3H 5KT7A 2XIGA 4DL7A 1S03G 5KG4A 2R7MA 3JSNA 3HKZA 4HR7A 3L4KA 3NGDA 1S10A 2R8KA 1N36H 5KFQA 4U7CA 4RNOA 3GIKA 1TAEA 5CA1F 1W96A 4DL2A 2JA6A 2UUBH 3K5IA 2VPSA 4UCUA 1DV1A 3RB0A 2R8IA 3ETJA 5DG7A 4RB0A 3VPBA 1WCMG 1ULZA 5D8DA 5DLGA 4LH7A 4J9MA 3UFXB 5CB4F 3T5HA 3M9MB 3OUUA 3Q8QB 1JIHA 2FPPB 4Q0YA 3KHLA 2AU0A 2V4RA 4BY7G 4DV3H 4DR4H 1Z2OX 2VQEH 4DR6H 1SEIA 2WAQE 3JAMW 3G6VA 4JI1H 3RTXA 3PO3G 2V9WA 4UCRA 4RB3C 5KFPA 4O3QA 5K2MA 1GSAA 4U6PA 1CS0A 3G6YA 3T5LA 2R92A 3M9NB 4LSXA 4RUCA 2WE6A 3VPDA 4APMA 2ZJTA 4I4TF 4CC5A 1Y14B 4RB2C 4C5CA 4M9UA 2R8GA 1RJPA 1B6SA 4EBDA 4FS1A 2HVQA 4DR7H 2UVUA 2R84A 5KFHA 2W8KA 2FLPA 3MR3A 2PMZA 5IYDG 3J80W 3GV7B 4ECYA 4LFBH 4YHHH 1S68A 4RAYA 2CZGA 2W7PA 4YY3H 4Q8EA 5KFMA 5LMUH 2YU9A 3IG0A 1W93A 4BWSC 1JKJB 3KXYT 2W9CB 4ECSA 3RB4A 1DV2A 3RF2A 5DQGA 4GC6A 3HOYG 2FKLA 3GTLA 1JDEA 5IP9G 4DV5H 2VQDA 1GO3E 4A3LG 2ALZA 4PWQA 2W6QA 2I87A 1WCMA 4ED7A 4LSAA 3ORRA 1HNXH 3KALA 4ED8A 1K1QA 3GIJA 1DGSA 2ATLA 4JI7H 1RK6A 1SYXB 2YRXA 2PBZA 4I55F 2FP4B 5DG8A 2VA3A 2I80A 3GTMA 3TQTA 1HNZH 3MR5A 1TWGA 2FLNA 3RAXA 4A3CG 3M4IA 1Y1VG 2YRWA 2ZDGA 2R7LA 4R7RA 3EPGA 1GLVA 4DL4A 3KHGA 3PW2A 3RV3A 2DPJA 3HOZG 3LP8A 5KFRA 5CAEB 3Q1KA 4JI3H 2W7OA 3GTQA 4MTEA 1IBKH 5KT2A 1UNNC 2WB1E 1K1SA 4JV1A 1S0OA 1J5EH 2J6TA 4WD3A 3K3PA 1AN7A 4QIWA 2NUAB 3PVXA 5C3EG 5KFIA 4LF9H 2R8JA 4M7EA 3N42B 3G8CA 4NXMH 4JYAH 1S97A 4RB1A 4EFBA 2FJZA 3HBLA 5KFXA 5FD6A 3RIZA 3QZ8A 2GPSA 5KFLA 2UVWA 2Y0SE 2B63G 4KHPH 5HV6A 2F4VH 4O2AF 2R6FA 4MAMA 1Z2PX 1KJ9A 3BAAA 4HNUA 5KFOA 1V4YA 5DG9A 2RGRA 4EBEA 5KFSA 1XDNA 1ZHSA 4FS2A 1PK8A 5KFGA 3MWDA 4JUZA 2C28A 1RK5A 4X62H 4EYHB 3HOUG 2YCHA 2HJWA 2NVYA 3GIIA 1EUCB 3FMAA 2C00A 5KG3A 1Y1VA 2C35B 2IP4A 2QYZA 3JRWA 2W9AA 5KFDA 3VMMA 4ECZA 2J6SA 2UXCH 4J9NA 5IYBG 3F8NA 3KAJA 4LFCH 2R7NA 4TQRA 1TA8A 5L1JA 4F4XA 3GQCA 1T3NA 2UUAH 2YZNA 1K83A 3PO2G 4F50A 4I7HA 4DL6A 2C2DA 2BQ3A 1I7LA 3RBDA 4GLXA 1I6UA 5LL6b 1RJQA 1KBLA 5KT5A 4A3FG 4ZHQF 1DIKA 3BQ0A 2E2IA 1PX2A 1SCUB 4FU0A 5KT3A 3QZ7A 3BABA 3PW0A 3J7AK 3OUZA 5JUMA 1E4GT 2XD4A 2B63A 2W6PA 1B33N 2W9BA 3BA8A 5KG0A 2W6ZA 3T5KA 4A3JG 2UVRA 4F4ZA 2ZDQA 3KTMA 4RZRA 5LP6F 3ORQA 3PR4A 4LF7H 5KFZA 1TWFA 2W6NA 2J9GA 3GIQA 2R87A 4MA5A 2RDIA 2R82A 5KFWA 1N34H 4JI2H 4HQ6A 4L1KA 4DV6H 3GTGA 1M0WA 4UCVA 3R23A 5KT6A 4UCSA 4R8UA 1VBHA 4ECVA 4IR1A 5KFFA 2BQRA 4A3BG 4X64H 4ZOLF 1HNWH 2UXBH 3K3VA 1WR2A 4ECXA 3MFIA 5F9NA 2DLNA 4YJ2F 1EZ1A 5JVLA 4ECQA 3HKZE 4O3NA 2JA5A 5KFJA 4IWXA 4QJFA 5LMNH 4JI4H 4J9QA 1TWAA 5KFKA 3V4ZA 1EYZA 1BGWA 3GV5B 2UVVA 1E4EA 2I8CA 5C5JA 3C0FB 3CVZA 2V59A 2W8LA 2R8HA 2NVXA 2E2HA 2P0AA 1RYRA 4J9KA 4IZOA 2W71A 2R93G 3UQ8A 2HGSA 5IP7G 4A3KG 1M6VA 5KG1A 5KFAA 4MTDA 3FKIG 4BY1G 3PW5A 4C5AA 1IBLH 2JA7G 5FLMG 4JI6H 3RFCA 2HVRA 1KC7A 2AGPA 4J9RA 1RYSA 3OTOH 4YQWA 4DR5H 3AYHB 5KG2A 4DV4H 4LF4H 3LWBA 1BXRA 4I50F 1N32H 3GV8B 4BBSG 5KFCA 5BPHA 2WYOA 4ED2A 2PMZE 2X0SA 4O3RA 2W9BB 5C1PA 3G6XA 4ECUA 2CW7A 2CKZB 4DV0H 5LYJF 4YR0A 4YB8B 5EOYA 5IYZF 5LOVF 4MV9A 3N44B 4RU9A 2RF4A 3KHRA 3GLKA 1B04A 4ED3A 3Q8SB 4X65H 5DGAA 2AQ4A 4NXNH 2XGPA 3N8DA 4YBZB 4LH6A 1VAJA 1KJIA 5FPOA 4O3OA 1S0NA 4BBRG 3R5FA 4DV7H 3MWEA 4ED0A 2VA2A 2JEGA 3HXLA 2GPWA 3JZIA 4A3DG 3JSLA 4NLGA 5BPFA 2W57A 1FVIA 4TUYF 4A3EG 2UU9H 3GIMA 2IMWP 2ASJA 1JX4A 3TIIA 1GSHA 3N40P 3FKIA 3PZPA 4DR2H 2RGVA 2JA7A 4C5BA 3V6KA 1MZBA 4O3SA 4GKJH 2V58A 4IAJA 5KFTA 2W70A 2DZDA 2NU6B 1XMQH 5KFNA 4B3RH 4F4WA 3RGXA 4LFAH 5JQWA 1XNQH 4A93G 1P8LA 4ED1A 1CE8A 2FK3A 2AGQA 1JXLA 5DQHA 5KFEA 2FPIB 5L1LA 5FD5A 1T36A 3HB9A 4C2MA 4QIWE 1S9FA 1B6RA 3L4JA 3MR6A 3BA9A 4TV8F 3J81W 2JEJA 4WBNF 3BG5A 3GTKA 4ECRA 4O3PA 5I47A 4IHJF 5J2UF 4AYBA 4LMYA 2YS6A 5H80A 4A2BA 1TWCA 5KKNB 3OHAA 4DUZH 2ASDA 3GTPA 2NU9B 5LXTF 4PDBA 1V9PA 3SE7A 4QWEA 4IR9A 1ZHQA 4Q45A 1GGOA 3M9OB 5KG6A 2YW2A 4YAJB 4CC6A 1SFOA 1I3QA 1C30A 5C1OA 3V6JA 2BR0A 4B3MH 4YR2A 4IRKA 2NU8B 1AUVA 4DL5A 4RNMA 3RV4A 3PR5B 2UUCH 3GIDA 5KG5A 2NU7B 3RUPA 2HHHH 3RGZA 4O4IF 1A0IA 2PVPA 4UCTA 2FLLA 4MV8A 1I7NA 5EWEA 4ZQIA 3U9SA 2V5AA 4MV3A 5CA0F 4QWCA 2OH2A 2R85A 1V51A 4LF8H 1EUDB 4MV7A 4XYMB 1T94A 2FK2A 4YP3A 2WAQA 2YZMA 2R86A 5L1KA 4ECWA 1Z2NX 2W6MA 3WO1A 3MWMA 3TIGA 4RAZA 2R7ZG 2IA6A 2C2RA 4DV2H 5J2TF 5DLFA 2XGQA 4B3TH 4O2BF 2YS7A 2XCAA 3WO0A 2JA8G 2FB9A 5HBRB 1KJJA 4IRDA 3K5HA 5LA6F 3H0GG 1WH2A 4EFEA 4ED6A 1XNRH 3H20A 4UFZA 5D1OA 4JV2A 5D1PA 3OSPA 3T5JA 2KSWA 1FJGH 3PW7A 4FBTA 3TINA
chains in the Genus database with same CATH topology
3KTMA 1OWTA 2FK1A 2FMAA 4PWQA 2FK2A 2FK3A 2FKLA 2M05A 2FJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTM A;  1OWT A;  2FK1 A;  2FMA A;  4PWQ A;  2FK2 A;  2FK3 A;  2FKL A;  2M05 A;  2FJZ A; 
#chains in the Genus database with same CATH topology
 1TWH A;  5F9L A;  1KEE A;  5KX5 F;  1I50 A;  1Y1W G;  4LF6 H;  4JV0 A;  3Q8P B;  3IN5 A;  2FPG B;  3LML A;  3SI8 A;  1IOV A;  1C3O A;  5BMV F;  4YR3 A;  3VPC A;  3RB3 A;  3FDS A;  4ECT A;  3PN1 A;  3DF7 A;  5EWF A;  5GON F;  4EEY A;  4J9L A;  1M7J A;  1O75 A;  2GLT A;  4Q8F A;  2VUM G;  4IWY A;  4XYL B;  4YJ3 F;  5FLX W;  2ZM6 H;  3BJY A;  4FM9 A;  2ZDH A;  3WNZ A;  3BQ2 A;  1AUX A;  4EEQ A;  3E5N A;  5T14 A;  5IT9 W;  2VR1 A;  4RUA A;  1M0T A;  4DR1 H;  3TQ1 A;  4AQY H;  1FKA H;  5JH7 F;  3R5H A;  4J0M A;  4O4L F;  5C44 G;  3H40 A;  4HYK A;  3PW4 A;  2UXD H;  2R7Z A;  1UC9 A;  2M05 A;  1WSC A;  4Q43 A;  4EGQ A;  4JI5 H;  5KT4 A;  2YZG A;  4Q44 A;  2FE3 A;  4ME6 A;  4A2A A;  1I94 H;  1OWT A;  4EGJ A;  3H0G A;  5KFY A;  5EDW A;  4FBU A;  3H3V H;  2WB1 A;  5DGB A;  1VBG A;  3RBE A;  1S0M A;  4E4T A;  2Q2U A;  5C8Y F;  5KFB A;  3QFF A;  3Q8R B;  2XC9 A;  3RAQ A;  3EYY A;  4R8U B;  4DUY H;  4MV4 A;  3GTO A;  5EWG A;  2XCP A;  3EPI A;  4JV5 H;  2HVS A;  2W6O A;  3KAK A;  4HNV A;  2V4Q A;  2ASL A;  1Y1W A;  4TV9 F;  2R93 A;  1KJQ A;  4G3I A;  4DLK A;  2E5L H;  1RJR A;  2Y0S A;  2RDJ A;  1KJ8 A;  4J9S A;  3H4D A;  2YL2 A;  4QW8 A;  4OX9 H;  1L2Z A;  2JEF A;  4ETS A;  2DWC A;  2CQY A;  4EYI B;  5KFU A;  3U9T A;  3V6H A;  2VUM A;  2CW8 A;  2VOB A;  4MV1 A;  1JDB B;  3N6X A;  4A3G G;  1XMO H;  2WTF A;  1E4E B;  1A9X A;  5D1O B;  1CQI B;  3GTJ A;  2J6U A;  1IOW A;  2FK1 A;  4IRC A;  1JLL B;  3ETH A;  2O03 A;  1GYF A;  3T1Y H;  4X66 H;  3V4S A;  4QWD A;  1E4F T;  4MV6 A;  4J9P A;  4O4H F;  3T1H H;  3JRX A;  4RNN A;  4LF5 H;  4EG0 A;  5IWA H;  4UCO A;  3CQZ A;  1HR0 H;  4MA0 A;  1IBM H;  1R9T A;  2R7K A;  2DPI A;  1N33 H;  2VQF H;  4BXX G;  4HNT A;  3RJ0 A;  5BR8 H;  5FJ8 G;  3MJF A;  2Q2T A;  4QWA A;  3N41 B;  2JA6 G;  3OHB A;  4RZQ A;  2MCT A;  2FMA A;  4QW9 A;  3I4M G;  5C4X G;  4A3I G;  2C2E A;  3OSN A;  5A2Q W;  4JI8 H;  3I12 A;  2JEI A;  5KG7 A;  4JI0 H;  3N43 B;  3GIP A;  1ZQ7 A;  5FPR A;  3RB6 A;  3H4B A;  4F4Y A;  2PN1 A;  4GKK H;  4K0K H;  4TQS A;  1BNC A;  4QWB A;  5JVD F;  1N48 A;  3HOV G;  4J9O A;  4XX0 B;  3BQ1 A;  2C22 A;  2XCL A;  5L9X A;  2WDT A;  4DL3 A;  1EHI A;  3L2P A;  4A3M G;  2W9C A;  5EZY F;  2AGO A;  4B3S H;  3MFH A;  1X9N A;  5DQI A;  4Y8V B;  4ZI7 F;  3Q2O A;  4AYB E;  3MR2 A;  4EBC A;  2JA5 G;  5KFV A;  2YYA A;  3KHH A;  2DIK A;  4GC7 A;  1BJT A;  2R92 G;  1VS0 A;  2OWO A;  4XZ3 B;  2OLS A;  2IBK A;  1CQJ B;  1UC8 A;  1GSO A;  2VPQ A;  4YAK B;  5L1I A;  4DV1 H;  3R5X A;  1ZET A;  1N56 A;  3I4N G;  5IYC G;  2BQU A;  2VUG A;  3GIL A;  2QK4 A;  3HOX G;  3HOW G;  1VKZ A;  2SCU B;  4DR3 H;  5KT7 A;  2XIG A;  4DL7 A;  1S03 G;  5KG4 A;  2R7M A;  3JSN A;  3HKZ A;  4HR7 A;  3L4K A;  3NGD A;  1S10 A;  2R8K A;  1N36 H;  5KFQ A;  4U7C A;  4RNO A;  3GIK A;  1TAE A;  5CA1 F;  1W96 A;  4DL2 A;  2JA6 A;  2UUB H;  3K5I A;  2VPS A;  4UCU A;  1DV1 A;  3RB0 A;  2R8I A;  3ETJ A;  5DG7 A;  4RB0 A;  3VPB A;  1WCM G;  1ULZ A;  5D8D A;  5DLG A;  4LH7 A;  4J9M A;  3UFX B;  5CB4 F;  3T5H A;  3M9M B;  3OUU A;  3Q8Q B;  1JIH A;  2FPP B;  4Q0Y A;  3KHL A;  2AU0 A;  2V4R A;  4BY7 G;  4DV3 H;  4DR4 H;  1Z2O X;  2VQE H;  4DR6 H;  1SEI A;  2WAQ E;  3JAM W;  3G6V A;  4JI1 H;  3RTX A;  3PO3 G;  2V9W A;  4UCR A;  4RB3 C;  5KFP A;  4O3Q A;  5K2M A;  1GSA A;  4U6P A;  1CS0 A;  3G6Y A;  3T5L A;  2R92 A;  3M9N B;  4LSX A;  4RUC A;  2WE6 A;  3VPD A;  4APM A;  2ZJT A;  4I4T F;  4CC5 A;  1Y14 B;  4RB2 C;  4C5C A;  4M9U A;  2R8G A;  1RJP A;  1B6S A;  4EBD A;  4FS1 A;  2HVQ A;  4DR7 H;  2UVU A;  2R84 A;  5KFH A;  2W8K A;  2FLP A;  3MR3 A;  2PMZ A;  5IYD G;  3J80 W;  3GV7 B;  4ECY A;  4LFB H;  4YHH H;  1S68 A;  4RAY A;  2CZG A;  2W7P A;  4YY3 H;  4Q8E A;  5KFM A;  5LMU H;  2YU9 A;  3IG0 A;  1W93 A;  4BWS C;  1JKJ B;  3KXY T;  2W9C B;  4ECS A;  3RB4 A;  1DV2 A;  3RF2 A;  5DQG A;  4GC6 A;  3HOY G;  2FKL A;  3GTL A;  1JDE A;  5IP9 G;  4DV5 H;  2VQD A;  1GO3 E;  4A3L G;  2ALZ A;  4PWQ A;  2W6Q A;  2I87 A;  1WCM A;  4ED7 A;  4LSA A;  3ORR A;  1HNX H;  3KAL A;  4ED8 A;  1K1Q A;  3GIJ A;  1DGS A;  2ATL A;  4JI7 H;  1RK6 A;  1SYX B;  2YRX A;  2PBZ A;  4I55 F;  2FP4 B;  5DG8 A;  2VA3 A;  2I80 A;  3GTM A;  3TQT A;  1HNZ H;  3MR5 A;  1TWG A;  2FLN A;  3RAX A;  4A3C G;  3M4I A;  1Y1V G;  2YRW A;  2ZDG A;  2R7L A;  4R7R A;  3EPG A;  1GLV A;  4DL4 A;  3KHG A;  3PW2 A;  3RV3 A;  2DPJ A;  3HOZ G;  3LP8 A;  5KFR A;  5CAE B;  3Q1K A;  4JI3 H;  2W7O A;  3GTQ A;  4MTE A;  1IBK H;  5KT2 A;  1UNN C;  2WB1 E;  1K1S A;  4JV1 A;  1S0O A;  1J5E H;  2J6T A;  4WD3 A;  3K3P A;  1AN7 A;  4QIW A;  2NUA B;  3PVX A;  5C3E G;  5KFI A;  4LF9 H;  2R8J A;  4M7E A;  3N42 B;  3G8C A;  4NXM H;  4JYA H;  1S97 A;  4RB1 A;  4EFB A;  2FJZ A;  3HBL A;  5KFX A;  5FD6 A;  3RIZ A;  3QZ8 A;  2GPS A;  5KFL A;  2UVW A;  2Y0S E;  2B63 G;  4KHP H;  5HV6 A;  2F4V H;  4O2A F;  2R6F A;  4MAM A;  1Z2P X;  1KJ9 A;  3BAA A;  4HNU A;  5KFO A;  1V4Y A;  5DG9 A;  2RGR A;  4EBE A;  5KFS A;  1XDN A;  1ZHS A;  4FS2 A;  1PK8 A;  5KFG A;  3MWD A;  4JUZ A;  2C28 A;  1RK5 A;  4X62 H;  4EYH B;  3HOU G;  2YCH A;  2HJW A;  2NVY A;  3GII A;  1EUC B;  3FMA A;  2C00 A;  5KG3 A;  1Y1V A;  2C35 B;  2IP4 A;  2QYZ A;  3JRW A;  2W9A A;  5KFD A;  3VMM A;  4ECZ A;  2J6S A;  2UXC H;  4J9N A;  5IYB G;  3F8N A;  3KAJ A;  4LFC H;  2R7N A;  4TQR A;  1TA8 A;  5L1J A;  4F4X A;  3GQC A;  1T3N A;  2UUA H;  2YZN A;  1K83 A;  3PO2 G;  4F50 A;  4I7H A;  4DL6 A;  2C2D A;  2BQ3 A;  1I7L A;  3RBD A;  4GLX A;  1I6U A;  5LL6 b;  1RJQ A;  1KBL A;  5KT5 A;  4A3F G;  4ZHQ F;  1DIK A;  3BQ0 A;  2E2I A;  1PX2 A;  1SCU B;  4FU0 A;  5KT3 A;  3QZ7 A;  3BAB A;  3PW0 A;  3J7A K;  3OUZ A;  5JUM A;  1E4G T;  2XD4 A;  2B63 A;  2W6P A;  1B33 N;  2W9B A;  3BA8 A;  5KG0 A;  2W6Z A;  3T5K A;  4A3J G;  2UVR A;  4F4Z A;  2ZDQ A;  3KTM A;  4RZR A;  5LP6 F;  3ORQ A;  3PR4 A;  4LF7 H;  5KFZ A;  1TWF A;  2W6N A;  2J9G A;  3GIQ A;  2R87 A;  4MA5 A;  2RDI A;  2R82 A;  5KFW A;  1N34 H;  4JI2 H;  4HQ6 A;  4L1K A;  4DV6 H;  3GTG A;  1M0W A;  4UCV A;  3R23 A;  5KT6 A;  4UCS A;  4R8U A;  1VBH A;  4ECV A;  4IR1 A;  5KFF A;  2BQR A;  4A3B G;  4X64 H;  4ZOL F;  1HNW H;  2UXB H;  3K3V A;  1WR2 A;  4ECX A;  3MFI A;  5F9N A;  2DLN A;  4YJ2 F;  1EZ1 A;  5JVL A;  4ECQ A;  3HKZ E;  4O3N A;  2JA5 A;  5KFJ A;  4IWX A;  4QJF A;  5LMN H;  4JI4 H;  4J9Q A;  1TWA A;  5KFK A;  3V4Z A;  1EYZ A;  1BGW A;  3GV5 B;  2UVV A;  1E4E A;  2I8C A;  5C5J A;  3C0F B;  3CVZ A;  2V59 A;  2W8L A;  2R8H A;  2NVX A;  2E2H A;  2P0A A;  1RYR A;  4J9K A;  4IZO A;  2W71 A;  2R93 G;  3UQ8 A;  2HGS A;  5IP7 G;  4A3K G;  1M6V A;  5KG1 A;  5KFA A;  4MTD A;  3FKI G;  4BY1 G;  3PW5 A;  4C5A A;  1IBL H;  2JA7 G;  5FLM G;  4JI6 H;  3RFC A;  2HVR A;  1KC7 A;  2AGP A;  4J9R A;  1RYS A;  3OTO H;  4YQW A;  4DR5 H;  3AYH B;  5KG2 A;  4DV4 H;  4LF4 H;  3LWB A;  1BXR A;  4I50 F;  1N32 H;  3GV8 B;  4BBS G;  5KFC A;  5BPH A;  2WYO A;  4ED2 A;  2PMZ E;  2X0S A;  4O3R A;  2W9B B;  5C1P A;  3G6X A;  4ECU A;  2CW7 A;  2CKZ B;  4DV0 H;  5LYJ F;  4YR0 A;  4YB8 B;  5EOY A;  5IYZ F;  5LOV F;  4MV9 A;  3N44 B;  4RU9 A;  2RF4 A;  3KHR A;  3GLK A;  1B04 A;  4ED3 A;  3Q8S B;  4X65 H;  5DGA A;  2AQ4 A;  4NXN H;  2XGP A;  3N8D A;  4YBZ B;  4LH6 A;  1VAJ A;  1KJI A;  5FPO A;  4O3O A;  1S0N A;  4BBR G;  3R5F A;  4DV7 H;  3MWE A;  4ED0 A;  2VA2 A;  2JEG A;  3HXL A;  2GPW A;  3JZI A;  4A3D G;  3JSL A;  4NLG A;  5BPF A;  2W57 A;  1FVI A;  4TUY F;  4A3E G;  2UU9 H;  3GIM A;  2IMW P;  2ASJ A;  1JX4 A;  3TII A;  1GSH A;  3N40 P;  3FKI A;  3PZP A;  4DR2 H;  2RGV A;  2JA7 A;  4C5B A;  3V6K A;  1MZB A;  4O3S A;  4GKJ H;  2V58 A;  4IAJ A;  5KFT A;  2W70 A;  2DZD A;  2NU6 B;  1XMQ H;  5KFN A;  4B3R H;  4F4W A;  3RGX A;  4LFA H;  5JQW A;  1XNQ H;  4A93 G;  1P8L A;  4ED1 A;  1CE8 A;  2FK3 A;  2AGQ A;  1JXL A;  5DQH A;  5KFE A;  2FPI B;  5L1L A;  5FD5 A;  1T36 A;  3HB9 A;  4C2M A;  4QIW E;  1S9F A;  1B6R A;  3L4J A;  3MR6 A;  3BA9 A;  4TV8 F;  3J81 W;  2JEJ A;  4WBN F;  3BG5 A;  3GTK A;  4ECR A;  4O3P A;  5I47 A;  4IHJ F;  5J2U F;  4AYB A;  4LMY A;  2YS6 A;  5H80 A;  4A2B A;  1TWC A;  5KKN B;  3OHA A;  4DUZ H;  2ASD A;  3GTP A;  2NU9 B;  5LXT F;  4PDB A;  1V9P A;  3SE7 A;  4QWE A;  4IR9 A;  1ZHQ A;  4Q45 A;  1GGO A;  3M9O B;  5KG6 A;  2YW2 A;  4YAJ B;  4CC6 A;  1SFO A;  1I3Q A;  1C30 A;  5C1O A;  3V6J A;  2BR0 A;  4B3M H;  4YR2 A;  4IRK A;  2NU8 B;  1AUV A;  4DL5 A;  4RNM A;  3RV4 A;  3PR5 B;  2UUC H;  3GID A;  5KG5 A;  2NU7 B;  3RUP A;  2HHH H;  3RGZ A;  4O4I F;  1A0I A;  2PVP A;  4UCT A;  2FLL A;  4MV8 A;  1I7N A;  5EWE A;  4ZQI A;  3U9S A;  2V5A A;  4MV3 A;  5CA0 F;  4QWC A;  2OH2 A;  2R85 A;  1V51 A;  4LF8 H;  1EUD B;  4MV7 A;  4XYM B;  1T94 A;  2FK2 A;  4YP3 A;  2WAQ A;  2YZM A;  2R86 A;  5L1K A;  4ECW A;  1Z2N X;  2W6M A;  3WO1 A;  3MWM A;  3TIG A;  4RAZ A;  2R7Z G;  2IA6 A;  2C2R A;  4DV2 H;  5J2T F;  5DLF A;  2XGQ A;  4B3T H;  4O2B F;  2YS7 A;  2XCA A;  3WO0 A;  2JA8 G;  2FB9 A;  5HBR B;  1KJJ A;  4IRD A;  3K5H A;  5LA6 F;  3H0G G;  1WH2 A;  4EFE A;  4ED6 A;  1XNR H;  3H20 A;  4UFZ A;  5D1O A;  4JV2 A;  5D1P A;  3OSP A;  3T5J A;  2KSW A;  1FJG H;  3PW7 A;  4FBT A;  3TIN A; 
#chains in the Genus database with same CATH homology
 3KTM A;  1OWT A;  2FK1 A;  2FMA A;  4PWQ A;  2FK2 A;  2FK3 A;  2FKL A;  2M05 A;  2FJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...