1OWTA

Structure of the alzheimer's disease amyloid precursor protein copper binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
SDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title Structure of the Alzheimer's Disease Amyloid Precursor Protein Copper Binding Domain. A REGULATOR OF NEURONAL COPPER HOMEOSTASIS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 1owtA00
2FKLA 4PWQA 2FK1A 2M05A 3KTMA 2FMAA 1OWTA 2FK2A 2FK3A 2FJZA
chains in the Genus database with same CATH superfamily
1T36A 3BABA 4UCUA 4Q44A 1WH2A 2NU9B 1C3OA 4MTEA 1KC7A 3M9MB 1EUDB 1VAJA 4RAYA 4RNMA 4DR5H 2BQ3A 4O3RA 4A3GG 1EYZA 2HVSA 4B3RH 3PW7A 3GQCA 4DUZH 2UUAH 5D1OB 1B04A 4I4TF 2YU9A 4EEYA 5L9XA 1IBMH 4RUAA 4MA5A 4YJ3F 2YZNA 3BAAA 1Y1VG 1WCMA 1J5EH 5IT9W 3T5LA 4JV2A 1DGSA 4ED7A 2R6FA 4RZQA 5KG7A 4ME6A 1W96A 2R86A 2W6NA 4QJFA 4F4ZA 3N43B 3V4ZA 3Q8RB 2FK1A 2DPIA 1ULZA 3T5JA 2V9WA 5KT5A 3HB9A 3GIMA 1S68A 4NXMH 2R87A 2XCLA 3OHAA 2PBZA 3TQTA 2FLPA 4IRDA 4YB8B 1I50A 2W9AA 4J9MA 4CC6A 2HVRA 4YAJB 2VUMA 3GV7B 3FKIG 5L1LA 1KBLA 2XCAA 3PR4A 3HBLA 1JX4A 4WBNF 5KT6A 1AUVA 3E5NA 1JKJB 4APMA 3TIIA 4IR1A 1DIKA 2W6PA 5KFUA 2RF4A 1WSCA 2W6ZA 4ZQIA 4ETSA 1I7LA 2W71A 4XYMB 4AYBE 3QZ8A 2V4RA 2VQFH 1KJJA 4MA0A 3GV8B 3FKIA 4BBRG 3AYHB 3RAQA 4I50F 5FD5A 1Z2NX 2W6QA 4ZHQF 3MWMA 4U7CA 2B63A 4J0MA 3VPCA 3TQ1A 2R85A 4EGQA 4JI5H 5FPOA 3GTMA 5BMVF 1JLLB 3Q8QB 1SEIA 2VA2A 4QIWA 2R7MA 1N33H 3M9OB 1GSHA 2FPGB 4MV8A 4EFEA 2V4QA 3VPDA 1ZETA 4A3LG 3PN1A 2I8CA 5KG6A 4ED2A 3H4BA 4MV7A 5DQGA 4JI7H 1UC8A 1V51A 2WDTA 3Q1KA 1AN7A 1RK5A 5KG3A 4C5AA 4HYKA 1E4FT 2PN1A 2YW2A 2ATLA 1HNWH 2ZDQA 5I47A 5L1KA 1T94A 5KFYA 3MR5A 3SE7A 1VKZA 3TINA 5C8YF 4R8UB 1DV1A 5KT7A 3T5HA 4DL4A 3GIIA 4B3TH 4CC5A 3G6XA 5C1OA 1IBKH 2FPPB 3GTOA 2V5AA 4BXXG 2YL2A 4BBSG 4J9RA 3H0GG 4A3DG 2FLNA 2YS7A 4DR4H 2YZGA 4K0KH 2FK3A 2YRWA 2GPSA 5IP7G 3GIDA 4QIWE 3V6KA 4DL5A 3PO2G 2CKZB 3MJFA 3RBEA 2VR1A 4ED0A 1B33N 2IA6A 1S0NA 1E4EB 1RJRA 3RFCA 2JA7G 4JI3H 2E2HA 4IHJF 3H0GA 5LMUH 3JSNA 5JVDF 2RGRA 1O75A 3BJYA 3KALA 3PO3G 5KFCA 2DIKA 3V6HA 4DUYH 5J2TF 4A3MG 2VOBA 2IMWP 4IR9A 2JA7A 5EOYA 1ZQ7A 4JI2H 1M0WA 4BY1G 4F4XA 4QW9A 5IWAH 1JDBB 4DV6H 5KG5A 2F4VH 1XNQH 3OUUA 1GSAA 4FM9A 1JXLA 2V58A 4DV3H 2C2DA 5IYCG 1IOWA 3KHHA 2C00A 4DV4H 3GIJA 3RB6A 3GTLA 1UC9A 1KJQA 4MV1A 3MR3A 5KFBA 3RB4A 1SYXB 2UVRA 5HV6A 5IYBG 4QWBA 3EPIA 2OLSA 5KFPA 4GC6A 4JI6H 4FU0A 4ED3A 3BQ0A 1CQIB 3GTKA 2O03A 4ZOLF 4DL2A 2E2IA 3TIGA 3BA8A 3PW0A 2CQYA 2IBKA 4MV3A 5KFTA 1WCMG 5CAEB 4YAKB 2UXBH 4XX0B 5K2MA 5JVLA 2C22A 2OWOA 1HNXH 2I87A 1RJPA 5KFEA 2FMAA 3R5XA 5KG2A 1TWGA 2ASLA 4IRKA 4J9PA 5KFKA 2NU6B 2BQRA 3J7AK 4A2BA 2W7OA 3M9NB 4EYIB 4JI0H 4ECUA 2R93G 2DPJA 4AYBA 5DQHA 4O2BF 3VMMA 3HOWG 4A2AA 3GV5B 5LOVF 2VUMG 4LMYA 1BXRA 3BQ2A 4ECWA 5T14A 4O3SA 4U6PA 4OX9H 2R93A 4DLKA 4RB3C 2NU7B 4B3SH 3L4JA 2W57A 4UCSA 1XMQH 5KFRA 1S0OA 4EYHB 5F9LA 3R5FA 3CVZA 2HGSA 3RB3A 4JV1A 1I7NA 4YJ2F 2AGPA 3KHRA 3J80W 3L4KA 5C3EG 3HOYG 5C44G 3MR6A 3RTXA 4YY3H 1EUCB 3HKZA 5KG1A 1GO3E 1ZHSA 3N41B 3L2PA 2B63G 4O4LF 4QWCA 1V9PA 4J9SA 1SFOA 4MV4A 1KJ8A 1E4GT 4R7RA 1N32H 5C4XG 4DL3A 4O3OA 3T5KA 3RGXA 3K5HA 3LWBA 3HOUG 5D1PA 4DR2H 5KFIA 2WB1A 4M7EA 3PW4A 1R9TA 4A3BG 4LSXA 4JYAH 5KFSA 1L2ZA 3MFHA 2YYAA 2W9BA 4F4YA 5LL6b 2C2EA 4Q8EA 4QWAA 4LF6H 2NUAB 2NU8B 2Q2UA 2NVXA 3PVXA 1Y1WG 4M9UA 4YR2A 2UVUA 1OWTA 2VPSA 4UCOA 5HBRB 5LA6F 4RNOA 5KFGA 3WNZA 5EWFA 5CA1F 4RZRA 1I6UA 3SI8A 2CW7A 3JZIA 4TV8F 5FLMG 3MWDA 3HKZE 1RJQA 1XMOH 4Y8VB 1UNNC 5C5JA 2W8KA 2J6TA 3MR2A 3N40P 4QWDA 4RB2C 4IWYA 4FS2A 3N8DA 5KT3A 3M4IA 5KFXA 1Y1WA 4A3FG 3MFIA 4UCRA 2GLTA 4EFBA 1B6SA 2OH2A 3JAMW 2WYOA 4O2AF 4YHHH 2WB1E 4LH7A 5CB4F 2XC9A 2FLLA 4RB1A 5D8DA 3KAJA 2W9CA 3RJ0A 1SCUB 1TWFA 2QYZA 2IP4A 4JUZA 3I4NG 2R7KA 4HNVA 2KSWA 4BY7G 1K1SA 3DF7A 4HQ6A 4Q45A 2ZDGA 3RB0A 1HR0H 2UXDH 4QWEA 5KT2A 4J9NA 3T1YH 3I4MG 5KFJA 4O3PA 4IWXA 2C28A 2WTFA 2J9GA 4A3IG 1RYSA 4ED8A 5KX5F 1CQJB 3WO0A 2WAQA 2R8HA 4FBUA 4DV2H 3HXLA 1MZBA 5IYZF 1M6VA 4RNNA 4FS1A 2HHHH 1S03G 2RDJA 3IN5A 2ZDHA 2FKLA 5LYJF 3OHBA 4F50A 4LF9H 5H80A 4LFAH 3H20A 3KTMA 1TWAA 3RUPA 1HNZH 3GIQA 1S9FA 4Q8FA 5JQWA 1FJGH 4LF7H 1AUXA 2JEGA 4Q0YA 2I80A 5KFZA 1JDEA 3OSPA 4DV1H 4RAZA 5DQIA 4EBCA 3JRXA 5DGAA 1N34H 1DV2A 4ZI7F 2PMZE 4J9KA 4GKKH 3R23A 1M7JA 5F9NA 1T3NA 1N56A 4UCVA 3GIKA 4MV9A 2WAQE 4IRCA 4A3JG 1EZ1A 1TWCA 2VPQA 1BGWA 4A3KG 2VUGA 4LFCH 1X9NA 4IAJA 4X64H 3PW2A 2JA6A 3K3PA 3CQZA 4ED6A 5GONF 2UU9H 3OTOH 3G6YA 1ZHQA 1IOVA 1B6RA 2HVQA 4DL6A 2YCHA 4I7HA 3HOXG 4QW8A 1XNRH 2UUBH 4EG0A 2JA8G 4PWQA 3Q8PB 1KJ9A 4RUCA 2JEFA 4TUYF 5KFFA 5KT4A 3G6VA 2VQEH 4HNUA 1S10A 4B3MH 4O3NA 4GLXA 1VBHA 1WR2A 3V6JA 1VBGA 2UVVA 4ECRA 2M05A 2X0SA 2ASJA 5KFLA 2J6UA 2UVWA 2FJZA 5KG4A 2P0AA 4C2MA 5JH7F 5FJ8G 2DWCA 2W9BB 3RBDA 2R7ZG 1E4EA 3N44B 4DL7A 3GIPA 4JI1H 1V4YA 5KG0A 2R92G 2R84A 5LXTF 5IP9G 1PX2A 3GTGA 4BWSC 4WD3A 3GLKA 2HJWA 4EGJA 1BNCA 3FDSA 3QFFA 1M0TA 1Z2OX 1A0IA 5KFAA 1TAEA 2R7ZA 4MAMA 3HOVG 4G3IA 5KFQA 4ECTA 2R92A 3KHLA 2XGQA 3NGDA 4A3CG 5C1PA 4YR3A 4A93G 4MV6A 2DZDA 3V4SA 2FE3A 2J6SA 3H40A 4ECZA 2AGQA 1TWHA 2V59A 1GYFA 2W9CB 3K5IA 1S0MA 1K1QA 5KFNA 1FVIA 3UQ8A 2UXCH 4HR7A 5L1JA 4YR0A 2FB9A 1Y1VA 3JRWA 3ORRA 1TA8A 2WE6A 3WO1A 3G8CA 3BQ1A 4ECXA 2BR0A 4FBTA 2JA5G 2VQDA 3GTQA 2XD4A 4J9LA 2ALZA 4DR7H 5JUMA 4LF8H 3IG0A 4J9OA 3HOZG 5BR8H 4IZOA 2YS6A 5DGBA 2ZM6H 4GC7A 4ECYA 1K83A 4JI4H 4LF4H 4DR1H 5DG7A 5A2QW 3F8NA 3MWEA 3EPGA 4A3EG 4UFZA 4X65H 2C35B 3RAXA 2JA5A 2ASDA 4ECQA 1PK8A 5D1OA 3T1HH 1BJTA 1CE8A 1VS0A 1N36H 1GGOA 3PR5B 4ED1A 2XGPA 4PDBA 1XDNA 1Z2PX 3J81W 3FMAA 5BPHA 3Q2OA 3OUZA 4LF5H 2MCTA 5EZYF 5FPRA 2NVYA 4JV0A 3OSNA 2W8LA 5L1IA 4J9QA 4YBZB 2R8GA 4EBEA 3GTJA 2R7NA 5KFOA 4AQYH 3KAKA 3VPBA 1GLVA 1A9XA 1S97A 4DV7H 2W6MA 1W93A 3JSLA 1GSOA 5LP6F 5KFWA 2RGVA 2PMZA 2XCPA 2VA3A 4HNTA 2GPWA 1FKAH 4L1KA 4YP3A 2JEJA 4O4HF 3I12A 4DV0H 1I94H 4LH6A 2ZJTA 4UCTA 2DLNA 2YRXA 1I3QA 5EWEA 4E4TA 1JIHA 3ETJA 4JI8H 2FPIB 4TQSA 4ECSA 4DR6H 3K3VA 4ECVA 2QK4A 3N42B 4X66H 3RF2A 4NLGA 2FK2A 3QZ7A 2RDIA 2Q2TA 2R7LA 3GILA 5DLFA 4O4IF 2C2RA 3GTPA 5CA0F 4XZ3B 2R82A 5IYDG 2W6OA 3KXYT 2Y0SA 2W70A 3KHGA 2XIGA 3R5HA 5BPFA 5DG9A 3U9SA 4KHPH 2W7PA 2UUCH 3EYYA 5KFVA 2JA6G 4DV5H 3UFXB 5EDWA 4F4WA 3PW5A 5DG8A 2AQ4A 2SCUB 2YZMA 3RGZA 5LMNH 4MTDA 1RYRA 4EBDA 2R8KA 2R8JA 3C0FB 4C5CA 4XYLB 1IBLH 5DLGA 2E5LH 1CS0A 4RU9A 3H4DA 4NXNH 4LFBH 2FP4B 4TV9F 4DR3H 5J2UF 2JEIA 1Y14B 5KKNB 3PZPA 1C30A 1P8LA 3RIZA 4JV5H 3BG5A 3ORQA 3H3VH 5KFMA 2PVPA 3LMLA 4R8UA 4EEQA 4TQRA 3LP8A 5FLXW 1KEEA 4GKJH 2R8IA 3ETHA 4X62H 5KFDA 3RV3A 4YQWA 2Y0SE 4I55F 3Q8SB 2CW8A 5KFHA 1EHIA 1KJIA 3BA9A 1RK6A 4LSAA 2AU0A 5EWGA 4O3QA 4C5BA 2AGOA 4Q43A 3RV4A 2CZGA 1N48A 4RB0A 3N6XA 3U9TA 2BQUA 5FD6A
chains in the Genus database with same CATH topology
2FKLA 4PWQA 2FK1A 2M05A 3KTMA 2FMAA 1OWTA 2FK2A 2FK3A 2FJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKL A;  4PWQ A;  2FK1 A;  2M05 A;  3KTM A;  2FMA A;  1OWT A;  2FK2 A;  2FK3 A;  2FJZ A; 
#chains in the Genus database with same CATH topology
 1T36 A;  3BAB A;  4UCU A;  4Q44 A;  1WH2 A;  2NU9 B;  1C3O A;  4MTE A;  1KC7 A;  3M9M B;  1EUD B;  1VAJ A;  4RAY A;  4RNM A;  4DR5 H;  2BQ3 A;  4O3R A;  4A3G G;  1EYZ A;  2HVS A;  4B3R H;  3PW7 A;  3GQC A;  4DUZ H;  2UUA H;  5D1O B;  1B04 A;  4I4T F;  2YU9 A;  4EEY A;  5L9X A;  1IBM H;  4RUA A;  4MA5 A;  4YJ3 F;  2YZN A;  3BAA A;  1Y1V G;  1WCM A;  1J5E H;  5IT9 W;  3T5L A;  4JV2 A;  1DGS A;  4ED7 A;  2R6F A;  4RZQ A;  5KG7 A;  4ME6 A;  1W96 A;  2R86 A;  2W6N A;  4QJF A;  4F4Z A;  3N43 B;  3V4Z A;  3Q8R B;  2FK1 A;  2DPI A;  1ULZ A;  3T5J A;  2V9W A;  5KT5 A;  3HB9 A;  3GIM A;  1S68 A;  4NXM H;  2R87 A;  2XCL A;  3OHA A;  2PBZ A;  3TQT A;  2FLP A;  4IRD A;  4YB8 B;  1I50 A;  2W9A A;  4J9M A;  4CC6 A;  2HVR A;  4YAJ B;  2VUM A;  3GV7 B;  3FKI G;  5L1L A;  1KBL A;  2XCA A;  3PR4 A;  3HBL A;  1JX4 A;  4WBN F;  5KT6 A;  1AUV A;  3E5N A;  1JKJ B;  4APM A;  3TII A;  4IR1 A;  1DIK A;  2W6P A;  5KFU A;  2RF4 A;  1WSC A;  2W6Z A;  4ZQI A;  4ETS A;  1I7L A;  2W71 A;  4XYM B;  4AYB E;  3QZ8 A;  2V4R A;  2VQF H;  1KJJ A;  4MA0 A;  3GV8 B;  3FKI A;  4BBR G;  3AYH B;  3RAQ A;  4I50 F;  5FD5 A;  1Z2N X;  2W6Q A;  4ZHQ F;  3MWM A;  4U7C A;  2B63 A;  4J0M A;  3VPC A;  3TQ1 A;  2R85 A;  4EGQ A;  4JI5 H;  5FPO A;  3GTM A;  5BMV F;  1JLL B;  3Q8Q B;  1SEI A;  2VA2 A;  4QIW A;  2R7M A;  1N33 H;  3M9O B;  1GSH A;  2FPG B;  4MV8 A;  4EFE A;  2V4Q A;  3VPD A;  1ZET A;  4A3L G;  3PN1 A;  2I8C A;  5KG6 A;  4ED2 A;  3H4B A;  4MV7 A;  5DQG A;  4JI7 H;  1UC8 A;  1V51 A;  2WDT A;  3Q1K A;  1AN7 A;  1RK5 A;  5KG3 A;  4C5A A;  4HYK A;  1E4F T;  2PN1 A;  2YW2 A;  2ATL A;  1HNW H;  2ZDQ A;  5I47 A;  5L1K A;  1T94 A;  5KFY A;  3MR5 A;  3SE7 A;  1VKZ A;  3TIN A;  5C8Y F;  4R8U B;  1DV1 A;  5KT7 A;  3T5H A;  4DL4 A;  3GII A;  4B3T H;  4CC5 A;  3G6X A;  5C1O A;  1IBK H;  2FPP B;  3GTO A;  2V5A A;  4BXX G;  2YL2 A;  4BBS G;  4J9R A;  3H0G G;  4A3D G;  2FLN A;  2YS7 A;  4DR4 H;  2YZG A;  4K0K H;  2FK3 A;  2YRW A;  2GPS A;  5IP7 G;  3GID A;  4QIW E;  3V6K A;  4DL5 A;  3PO2 G;  2CKZ B;  3MJF A;  3RBE A;  2VR1 A;  4ED0 A;  1B33 N;  2IA6 A;  1S0N A;  1E4E B;  1RJR A;  3RFC A;  2JA7 G;  4JI3 H;  2E2H A;  4IHJ F;  3H0G A;  5LMU H;  3JSN A;  5JVD F;  2RGR A;  1O75 A;  3BJY A;  3KAL A;  3PO3 G;  5KFC A;  2DIK A;  3V6H A;  4DUY H;  5J2T F;  4A3M G;  2VOB A;  2IMW P;  4IR9 A;  2JA7 A;  5EOY A;  1ZQ7 A;  4JI2 H;  1M0W A;  4BY1 G;  4F4X A;  4QW9 A;  5IWA H;  1JDB B;  4DV6 H;  5KG5 A;  2F4V H;  1XNQ H;  3OUU A;  1GSA A;  4FM9 A;  1JXL A;  2V58 A;  4DV3 H;  2C2D A;  5IYC G;  1IOW A;  3KHH A;  2C00 A;  4DV4 H;  3GIJ A;  3RB6 A;  3GTL A;  1UC9 A;  1KJQ A;  4MV1 A;  3MR3 A;  5KFB A;  3RB4 A;  1SYX B;  2UVR A;  5HV6 A;  5IYB G;  4QWB A;  3EPI A;  2OLS A;  5KFP A;  4GC6 A;  4JI6 H;  4FU0 A;  4ED3 A;  3BQ0 A;  1CQI B;  3GTK A;  2O03 A;  4ZOL F;  4DL2 A;  2E2I A;  3TIG A;  3BA8 A;  3PW0 A;  2CQY A;  2IBK A;  4MV3 A;  5KFT A;  1WCM G;  5CAE B;  4YAK B;  2UXB H;  4XX0 B;  5K2M A;  5JVL A;  2C22 A;  2OWO A;  1HNX H;  2I87 A;  1RJP A;  5KFE A;  2FMA A;  3R5X A;  5KG2 A;  1TWG A;  2ASL A;  4IRK A;  4J9P A;  5KFK A;  2NU6 B;  2BQR A;  3J7A K;  4A2B A;  2W7O A;  3M9N B;  4EYI B;  4JI0 H;  4ECU A;  2R93 G;  2DPJ A;  4AYB A;  5DQH A;  4O2B F;  3VMM A;  3HOW G;  4A2A A;  3GV5 B;  5LOV F;  2VUM G;  4LMY A;  1BXR A;  3BQ2 A;  4ECW A;  5T14 A;  4O3S A;  4U6P A;  4OX9 H;  2R93 A;  4DLK A;  4RB3 C;  2NU7 B;  4B3S H;  3L4J A;  2W57 A;  4UCS A;  1XMQ H;  5KFR A;  1S0O A;  4EYH B;  5F9L A;  3R5F A;  3CVZ A;  2HGS A;  3RB3 A;  4JV1 A;  1I7N A;  4YJ2 F;  2AGP A;  3KHR A;  3J80 W;  3L4K A;  5C3E G;  3HOY G;  5C44 G;  3MR6 A;  3RTX A;  4YY3 H;  1EUC B;  3HKZ A;  5KG1 A;  1GO3 E;  1ZHS A;  3N41 B;  3L2P A;  2B63 G;  4O4L F;  4QWC A;  1V9P A;  4J9S A;  1SFO A;  4MV4 A;  1KJ8 A;  1E4G T;  4R7R A;  1N32 H;  5C4X G;  4DL3 A;  4O3O A;  3T5K A;  3RGX A;  3K5H A;  3LWB A;  3HOU G;  5D1P A;  4DR2 H;  5KFI A;  2WB1 A;  4M7E A;  3PW4 A;  1R9T A;  4A3B G;  4LSX A;  4JYA H;  5KFS A;  1L2Z A;  3MFH A;  2YYA A;  2W9B A;  4F4Y A;  5LL6 b;  2C2E A;  4Q8E A;  4QWA A;  4LF6 H;  2NUA B;  2NU8 B;  2Q2U A;  2NVX A;  3PVX A;  1Y1W G;  4M9U A;  4YR2 A;  2UVU A;  1OWT A;  2VPS A;  4UCO A;  5HBR B;  5LA6 F;  4RNO A;  5KFG A;  3WNZ A;  5EWF A;  5CA1 F;  4RZR A;  1I6U A;  3SI8 A;  2CW7 A;  3JZI A;  4TV8 F;  5FLM G;  3MWD A;  3HKZ E;  1RJQ A;  1XMO H;  4Y8V B;  1UNN C;  5C5J A;  2W8K A;  2J6T A;  3MR2 A;  3N40 P;  4QWD A;  4RB2 C;  4IWY A;  4FS2 A;  3N8D A;  5KT3 A;  3M4I A;  5KFX A;  1Y1W A;  4A3F G;  3MFI A;  4UCR A;  2GLT A;  4EFB A;  1B6S A;  2OH2 A;  3JAM W;  2WYO A;  4O2A F;  4YHH H;  2WB1 E;  4LH7 A;  5CB4 F;  2XC9 A;  2FLL A;  4RB1 A;  5D8D A;  3KAJ A;  2W9C A;  3RJ0 A;  1SCU B;  1TWF A;  2QYZ A;  2IP4 A;  4JUZ A;  3I4N G;  2R7K A;  4HNV A;  2KSW A;  4BY7 G;  1K1S A;  3DF7 A;  4HQ6 A;  4Q45 A;  2ZDG A;  3RB0 A;  1HR0 H;  2UXD H;  4QWE A;  5KT2 A;  4J9N A;  3T1Y H;  3I4M G;  5KFJ A;  4O3P A;  4IWX A;  2C28 A;  2WTF A;  2J9G A;  4A3I G;  1RYS A;  4ED8 A;  5KX5 F;  1CQJ B;  3WO0 A;  2WAQ A;  2R8H A;  4FBU A;  4DV2 H;  3HXL A;  1MZB A;  5IYZ F;  1M6V A;  4RNN A;  4FS1 A;  2HHH H;  1S03 G;  2RDJ A;  3IN5 A;  2ZDH A;  2FKL A;  5LYJ F;  3OHB A;  4F50 A;  4LF9 H;  5H80 A;  4LFA H;  3H20 A;  3KTM A;  1TWA A;  3RUP A;  1HNZ H;  3GIQ A;  1S9F A;  4Q8F A;  5JQW A;  1FJG H;  4LF7 H;  1AUX A;  2JEG A;  4Q0Y A;  2I80 A;  5KFZ A;  1JDE A;  3OSP A;  4DV1 H;  4RAZ A;  5DQI A;  4EBC A;  3JRX A;  5DGA A;  1N34 H;  1DV2 A;  4ZI7 F;  2PMZ E;  4J9K A;  4GKK H;  3R23 A;  1M7J A;  5F9N A;  1T3N A;  1N56 A;  4UCV A;  3GIK A;  4MV9 A;  2WAQ E;  4IRC A;  4A3J G;  1EZ1 A;  1TWC A;  2VPQ A;  1BGW A;  4A3K G;  2VUG A;  4LFC H;  1X9N A;  4IAJ A;  4X64 H;  3PW2 A;  2JA6 A;  3K3P A;  3CQZ A;  4ED6 A;  5GON F;  2UU9 H;  3OTO H;  3G6Y A;  1ZHQ A;  1IOV A;  1B6R A;  2HVQ A;  4DL6 A;  2YCH A;  4I7H A;  3HOX G;  4QW8 A;  1XNR H;  2UUB H;  4EG0 A;  2JA8 G;  4PWQ A;  3Q8P B;  1KJ9 A;  4RUC A;  2JEF A;  4TUY F;  5KFF A;  5KT4 A;  3G6V A;  2VQE H;  4HNU A;  1S10 A;  4B3M H;  4O3N A;  4GLX A;  1VBH A;  1WR2 A;  3V6J A;  1VBG A;  2UVV A;  4ECR A;  2M05 A;  2X0S A;  2ASJ A;  5KFL A;  2J6U A;  2UVW A;  2FJZ A;  5KG4 A;  2P0A A;  4C2M A;  5JH7 F;  5FJ8 G;  2DWC A;  2W9B B;  3RBD A;  2R7Z G;  1E4E A;  3N44 B;  4DL7 A;  3GIP A;  4JI1 H;  1V4Y A;  5KG0 A;  2R92 G;  2R84 A;  5LXT F;  5IP9 G;  1PX2 A;  3GTG A;  4BWS C;  4WD3 A;  3GLK A;  2HJW A;  4EGJ A;  1BNC A;  3FDS A;  3QFF A;  1M0T A;  1Z2O X;  1A0I A;  5KFA A;  1TAE A;  2R7Z A;  4MAM A;  3HOV G;  4G3I A;  5KFQ A;  4ECT A;  2R92 A;  3KHL A;  2XGQ A;  3NGD A;  4A3C G;  5C1P A;  4YR3 A;  4A93 G;  4MV6 A;  2DZD A;  3V4S A;  2FE3 A;  2J6S A;  3H40 A;  4ECZ A;  2AGQ A;  1TWH A;  2V59 A;  1GYF A;  2W9C B;  3K5I A;  1S0M A;  1K1Q A;  5KFN A;  1FVI A;  3UQ8 A;  2UXC H;  4HR7 A;  5L1J A;  4YR0 A;  2FB9 A;  1Y1V A;  3JRW A;  3ORR A;  1TA8 A;  2WE6 A;  3WO1 A;  3G8C A;  3BQ1 A;  4ECX A;  2BR0 A;  4FBT A;  2JA5 G;  2VQD A;  3GTQ A;  2XD4 A;  4J9L A;  2ALZ A;  4DR7 H;  5JUM A;  4LF8 H;  3IG0 A;  4J9O A;  3HOZ G;  5BR8 H;  4IZO A;  2YS6 A;  5DGB A;  2ZM6 H;  4GC7 A;  4ECY A;  1K83 A;  4JI4 H;  4LF4 H;  4DR1 H;  5DG7 A;  5A2Q W;  3F8N A;  3MWE A;  3EPG A;  4A3E G;  4UFZ A;  4X65 H;  2C35 B;  3RAX A;  2JA5 A;  2ASD A;  4ECQ A;  1PK8 A;  5D1O A;  3T1H H;  1BJT A;  1CE8 A;  1VS0 A;  1N36 H;  1GGO A;  3PR5 B;  4ED1 A;  2XGP A;  4PDB A;  1XDN A;  1Z2P X;  3J81 W;  3FMA A;  5BPH A;  3Q2O A;  3OUZ A;  4LF5 H;  2MCT A;  5EZY F;  5FPR A;  2NVY A;  4JV0 A;  3OSN A;  2W8L A;  5L1I A;  4J9Q A;  4YBZ B;  2R8G A;  4EBE A;  3GTJ A;  2R7N A;  5KFO A;  4AQY H;  3KAK A;  3VPB A;  1GLV A;  1A9X A;  1S97 A;  4DV7 H;  2W6M A;  1W93 A;  3JSL A;  1GSO A;  5LP6 F;  5KFW A;  2RGV A;  2PMZ A;  2XCP A;  2VA3 A;  4HNT A;  2GPW A;  1FKA H;  4L1K A;  4YP3 A;  2JEJ A;  4O4H F;  3I12 A;  4DV0 H;  1I94 H;  4LH6 A;  2ZJT A;  4UCT A;  2DLN A;  2YRX A;  1I3Q A;  5EWE A;  4E4T A;  1JIH A;  3ETJ A;  4JI8 H;  2FPI B;  4TQS A;  4ECS A;  4DR6 H;  3K3V A;  4ECV A;  2QK4 A;  3N42 B;  4X66 H;  3RF2 A;  4NLG A;  2FK2 A;  3QZ7 A;  2RDI A;  2Q2T A;  2R7L A;  3GIL A;  5DLF A;  4O4I F;  2C2R A;  3GTP A;  5CA0 F;  4XZ3 B;  2R82 A;  5IYD G;  2W6O A;  3KXY T;  2Y0S A;  2W70 A;  3KHG A;  2XIG A;  3R5H A;  5BPF A;  5DG9 A;  3U9S A;  4KHP H;  2W7P A;  2UUC H;  3EYY A;  5KFV A;  2JA6 G;  4DV5 H;  3UFX B;  5EDW A;  4F4W A;  3PW5 A;  5DG8 A;  2AQ4 A;  2SCU B;  2YZM A;  3RGZ A;  5LMN H;  4MTD A;  1RYR A;  4EBD A;  2R8K A;  2R8J A;  3C0F B;  4C5C A;  4XYL B;  1IBL H;  5DLG A;  2E5L H;  1CS0 A;  4RU9 A;  3H4D A;  4NXN H;  4LFB H;  2FP4 B;  4TV9 F;  4DR3 H;  5J2U F;  2JEI A;  1Y14 B;  5KKN B;  3PZP A;  1C30 A;  1P8L A;  3RIZ A;  4JV5 H;  3BG5 A;  3ORQ A;  3H3V H;  5KFM A;  2PVP A;  3LML A;  4R8U A;  4EEQ A;  4TQR A;  3LP8 A;  5FLX W;  1KEE A;  4GKJ H;  2R8I A;  3ETH A;  4X62 H;  5KFD A;  3RV3 A;  4YQW A;  2Y0S E;  4I55 F;  3Q8S B;  2CW8 A;  5KFH A;  1EHI A;  1KJI A;  3BA9 A;  1RK6 A;  4LSA A;  2AU0 A;  5EWG A;  4O3Q A;  4C5B A;  2AGO A;  4Q43 A;  3RV4 A;  2CZG A;  1N48 A;  4RB0 A;  3N6X A;  3U9T A;  2BQU A;  5FD6 A; 
#chains in the Genus database with same CATH homology
 2FKL A;  4PWQ A;  2FK1 A;  2M05 A;  3KTM A;  2FMA A;  1OWT A;  2FK2 A;  2FK3 A;  2FJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...