1OWTA

Structure of the alzheimer's disease amyloid precursor protein copper binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
SDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Alzheimer's Disease Amyloid Precursor Protein Copper Binding Domain. A REGULATOR OF NEURONAL COPPER HOMEOSTASIS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Amyloid beta A4 protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 1owtA00
2M05A 2FK2A 2FMAA 2FK3A 2FK1A 2FKLA 2FJZA 4PWQA 3KTMA 1OWTA
chains in the Genus database with same CATH superfamily
2KSWA 4RB3C 3BQ0A 1IOVA 5IYDG 2NU8B 1R9TA 3KXYT 4YR0A 4RNOA 4YJ2F 4NLGA 2R85A 5DQIA 2W8LA 1N48A 2E5LH 2BQRA 4JI7H 5FJ8G 1ZETA 2YU9A 4RNNA 5JH7F 3FMAA 4M9UA 1N56A 3MR2A 4B3MH 5DG9A 4LFAH 1M7JA 5HV6A 5DQGA 4IRKA 4ZHQF 3VPDA 1V51A 1E4FT 2UUCH 3OTOH 3BAAA 3HOZG 2FPGB 4LMYA 1JDBB 3OSPA 3G6VA 2ASLA 3RGXA 2UUAH 3PW0A 1Y1WG 3M9NB 4IWXA 4DV2H 3GIJA 1ULZA 2CZGA 4NXNH 4HR7A 5KG0A 2YS7A 4UCTA 5CA1F 3WNZA 5I47A 3GV5B 4MV4A 3RB0A 4RUAA 4J9QA 1ZQ7A 3VPBA 5C4XG 4I50F 4EG0A 4BBRG 2W70A 4PDBA 1KJIA 4R8UB 1DV2A 3PR5B 4GKJH 4YB8B 2W7PA 2NU6B 3GQCA 3H4DA 5LXTF 3SI8A 1IBMH 2VQEH 4JI4H 2YW2A 2FPPB 4QIWE 1VAJA 1S10A 5L1KA 3IN5A 1T94A 4J9PA 2J6TA 2IP4A 2ZDQA 3Q8RB 1GSHA 2AGOA 2JEFA 5DG8A 2JA7G 2E2HA 2R7MA 2DIKA 4EYIB 2GPWA 3BA9A 3FKIA 2XD4A 3GTQA 5KFTA 4XYLB 3MR3A 2V4QA 1RYRA 4IAJA 2WTFA 3H20A 3G6XA 5LL6b 3HOXG 2HVQA 4J9MA 4UCVA 3RB6A 4J9SA 2W6NA 3OHAA 4FM9A 2C00A 2AGQA 4I7HA 3UQ8A 3HKZA 1JX4A 3V6JA 4EEYA 3JRWA 2I87A 5JVLA 4QW9A 3BQ1A 4UCOA 1I94H 2C28A 2R92G 1SEIA 3LWBA 4CC5A 4MV3A 1J5EH 2YZGA 2R87A 5H80A 2X0SA 3M9MB 4ECTA 2W6QA 4DR7H 4DV6H 1WR2A 5KFCA 2W6OA 1CS0A 4GLXA 4A93G 1XMQH 4O2AF 2Q2TA 2QYZA 1JXLA 1BJTA 5J2TF 4FS1A 3Q8PB 2QK4A 4J0MA 3LP8A 4J9LA 4O3RA 5C44G 4IWYA 4O3PA 4JUZA 4B3TH 4LF4H 2UXDH 3RBDA 1IOWA 5GONF 1GSOA 2PBZA 4ECYA 3M4IA 4ECRA 1B33N 5KG1A 4PWQA 4F4ZA 1WSCA 3M9OB 2NU9B 5J2UF 4JV2A 2HVSA 2O03A 5BMVF 2CW7A 1ZHSA 1CQJB 5L1IA 4RNMA 3RIZA 2R82A 3R5XA 2JEJA 3H0GA 2W9AA 3OUUA 2BQ3A 1I7LA 2YZMA 2R8GA 2FLPA 2NVYA 5KFPA 3I4NG 2SCUB 4QW8A 5IT9W 1RJRA 5C1PA 4GC6A 2FE3A 4GC7A 3GIDA 4FU0A 1EHIA 2UXCH 3MWDA 4RB1A 3T5LA 2FLNA 2R8IA 3GIIA 2OLSA 1ZHQA 3RAQA 2VQFH 4B3SH 2W71A 2F4VH 5CA0F 2C2EA 2RDIA 2NVXA 1S0MA 1DV1A 4YP3A 2PN1A 4Q44A 2JEIA 1E4EA 4RAYA 1RJPA 3N41B 4ZQIA 2UVRA 3UFXB 4A3GG 2RGVA 3H4BA 3PN1A 2ALZA 5L9XA 4RB0A 1EUDB 4FBTA 4JV5H 5KT2A 2VPQA 2Y0SE 4R8UA 3DF7A 1W93A 4MV6A 1E4GT 3N43B 4A2BA 4LFCH 5F9LA 4ED3A 3ORQA 5LMUH 2YRXA 4RAZA 2PVPA 1Z2OX 1KEEA 1S0OA 4IZOA 3EPGA 4DLKA 4QWBA 5KG6A 2AU0A 4JI6H 3RFCA 5KFYA 3N40P 3EYYA 4YAKB 5KT6A 5FLXW 1K1SA 2YZNA 4ECQA 1V4YA 2FB9A 4J9OA 4XX0B 1HR0H 4KHPH 4MA0A 1GYFA 2CW8A 5KG3A 3R23A 1EYZA 1VBHA 1CQIB 4MTEA 4BBSG 5C5JA 5KFQA 2V9WA 4F4XA 4GKKH 5LP6F 4MAMA 5KFSA 2HHHH 2JA6G 1GSAA 2I80A 4MA5A 4M7EA 1EZ1A 2WDTA 3BG5A 4LH7A 4LFBH 2XCLA 3ORRA 5KFRA 5IP9G 3HOVG 3PO2G 3GTLA 3GTOA 4LF7H 1FVIA 3MWMA 5JVDF 3H3VH 3GTJA 4YQWA 4QIWA 2VPSA 3BQ2A 2ZDHA 3QFFA 5LA6F 2J9GA 3HOWG 4L1KA 5KFMA 2XGQA 4TUYF 5D8DA 5F9NA 4LF5H 5KFOA 2VR1A 3BJYA 4ED7A 2R6FA 5FPRA 2BR0A 1UC8A 4Y8VB 1XDNA 3PZPA 4QWDA 3PR4A 2DZDA 2P0AA 3FDSA 4DV4H 1RK6A 4J9NA 2C2DA 1Y1VG 5KFFA 2W9CB 1UNNC 3T5KA 1K1QA 2V5AA 3GIQA 5D1OB 2W7OA 3T1YH 4FS2A 3J7AK 5IWAH 3HKZE 1B6RA 2W6ZA 3RBEA 3Q8SB 5LYJF 1UC9A 2YRWA 3KHHA 4WD3A 4F50A 4DV7H 5KFDA 3KHGA 3PW4A 2IMWP 3V6KA 1JKJB 4QJFA 2V4RA 1S9FA 3MR6A 4C5CA 3JSLA 3MWEA 5T14A 3IG0A 3Q2OA 4Q0YA 3NGDA 1FKAH 1WCMA 3GTGA 2JA5A 3MFHA 1KBLA 2OH2A 3PW2A 1A0IA 3K5IA 5DLFA 4UCSA 1X9NA 1RK5A 2NUAB 1HNZH 3BABA 2ZDGA 3ETJA 1C30A 3ETHA 3N6XA 5BPHA 3Q1KA 3Q8QB 1TWAA 1MZBA 3VMMA 4LSXA 5FD6A 3L4KA 3BA8A 2VQDA 2FP4B 4DV1H 3OHBA 1IBLH 3N8DA 3CQZA 3MJFA 4O2BF 5D1OA 4O3NA 3RB4A 5A2QW 4IRCA 2W6MA 4X65H 4MV7A 5CAEB 2UUBH 4HYKA 4JI3H 4ETSA 4O4HF 2I8CA 5KFVA 2HJWA 2JA7A 3T5JA 5KKNB 1Y1WA 2NU7B 3GTKA 2ZM6H 3WO0A 3C0FB 4HNVA 4ED8A 3OUZA 3K3VA 4MV1A 4UCUA 5HBRB 4EBEA 3TQ1A 4O3SA 3HB9A 1VKZA 2B63A 4APMA 3GV7B 3HXLA 1M0TA 1B6SA 5KG4A 1DIKA 3N42B 1A9XA 4IR9A 4A3LG 1TA8A 2R93A 2ATLA 4DL6A 2YYAA 2R86A 1PK8A 2HGSA 5KG7A 5KFKA 1N36H 5IP7G 1E4EB 3RTXA 4HNTA 4EFBA 4WBNF 4IR1A 4C5AA 4LF9H 2FPIB 3RJ0A 2FKLA 2GLTA 4ED2A 1SFOA 2B63G 1GO3E 4O4LF 3RAXA 3MFIA 5CB4F 1I50A 4EYHB 2XIGA 3R5HA 4IHJF 5IYCG 3GILA 1KJQA 3GTPA 4JV0A 1M0WA 4ZOLF 4EEQA 2C35B 5DQHA 4YHHH 5K2MA 1FJGH 4Q8FA 2UXBH 1P8LA 5BR8H 4JI5H 1BXRA 1K83A 4UCRA 4JI0H 1DGSA 5KT4A 2W9CA 2FMAA 3KHLA 4A3FG 1N32H 1GLVA 5KX5F 1TWCA 3K3PA 4RUCA 4HNUA 2BQUA 4O3QA 4NXMH 4U6PA 5FD5A 2PMZA 4BY7G 5LOVF 2WE6A 3T1HH 5BPFA 4A3DG 5KG5A 4JV1A 1JIHA 4DR4H 3V4ZA 3I12A 3N44B 1I3QA 4DL4A 4EGQA 5KFBA 4DV5H 5KFWA 2W9BB 2WAQA 1RYSA 3RV3A 4DV0H 4DR1H 3U9SA 3GTMA 5KFZA 2VA3A 4CC6A 1SCUB 1TWHA 1T3NA 5EOYA 4Q8EA 1VBGA 3PW7A 2R92A 4E4TA 5IYBG 4RU9A 5KT7A 3RGZA 3R5FA 3HBLA 4UFZA 3TINA 2XC9A 2W8KA 3CVZA 3WO1A 1XNQH 1TWFA 2XCAA 2FK1A 4I55F 1XMOH 4LF8H 5D1PA 4BWSC 4Q43A 3QZ7A 3KALA 5KFXA 5L1JA 4DR2H 2GPSA 3QZ8A 4DL5A 1HNXH 2RGRA 2FLLA 3HOYG 2R7ZA 2ASDA 1S03G 5C8YF 3H40A 3GIKA 4F4WA 3RV4A 5DG7A 5KT5A 4ECVA 2XGPA 4YAJB 4RZRA 1BNCA 2XCPA 5LMNH 2FK2A 2DPJA 2FK3A 3PW5A 4DL2A 2AQ4A 3GV8B 4C2MA 1KJJA 4O3OA 5KFJA 3OSNA 1I7NA 3GIMA 1M6VA 4EFEA 2C22A 1N33H 5JQWA 2R7ZG 2W9BA 3K5HA 4DR5H 2R8HA 3LMLA 4MV8A 3KTMA 4J9KA 2RDJA 1T36A 1GGOA 4ED0A 1Z2NX 4C5BA 2AGPA 2R84A 4QWEA 4MTDA 2VUMA 1AN7A 4ECXA 3FKIG 4RZQA 3G6YA 2JA6A 3VPCA 3JZIA 5KFIA 3U9TA 4DL3A 4X66H 2RF4A 4AYBA 4RB2C 4QWCA 1EUCB 4TQSA 2VA2A 4XYMB 4DV3H 1I6UA 2J6UA 5FLMG 3HOUG 4DL7A 2C2RA 4YY3H 2DLNA 4A3BG 5KG2A 4ME6A 4ECSA 2YCHA 4ECWA 1BGWA 4TV9F 2R7NA 5EWFA 4DUZH 1KJ8A 1TWGA 2DWCA 2CQYA 3JSNA 1O75A 1OWTA 5L1LA 4LH6A 1RJQA 4F4YA 1Y14B 4AYBE 4LSAA 4YR3A 2IA6A 3GIPA 3J81W 3V6HA 2PMZE 1S0NA 5C3EG 1C3OA 4EGJA 3JAMW 5KFGA 3F8NA 4ECUA 2UU9H 3RB3A 3KAJA 3RUPA 1V9PA 3G8CA 4X64H 1N34H 1B04A 5KFLA 3TIGA 3AYHB 4EBCA 4TQRA 3SE7A 4JYAH 2E2IA 2VOBA 4LF6H 1KJ9A 2V58A 4BY1G 2HVRA 1XNRH 3E5NA 3PO3G 4R7RA 4BXXG 4ED6A 2Q2UA 1SYXB 2R93G 4U7CA 4A3CG 2ZJTA 5EDWA 2JA5G 2IBKA 4DUYH 2UVWA 2Y0SA 1VS0A 1WH2A 1S68A 2CKZB 4YR2A 1JDEA 3T5HA 2JA8G 2VUMG 3TIIA 3EPIA 1Z2PX 2FJZA 4YBZB 1HNWH 5EWGA 2WB1A 4Q45A 4ZI7F 4JI2H 3L2PA 4HQ6A 5KFEA 5C1OA 1JLLB 2R7KA 4ECZA 4ED1A 4A3EG 3H0GG 2MCTA 2YL2A 1PX2A 1L2ZA 4MV9A 3V4SA 2OWOA 4JI1H 1AUXA 3PVXA 1Y1VA 4DR3H 4QWAA 4EBDA 2JEGA 3TQTA 4A2AA 4X62H 5KT3A 3KHRA 1AUVA 2WAQE 4TV8F 3JRXA 2WB1E 1S97A 4OX9H 4A3KG 5KFAA 4JI8H 2W57A 5JUMA 1W96A 4B3RH 2M05A 2WYOA 4A3IG 2W6PA 3RF2A 3J80W 1IBKH 4A3MG 2J6SA 3I4MG 2DPIA 2R8JA 4K0KH 4AQYH 4YJ3F 2UVVA 1TAEA 4O4IF 5EZYF 3GLKA 5IYZF 5KFUA 3L4JA 1WCMG 2YS6A 4DR6H 2VUGA 4A3JG 2ASJA 4J9RA 4G3IA 2V59A 4I4TF 1KC7A 4XZ3B 5KFNA 5DLGA 5DGBA 2R7LA 5EWEA 2UVUA 2R8KA 4IRDA 3MR5A 1CE8A 5DGAA 5KFHA 4FBUA 3KAKA 5FPOA
chains in the Genus database with same CATH topology
2M05A 2FK2A 2FMAA 2FK3A 2FK1A 2FKLA 2FJZA 4PWQA 3KTMA 1OWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M05 A;  2FK2 A;  2FMA A;  2FK3 A;  2FK1 A;  2FKL A;  2FJZ A;  4PWQ A;  3KTM A;  1OWT A; 
#chains in the Genus database with same CATH topology
 2KSW A;  4RB3 C;  3BQ0 A;  1IOV A;  5IYD G;  2NU8 B;  1R9T A;  3KXY T;  4YR0 A;  4RNO A;  4YJ2 F;  4NLG A;  2R85 A;  5DQI A;  2W8L A;  1N48 A;  2E5L H;  2BQR A;  4JI7 H;  5FJ8 G;  1ZET A;  2YU9 A;  4RNN A;  5JH7 F;  3FMA A;  4M9U A;  1N56 A;  3MR2 A;  4B3M H;  5DG9 A;  4LFA H;  1M7J A;  5HV6 A;  5DQG A;  4IRK A;  4ZHQ F;  3VPD A;  1V51 A;  1E4F T;  2UUC H;  3OTO H;  3BAA A;  3HOZ G;  2FPG B;  4LMY A;  1JDB B;  3OSP A;  3G6V A;  2ASL A;  3RGX A;  2UUA H;  3PW0 A;  1Y1W G;  3M9N B;  4IWX A;  4DV2 H;  3GIJ A;  1ULZ A;  2CZG A;  4NXN H;  4HR7 A;  5KG0 A;  2YS7 A;  4UCT A;  5CA1 F;  3WNZ A;  5I47 A;  3GV5 B;  4MV4 A;  3RB0 A;  4RUA A;  4J9Q A;  1ZQ7 A;  3VPB A;  5C4X G;  4I50 F;  4EG0 A;  4BBR G;  2W70 A;  4PDB A;  1KJI A;  4R8U B;  1DV2 A;  3PR5 B;  4GKJ H;  4YB8 B;  2W7P A;  2NU6 B;  3GQC A;  3H4D A;  5LXT F;  3SI8 A;  1IBM H;  2VQE H;  4JI4 H;  2YW2 A;  2FPP B;  4QIW E;  1VAJ A;  1S10 A;  5L1K A;  3IN5 A;  1T94 A;  4J9P A;  2J6T A;  2IP4 A;  2ZDQ A;  3Q8R B;  1GSH A;  2AGO A;  2JEF A;  5DG8 A;  2JA7 G;  2E2H A;  2R7M A;  2DIK A;  4EYI B;  2GPW A;  3BA9 A;  3FKI A;  2XD4 A;  3GTQ A;  5KFT A;  4XYL B;  3MR3 A;  2V4Q A;  1RYR A;  4IAJ A;  2WTF A;  3H20 A;  3G6X A;  5LL6 b;  3HOX G;  2HVQ A;  4J9M A;  4UCV A;  3RB6 A;  4J9S A;  2W6N A;  3OHA A;  4FM9 A;  2C00 A;  2AGQ A;  4I7H A;  3UQ8 A;  3HKZ A;  1JX4 A;  3V6J A;  4EEY A;  3JRW A;  2I87 A;  5JVL A;  4QW9 A;  3BQ1 A;  4UCO A;  1I94 H;  2C28 A;  2R92 G;  1SEI A;  3LWB A;  4CC5 A;  4MV3 A;  1J5E H;  2YZG A;  2R87 A;  5H80 A;  2X0S A;  3M9M B;  4ECT A;  2W6Q A;  4DR7 H;  4DV6 H;  1WR2 A;  5KFC A;  2W6O A;  1CS0 A;  4GLX A;  4A93 G;  1XMQ H;  4O2A F;  2Q2T A;  2QYZ A;  1JXL A;  1BJT A;  5J2T F;  4FS1 A;  3Q8P B;  2QK4 A;  4J0M A;  3LP8 A;  4J9L A;  4O3R A;  5C44 G;  4IWY A;  4O3P A;  4JUZ A;  4B3T H;  4LF4 H;  2UXD H;  3RBD A;  1IOW A;  5GON F;  1GSO A;  2PBZ A;  4ECY A;  3M4I A;  4ECR A;  1B33 N;  5KG1 A;  4PWQ A;  4F4Z A;  1WSC A;  3M9O B;  2NU9 B;  5J2U F;  4JV2 A;  2HVS A;  2O03 A;  5BMV F;  2CW7 A;  1ZHS A;  1CQJ B;  5L1I A;  4RNM A;  3RIZ A;  2R82 A;  3R5X A;  2JEJ A;  3H0G A;  2W9A A;  3OUU A;  2BQ3 A;  1I7L A;  2YZM A;  2R8G A;  2FLP A;  2NVY A;  5KFP A;  3I4N G;  2SCU B;  4QW8 A;  5IT9 W;  1RJR A;  5C1P A;  4GC6 A;  2FE3 A;  4GC7 A;  3GID A;  4FU0 A;  1EHI A;  2UXC H;  3MWD A;  4RB1 A;  3T5L A;  2FLN A;  2R8I A;  3GII A;  2OLS A;  1ZHQ A;  3RAQ A;  2VQF H;  4B3S H;  2W71 A;  2F4V H;  5CA0 F;  2C2E A;  2RDI A;  2NVX A;  1S0M A;  1DV1 A;  4YP3 A;  2PN1 A;  4Q44 A;  2JEI A;  1E4E A;  4RAY A;  1RJP A;  3N41 B;  4ZQI A;  2UVR A;  3UFX B;  4A3G G;  2RGV A;  3H4B A;  3PN1 A;  2ALZ A;  5L9X A;  4RB0 A;  1EUD B;  4FBT A;  4JV5 H;  5KT2 A;  2VPQ A;  2Y0S E;  4R8U A;  3DF7 A;  1W93 A;  4MV6 A;  1E4G T;  3N43 B;  4A2B A;  4LFC H;  5F9L A;  4ED3 A;  3ORQ A;  5LMU H;  2YRX A;  4RAZ A;  2PVP A;  1Z2O X;  1KEE A;  1S0O A;  4IZO A;  3EPG A;  4DLK A;  4QWB A;  5KG6 A;  2AU0 A;  4JI6 H;  3RFC A;  5KFY A;  3N40 P;  3EYY A;  4YAK B;  5KT6 A;  5FLX W;  1K1S A;  2YZN A;  4ECQ A;  1V4Y A;  2FB9 A;  4J9O A;  4XX0 B;  1HR0 H;  4KHP H;  4MA0 A;  1GYF A;  2CW8 A;  5KG3 A;  3R23 A;  1EYZ A;  1VBH A;  1CQI B;  4MTE A;  4BBS G;  5C5J A;  5KFQ A;  2V9W A;  4F4X A;  4GKK H;  5LP6 F;  4MAM A;  5KFS A;  2HHH H;  2JA6 G;  1GSA A;  2I80 A;  4MA5 A;  4M7E A;  1EZ1 A;  2WDT A;  3BG5 A;  4LH7 A;  4LFB H;  2XCL A;  3ORR A;  5KFR A;  5IP9 G;  3HOV G;  3PO2 G;  3GTL A;  3GTO A;  4LF7 H;  1FVI A;  3MWM A;  5JVD F;  3H3V H;  3GTJ A;  4YQW A;  4QIW A;  2VPS A;  3BQ2 A;  2ZDH A;  3QFF A;  5LA6 F;  2J9G A;  3HOW G;  4L1K A;  5KFM A;  2XGQ A;  4TUY F;  5D8D A;  5F9N A;  4LF5 H;  5KFO A;  2VR1 A;  3BJY A;  4ED7 A;  2R6F A;  5FPR A;  2BR0 A;  1UC8 A;  4Y8V B;  1XDN A;  3PZP A;  4QWD A;  3PR4 A;  2DZD A;  2P0A A;  3FDS A;  4DV4 H;  1RK6 A;  4J9N A;  2C2D A;  1Y1V G;  5KFF A;  2W9C B;  1UNN C;  3T5K A;  1K1Q A;  2V5A A;  3GIQ A;  5D1O B;  2W7O A;  3T1Y H;  4FS2 A;  3J7A K;  5IWA H;  3HKZ E;  1B6R A;  2W6Z A;  3RBE A;  3Q8S B;  5LYJ F;  1UC9 A;  2YRW A;  3KHH A;  4WD3 A;  4F50 A;  4DV7 H;  5KFD A;  3KHG A;  3PW4 A;  2IMW P;  3V6K A;  1JKJ B;  4QJF A;  2V4R A;  1S9F A;  3MR6 A;  4C5C A;  3JSL A;  3MWE A;  5T14 A;  3IG0 A;  3Q2O A;  4Q0Y A;  3NGD A;  1FKA H;  1WCM A;  3GTG A;  2JA5 A;  3MFH A;  1KBL A;  2OH2 A;  3PW2 A;  1A0I A;  3K5I A;  5DLF A;  4UCS A;  1X9N A;  1RK5 A;  2NUA B;  1HNZ H;  3BAB A;  2ZDG A;  3ETJ A;  1C30 A;  3ETH A;  3N6X A;  5BPH A;  3Q1K A;  3Q8Q B;  1TWA A;  1MZB A;  3VMM A;  4LSX A;  5FD6 A;  3L4K A;  3BA8 A;  2VQD A;  2FP4 B;  4DV1 H;  3OHB A;  1IBL H;  3N8D A;  3CQZ A;  3MJF A;  4O2B F;  5D1O A;  4O3N A;  3RB4 A;  5A2Q W;  4IRC A;  2W6M A;  4X65 H;  4MV7 A;  5CAE B;  2UUB H;  4HYK A;  4JI3 H;  4ETS A;  4O4H F;  2I8C A;  5KFV A;  2HJW A;  2JA7 A;  3T5J A;  5KKN B;  1Y1W A;  2NU7 B;  3GTK A;  2ZM6 H;  3WO0 A;  3C0F B;  4HNV A;  4ED8 A;  3OUZ A;  3K3V A;  4MV1 A;  4UCU A;  5HBR B;  4EBE A;  3TQ1 A;  4O3S A;  3HB9 A;  1VKZ A;  2B63 A;  4APM A;  3GV7 B;  3HXL A;  1M0T A;  1B6S A;  5KG4 A;  1DIK A;  3N42 B;  1A9X A;  4IR9 A;  4A3L G;  1TA8 A;  2R93 A;  2ATL A;  4DL6 A;  2YYA A;  2R86 A;  1PK8 A;  2HGS A;  5KG7 A;  5KFK A;  1N36 H;  5IP7 G;  1E4E B;  3RTX A;  4HNT A;  4EFB A;  4WBN F;  4IR1 A;  4C5A A;  4LF9 H;  2FPI B;  3RJ0 A;  2FKL A;  2GLT A;  4ED2 A;  1SFO A;  2B63 G;  1GO3 E;  4O4L F;  3RAX A;  3MFI A;  5CB4 F;  1I50 A;  4EYH B;  2XIG A;  3R5H A;  4IHJ F;  5IYC G;  3GIL A;  1KJQ A;  3GTP A;  4JV0 A;  1M0W A;  4ZOL F;  4EEQ A;  2C35 B;  5DQH A;  4YHH H;  5K2M A;  1FJG H;  4Q8F A;  2UXB H;  1P8L A;  5BR8 H;  4JI5 H;  1BXR A;  1K83 A;  4UCR A;  4JI0 H;  1DGS A;  5KT4 A;  2W9C A;  2FMA A;  3KHL A;  4A3F G;  1N32 H;  1GLV A;  5KX5 F;  1TWC A;  3K3P A;  4RUC A;  4HNU A;  2BQU A;  4O3Q A;  4NXM H;  4U6P A;  5FD5 A;  2PMZ A;  4BY7 G;  5LOV F;  2WE6 A;  3T1H H;  5BPF A;  4A3D G;  5KG5 A;  4JV1 A;  1JIH A;  4DR4 H;  3V4Z A;  3I12 A;  3N44 B;  1I3Q A;  4DL4 A;  4EGQ A;  5KFB A;  4DV5 H;  5KFW A;  2W9B B;  2WAQ A;  1RYS A;  3RV3 A;  4DV0 H;  4DR1 H;  3U9S A;  3GTM A;  5KFZ A;  2VA3 A;  4CC6 A;  1SCU B;  1TWH A;  1T3N A;  5EOY A;  4Q8E A;  1VBG A;  3PW7 A;  2R92 A;  4E4T A;  5IYB G;  4RU9 A;  5KT7 A;  3RGZ A;  3R5F A;  3HBL A;  4UFZ A;  3TIN A;  2XC9 A;  2W8K A;  3CVZ A;  3WO1 A;  1XNQ H;  1TWF A;  2XCA A;  2FK1 A;  4I55 F;  1XMO H;  4LF8 H;  5D1P A;  4BWS C;  4Q43 A;  3QZ7 A;  3KAL A;  5KFX A;  5L1J A;  4DR2 H;  2GPS A;  3QZ8 A;  4DL5 A;  1HNX H;  2RGR A;  2FLL A;  3HOY G;  2R7Z A;  2ASD A;  1S03 G;  5C8Y F;  3H40 A;  3GIK A;  4F4W A;  3RV4 A;  5DG7 A;  5KT5 A;  4ECV A;  2XGP A;  4YAJ B;  4RZR A;  1BNC A;  2XCP A;  5LMN H;  2FK2 A;  2DPJ A;  2FK3 A;  3PW5 A;  4DL2 A;  2AQ4 A;  3GV8 B;  4C2M A;  1KJJ A;  4O3O A;  5KFJ A;  3OSN A;  1I7N A;  3GIM A;  1M6V A;  4EFE A;  2C22 A;  1N33 H;  5JQW A;  2R7Z G;  2W9B A;  3K5H A;  4DR5 H;  2R8H A;  3LML A;  4MV8 A;  3KTM A;  4J9K A;  2RDJ A;  1T36 A;  1GGO A;  4ED0 A;  1Z2N X;  4C5B A;  2AGP A;  2R84 A;  4QWE A;  4MTD A;  2VUM A;  1AN7 A;  4ECX A;  3FKI G;  4RZQ A;  3G6Y A;  2JA6 A;  3VPC A;  3JZI A;  5KFI A;  3U9T A;  4DL3 A;  4X66 H;  2RF4 A;  4AYB A;  4RB2 C;  4QWC A;  1EUC B;  4TQS A;  2VA2 A;  4XYM B;  4DV3 H;  1I6U A;  2J6U A;  5FLM G;  3HOU G;  4DL7 A;  2C2R A;  4YY3 H;  2DLN A;  4A3B G;  5KG2 A;  4ME6 A;  4ECS A;  2YCH A;  4ECW A;  1BGW A;  4TV9 F;  2R7N A;  5EWF A;  4DUZ H;  1KJ8 A;  1TWG A;  2DWC A;  2CQY A;  3JSN A;  1O75 A;  1OWT A;  5L1L A;  4LH6 A;  1RJQ A;  4F4Y A;  1Y14 B;  4AYB E;  4LSA A;  4YR3 A;  2IA6 A;  3GIP A;  3J81 W;  3V6H A;  2PMZ E;  1S0N A;  5C3E G;  1C3O A;  4EGJ A;  3JAM W;  5KFG A;  3F8N A;  4ECU A;  2UU9 H;  3RB3 A;  3KAJ A;  3RUP A;  1V9P A;  3G8C A;  4X64 H;  1N34 H;  1B04 A;  5KFL A;  3TIG A;  3AYH B;  4EBC A;  4TQR A;  3SE7 A;  4JYA H;  2E2I A;  2VOB A;  4LF6 H;  1KJ9 A;  2V58 A;  4BY1 G;  2HVR A;  1XNR H;  3E5N A;  3PO3 G;  4R7R A;  4BXX G;  4ED6 A;  2Q2U A;  1SYX B;  2R93 G;  4U7C A;  4A3C G;  2ZJT A;  5EDW A;  2JA5 G;  2IBK A;  4DUY H;  2UVW A;  2Y0S A;  1VS0 A;  1WH2 A;  1S68 A;  2CKZ B;  4YR2 A;  1JDE A;  3T5H A;  2JA8 G;  2VUM G;  3TII A;  3EPI A;  1Z2P X;  2FJZ A;  4YBZ B;  1HNW H;  5EWG A;  2WB1 A;  4Q45 A;  4ZI7 F;  4JI2 H;  3L2P A;  4HQ6 A;  5KFE A;  5C1O A;  1JLL B;  2R7K A;  4ECZ A;  4ED1 A;  4A3E G;  3H0G G;  2MCT A;  2YL2 A;  1PX2 A;  1L2Z A;  4MV9 A;  3V4S A;  2OWO A;  4JI1 H;  1AUX A;  3PVX A;  1Y1V A;  4DR3 H;  4QWA A;  4EBD A;  2JEG A;  3TQT A;  4A2A A;  4X62 H;  5KT3 A;  3KHR A;  1AUV A;  2WAQ E;  4TV8 F;  3JRX A;  2WB1 E;  1S97 A;  4OX9 H;  4A3K G;  5KFA A;  4JI8 H;  2W57 A;  5JUM A;  1W96 A;  4B3R H;  2M05 A;  2WYO A;  4A3I G;  2W6P A;  3RF2 A;  3J80 W;  1IBK H;  4A3M G;  2J6S A;  3I4M G;  2DPI A;  2R8J A;  4K0K H;  4AQY H;  4YJ3 F;  2UVV A;  1TAE A;  4O4I F;  5EZY F;  3GLK A;  5IYZ F;  5KFU A;  3L4J A;  1WCM G;  2YS6 A;  4DR6 H;  2VUG A;  4A3J G;  2ASJ A;  4J9R A;  4G3I A;  2V59 A;  4I4T F;  1KC7 A;  4XZ3 B;  5KFN A;  5DLG A;  5DGB A;  2R7L A;  5EWE A;  2UVU A;  2R8K A;  4IRD A;  3MR5 A;  1CE8 A;  5DGA A;  5KFH A;  4FBU A;  3KAK A;  5FPO A; 
#chains in the Genus database with same CATH homology
 2M05 A;  2FK2 A;  2FMA A;  2FK3 A;  2FK1 A;  2FKL A;  2FJZ A;  4PWQ A;  3KTM A;  1OWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...