1OWTA

Structure of the alzheimer's disease amyloid precursor protein copper binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
SDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Alzheimer's Disease Amyloid Precursor Protein Copper Binding Domain. A REGULATOR OF NEURONAL COPPER HOMEOSTASIS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Amyloid beta A4 protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 1owtA00
2FK3A 2FMAA 3KTMA 2FKLA 4PWQA 2FK2A 2FJZA 1OWTA 2M05A 2FK1A
chains in the Genus database with same CATH superfamily
2NU8B 5A2QW 1K83A 3RBDA 4M7EA 4EFBA 4EEYA 2VQDA 3K5HA 3RV4A 3V6HA 3RV3A 4LH6A 1DGSA 1VS0A 4DV1H 4IHJF 5KG0A 5KT7A 2ZDHA 5JVDF 3MR5A 3MWMA 5DLGA 4J9SA 5EDWA 1UC9A 2UUBH 2UVVA 4B3MH 3R5FA 1RJPA 4RNMA 2HVQA 3PR5B 4ECYA 1DV2A 1DIKA 4RB2C 2UUCH 2E5LH 4A3LG 2JEIA 5KFPA 3GIDA 5KFSA 3ETJA 1C30A 4JI7H 4MV8A 4HNTA 3KHGA 4ED2A 1Y1VG 4YR3A 4X62H 1N48A 3FMAA 5BPFA 4A3CG 2RGRA 4JI3H 1A0IA 1M0TA 2C2DA 3HB9A 3SI8A 4MV1A 4CC5A 5KKNB 4BWSC 4ZOLF 3RB3A 4I50F 5JUMA 3JRXA 4Q45A 4J9LA 3HOYG 3MFIA 3T5KA 2PBZA 2WTFA 4G3IA 1WCMG 4MA0A 2R86A 4R8UA 1BGWA 1TWGA 2C00A 4A3EG 3HOZG 1GSAA 4ECUA 4FBTA 2QYZA 5EOYA 3G8CA 5KFFA 3RJ0A 4DL2A 1B33N 5KG4A 2I87A 2RDJA 4X65H 4O3SA 3VPDA 3BG5A 3RF2A 2PMZE 5KFHA 5KG7A 1ZHQA 1E4FT 1PK8A 3R5HA 2JA5G 1KJJA 2YU9A 3H3VH 2YZMA 3G6XA 1N32H 1S0OA 3MWEA 3GTLA 4ETSA 4DL6A 5BR8H 4LF4H 4LF8H 1VKZA 1S03G 4RUAA 5EZYF 3KXYT 4AYBA 5HV6A 4J9OA 2IMWP 3T5HA 5F9LA 2RF4A 3Q8SB 4IWXA 3PN1A 3H20A 3R5XA 3PR4A 2FP4B 4BY7G 5KFEA 2WAQE 4M9UA 3BQ2A 3GIIA 1WR2A 2PVPA 3KAKA 3OHBA 2J9GA 3CQZA 3I4NG 5FJ8G 5IYCG 4RNOA 1JIHA 2RGVA 2JA6G 2R93A 4JV1A 5KT6A 1B6RA 5LMUH 5IYDG 4ED8A 3PW0A 5KFVA 2NU9B 2V5AA 2W9BB 2R84A 1JLLB 4ED1A 3H0GG 3BJYA 1MZBA 3PW5A 3HOWG 2KSWA 4YB8B 4TUYF 4NLGA 3WO1A 3OSPA 2VQFH 4O2AF 3PW4A 5KFJA 1S0MA 1K1SA 3GV7B 2UUAH 5KFGA 5KFOA 1HNWH 2R8GA 1S9FA 1GSHA 4UCVA 2R7MA 5KT2A 4QWCA 2RDIA 2OWOA 2ASLA 4J9MA 2FLPA 1V4YA 3BA9A 4MV9A 4C2MA 1IOWA 4ECRA 3MR6A 1EYZA 2FB9A 3KHRA 4C5BA 5LOVF 1CS0A 5KX5F 1Z2NX 1IBKH 3KHLA 1ULZA 3RTXA 3IG0A 4EBCA 2FK2A 1I3QA 4CC6A 4YJ3F 2I8CA 4Y8VB 3H0GA 3V4SA 1CQJB 1J5EH 2YCHA 3FKIG 3GIQA 2W9CB 4HQ6A 3EPIA 3PO2G 2NVYA 4RZQA 1ZETA 2OH2A 1RK6A 3ORQA 4RAZA 2W9BA 3RB6A 3RB0A 1XNQH 3J7AK 4J9KA 1Y1WA 2WB1A 1WH2A 2BQ3A 3ORRA 4Q44A 5L1LA 1KJ9A 4MTDA 1T94A 2NUAB 2PMZA 5H80A 3GIMA 5D8DA 2YS7A 3F8NA 3JZIA 4ME6A 2W6PA 4DR3H 3K3VA 1XMOH 1SYXB 5KFQA 5J2UF 2R92A 1O75A 3FDSA 3M4IA 1W93A 3Q8RB 1RYSA 1VBGA 1JDEA 2B63G 2PN1A 3U9SA 4IRKA 4F4YA 4DR7H 1I6UA 1FVIA 1KBLA 1B04A 5KFNA 2XGPA 5EWGA 4A3IG 4BBSG 2FKLA 4MTEA 4GKKH 2ZDGA 3PVXA 4FM9A 3I4MG 5EWEA 3RB4A 1JKJB 2R8HA 2W7PA 3N43B 5C1PA 4O3PA 2W6ZA 1E4EB 3T5LA 4ED6A 2R8IA 3RUPA 3GIKA 1AUVA 3G6VA 3VMMA 3T1HH 2F4VH 1S68A 2AQ4A 2NU7B 4DV0H 4FBUA 1Y1VA 2Y0SE 4EYIB 2W6QA 1N56A 2IBKA 4IZOA 3WNZA 3GV5B 1ZQ7A 2Q2UA 3U9TA 5FPOA 1TWFA 2VPQA 2C2EA 1S97A 4BY1G 2UXCH 2R85A 2CQYA 3HOUG 4QWBA 4A3MG 3N40P 2AU0A 2HGSA 1GLVA 1RJRA 3R23A 3RGXA 1GO3E 3M9OB 4F4ZA 4ED7A 3JSLA 1DV1A 4Q43A 1M6VA 3Q8QB 4QWDA 3TINA 4O2BF 4DUYH 2I80A 3TQTA 5L1KA 3E5NA 1TWHA 3Q1KA 2FLLA 4IWYA 4QWEA 3PO3G 5DLFA 5KFLA 2YS6A 2BQUA 4O3QA 3HOVG 2V4QA 4XZ3B 1EUCB 4JUZA 5LYJF 1R9TA 5CA1F 2XD4A 4DV4H 4A3GG 1RK5A 4JI0H 4DL5A 1GGOA 2WYOA 3LMLA 4EEQA 3I12A 4C5CA 2JA7G 1B6SA 3OUUA 3IN5A 2BR0A 4F50A 2FLNA 4J0MA 4YP3A 4LF6H 3CVZA 5FLXW 3H4BA 4UCTA 2VOBA 5KFBA 3BA8A 2J6UA 4LFCH 1SCUB 2VPSA 3HXLA 1IBMH 2FMAA 2FPPB 5DQGA 3LWBA 2BQRA 4IR9A 2E2IA 5C44G 4AYBE 5FD5A 4JV2A 5D1OA 3UFXB 2R7NA 4LF9H 1TWCA 3OUZA 2JEFA 3M9NB 3QZ7A 5KG1A 4B3TH 1S0NA 4IAJA 4ECZA 2ZDQA 1Z2PX 5C5JA 3MJFA 1GYFA 2FE3A 3OHAA 3GIPA 1XNRH 4QW9A 1C3OA 4JV0A 4DLKA 5K2MA 2W7OA 1RYRA 4LF5H 2VA3A 3V4ZA 2ZM6H 2UVUA 5KFUA 4A93G 2AGOA 2X0SA 4LSXA 2UVWA 5IWAH 5KFIA 1Z2OX 1HR0H 2NVXA 4PWQA 5KFKA 4DR5H 2GLTA 2DPIA 5LMNH 2B63A 2OLSA 1I94H 5IYZF 4A3JG 4DV3H 4JI5H 2SCUB 4TV8F 5KT5A 5IP9G 2C35B 1GSOA 4RU9A 5L1IA 1KJ8A 2YRWA 2YL2A 3JAMW 4RNNA 5L9XA 4J9QA 4GC7A 4PDBA 1A9XA 1JDBB 5KFMA 5DGAA 4LFBH 5D1OB 1BJTA 4ECSA 2VUMG 5DG9A 2VUMA 4O4HF 1S10A 4XX0B 5KFZA 4ZHQF 4EG0A 4DL3A 4TQSA 1SFOA 3RIZA 2IA6A 2CW7A 2FK3A 4HNVA 1CE8A 3G6YA 4J9RA 2GPSA 4EGJA 2FPIB 5JH7F 4R8UB 4TQRA 3GTJA 4DUZH 4GKJH 2DIKA 1V9PA 3BQ1A 4GC6A 4J9NA 3GTKA 4QJFA 3MR3A 4UCUA 3EYYA 4DV2H 1JXLA 4HR7A 4LMYA 4MAMA 5BPHA 3GILA 1I50A 4XYMB 3K3PA 2FPGB 2YYAA 3LP8A 2W70A 4RB3C 3GTQA 4A3DG 2CZGA 3KHHA 5J2TF 4BBRG 1I7NA 2VQEH 2J6TA 4F4WA 5IP7G 2JEJA 2R8JA 4J9PA 3OSNA 4DR2H 1EHIA 1T3NA 2WE6A 4UCRA 2DWCA 3KALA 4IRCA 2YZGA 4NXNH 4LH7A 4B3RH 4O4LF 2IP4A 4U7CA 1N34H 3RAQA 5D1PA 2ASJA 2AGPA 2Y0SA 2W71A 5LA6F 2ATLA 4C5AA 2XGQA 2XIGA 4JI2H 3WO0A 4EFEA 3RBEA 4O3NA 3T5JA 5GONF 4APMA 4O4IF 2ALZA 3T1YH 2VUGA 4TV9F 2W8KA 3HOXG 5KT4A 5T14A 3RFCA 4B3SH 2UXBH 4EGQA 5KFCA 3L2PA 2MCTA 4WD3A 2W6NA 1V51A 5C4XG 2QK4A 3DF7A 2M05A 4F4XA 4MV7A 1AN7A 4JI4H 4HYKA 4A2AA 5IYBG 3J80W 4LF7H 4K0KH 4WBNF 3TQ1A 3H40A 4IR1A 2JA8G 1BXRA 2V59A 4FU0A 2HJWA 4DV6H 2R7ZA 4EBEA 4X66H 1KJIA 4XYLB 4LFAH 2R7ZG 4GLXA 4JI6H 5FPRA 3QZ8A 4ECVA 4RAYA 1BNCA 5C1OA 1TWAA 2NU6B 3SE7A 3BQ0A 1UNNC 4RB1A 4U6PA 2XCPA 1N33H 1IBLH 2DLNA 1RJQA 2Q2TA 2FK1A 3UQ8A 4UFZA 4DV7H 3EPGA 4YY3H 4ECXA 5CA0F 1KC7A 5KFWA 1K1QA 2WB1E 3GIJA 2R8KA 3PZPA 1Y14B 5DGBA 3K5IA 4HNUA 4NXMH 3BAAA 2R87A 5FD6A 2DZDA 4AQYH 4DR4H 4ED0A 1EUDB 1SEIA 2WAQA 3MR2A 3TIIA 2J6SA 2HVRA 1KEEA 2JA7A 5F9NA 1P8LA 1L2ZA 2UXDH 4Q0YA 3L4JA 5KG3A 3Q8PB 1WCMA 4I4TF 2O03A 1N36H 2JA5A 5KFRA 4UCSA 2C28A 5JQWA 2XCLA 3NGDA 3L4KA 3KAJA 4YR0A 3C0FB 4ED3A 3GTGA 4ECWA 3PW7A 1X9NA 2W6OA 2C2RA 5JVLA 1W96A 2ASDA 4MV6A 3MFHA 1FKAH 4Q8EA 4O3RA 2HVSA 4JV5H 3TIGA 5BMVF 2AGQA 4Q8FA 4RZRA 1M0WA 3ETHA 3RAXA 4QW8A 4QWAA 1M7JA 3PW2A 1E4EA 2YRXA 5L1JA 5FLMG 5DG7A 4I55F 4E4TA 4YBZB 2R7LA 3GLKA 1TA8A 3JRWA 2V58A 5KFYA 3VPCA 1WSCA 1E4GT 5LXTF 4DL4A 2FJZA 5KG5A 3GTMA 4JYAH 1I7LA 2R82A 5IT9W 2R6FA 4YHHH 4YR2A 4EYHB 2R7KA 4MV4A 2R92G 1VBHA 4DL7A 3GV8B 4JI1H 5DQIA 4ECTA 3MWDA 2WDTA 4YAKB 2XCAA 2YW2A 4L1KA 4JI8H 3JSNA 5KG6A 5C8YF 1VAJA 4R7RA 2W9CA 5HBRB 2R93G 2JA6A 3H4DA 2CKZB 3AYHB 5KG2A 3GQCA 4QIWE 1HNZH 2V4RA 1T36A 1ZHSA 1XDNA 3HKZA 3N41B 4A2BA 1Y1WG 1HNXH 2HHHH 3HKZE 4MA5A 2ZJTA 3GTPA 2UVRA 2GPWA 3N42B 3N8DA 4X64H 4ZQIA 2XC9A 4OX9H 1PX2A 2UU9H 2V9WA 4DR6H 4O3OA 4RUCA 2VA2A 4ZI7F 4A3FG 1UC8A 3RGZA 3N44B 5CB4F 4EBDA 4ECQA 2JEGA 4YJ2F 4YAJB 5LP6F 2VR1A 3HBLA 3KTMA 2E2HA 4MV3A 2YZNA 4UCOA 1OWTA 5LL6b 1CQIB 5DQHA 3GTOA 5C3EG 4FS2A 2P0AA 4FS1A 5KFXA 2DPJA 5EWFA 3M9MB 1FJGH 3OTOH 1XMQH 1JX4A 4QIWA 4LSAA 4IRDA 3FKIA 5KFDA 4YQWA 3N6XA 5DG8A 2C22A 1KJQA 3V6JA 4RB0A 4I7HA 5I47A 3V6KA 1IOVA 5CAEB 1EZ1A 3BABA 4A3BG 5KT3A 1TAEA 4DV5H 5KFTA 2CW8A 2W57A 4DR1H 1AUXA 2W6MA 2W8LA 4KHPH 5KFAA 3J81W 2W9AA 3Q2OA 3QFFA 4BXXG 3VPBA 4A3KG
chains in the Genus database with same CATH topology
2FK3A 2FMAA 3KTMA 2FKLA 4PWQA 2FK2A 2FJZA 1OWTA 2M05A 2FK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK3 A;  2FMA A;  3KTM A;  2FKL A;  4PWQ A;  2FK2 A;  2FJZ A;  1OWT A;  2M05 A;  2FK1 A; 
#chains in the Genus database with same CATH topology
 2NU8 B;  5A2Q W;  1K83 A;  3RBD A;  4M7E A;  4EFB A;  4EEY A;  2VQD A;  3K5H A;  3RV4 A;  3V6H A;  3RV3 A;  4LH6 A;  1DGS A;  1VS0 A;  4DV1 H;  4IHJ F;  5KG0 A;  5KT7 A;  2ZDH A;  5JVD F;  3MR5 A;  3MWM A;  5DLG A;  4J9S A;  5EDW A;  1UC9 A;  2UUB H;  2UVV A;  4B3M H;  3R5F A;  1RJP A;  4RNM A;  2HVQ A;  3PR5 B;  4ECY A;  1DV2 A;  1DIK A;  4RB2 C;  2UUC H;  2E5L H;  4A3L G;  2JEI A;  5KFP A;  3GID A;  5KFS A;  3ETJ A;  1C30 A;  4JI7 H;  4MV8 A;  4HNT A;  3KHG A;  4ED2 A;  1Y1V G;  4YR3 A;  4X62 H;  1N48 A;  3FMA A;  5BPF A;  4A3C G;  2RGR A;  4JI3 H;  1A0I A;  1M0T A;  2C2D A;  3HB9 A;  3SI8 A;  4MV1 A;  4CC5 A;  5KKN B;  4BWS C;  4ZOL F;  3RB3 A;  4I50 F;  5JUM A;  3JRX A;  4Q45 A;  4J9L A;  3HOY G;  3MFI A;  3T5K A;  2PBZ A;  2WTF A;  4G3I A;  1WCM G;  4MA0 A;  2R86 A;  4R8U A;  1BGW A;  1TWG A;  2C00 A;  4A3E G;  3HOZ G;  1GSA A;  4ECU A;  4FBT A;  2QYZ A;  5EOY A;  3G8C A;  5KFF A;  3RJ0 A;  4DL2 A;  1B33 N;  5KG4 A;  2I87 A;  2RDJ A;  4X65 H;  4O3S A;  3VPD A;  3BG5 A;  3RF2 A;  2PMZ E;  5KFH A;  5KG7 A;  1ZHQ A;  1E4F T;  1PK8 A;  3R5H A;  2JA5 G;  1KJJ A;  2YU9 A;  3H3V H;  2YZM A;  3G6X A;  1N32 H;  1S0O A;  3MWE A;  3GTL A;  4ETS A;  4DL6 A;  5BR8 H;  4LF4 H;  4LF8 H;  1VKZ A;  1S03 G;  4RUA A;  5EZY F;  3KXY T;  4AYB A;  5HV6 A;  4J9O A;  2IMW P;  3T5H A;  5F9L A;  2RF4 A;  3Q8S B;  4IWX A;  3PN1 A;  3H20 A;  3R5X A;  3PR4 A;  2FP4 B;  4BY7 G;  5KFE A;  2WAQ E;  4M9U A;  3BQ2 A;  3GII A;  1WR2 A;  2PVP A;  3KAK A;  3OHB A;  2J9G A;  3CQZ A;  3I4N G;  5FJ8 G;  5IYC G;  4RNO A;  1JIH A;  2RGV A;  2JA6 G;  2R93 A;  4JV1 A;  5KT6 A;  1B6R A;  5LMU H;  5IYD G;  4ED8 A;  3PW0 A;  5KFV A;  2NU9 B;  2V5A A;  2W9B B;  2R84 A;  1JLL B;  4ED1 A;  3H0G G;  3BJY A;  1MZB A;  3PW5 A;  3HOW G;  2KSW A;  4YB8 B;  4TUY F;  4NLG A;  3WO1 A;  3OSP A;  2VQF H;  4O2A F;  3PW4 A;  5KFJ A;  1S0M A;  1K1S A;  3GV7 B;  2UUA H;  5KFG A;  5KFO A;  1HNW H;  2R8G A;  1S9F A;  1GSH A;  4UCV A;  2R7M A;  5KT2 A;  4QWC A;  2RDI A;  2OWO A;  2ASL A;  4J9M A;  2FLP A;  1V4Y A;  3BA9 A;  4MV9 A;  4C2M A;  1IOW A;  4ECR A;  3MR6 A;  1EYZ A;  2FB9 A;  3KHR A;  4C5B A;  5LOV F;  1CS0 A;  5KX5 F;  1Z2N X;  1IBK H;  3KHL A;  1ULZ A;  3RTX A;  3IG0 A;  4EBC A;  2FK2 A;  1I3Q A;  4CC6 A;  4YJ3 F;  2I8C A;  4Y8V B;  3H0G A;  3V4S A;  1CQJ B;  1J5E H;  2YCH A;  3FKI G;  3GIQ A;  2W9C B;  4HQ6 A;  3EPI A;  3PO2 G;  2NVY A;  4RZQ A;  1ZET A;  2OH2 A;  1RK6 A;  3ORQ A;  4RAZ A;  2W9B A;  3RB6 A;  3RB0 A;  1XNQ H;  3J7A K;  4J9K A;  1Y1W A;  2WB1 A;  1WH2 A;  2BQ3 A;  3ORR A;  4Q44 A;  5L1L A;  1KJ9 A;  4MTD A;  1T94 A;  2NUA B;  2PMZ A;  5H80 A;  3GIM A;  5D8D A;  2YS7 A;  3F8N A;  3JZI A;  4ME6 A;  2W6P A;  4DR3 H;  3K3V A;  1XMO H;  1SYX B;  5KFQ A;  5J2U F;  2R92 A;  1O75 A;  3FDS A;  3M4I A;  1W93 A;  3Q8R B;  1RYS A;  1VBG A;  1JDE A;  2B63 G;  2PN1 A;  3U9S A;  4IRK A;  4F4Y A;  4DR7 H;  1I6U A;  1FVI A;  1KBL A;  1B04 A;  5KFN A;  2XGP A;  5EWG A;  4A3I G;  4BBS G;  2FKL A;  4MTE A;  4GKK H;  2ZDG A;  3PVX A;  4FM9 A;  3I4M G;  5EWE A;  3RB4 A;  1JKJ B;  2R8H A;  2W7P A;  3N43 B;  5C1P A;  4O3P A;  2W6Z A;  1E4E B;  3T5L A;  4ED6 A;  2R8I A;  3RUP A;  3GIK A;  1AUV A;  3G6V A;  3VMM A;  3T1H H;  2F4V H;  1S68 A;  2AQ4 A;  2NU7 B;  4DV0 H;  4FBU A;  1Y1V A;  2Y0S E;  4EYI B;  2W6Q A;  1N56 A;  2IBK A;  4IZO A;  3WNZ A;  3GV5 B;  1ZQ7 A;  2Q2U A;  3U9T A;  5FPO A;  1TWF A;  2VPQ A;  2C2E A;  1S97 A;  4BY1 G;  2UXC H;  2R85 A;  2CQY A;  3HOU G;  4QWB A;  4A3M G;  3N40 P;  2AU0 A;  2HGS A;  1GLV A;  1RJR A;  3R23 A;  3RGX A;  1GO3 E;  3M9O B;  4F4Z A;  4ED7 A;  3JSL A;  1DV1 A;  4Q43 A;  1M6V A;  3Q8Q B;  4QWD A;  3TIN A;  4O2B F;  4DUY H;  2I80 A;  3TQT A;  5L1K A;  3E5N A;  1TWH A;  3Q1K A;  2FLL A;  4IWY A;  4QWE A;  3PO3 G;  5DLF A;  5KFL A;  2YS6 A;  2BQU A;  4O3Q A;  3HOV G;  2V4Q A;  4XZ3 B;  1EUC B;  4JUZ A;  5LYJ F;  1R9T A;  5CA1 F;  2XD4 A;  4DV4 H;  4A3G G;  1RK5 A;  4JI0 H;  4DL5 A;  1GGO A;  2WYO A;  3LML A;  4EEQ A;  3I12 A;  4C5C A;  2JA7 G;  1B6S A;  3OUU A;  3IN5 A;  2BR0 A;  4F50 A;  2FLN A;  4J0M A;  4YP3 A;  4LF6 H;  3CVZ A;  5FLX W;  3H4B A;  4UCT A;  2VOB A;  5KFB A;  3BA8 A;  2J6U A;  4LFC H;  1SCU B;  2VPS A;  3HXL A;  1IBM H;  2FMA A;  2FPP B;  5DQG A;  3LWB A;  2BQR A;  4IR9 A;  2E2I A;  5C44 G;  4AYB E;  5FD5 A;  4JV2 A;  5D1O A;  3UFX B;  2R7N A;  4LF9 H;  1TWC A;  3OUZ A;  2JEF A;  3M9N B;  3QZ7 A;  5KG1 A;  4B3T H;  1S0N A;  4IAJ A;  4ECZ A;  2ZDQ A;  1Z2P X;  5C5J A;  3MJF A;  1GYF A;  2FE3 A;  3OHA A;  3GIP A;  1XNR H;  4QW9 A;  1C3O A;  4JV0 A;  4DLK A;  5K2M A;  2W7O A;  1RYR A;  4LF5 H;  2VA3 A;  3V4Z A;  2ZM6 H;  2UVU A;  5KFU A;  4A93 G;  2AGO A;  2X0S A;  4LSX A;  2UVW A;  5IWA H;  5KFI A;  1Z2O X;  1HR0 H;  2NVX A;  4PWQ A;  5KFK A;  4DR5 H;  2GLT A;  2DPI A;  5LMN H;  2B63 A;  2OLS A;  1I94 H;  5IYZ F;  4A3J G;  4DV3 H;  4JI5 H;  2SCU B;  4TV8 F;  5KT5 A;  5IP9 G;  2C35 B;  1GSO A;  4RU9 A;  5L1I A;  1KJ8 A;  2YRW A;  2YL2 A;  3JAM W;  4RNN A;  5L9X A;  4J9Q A;  4GC7 A;  4PDB A;  1A9X A;  1JDB B;  5KFM A;  5DGA A;  4LFB H;  5D1O B;  1BJT A;  4ECS A;  2VUM G;  5DG9 A;  2VUM A;  4O4H F;  1S10 A;  4XX0 B;  5KFZ A;  4ZHQ F;  4EG0 A;  4DL3 A;  4TQS A;  1SFO A;  3RIZ A;  2IA6 A;  2CW7 A;  2FK3 A;  4HNV A;  1CE8 A;  3G6Y A;  4J9R A;  2GPS A;  4EGJ A;  2FPI B;  5JH7 F;  4R8U B;  4TQR A;  3GTJ A;  4DUZ H;  4GKJ H;  2DIK A;  1V9P A;  3BQ1 A;  4GC6 A;  4J9N A;  3GTK A;  4QJF A;  3MR3 A;  4UCU A;  3EYY A;  4DV2 H;  1JXL A;  4HR7 A;  4LMY A;  4MAM A;  5BPH A;  3GIL A;  1I50 A;  4XYM B;  3K3P A;  2FPG B;  2YYA A;  3LP8 A;  2W70 A;  4RB3 C;  3GTQ A;  4A3D G;  2CZG A;  3KHH A;  5J2T F;  4BBR G;  1I7N A;  2VQE H;  2J6T A;  4F4W A;  5IP7 G;  2JEJ A;  2R8J A;  4J9P A;  3OSN A;  4DR2 H;  1EHI A;  1T3N A;  2WE6 A;  4UCR A;  2DWC A;  3KAL A;  4IRC A;  2YZG A;  4NXN H;  4LH7 A;  4B3R H;  4O4L F;  2IP4 A;  4U7C A;  1N34 H;  3RAQ A;  5D1P A;  2ASJ A;  2AGP A;  2Y0S A;  2W71 A;  5LA6 F;  2ATL A;  4C5A A;  2XGQ A;  2XIG A;  4JI2 H;  3WO0 A;  4EFE A;  3RBE A;  4O3N A;  3T5J A;  5GON F;  4APM A;  4O4I F;  2ALZ A;  3T1Y H;  2VUG A;  4TV9 F;  2W8K A;  3HOX G;  5KT4 A;  5T14 A;  3RFC A;  4B3S H;  2UXB H;  4EGQ A;  5KFC A;  3L2P A;  2MCT A;  4WD3 A;  2W6N A;  1V51 A;  5C4X G;  2QK4 A;  3DF7 A;  2M05 A;  4F4X A;  4MV7 A;  1AN7 A;  4JI4 H;  4HYK A;  4A2A A;  5IYB G;  3J80 W;  4LF7 H;  4K0K H;  4WBN F;  3TQ1 A;  3H40 A;  4IR1 A;  2JA8 G;  1BXR A;  2V59 A;  4FU0 A;  2HJW A;  4DV6 H;  2R7Z A;  4EBE A;  4X66 H;  1KJI A;  4XYL B;  4LFA H;  2R7Z G;  4GLX A;  4JI6 H;  5FPR A;  3QZ8 A;  4ECV A;  4RAY A;  1BNC A;  5C1O A;  1TWA A;  2NU6 B;  3SE7 A;  3BQ0 A;  1UNN C;  4RB1 A;  4U6P A;  2XCP A;  1N33 H;  1IBL H;  2DLN A;  1RJQ A;  2Q2T A;  2FK1 A;  3UQ8 A;  4UFZ A;  4DV7 H;  3EPG A;  4YY3 H;  4ECX A;  5CA0 F;  1KC7 A;  5KFW A;  1K1Q A;  2WB1 E;  3GIJ A;  2R8K A;  3PZP A;  1Y14 B;  5DGB A;  3K5I A;  4HNU A;  4NXM H;  3BAA A;  2R87 A;  5FD6 A;  2DZD A;  4AQY H;  4DR4 H;  4ED0 A;  1EUD B;  1SEI A;  2WAQ A;  3MR2 A;  3TII A;  2J6S A;  2HVR A;  1KEE A;  2JA7 A;  5F9N A;  1P8L A;  1L2Z A;  2UXD H;  4Q0Y A;  3L4J A;  5KG3 A;  3Q8P B;  1WCM A;  4I4T F;  2O03 A;  1N36 H;  2JA5 A;  5KFR A;  4UCS A;  2C28 A;  5JQW A;  2XCL A;  3NGD A;  3L4K A;  3KAJ A;  4YR0 A;  3C0F B;  4ED3 A;  3GTG A;  4ECW A;  3PW7 A;  1X9N A;  2W6O A;  2C2R A;  5JVL A;  1W96 A;  2ASD A;  4MV6 A;  3MFH A;  1FKA H;  4Q8E A;  4O3R A;  2HVS A;  4JV5 H;  3TIG A;  5BMV F;  2AGQ A;  4Q8F A;  4RZR A;  1M0W A;  3ETH A;  3RAX A;  4QW8 A;  4QWA A;  1M7J A;  3PW2 A;  1E4E A;  2YRX A;  5L1J A;  5FLM G;  5DG7 A;  4I55 F;  4E4T A;  4YBZ B;  2R7L A;  3GLK A;  1TA8 A;  3JRW A;  2V58 A;  5KFY A;  3VPC A;  1WSC A;  1E4G T;  5LXT F;  4DL4 A;  2FJZ A;  5KG5 A;  3GTM A;  4JYA H;  1I7L A;  2R82 A;  5IT9 W;  2R6F A;  4YHH H;  4YR2 A;  4EYH B;  2R7K A;  4MV4 A;  2R92 G;  1VBH A;  4DL7 A;  3GV8 B;  4JI1 H;  5DQI A;  4ECT A;  3MWD A;  2WDT A;  4YAK B;  2XCA A;  2YW2 A;  4L1K A;  4JI8 H;  3JSN A;  5KG6 A;  5C8Y F;  1VAJ A;  4R7R A;  2W9C A;  5HBR B;  2R93 G;  2JA6 A;  3H4D A;  2CKZ B;  3AYH B;  5KG2 A;  3GQC A;  4QIW E;  1HNZ H;  2V4R A;  1T36 A;  1ZHS A;  1XDN A;  3HKZ A;  3N41 B;  4A2B A;  1Y1W G;  1HNX H;  2HHH H;  3HKZ E;  4MA5 A;  2ZJT A;  3GTP A;  2UVR A;  2GPW A;  3N42 B;  3N8D A;  4X64 H;  4ZQI A;  2XC9 A;  4OX9 H;  1PX2 A;  2UU9 H;  2V9W A;  4DR6 H;  4O3O A;  4RUC A;  2VA2 A;  4ZI7 F;  4A3F G;  1UC8 A;  3RGZ A;  3N44 B;  5CB4 F;  4EBD A;  4ECQ A;  2JEG A;  4YJ2 F;  4YAJ B;  5LP6 F;  2VR1 A;  3HBL A;  3KTM A;  2E2H A;  4MV3 A;  2YZN A;  4UCO A;  1OWT A;  5LL6 b;  1CQI B;  5DQH A;  3GTO A;  5C3E G;  4FS2 A;  2P0A A;  4FS1 A;  5KFX A;  2DPJ A;  5EWF A;  3M9M B;  1FJG H;  3OTO H;  1XMQ H;  1JX4 A;  4QIW A;  4LSA A;  4IRD A;  3FKI A;  5KFD A;  4YQW A;  3N6X A;  5DG8 A;  2C22 A;  1KJQ A;  3V6J A;  4RB0 A;  4I7H A;  5I47 A;  3V6K A;  1IOV A;  5CAE B;  1EZ1 A;  3BAB A;  4A3B G;  5KT3 A;  1TAE A;  4DV5 H;  5KFT A;  2CW8 A;  2W57 A;  4DR1 H;  1AUX A;  2W6M A;  2W8L A;  4KHP H;  5KFA A;  3J81 W;  2W9A A;  3Q2O A;  3QFF A;  4BXX G;  3VPB A;  4A3K G; 
#chains in the Genus database with same CATH homology
 2FK3 A;  2FMA A;  3KTM A;  2FKL A;  4PWQ A;  2FK2 A;  2FJZ A;  1OWT A;  2M05 A;  2FK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...