1OWTA

Structure of the alzheimer's disease amyloid precursor protein copper binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
b'SDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
molecule tags Apoptosis
source organism Homo sapiens
publication title Structure of the Alzheimer's Disease Amyloid Precursor Protein Copper Binding Domain. A REGULATOR OF NEURONAL COPPER HOMEOSTASIS.
pubmed doi rcsb
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 1owtA00
3KTMA 2FJZA 2FMAA 2FK1A 2FKLA 2FK3A 1OWTA 4PWQA 2FK2A 2M05A
chains in the Genus database with same CATH superfamily
1RJRA 5CA0F 1EUDB 4JV2A 2KSWA 3IN5A 2XIGA 5KFMA 1XMOH 2ATLA 4ECWA 4A3FG 4O3SA 4ECRA 4MA5A 2NUAB 4RB1A 4AYBA 3HOUG 2R92A 4OX9H 5BPHA 3RV3A 4X65H 4R8UB 2I80A 4YAKB 4JI8H 3HOWG 2Q2TA 1EUCB 2WDTA 3MFHA 4JI2H 2ZDHA 4C5BA 4YB8B 4F4WA 4HNUA 3GTGA 3G8CA 3GTQA 2VOBA 4X66H 5BR8H 4WBNF 2XGPA 4MV1A 3BA9A 1JXLA 3JRWA 2RGRA 3CVZA 5IYZF 2R82A 3N8DA 5IYDG 1KJQA 3L4JA 2DZDA 3H20A 3K5HA 4TUYF 3M9OB 3N40P 3RJ0A 5C44G 5KFAA 3RBDA 1UNNC 3JRXA 5CAEB 3PN1A 4RB2C 2UUCH 3H4BA 3PW0A 3NGDA 4EFBA 4ECQA 3GV5B 2BR0A 4AQYH 2QK4A 3OTOH 2HVSA 5EOYA 4IR1A 2J9GA 2AGOA 2W9CB 5FPRA 4LSXA 5KFIA 1O75A 5GONF 2R85A 2I87A 3FMAA 4JI6H 5KG1A 4QWAA 3HOXG 2W70A 2FP4B 4MV4A 4RB3C 2SCUB 5DGAA 2W8LA 3VPCA 3T5JA 4B3TH 3DF7A 3HB9A 4EGQA 5KG3A 2VUGA 1CS0A 3WO1A 4QWCA 1IOWA 4XYMB 3GIKA 3GQCA 5IWAH 1N48A 2R7LA 2OWOA 2PN1A 2W6QA 4O4IF 2W9BA 4YR3A 5FJ8G 2ZDGA 2RF4A 3RFCA 4RB0A 3M9NB 4ED6A 4U6PA 3TQ1A 1V9PA 5KFSA 1V4YA 4DR4H 4YJ3F 1CE8A 4TQSA 2WAQA 3PW7A 3GIPA 3N41B 5KFTA 4ED2A 1N56A 4MA0A 4PDBA 4BWSC 4DLKA 3OHBA 3IG0A 4TQRA 2W6NA 5T14A 5KFZA 4JI0H 1I6UA 2R7MA 2NVYA 4RZQA 2VQFH 3UQ8A 3N43B 2NVXA 1ZHQA 3R5FA 1JIHA 2R8GA 2DWCA 1KJ9A 2J6TA 4J9MA 3T1YH 1KJJA 1Y1VA 2E5LH 2YS6A 2FK3A 2R84A 2BQ3A 3BABA 1BJTA 3N6XA 5BMVF 3Q8RB 1K1QA 4BY1G 2VQEH 4ED1A 4ZQIA 4DL5A 5DQGA 2W9AA 3PR5B 3M9MB 2FPGB 4MV6A 4DV7H 4A3CG 1WCMG 3M4IA 4EEQA 2FMAA 1KJIA 4A3GG 5J2TF 3BA8A 3GIIA 2WB1E 1WSCA 4LSAA 4YAJB 5K2MA 4A3EG 2VA3A 4DL4A 3RBEA 5KT2A 1DIKA 4DV4H 1ULZA 2FPIB 1ZETA 2IMWP 2BQUA 3J7AK 3V4SA 3U9SA 4RNOA 3R5XA 3RIZA 3N42B 2VR1A 3VPBA 1GSOA 1RK6A 1K1SA 2FB9A 2W6MA 5KFKA 4UCOA 5IP9G 4RNMA 2GPWA 4FU0A 4RAZA 4DR1H 1I7LA 3TIIA 4UCTA 1M0TA 3JAMW 2C2EA 1JDBB 1B6SA 3WNZA 3JZIA 4ECVA 2RGVA 4QJFA 4EGJA 2R93G 3PO3G 3MFIA 1S10A 4YJ2F 5FD6A 4IRKA 1S9FA 3FKIA 4LFBH 1RYRA 4YHHH 3RB4A 3RTXA 2VUMA 4MV7A 4TV9F 3KHRA 1HNWH 4CC5A 3HKZA 4PWQA 2R7KA 2R7NA 4IAJA 4U7CA 5L1KA 4ECXA 1GSHA 1JX4A 5F9LA 5DQIA 2GLTA 2UVVA 2YCHA 4MAMA 3I4MG 4UCVA 1GO3E 4Q8EA 4O3PA 2E2HA 1OWTA 4RZRA 1R9TA 3BQ0A 1S0NA 1SEIA 4QWEA 3J80W 4UCUA 1JKJB 5KFGA 1CQJB 4C2MA 2F4VH 4DL7A 4E4TA 4L1KA 3PW2A 2W71A 3KALA 4KHPH 3Q8SB 1S03G 5KFUA 3GV8B 5KT7A 4EEYA 1EYZA 3F8NA 3PW5A 4JI3H 2AU0A 4UCSA 3HXLA 4MV9A 5KFOA 5C4XG 1TWHA 1S0MA 2DIKA 1WCMA 1RK5A 1WH2A 2FLLA 2CW7A 5JH7F 5EWEA 5IP7G 3RB6A 3HOZG 1GYFA 2YZGA 4UFZA 5KKNB 3MR3A 3T5HA 1TWGA 2V58A 4QIWA 4MTDA 2VPQA 1ZHSA 1Z2PX 2JA5A 3G6XA 4B3MH 2HJWA 2YW2A 5D8DA 3GIMA 2OLSA 4I7HA 3RGZA 5KFCA 2UVWA 4LF5H 2PBZA 4A3DG 4DR7H 4ZI7F 1E4EA 4F4YA 4G3IA 4C5AA 2JA7G 3RGXA 2UU9H 1MZBA 4GLXA 3ETHA 3KAKA 4UCRA 5JQWA 2JA6G 4EBDA 4A2AA 5DQHA 5C1PA 4R7RA 1I3QA 2W7OA 2C28A 2UXCH 3BQ2A 4JI5H 2AGPA 4QWDA 2B63G 3T1HH 5BPFA 5LMUH 1I50A 4ECUA 4JV1A 5KFEA 3T5KA 4EYHB 1T94A 1BXRA 3K3PA 1UC8A 3L4KA 4Q43A 4A3JG 1SCUB 3H4DA 3R23A 4O3OA 1AUVA 4LFAH 1XNQH 4JI7H 4HQ6A 4J9LA 4QIWE 1Y1WA 5DLFA 3LWBA 4LF9H 1JDEA 1SYXB 5FLMG 4M9UA 5L1LA 2UVUA 2NU9B 2C00A 3OSPA 4BBSG 2XD4A 5KFFA 1RJQA 3RB3A 3GTMA 4MV3A 2UVRA 3V6HA 1FVIA 2YU9A 2JEFA 5KT6A 2AGQA 2BQRA 2UXDH 4A2BA 2W8KA 3MWEA 4JUZA 3QZ8A 4Y8VB 3G6VA 3GIDA 2W57A 3V6JA 2R8HA 5FD5A 4QW8A 4AYBE 2Y0SE 1ZQ7A 2ZJTA 2XCAA 3RUPA 2FLNA 3TINA 2FPPB 2HHHH 1TA8A 3OSNA 1L2ZA 4LH6A 2Q2UA 3RF2A 4F4ZA 5KFQA 4IRDA 3PVXA 1V51A 2DPIA 3GTLA 3H40A 3BJYA 4K0KH 3GTKA 2JA6A 4XZ3B 4J9PA 3R5HA 5L1IA 2ASLA 2FKLA 4ZOLF 3VPDA 5JVDF 4FS1A 4LH7A 5D1PA 5FLXW 2R87A 2JEIA 2FK2A 1TWFA 4Q44A 2DPJA 4O2AF 5EZYF 1RJPA 2J6SA 2Y0SA 5KG0A 2R93A 3C0FB 3PO2G 5IT9W 3OUUA 5LP6F 3Q8PB 4O2BF 4ECSA 2VUMG 1VBGA 3GILA 2YS7A 1VKZA 3L2PA 4A3IG 2IBKA 3UFXB 4JV0A 1A9XA 2C2DA 5IYCG 2GPSA 2XCPA 1Y1WG 5LA6F 1VAJA 5L1JA 4BBRG 2ASJA 4X62H 1E4FT 4LMYA 4EBEA 2YRWA 4RU9A 2VPSA 3H0GG 4EBCA 3SE7A 2UUAH 1N32H 4R8UA 5DG7A 5CB4F 5C8YF 5DG8A 5DLGA 4J9OA 4GC7A 1IBLH 3V4ZA 4ZHQF 4RNNA 5IYBG 4IRCA 4B3RH 1EZ1A 1C3OA 1M6VA 3CQZA 2V4QA 1BNCA 4FS2A 2W6OA 2UUBH 1DV2A 1HR0H 2O03A 5EWFA 1C30A 2I8CA 3H3VH 4J9KA 1DGSA 2XGQA 1GSAA 5C1OA 4BY7G 2W6PA 3RAXA 2NU6B 4X64H 3MR5A 3PZPA 4J0MA 3V6KA 2FLPA 4J9SA 1AUXA 2CZGA 2RDJA 2CW8A 4YR2A 4HNTA 2C22A 3HOYG 4DR6H 2XCLA 2PMZA 5LXTF 4WD3A 3TIGA 3SI8A 2HGSA 2HVRA 4FBTA 3N44B 4A93G 4XX0B 2ZDQA 2W9CA 4A3KG 5KFVA 4C5CA 3HOVG 4I4TF 3MWMA 3TQTA 1IBMH 2JA8G 4F50A 2R86A 2JA7A 4DV6H 1I7NA 2W7PA 4O3NA 1Y14B 1X9NA 3KAJA 4IHJF 1GGOA 3I4NG 1N33H 3BQ1A 5KT3A 2B63A 4DV2H 5EDWA 4O4LF 4ED0A 4YP3A 3H0GA 5C3EG 1K83A 2J6UA 4J9QA 3ORRA 1N36H 1JLLB 5LOVF 1S97A 2WYOA 1GLVA 4RUAA 3Q1KA 1TAEA 2YZMA 5H80A 5KG4A 4EG0A 4YR0A 2C35B 5LMNH 3MR6A 4TV8F 1P8LA 2M05A 2IP4A 1I94H 4LF4H 5KFYA 2R7ZA 3RV4A 2R8IA 3KXYT 4IZOA 5I47A 3KHHA 4ECYA 2WAQE 3VMMA 5KG6A 3PR4A 1T36A 5KFBA 3AYHB 4RUCA 1J5EH 5JUMA 1EHIA 3GTJA 1WR2A 3EYYA 4MTEA 2WTFA 2HVQA 5EWGA 4QW9A 1XMQH 3WO0A 3RAQA 3G6YA 2YL2A 4HR7A 1W93A 4EYIB 4FM9A 4DL6A 3JSLA 3U9TA 3LMLA 4FBUA 2R7ZG 3QFFA 3GTPA 1IOVA 4O4HF 2AQ4A 2R92G 3EPIA 4HYKA 5KFLA 1KEEA 4APMA 5KG5A 4DL3A 1AN7A 5DGBA 3I12A 1HNZH 2VQDA 1S0OA 2NU7B 4YY3H 3GV7B 4NXNH 3K3VA 4ECZA 2V5AA 5KFWA 4I50F 4GKJH 5JVLA 2PVPA 2V59A 4DUZH 4LFCH 1VBHA 1T3NA 2CKZB 5KFDA 4DV1H 3MWDA 2JEGA 1RYSA 2ALZA 1IBKH 1Z2NX 4CC6A 3J81W 3BG5A 2DLNA 2FK1A 4HNVA 2UXBH 2FE3A 4O3QA 3HKZE 4DL2A 1FJGH 1E4GT 4IWXA 1B04A 5A2QW 1E4EB 1B6RA 4XYLB 5KFPA 5KFNA 2YZNA 1KC7A 5C5JA 5KT4A 4NLGA 4DV3H 5KX5F 4Q8FA 5KFRA 5D1OB 2R6FA 2CQYA 4YBZB 3QZ7A 5KG2A 4Q0YA 3ETJA 4IWYA 1W96A 4F4XA 5KG7A 4DV0H 5J2UF 5KT5A 4ED3A 4Q45A 2ASDA 4B3SH 5KFXA 5KFHA 5DG9A 1XNRH 4JV5H 2JEJA 4J9RA 3KHLA 4RAYA 4GKKH 2W6ZA 2PMZE 4ED8A 4A3LG 2NU8B 3KHGA 3GIJA 3FDSA 5D1OA 4DR5H 2WB1A 3Q2OA 1CQIB 1N34H 4LF8H 4ECTA 4YQWA 2X0SA 4IR9A 4BXXG 1PK8A 2V4RA 3KTMA 1PX2A 4ETSA 4JI1H 4ME6A 1S68A 3MR2A 2P0AA 2OH2A 3OUZA 4QWBA 3HBLA 1M7JA 5L9XA 4LF7H 2YRXA 2C2RA 2MCTA 4JI4H 1HNXH 4LF6H 1A0IA 3Q8QB 4DUYH 5CA1F 1FKAH 4O3RA 4I55F 5LL6b 2QYZA 3EPGA 4EFEA 2RDIA 4ED7A 1VS0A 1B33N 1M0WA 3FKIG 3GLKA 2V9WA 1Y1VG 3JSNA 2W9BB 5KFJA 2R8JA 1Z2OX 2E2IA 3RB0A 1KJ8A 5FPOA 2WE6A 2R8KA 2FJZA 1SFOA 1XDNA 4M7EA 4A3MG 2JA5G 1TWAA 3LP8A 4JYAH 2IA6A 5HBRB 4MV8A 3OHAA 1UC9A 2YYAA 3E5NA 4DR2H 2ZM6H 3GIQA 4GC6A 3T5LA 2XC9A 1BGWA 5LYJF 1KBLA 4DV5H 5F9NA 5HV6A 3K5IA 4J9NA 3PW4A 1DV1A 3ORQA 4DR3H 3GTOA 3MJFA 4NXMH 1TWCA 3BAAA 4A3BG 2VA2A
chains in the Genus database with same CATH topology
3KTMA 2FJZA 2FMAA 2FK1A 2FKLA 2FK3A 1OWTA 4PWQA 2FK2A 2M05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTM A;  2FJZ A;  2FMA A;  2FK1 A;  2FKL A;  2FK3 A;  1OWT A;  4PWQ A;  2FK2 A;  2M05 A; 
#chains in the Genus database with same CATH topology
 1RJR A;  5CA0 F;  1EUD B;  4JV2 A;  2KSW A;  3IN5 A;  2XIG A;  5KFM A;  1XMO H;  2ATL A;  4ECW A;  4A3F G;  4O3S A;  4ECR A;  4MA5 A;  2NUA B;  4RB1 A;  4AYB A;  3HOU G;  2R92 A;  4OX9 H;  5BPH A;  3RV3 A;  4X65 H;  4R8U B;  2I80 A;  4YAK B;  4JI8 H;  3HOW G;  2Q2T A;  1EUC B;  2WDT A;  3MFH A;  4JI2 H;  2ZDH A;  4C5B A;  4YB8 B;  4F4W A;  4HNU A;  3GTG A;  3G8C A;  3GTQ A;  2VOB A;  4X66 H;  5BR8 H;  4WBN F;  2XGP A;  4MV1 A;  3BA9 A;  1JXL A;  3JRW A;  2RGR A;  3CVZ A;  5IYZ F;  2R82 A;  3N8D A;  5IYD G;  1KJQ A;  3L4J A;  2DZD A;  3H20 A;  3K5H A;  4TUY F;  3M9O B;  3N40 P;  3RJ0 A;  5C44 G;  5KFA A;  3RBD A;  1UNN C;  3JRX A;  5CAE B;  3PN1 A;  4RB2 C;  2UUC H;  3H4B A;  3PW0 A;  3NGD A;  4EFB A;  4ECQ A;  3GV5 B;  2BR0 A;  4AQY H;  2QK4 A;  3OTO H;  2HVS A;  5EOY A;  4IR1 A;  2J9G A;  2AGO A;  2W9C B;  5FPR A;  4LSX A;  5KFI A;  1O75 A;  5GON F;  2R85 A;  2I87 A;  3FMA A;  4JI6 H;  5KG1 A;  4QWA A;  3HOX G;  2W70 A;  2FP4 B;  4MV4 A;  4RB3 C;  2SCU B;  5DGA A;  2W8L A;  3VPC A;  3T5J A;  4B3T H;  3DF7 A;  3HB9 A;  4EGQ A;  5KG3 A;  2VUG A;  1CS0 A;  3WO1 A;  4QWC A;  1IOW A;  4XYM B;  3GIK A;  3GQC A;  5IWA H;  1N48 A;  2R7L A;  2OWO A;  2PN1 A;  2W6Q A;  4O4I F;  2W9B A;  4YR3 A;  5FJ8 G;  2ZDG A;  2RF4 A;  3RFC A;  4RB0 A;  3M9N B;  4ED6 A;  4U6P A;  3TQ1 A;  1V9P A;  5KFS A;  1V4Y A;  4DR4 H;  4YJ3 F;  1CE8 A;  4TQS A;  2WAQ A;  3PW7 A;  3GIP A;  3N41 B;  5KFT A;  4ED2 A;  1N56 A;  4MA0 A;  4PDB A;  4BWS C;  4DLK A;  3OHB A;  3IG0 A;  4TQR A;  2W6N A;  5T14 A;  5KFZ A;  4JI0 H;  1I6U A;  2R7M A;  2NVY A;  4RZQ A;  2VQF H;  3UQ8 A;  3N43 B;  2NVX A;  1ZHQ A;  3R5F A;  1JIH A;  2R8G A;  2DWC A;  1KJ9 A;  2J6T A;  4J9M A;  3T1Y H;  1KJJ A;  1Y1V A;  2E5L H;  2YS6 A;  2FK3 A;  2R84 A;  2BQ3 A;  3BAB A;  1BJT A;  3N6X A;  5BMV F;  3Q8R B;  1K1Q A;  4BY1 G;  2VQE H;  4ED1 A;  4ZQI A;  4DL5 A;  5DQG A;  2W9A A;  3PR5 B;  3M9M B;  2FPG B;  4MV6 A;  4DV7 H;  4A3C G;  1WCM G;  3M4I A;  4EEQ A;  2FMA A;  1KJI A;  4A3G G;  5J2T F;  3BA8 A;  3GII A;  2WB1 E;  1WSC A;  4LSA A;  4YAJ B;  5K2M A;  4A3E G;  2VA3 A;  4DL4 A;  3RBE A;  5KT2 A;  1DIK A;  4DV4 H;  1ULZ A;  2FPI B;  1ZET A;  2IMW P;  2BQU A;  3J7A K;  3V4S A;  3U9S A;  4RNO A;  3R5X A;  3RIZ A;  3N42 B;  2VR1 A;  3VPB A;  1GSO A;  1RK6 A;  1K1S A;  2FB9 A;  2W6M A;  5KFK A;  4UCO A;  5IP9 G;  4RNM A;  2GPW A;  4FU0 A;  4RAZ A;  4DR1 H;  1I7L A;  3TII A;  4UCT A;  1M0T A;  3JAM W;  2C2E A;  1JDB B;  1B6S A;  3WNZ A;  3JZI A;  4ECV A;  2RGV A;  4QJF A;  4EGJ A;  2R93 G;  3PO3 G;  3MFI A;  1S10 A;  4YJ2 F;  5FD6 A;  4IRK A;  1S9F A;  3FKI A;  4LFB H;  1RYR A;  4YHH H;  3RB4 A;  3RTX A;  2VUM A;  4MV7 A;  4TV9 F;  3KHR A;  1HNW H;  4CC5 A;  3HKZ A;  4PWQ A;  2R7K A;  2R7N A;  4IAJ A;  4U7C A;  5L1K A;  4ECX A;  1GSH A;  1JX4 A;  5F9L A;  5DQI A;  2GLT A;  2UVV A;  2YCH A;  4MAM A;  3I4M G;  4UCV A;  1GO3 E;  4Q8E A;  4O3P A;  2E2H A;  1OWT A;  4RZR A;  1R9T A;  3BQ0 A;  1S0N A;  1SEI A;  4QWE A;  3J80 W;  4UCU A;  1JKJ B;  5KFG A;  1CQJ B;  4C2M A;  2F4V H;  4DL7 A;  4E4T A;  4L1K A;  3PW2 A;  2W71 A;  3KAL A;  4KHP H;  3Q8S B;  1S03 G;  5KFU A;  3GV8 B;  5KT7 A;  4EEY A;  1EYZ A;  3F8N A;  3PW5 A;  4JI3 H;  2AU0 A;  4UCS A;  3HXL A;  4MV9 A;  5KFO A;  5C4X G;  1TWH A;  1S0M A;  2DIK A;  1WCM A;  1RK5 A;  1WH2 A;  2FLL A;  2CW7 A;  5JH7 F;  5EWE A;  5IP7 G;  3RB6 A;  3HOZ G;  1GYF A;  2YZG A;  4UFZ A;  5KKN B;  3MR3 A;  3T5H A;  1TWG A;  2V58 A;  4QIW A;  4MTD A;  2VPQ A;  1ZHS A;  1Z2P X;  2JA5 A;  3G6X A;  4B3M H;  2HJW A;  2YW2 A;  5D8D A;  3GIM A;  2OLS A;  4I7H A;  3RGZ A;  5KFC A;  2UVW A;  4LF5 H;  2PBZ A;  4A3D G;  4DR7 H;  4ZI7 F;  1E4E A;  4F4Y A;  4G3I A;  4C5A A;  2JA7 G;  3RGX A;  2UU9 H;  1MZB A;  4GLX A;  3ETH A;  3KAK A;  4UCR A;  5JQW A;  2JA6 G;  4EBD A;  4A2A A;  5DQH A;  5C1P A;  4R7R A;  1I3Q A;  2W7O A;  2C28 A;  2UXC H;  3BQ2 A;  4JI5 H;  2AGP A;  4QWD A;  2B63 G;  3T1H H;  5BPF A;  5LMU H;  1I50 A;  4ECU A;  4JV1 A;  5KFE A;  3T5K A;  4EYH B;  1T94 A;  1BXR A;  3K3P A;  1UC8 A;  3L4K A;  4Q43 A;  4A3J G;  1SCU B;  3H4D A;  3R23 A;  4O3O A;  1AUV A;  4LFA H;  1XNQ H;  4JI7 H;  4HQ6 A;  4J9L A;  4QIW E;  1Y1W A;  5DLF A;  3LWB A;  4LF9 H;  1JDE A;  1SYX B;  5FLM G;  4M9U A;  5L1L A;  2UVU A;  2NU9 B;  2C00 A;  3OSP A;  4BBS G;  2XD4 A;  5KFF A;  1RJQ A;  3RB3 A;  3GTM A;  4MV3 A;  2UVR A;  3V6H A;  1FVI A;  2YU9 A;  2JEF A;  5KT6 A;  2AGQ A;  2BQR A;  2UXD H;  4A2B A;  2W8K A;  3MWE A;  4JUZ A;  3QZ8 A;  4Y8V B;  3G6V A;  3GID A;  2W57 A;  3V6J A;  2R8H A;  5FD5 A;  4QW8 A;  4AYB E;  2Y0S E;  1ZQ7 A;  2ZJT A;  2XCA A;  3RUP A;  2FLN A;  3TIN A;  2FPP B;  2HHH H;  1TA8 A;  3OSN A;  1L2Z A;  4LH6 A;  2Q2U A;  3RF2 A;  4F4Z A;  5KFQ A;  4IRD A;  3PVX A;  1V51 A;  2DPI A;  3GTL A;  3H40 A;  3BJY A;  4K0K H;  3GTK A;  2JA6 A;  4XZ3 B;  4J9P A;  3R5H A;  5L1I A;  2ASL A;  2FKL A;  4ZOL F;  3VPD A;  5JVD F;  4FS1 A;  4LH7 A;  5D1P A;  5FLX W;  2R87 A;  2JEI A;  2FK2 A;  1TWF A;  4Q44 A;  2DPJ A;  4O2A F;  5EZY F;  1RJP A;  2J6S A;  2Y0S A;  5KG0 A;  2R93 A;  3C0F B;  3PO2 G;  5IT9 W;  3OUU A;  5LP6 F;  3Q8P B;  4O2B F;  4ECS A;  2VUM G;  1VBG A;  3GIL A;  2YS7 A;  1VKZ A;  3L2P A;  4A3I G;  2IBK A;  3UFX B;  4JV0 A;  1A9X A;  2C2D A;  5IYC G;  2GPS A;  2XCP A;  1Y1W G;  5LA6 F;  1VAJ A;  5L1J A;  4BBR G;  2ASJ A;  4X62 H;  1E4F T;  4LMY A;  4EBE A;  2YRW A;  4RU9 A;  2VPS A;  3H0G G;  4EBC A;  3SE7 A;  2UUA H;  1N32 H;  4R8U A;  5DG7 A;  5CB4 F;  5C8Y F;  5DG8 A;  5DLG A;  4J9O A;  4GC7 A;  1IBL H;  3V4Z A;  4ZHQ F;  4RNN A;  5IYB G;  4IRC A;  4B3R H;  1EZ1 A;  1C3O A;  1M6V A;  3CQZ A;  2V4Q A;  1BNC A;  4FS2 A;  2W6O A;  2UUB H;  1DV2 A;  1HR0 H;  2O03 A;  5EWF A;  1C30 A;  2I8C A;  3H3V H;  4J9K A;  1DGS A;  2XGQ A;  1GSA A;  5C1O A;  4BY7 G;  2W6P A;  3RAX A;  2NU6 B;  4X64 H;  3MR5 A;  3PZP A;  4J0M A;  3V6K A;  2FLP A;  4J9S A;  1AUX A;  2CZG A;  2RDJ A;  2CW8 A;  4YR2 A;  4HNT A;  2C22 A;  3HOY G;  4DR6 H;  2XCL A;  2PMZ A;  5LXT F;  4WD3 A;  3TIG A;  3SI8 A;  2HGS A;  2HVR A;  4FBT A;  3N44 B;  4A93 G;  4XX0 B;  2ZDQ A;  2W9C A;  4A3K G;  5KFV A;  4C5C A;  3HOV G;  4I4T F;  3MWM A;  3TQT A;  1IBM H;  2JA8 G;  4F50 A;  2R86 A;  2JA7 A;  4DV6 H;  1I7N A;  2W7P A;  4O3N A;  1Y14 B;  1X9N A;  3KAJ A;  4IHJ F;  1GGO A;  3I4N G;  1N33 H;  3BQ1 A;  5KT3 A;  2B63 A;  4DV2 H;  5EDW A;  4O4L F;  4ED0 A;  4YP3 A;  3H0G A;  5C3E G;  1K83 A;  2J6U A;  4J9Q A;  3ORR A;  1N36 H;  1JLL B;  5LOV F;  1S97 A;  2WYO A;  1GLV A;  4RUA A;  3Q1K A;  1TAE A;  2YZM A;  5H80 A;  5KG4 A;  4EG0 A;  4YR0 A;  2C35 B;  5LMN H;  3MR6 A;  4TV8 F;  1P8L A;  2M05 A;  2IP4 A;  1I94 H;  4LF4 H;  5KFY A;  2R7Z A;  3RV4 A;  2R8I A;  3KXY T;  4IZO A;  5I47 A;  3KHH A;  4ECY A;  2WAQ E;  3VMM A;  5KG6 A;  3PR4 A;  1T36 A;  5KFB A;  3AYH B;  4RUC A;  1J5E H;  5JUM A;  1EHI A;  3GTJ A;  1WR2 A;  3EYY A;  4MTE A;  2WTF A;  2HVQ A;  5EWG A;  4QW9 A;  1XMQ H;  3WO0 A;  3RAQ A;  3G6Y A;  2YL2 A;  4HR7 A;  1W93 A;  4EYI B;  4FM9 A;  4DL6 A;  3JSL A;  3U9T A;  3LML A;  4FBU A;  2R7Z G;  3QFF A;  3GTP A;  1IOV A;  4O4H F;  2AQ4 A;  2R92 G;  3EPI A;  4HYK A;  5KFL A;  1KEE A;  4APM A;  5KG5 A;  4DL3 A;  1AN7 A;  5DGB A;  3I12 A;  1HNZ H;  2VQD A;  1S0O A;  2NU7 B;  4YY3 H;  3GV7 B;  4NXN H;  3K3V A;  4ECZ A;  2V5A A;  5KFW A;  4I50 F;  4GKJ H;  5JVL A;  2PVP A;  2V59 A;  4DUZ H;  4LFC H;  1VBH A;  1T3N A;  2CKZ B;  5KFD A;  4DV1 H;  3MWD A;  2JEG A;  1RYS A;  2ALZ A;  1IBK H;  1Z2N X;  4CC6 A;  3J81 W;  3BG5 A;  2DLN A;  2FK1 A;  4HNV A;  2UXB H;  2FE3 A;  4O3Q A;  3HKZ E;  4DL2 A;  1FJG H;  1E4G T;  4IWX A;  1B04 A;  5A2Q W;  1E4E B;  1B6R A;  4XYL B;  5KFP A;  5KFN A;  2YZN A;  1KC7 A;  5C5J A;  5KT4 A;  4NLG A;  4DV3 H;  5KX5 F;  4Q8F A;  5KFR A;  5D1O B;  2R6F A;  2CQY A;  4YBZ B;  3QZ7 A;  5KG2 A;  4Q0Y A;  3ETJ A;  4IWY A;  1W96 A;  4F4X A;  5KG7 A;  4DV0 H;  5J2U F;  5KT5 A;  4ED3 A;  4Q45 A;  2ASD A;  4B3S H;  5KFX A;  5KFH A;  5DG9 A;  1XNR H;  4JV5 H;  2JEJ A;  4J9R A;  3KHL A;  4RAY A;  4GKK H;  2W6Z A;  2PMZ E;  4ED8 A;  4A3L G;  2NU8 B;  3KHG A;  3GIJ A;  3FDS A;  5D1O A;  4DR5 H;  2WB1 A;  3Q2O A;  1CQI B;  1N34 H;  4LF8 H;  4ECT A;  4YQW A;  2X0S A;  4IR9 A;  4BXX G;  1PK8 A;  2V4R A;  3KTM A;  1PX2 A;  4ETS A;  4JI1 H;  4ME6 A;  1S68 A;  3MR2 A;  2P0A A;  2OH2 A;  3OUZ A;  4QWB A;  3HBL A;  1M7J A;  5L9X A;  4LF7 H;  2YRX A;  2C2R A;  2MCT A;  4JI4 H;  1HNX H;  4LF6 H;  1A0I A;  3Q8Q B;  4DUY H;  5CA1 F;  1FKA H;  4O3R A;  4I55 F;  5LL6 b;  2QYZ A;  3EPG A;  4EFE A;  2RDI A;  4ED7 A;  1VS0 A;  1B33 N;  1M0W A;  3FKI G;  3GLK A;  2V9W A;  1Y1V G;  3JSN A;  2W9B B;  5KFJ A;  2R8J A;  1Z2O X;  2E2I A;  3RB0 A;  1KJ8 A;  5FPO A;  2WE6 A;  2R8K A;  2FJZ A;  1SFO A;  1XDN A;  4M7E A;  4A3M G;  2JA5 G;  1TWA A;  3LP8 A;  4JYA H;  2IA6 A;  5HBR B;  4MV8 A;  3OHA A;  1UC9 A;  2YYA A;  3E5N A;  4DR2 H;  2ZM6 H;  3GIQ A;  4GC6 A;  3T5L A;  2XC9 A;  1BGW A;  5LYJ F;  1KBL A;  4DV5 H;  5F9N A;  5HV6 A;  3K5I A;  4J9N A;  3PW4 A;  1DV1 A;  3ORQ A;  4DR3 H;  3GTO A;  3MJF A;  4NXM H;  1TWC A;  3BAA A;  4A3B G;  2VA2 A; 
#chains in the Genus database with same CATH homology
 3KTM A;  2FJZ A;  2FMA A;  2FK1 A;  2FKL A;  2FK3 A;  1OWT A;  4PWQ A;  2FK2 A;  2M05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...