1OWWA

Solution structure of the first type iii module of human fibronectin determined by 1h, 15n nmr spectroscopy
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
93
structure length
93
Chain Sequence
SGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional significance of mechanically unfolded fibronectin type III1 intermediates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Fibronectin first type III module
total genus 10
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1owwA00
3WFDL 3LQZA 1MHEB 2ADIB 1JIBA 2DIJA 4JPWL 1QPPA 3QG6A 4D0CA 5IK3A 3P9WB 1F4XH 1ZT7A 1VFOA 4HC1H 2VDRH 5B21A 4ALAH 4MGXA 4AK1A 4L9DA 3BZEB 1S7SB 4FTVA 5A16B 5IQ9B 1MVUB 1NC2A 4K8RC 5DJ8A 1J1OH 2MJWA 5JW4M 4Q2ZB 4YHIA 2BNQB 1FVCB 3KPQB 4FXGA 1A8JH 2F9BT 4PG9A 1U8LB 2PO6B 3NCYS 4PJIF 3DBXB 1A7RH 4D8PB 3CFCL 3D48R 4WFEE 2ZP0T 3IDXH 5IMKA 2EXYC 2W0FA 2FH6A 1FCCA 1REIA 5EUOE 2ERJC 2F8OA 5FYKH 4C56D 3TIEA 1LEKA 1JTTA 4NWUL 1MWAA 3D9AL 3DJ9A 3LRGA 2MOVA 2DI7A 3BMWA 1CE6A 3FOMA 5TQ0H 1IKFL 1ZT4A 4OZGA 1XH3B 2CDEB 1U8HA 1OY3B 5EU6A 1C16A 2XT1B 4OV6F 2Q3AA 2GAZB 4P9ML 4O4YL 5IJVB 1XT5A 1FBIL 1YMME 2GJ6D 3VD3A 5D2NB 1KBGL 4D0CB 4YHLL 4BUHA 1N26A 3MRFA 3U0TB 3V4UH 3GJFA 4OLWL 4YXHH 5EUOB 3BDBA 3DHMA 4IOIB 3U9PL 4MNGE 3F7VB 1JP5A 3SE3C 3CLEL 1A02N 3FHQA 3OKMB 3QAZC 1MJJA 2PO6A 3SPVA 2R2EA 1U92A 4MDIB 2H32A 1SYVB 2X5PA 1OGAE 4EN3D 4GRWF 1JV5A 2IAMC 1WAAE 4PJBF 5ICZB 5LXGL 4ZSOE 4N8CL 2W60B 1ITCA 3B43A 1RIHH 1PW3A 1UA6L 4P4KD 2YD1A 3DUSA 3KPMA 5EBWA 3OKDB 2P8PA 5EDXA 4DN4H 1KB5B 3SKOA 5T33L 4P4KC 4KUZH 4M6OL 1HI6B 4RQQB 4KHTL 1JHLH 3IVKB 5B39A 1FNFA 4POYA 5J12C 3WLWC 5AYUH 2WUBH 4NO0D 2E7LC 5JMRA 4BJLA 4JO4H 3EZJB 4HH9B 5MEPA 5SWQB 4Y4KA 4K2UL 3BSZH 5HYSA 3PDGA 4JPKL 1EFXA 2PNDA 3LN5B 3IDMB 4K3DH 2GSGB 1GGIH 3D0LA 1I8LC 5J9PB 4N5ED 1KENH 4QRQA 1D9KB 1UENA 4K7PX 1FDLH 3MACH 2W60A 2E9JA 4NUGH 4JB9H 1SJEB 3T0AA 5T3ZL 1A7RL 1GHFL 4NDMA 4WU5A 1NFDF 1NCUA 3WJLA 4UTAH 4JY4B 2OQJA 2G2RB 4QHKJ 1R0AL 2IALA 4GKSB 2X44D 3DX6A 2ATPB 4F58L 4WV1B 1S7QB 4GBXB 1YEDB 1JNHA 1WITA 4ONHB 2DQJL 3H42H 2ITDB 3I2CH 1JL8A 1L6ZA 4DAGH 1K8IA 1C7TA 2CGRL 3SKMA 4XPFH 5CD5C 2AEPL 2QQKH 4YNYA 1JZ3A 4LNVA 2C1PB 3O3EA 4PJ8C 1YN6A 1T7ZA 4G8FA 4JKKA 1HZHH 1N5YL 1XIWA 2ZJSH 1XR9A 1DUZB 3GMPB 5DURB 4DUWA 2DJ4A 4GRMA 3UYRH 1LNUB 4O02L 2AK4D 3ARBB 1ZMYA 4H5SB 4MNGA 2VZSA 1G7MA 1XGTB 3ZKMC 2QSVA 5LCVL 1YNLL 4NYLB 3RDTA 3NIGE 5DD5L 3GKZA 5D7JA 2V9RA 1LEIB 4GRLB 4QO1A 2ZOKB 5DEGB 2F74B 4FNLL 3UJJH 3VFGL 5DUML 2CDGA 4LEXL 3PNWB 3KPOA 3HRPA 1YEDA 1DBBH 1DANT 1T20A 4O5LL 4X7SL 4XMPL 2MHAA 2QSQA 2VDMH 5IB2A 4XC3L 4LASL 4ZFOB 1OLZA 3H6JA 3TA3C 2RB8A 4GW1B 3MLXH 4IIQC 4MNQB 4Y2DB 5C0AA 2JF1A 3GM0A 3OXSA 3ARGD 3NTCL 5BV7B 1S7RA 2C1PA 3OAYH 4HMDA 2R1WB 2Q8AL 2JCCE 5DD6A 4XNMB 3BN3B 5GRXG 2BVTA 3MFFA 2YN5A 4LDOB 4HK0B 4Z7VF 3ZKMD 4QF1B 1JVKA 4UT6H 1MFCH 4D0DA 2AK4E 2NMSA 5C71A 1AHWA 1FYTA 3D25A 1NLBL 4MJIA 1OTTC 4ZOAA 4MAUL 2PYEB 4FQQA 1JRHL 1YEKH 4LLWB 3QQNA 4WCYH 3S4SA 2B4CL 4Y4KC 3SBWC 1JNNL 4WW2F 3KYNB 3P4OA 2JK5B 3Q6GL 1OPGL 4J12A 1JZ6A 4LKXA 2WAHA 2WNGA 3TEUA 2NY5C 4JG1H 1BX2A 3O4LE 1AXTL 4WI3A 1ZSDA 3GMQA 2XIDA 4NKOA 4ZUWA 2ICCA 2CQVA 3SY0A 2WLZA 1OT2A 3KWWB 4HF5H 1A64A 1AGCB 3ULUL 2CK2A 1BGXL 4O51A 2FBJH 5C9JA 5I1CH 5IB1A 5IBLC 2WANA 3V7AE 5FOJA 3RZCC 3FL7A 3TBWB 3E1F1 2AXJA 4LK4A 5CUSL 2DQIL 1QACA 3BDXA 4PJ7E 4OZFG 3QUMB 3EIFA 1XGUB 2E9WA 4D0BB 4W4OA 1H8SA 4UB0L 1AHWB 4L3EA 5JXEC 3BKCH 2PYEA 2O5XL 4FQQB 3AM8C 5F70A 4RMVA 1C1EH 1TVDA 5JXED 5FKPB 4ODUB 1HHIB 3HE7C 2X9XA 4MSWA 4M6MH 4ZXBA 3HUJE 4XXDA 4U33A 1E4XL 1IARB 1NCNA 4LSTL 3DIFB 1OF2B 2HVJA 4PRPE 4D9QD 3W9EA 5EPMA 4PGDA 3EFDL 2NLJA 3H9SB 3NPSC 1H3PH 3D2UA 5HYJA 5D7JD 3M17A 1Q0XH 4JFQB 4YDVB 5LGHH 3MRRA 3VFNA 4JKPL 2X4PB 5C7XL 4MCYA 1OAUL 2YPLA 2BSTB 1PYWA 3FONB 4NIKB 5GGSB 3U9PH 5FCUL 3VH8A 1O7SA 3WD5L 3IU4H 4MS8D 1TZGH 2C4XA 2ENYA 4RAHA 3MRMA 4X4ZA 2VABA 4LBEB 3I9GH 5FUCC 4PB0L 3C2AH 1OGAD 3HUJB 3FZUD 4D0BA 2D31B 2VIRA 4P59H 4L3EB 1MF2H 1N2RB 4JFOA 4FTVE 4JHWH 1KPRB 1T0PB 5MEND 5C08D 1F42A 2VC2H 3S37X 3S3PA 2DICA 1WIUA 1HHIA 3SEPA 4MA1B 1XGQB 4YHOH 4OCYL 4Y4FB 4P3CH 1BJ1J 1N7ML 4Y5XA 2KQMA 1YMMD 2GJ6E 2R9HD 4YDVA 2R23A 5MP6L 3AREC 5GS0L 1AGBA 5IFJB 1CLZL 5JZ7D 3GJFH 1BFVL 1IGFH 2VR4A 1G7HA 3VG0H 2EDJA 3QPQD 4CRPA 1I8LA 2CKBH 4J3SA 4U1MB 5IJKA 1F58H 4OZ4A 3CJJA 4C56E 4G6ML 2C1OB 2CLRB 1MRCH 1B6DA 3V9FA 4HJJH 3QI9C 3EYSH 2AK1H 1KCUL 3BE1H 3KLAA 1OTUD 2PYFB 1MFAH 2WINA 3OKYA 1YUHA 3MV7B 5GS0C 1EGJL 1IGCL 3MO1B 5EU6D 5E1AA 5EUKA 3ZSSA 5SWSA 3HMXA 3QO1A 3P4NA 5D6DA 3X12B 3MV8D 4P46C 3RKPA 4R4NC 4NKQB 4RZCB 2AEIT 2PTTA 1IZKA 4FFZL 3ARPA 4ZDHB 1W8NA 4L4TA 3W0WE 5F1SA 4E41B 3U7AA 5TFSH 2DTSA 3WV0A 4GJTB 3FQRB 3AS2A 4PJ8A 5GGVY 1ZHBB 3O2WL 1FZKB 4XB7A 1MCPH 3EOTL 1FFQA 3MZGB 4EUPA 3HPJA 4JN1H 1GH7A 3DXAB 5EBMB 2AGJH 4QHLA 5HDOA 3MMEB 4YUEH 4XHJC 4XCCL 1OM3H 1XGRA 2QQNH 3K1KC 1RUKH 3SGDI 1G9NC 2OTPA 3VA2C 2JJTA 1U93B 2FSEA 4RA0C 3DTXA 3FAWA 1YJDH 4TTDC 7FABL 3OL2A 4JFDA 4PS4L 3HB3D 4LQFL 4Y16B 4XT1C 1LK3L 3TZVB 3HI1A 4PJHF 4DKFH 1CGXA 4RAUA 4EI5A 1HWGB 3B9KC 3TJEL 3SGDH 4MQXC 4TSCL 3HE6C 5CEZL 4K94H 2IJ0C 3MBXL 1TNNA 5H35B 5EIVA 3TNMB 1J1XH 2XI9A 4AY0A 2RBLA 3MLZH 4ZOCA 5I1DB 2FEDC 1X5KA 5JNYB 4LARL 1WAAA 2NW3A 1GPOL 3FO9B 3TP4A 3TYFA 4X4ME 3CUPA 4EN3C 1DQLH 2YMXH 4WWKB 5L88L 1IGIH 3N9GH 1JPGB 43CAB 3RA7H 2NR6C 3DXAA 5EBMA 1LO3H 3VXUD 3N85H 4OLZL 2VXVL 3TNNA 4J3XA 1EO8L 2X4RB 5TE7L 4JPIA 4P2OD 5GSRB 1EJOL 1ZS8A 4TTDD 2X1XR 4P4KA 5JLZA 1MHHB 4KRLB 2BJML 5DQJB 1MIEL 1KLUB 3IT8D 2D03H 5F1IB 1FV1A 2X10A 4LCIH 4RAUB 4KK6C 1WSST 3LKRB 3P0VH 1K4CA 3UTZA 5BVJA 4AEEA 2P5EB 2ZCLH 4MJ2A 3LEVH 4DTGL 1HILA 1R3IL 5EN2A 3UTTE 4OD3L 1AO7E 2ZCLL 5KVDL 3KYMB 1NCAL 2CK0H 4NO3A 4ZYKB 3WE6A 3UZEA 4PJ5A 3OKLB 1YYML 3CFBB 3OHXA 4YO0A 2DQEH 4KTYA 4YHOL 1UWGL 4WHYH 2YSSA 4RGOH 2H2PD 3D18B 1T5XA 3WUWA 5A43C 1A6UH 3MPCA 3Q5OA 2Q8BH 2DLTA 4ELMF 3QDJB 1RULL 1A6UL 2D7NA 3MOQA 2WUCH 3O6FD 3QIUB 2X2YA 4P57A 4P2QB 1J5OH 4F3FA 4WO4B 1OAXL 3ARFC 5FGRA 1IGFL 4HAGA 3GSUB 3QI9B 2HG5A 3LB6D 4UB0H 5K9QI 4K3HA 4ZTPH 5B8CA 3ROLA 2ARWA 1UJ3B 1UKTA 1X4ZA 3A6BL 3GK8L 4PS4H 5JIIA 4KI5E 5FYLE 5FKAA 4NP4H 4AEIH 3E6HB 1KG0A 5MENE 4E5XB 5CJ5A 3VXMD 2Z8VC 5HI4D 4MCZA 5TE4L 4HGWB 4N1EA 4S1RH 1OAQL 4PJDE 1ZLVH 1KFAH 3THML 4UQ3B 5F3BB 3GIZH 1KJ2B 3TBYA 3DVGA 4F80A 3GMLB 4PRHD 4Y4FC 3CX5K 4PBXA 2XXCB 5E5UB 5C1MB 3O2DH 3RDTC 4WY7L 2FEEL 3ZSTA 2YEZA 4K3EL 1VFUA 2KPNA 4GXUN 3W39B 1INQA 3BKYH 4ZOEA 4WFHD 1NFDE 3OF6A 1G7JA 4YZFE 1FN4A 4MA7L 3BO8A 3LVEA 5C09A 1BEYH 4EVNA 2V5TA 3ELAT 1JWMA 1QFWL 4PRHA 2A1WL 4JZOB 1NH6A 4JG0L 4C4KT 1R3KB 1AD9B 4ZFZB 3WJJA 2D7QA 4GRWH 5DFWH 2XN9A 3EW3B 1E4KC 3IAPA 4HDIA 4WTXA 4FFWD 4QTIL 4JHAL 3NCJH 1ED3B 4FQLH 5MEOB 1I85A 2FX7H 4CVZA 3LQAL 3R1GL 3EYQD 5T3ZE 4X5WA 4XVTH 3QIBC 5EO0B 1QSZA 1T5WA 5FGSA 1U3HD 3K74B 1HIML 3C6LD 4QHMA 2JJUA 3RVTD 3C60C 1OAKH 1P4BH 3EDFA 4CU8A 4AM0B 5GRWA 1KBGH 1H3GA 3ZHDA 2KZWA 1D3CA 1ZXQA 2HT3D 1X5YA 4GSDL 1B4JL 3HC0B 4FFYL 3B8SA 2IQ9L 2EYRA 5F88B 1DSFH 2COQA 4NO5B 4U1HB 3SOBH 3MLSL 5IMKB 1HKLL 4LRIA 3T0ED 5DEZA 3UYOD 1LWRA 43C9B 3RZCB 5T1LD 1IEAB 2R1XB 4P46A 1NMAL 3ZLQC 4CDHA 3L6FB 4AIZA 1CE6B 2V9QA 1IGTB 3SJVB 3F62A 4XMKH 1XAUA 5CSBA 1WBXA 3FN9A 2K9UA 3TBVB 5B3JE 3RP1A 1G9MC 4KJQD 3SDAB 3WKNA 4D94A 3TYGH 3L5HA 1MJUH 2DQJH 3H42L 2CRZA 3JVGC 3QEQE 2OK0L 4HBCL 4ISVB 1K4DA 1BOGB 3QDMA 1QBLH 1JI2A 3RWFB 1T1XA 4GAGL 4PRNA 4FP8L 1WZKA 3L1OL 1OAYL 3ARVA 1GC1C 4OKDA 3QWRA 4ACPA 2YZ1A 8FABA 2YKLL 2YPKA 2PXYA 4F7TB 4OJFL 2V2XB 2HFFA 5IVOA 3RL1B 4AL8L 2OZ4L 2F5BH 3TN0D 1PVHA 3UTSA 2RGSA 4E0RA 43C9A 3I85A 3ZKSD 2E5EA 5GGTA 1FPTL 5IBUG 1X3DA 1P1ZB 4G7YL 1U6AH 2NW2B 5HGHB 3OKDA 4Q9QH 3B8YA 3IJYB 4JPKH 2AQ2A 4JRXD 4NQEA 4WI5A 2EC8A 1ZK9A 3MV9D 2H26B 1NJ9A 3IVKA 4F7CA 3ULVE 4AQOA 4KVNH 5F9WB 2BDNH 3BIKA 5D8JH 2VLJE 3LKNA 4PJFE 1QNZL 4MA8L 4M7KL 3AB0B 2FHFA 2XNAA 2FB4L 4KRPB 4XAKE 4XTRD 4YDJA 4POZC 5JIPA 4EKXA 1SJHA 5L7XH 4XWGH 4JQVA 4H8WH 4EQ3A 3WFZA 1QSEA 4KGLA 5FYJH 4K07A 3DX7B 5HHMD 4CNIB 1F3DJ 5CEXA 5FO8B 3H3PL 1T1ZA 3FQUB 1VB9A 3T3ME 5LAXA 1GOHA 4I2XE 2HFFB 4HIHA 4P5KB 5I74B 3ARBC 3HTLX 2NZ9C 2XA3A 4TVPD 3QSKB 3GO1H 2BSRB 3VI4E 4KJPC 5I18H 3SDAD 4RMWA 1FBIH 3RZWA 1NCCH 3T4AA 3CLEH 3NAAL 1YNTA 1AIFB 3KJ4C 2W65B 3MRCA 5FHAL 1S5HA 1JZ4A 1R3HB 5CZVH 4LMQI 3HNVL 1VEMA 1BD2E 1MAML 3U6RB 5F7HA 5J56B 2VL5B 3E2HC 4WTZG 4O2CA 4ZS6C 3OKNA 5D7LD 5D1XD 3KDMB 1RIUL 5C0GB 1A9BB 1U8NA 4XC3H 4U1SA 2EE2A 3V5KA 4YR6B 1VSCA 4L9LC 5LBSL 2AABL 3TPKA 1DUZA 3GMPA 5HDQL 5ALCL 1CICC 2CUHA 3TO4C 1AQKH 1T22B 2N7BA 5E99L 4JFHE 3JUYA 1CGYA 5IGXH 5JXAL 4YHYC 4V1DB 1UT9A 4TUOA 1QTYT 3JWOC 3O4LA 5H37H 4XZUA 1NC4B 1ZOXA 5JOPD 4XVSH 1JUFB 2P5WB 4TNWK 3E6FB 3MOBL 4ZO6A 3S3JA 5CAYB 1CG9A 1JHLL 5C0JA 4FS0A 3BW9B 3SDCD 3BYYA 4GRLA 1X5AA 2VXUL 1Y0LB 4XP6L 4E9LA 4DW2H 2VB5A 3O3DB 1S5HB 2OTWA 1MI5B 2E6JA 3HZKB 3NIFF 4HWZA 2OJZL 2IAMA 4M7LL 3FFCE 1Q9WB 5F7UA 2FGWH 4NQEE 2BVEA 2XKNA 4JM4L 3UBXG 5TDPA 4RGMC 2BSED 5KS9F 1OLLA 3FB6B 1OSZB 5FUOH 4R4ND 1EO7A 1P6FA 3CH1A 3UTTA 2XWJB 3KR3L 4TQEH 4B7IA 4DZBB 4XNMA 3EYUH 3TF7C 4ZQKB 1I7ZA 4Y4HD 4ZAKB 3SCMB 1CYGA 2EO1A 4X0KA 1ZAGA 3HG1D 1ZKAA 3BKYL 3L95A 4Y4HC 4HWNA 2PO6D 4BELD 4IOFC 4ZUVB 2G60H 1I3RA 1XFPA 4F58H 2DLFL 1D5MB 4QNPF 4XVUC 5BJTA 5FV2A 4BKLB 4BQ9A 1BGXH 3S4SB 3GO1L 2CKBB 5C8JB 5F9AC 1G6RB 5D4QA 4JY6B 2XQYK 3OKMA 1G7LA 1Q1JL 5J3HD 1G9ML 4LQFH 2AJUL 3N0PB 3GSWB 3PWPE 5HVHC 2BY3A 4JCLA 4QCIA 5TPWH 3DPBA 5GS0D 1F2XK 3DURB 5CP3H 5DJ6B 4FQLL 2D7TH 1T80A 2FO4B 2GIYA 4K3DL 1A22B 2AXFA 5C0RH 3BP5B 1IAOA 2G5RA 3S6CA 1KB5L 1T3FA 4LRIC 4Z77B 5AWNL 1IBGH 5HYEA 2PO6C 1NANH 4WJ5B 2FIKB 5INDA 1YJDC 4ZUVA 2GTWB 3LPWA 1WCQA 3GHBL 4JFHD 1ODAA 1R0AH 1MAMH 3SDYL 4UBDD 1YQVL 1ACYL 4Z7UA 1S9WB 4YHZH 3OWEA 1A9EB 3SDDD 2CMRL 2CXKA 1LO3L 4GAJH 1P4IH 2CUIA 4JO3H 2EKSB 3O0RH 4LSQH 2B39A 5I1JL 2XN9E 2YPLE 5IF0A 2I24N 1YDPA 2JLLA 4RWYH 1PJ9A 3PDDA 4C59B 1S9XA 5D6CA 3JV4A 3LEVL 1BD2D 2HJFA 1PYWB 3FONA 1ACZA 3UBXI 2XWBA 3GJFK 2A6IB 4J4PC 2G2RA 4LCIL 4NBZB 3SDDA 4KROB 2H2SD 3SDCB 1UKSA 3DI2B 4OZGF 4PJIE 4F7PB 4MB4A 2L7UA 1Q38A 3HUJA 3WFCH 2PXYD 1TTFA 3MXVL 3EFFA 2GT9B 3H8NA 3CSBA 1JF1B 2V6HA 2GITB 3QCVL 5F97E 1N4XL 2EEDA 3OBAA 4XBGA 5C0DB 5DQ9B 3MBEA 3VRJA 5ADOL 5DHYA 4FQ1L 1UVQB 2BK8A 5LVEA 1KTDA 2J8HA 3UBXA 5FYLH 2V9TA 2NXZB 4H1LH 5LBSH 1S9YA 2Y36H 4Z5RA 3K4AA 4I8DA 5EU7C 4OBRA 1MRCL 3WFEH 4WW2C 2EE9A 1NGPH 4OT1H 3VE0B 4Y0GA 3QG7H 5HVHB 3SKJH 3PWPA 4HUWB 4NQDE 2DJSA 4L3CB 1AGBB 4C58B 2R8SH 5L8JB 5JIHA 1JK8B 4Y19B 1U8MB 5JA8B 5I8CB 2ZOLB 2NY0C 4ZFFA 2WIIB 3K2UL 2VLME 2HYMA 1HHKB 4ZS7L 3F8UB 5I8EB 4MXQD 4A2MA 1PZUB 3B2VL 3VXRE 4PBWD 5KG9A 3VD4A 1FLRL 3ROOA 4Z76A 1ETZB 4XNYH 1Q0XL 3IFOA 1DN0B 4YUEL 3PWLB 5T3XH 1KFAL 3THMH 1TNMA 5EC1B 1EEYB 2BMKB 4X4YB 3MXWL 1INEL 4WUUA 5DD3H 2BNUB 2IQAB 5IW3A 5DGQA 5CIPA 3QNZA 4RGMB 3I75B 1IC5L 4ONFH 1JGVH 1UZ6F 3ALWA 1S7VB 1IC5H 1MCIA 3BPOC 3RGVC 3S5LA 2JJTC 4ONFL 1S7SA 2APFA 1CGSL 5E4EC 4IIQA 1D6EB 3ZKND 2DWEB 4YZFF 3BN9D 1QBAA 4S2SA 4K94L 1J0ZA 1HCVA 4LLYA 4MXQC 4H8WC 4KQ3H 5ERWA 4GAFB 1PEZA 4JDZB 2VXTH 3FRUA 5D1ZD 5IFHL 5DZNA 2FLRT 2VYRE 3UTSD 4DCQB 5BS0B 4RMQA 2AKRB 3CVHA 3CSYA 4ONGL 4CL7A 3FT4A 2MCPL 3CFIC 1NC4D 1PX3A 4OCLC 5EU3A 4DKDC 2XQBL 3C5SA 1WZ1L 5DD5H 1J1PL 3T2NH 5GGUA 2ID5A 2CJUH 3PHOA 5DS8B 1EFQA 1U3HC 4EDWH 3C6LC 2PYED 5FEBA 3V4UL 2JKXA 5HYJE 3WSQH 1KLGB 4LSRL 3NA9L 1FORH 4DKAA 3U9UA 2H3NB 5HVFB 5FB8B 1CLCA 2EDKA 2YK1L 3B2UD 2B8OT 1CFTB 5IKCA 3EYOA 5IWLA 2IBZX 1DJSA 4XI5C 1J11A 1R24B 1KCUH 4UI2A 3SJVD 3U79A 4LLUA 2JIXB 3MCG1 4RGOL 4W68A 1NCBH 1PG7X 1AE6L 3D3VE 5I71C 2MKLC 2GSGA 4BM7A 3AAZA 4LSVL 4GLRH 4J3OC 5IROC 1WC7A 4Q9RL 4I18C 3Q2CA 2Z31B 1Q9OB 2FDBP 3EBAA 5MHSE 2Q87A 1OAQH 4LFHD 2C4FT 3CD4A 4QYOA 4RDQG 4HAFA 3P0VL 4JY4A 2IMNA 5GGSA 5IQ7H 3H9SD 5IHBA 3OPZH 1CDJA 4L8SA 5JXAH 2HJLB 2VLRA 4QRRD 1S7XB 3HHRB 4PJCA 1BHGA 3AB0C 4NO3B 1YN7A 3BQUB 2VQ1B 4UU9B 4Z8FH 4JHAH 4R0LA 1S7QA 3JVGA 3UZQA 1NC2D 3GBNH 4M62L 3MOBH 1AI1L 1SEQL 1MCHA 1XF5B 1F3JB 1XZ0B 1T21A 2OMNA 1YMMA 4PJAF 2BNRA 1UH3A 2HFTA 5DC4B 2ICWI 2KKQA 5JPNB 1ZLWK 3QYCA 1V7NL 1TCRB 4UNUA 5AAWA 1I4FA 1IQDA 5KW9H 1XR9B 3RVVD 1WQVT 4G6KL 4QRPE 4JRYD 4WEBL 2N7AA 3PL6C 5I1KL 1XF3A 3CDGB 4ZPTB 1KGCE 3NZ8A 1A6VH 2R23B 3BGMA 3FZUC 4MHHG 2ED7A 2IANE 3MV9B 4I18B 3S36L 3OJDA 5FM4A 1BQLL 5AWNH 1I1FA 3I3EA 1I1AD 2UWEE 1ZA6B 2ATPA 4G6FB 1LO2L 2ZCKH 4XP5H 5ITBH 2NZ9D 1YEJH 2AJXL 3HKFA 1K8DA 3O0RL 2A9ML 5EG6C 3CFJA 3ILQD 4X9GA 4YIQB 5F8RC 1C12B 4DEPC 3DVNB 2J12B 2UUDK 5GSVA 5DWUL 4XCFH 3U48A 3VW3L 3H9HA 5FECA 5JW3H 1CLOL 2Z31D 1Y6KR 4U1IB 5EBLB 2HP4A 2X6MA 5FUZH 4R97C 2YUXA 1G7MB 1FVEA 2DBJA 3P4NB 4BZYA 4HKXA 4GW4A 1AY1L 5EZJB 1QYGL 3ULVL 3CFKB 1A3RH 4HKZB 2F15A 3AXLA 5DSCB 4EDWL 4L8CA 2EDRA 3BWUC 4X7TB 5E00B 5ACZA 3LMJH 4XHQA 3RU8H 4MJIB 2EDNA 3D39A 1J1XL 4GAYB 1FNSL 3IS1X 1DE4A 2A0LD 1F6FB 1NMBL 4HUVA 1MNUH 2H6PB 3SE8H 1II4E 3CFCH 3QQ9C 3MNZB 2D0GA 5MEOA 1T66D 3L3KB 1S3KL 3RGVB 2VDNL 3B5GA 3S34L 2NQCA 4FQ2L 1KCVL 3GB7A 3GMQB 1Z9SA 4HXAH 4YHML 1IC7L 1DDHB 3FOMB 3SHSA 5C2BL 1NMCC 2DI9A 3IRZA 2BNRE 2DKSA 3TYGL 1WWBX 1BVZA 4JO2L 3AC0A 1AQDA 5IW1B 4HW6A 1S9VB 4JZJC 1AD0B 3ARXA 1FYTD 3QUZA 5JNYA 2W91A 2GJ6B 4DFHA 1F5WA 2WM0A 5I1GL 1MCOL 4QRSB 4TQEL 1JWUB 3D39B 1G7IB 4HZLA 2X7LA 1W0VB 5FDWA 1KT2A 4JRYA 4APQD 2N56A 5IHZB 1EIBA 4L5FL 3WUWG 5L2KE 1HKFA 1I7UB 1KC5L 5ACMA 3K4DA 3E8UL 3ARDC 3U30B 2NY0B 4MSWB 4NQSB 4XMKL 4EI6A 2FCBA 5CP3A 5TF1L 2RQ8A 5KS9E 3L3KA 1RUQL 2ITCB 4KJWD 3NOIA 1FNEB 3MA7A 1KJMA 4M9PA 3QIWC 4NO2A 1MHHA 5CLWA 5IMOB 2P8PB 3JV5A 1KYOJ 5IBTH 1RZ7L 1CK0H 5KAQG 5KJRL 4N1HB 3IF1A 4WW2B 4XMLL 2A6JA 1JGVL 4BFEA 4NQCE 3QULB 3DRTB 1T1XB 3UJTL 4LCYB 3MV7E 3QUMA 4OGAC 4LHUG 3QUYC 4PJGF 4OZGE 5EU6E 2BOBB 4D2NA 1FL5B 3RWDB 3ZTJG 1CE1H 4WTWA 4JREC 3EOYG 4PRDB 3E3QE 2VABB 3U0PB 4QT5A 1X5GA 5GS1C 3C09B 4KK5D 4JFZH 1A3LH 4ZO7A 3OR6B 4JM2F 2YPVH 2YSSB 1O7VA 1URLA 3H7LA 4JFZL 4X6FA 1G7QA 1FFPB 1NANI 3MRKB 5FM5O 3VWJA 1CDBA 1NGXB 5FGBC 5J4MA 4OCSH 2DLEA 5MEQB 1BM3H 5L7XL 4Q0XL 3IXAA 5JOFB 1YA5A 5GRZA 4F7MB 3LS4H 4FQJH 3QISA 2HWZH 1F3DH 3EYFA 2NXZD 4F3FB 3GMNB 4P5TA 5ADPH 4OLWH 4RNRB 3T8XB 4R7NB 3EJYD 1LE9B 3FB5B 4JFFD 4XNZB 1NBZA 4OGAD 4YDJB 4RMUA 1J88A 4P23B 3GMOB 4S1DD 4IDJL 5H8DA 1DQJA 3WD5H 1ZWIB 3OJMB 3KPPA 2C5DC 2C7UA 2GJZA 1A6AB 3ZTNH 5DHVB 3AVEA 5DYOA 1VADA 3PV7A 5M95B 3VW3H 2EDLA 4JFOB 4R4FH 1T03H 3AM8A 3V6OA 4LPWA 2ZCHL 2BFVH 4FG6C 5JQ6L 3UO1L 3BZ4B 3M07A 2EDWA 2HJKB 4MVBD 1NUNB 1BD2B 1A4JB 2I5YL 4F2MB 4IRJD 2VLJA 4KAQL 3FFCA 3PWNA 4GAGH 3L3GB 4MYWB 2ADJA 5SWSB 3KLDA 4XVSL 5J1TC 3VFRA 2BRRL 3MGTB 2UWEF 5DJ8B 3MQIA 2QADB 2FHCA 3IFPB 5IFJA 2H8PA 3UDWA 4UBDC 3NH7H 3ILPB 2MCG1 1MFEL 2AEQH 5DK0B 4OI7A 1HHHA 4IRSB 5CZXD 4U6XB 5HGAA 4NZTL 3ZYJA 1J0JA 1CGWA 4LLDB 3FMGL 2CLRA 4U1SB 3B4NA 2K1MA 1BZ7B 4WUUE 3V5KB 5I1GH 3L3JA 5D5MB 2X1WL 4D9RD 3U82B 5CILL 2NX5B 1A1MA 1HHGA 2EYTA 2IMMA 1YECL 3MREB 3EYSL 4MMZC 1DLFL 1BVKA 2V5RA 2Y36L 4XNUH 4Y5VC 5CZKA 5D7LA 1T0MB 3REWA 4UTBH 2DTML 1NC4A 3WKMH 4LU5L 1OGAB 1MCKA 4J8RB 3SCMC 2WV3A 1JMZA 4OZIB 2V2TB 1P7KA 4J6RH 5ILTH 3TPUA 3DUHA 2A38A 4OI8A 4K71B 4DW2L 1CU4L 3F7VA 1WUNT 2PXYC 4LL9A 5DVLA 1MI5A 4M1CD 1MCNA 5FOBB 2R15A 5I1DA 1DANU 1KNOB 5JHLH 3F12A 4LSQL 3MRQB 4PJXE 2J8UE 5LGHL 4NQED 2YUVA 5IVXF 3RIFK 1OSZA 2A9MH 2EDOA 1VEPA 4P46B 1H3PL 4J1UA 2ESVA 3LS5L 1FG2B 1QFUL 1NGZA 3UTPD 1H3XA 3MLWH 3Q5YA 2HFGL 3FQXA 5TJWK 3DYPA 1N5AB 2DQGH 1MQKH 5E8PB 1KIQB 2NTSP 5DJXA 5DQDL 5IBUB 3PXJA 1TVHB 4NCC2 2VMFA 5GS1B 3F7YB 1D5MA 4LEXH 5D2LE 4PGZA 1IE5A 4TN9A 4ZUTA 3RIFF 3IFLH 2UZXB 3KJ6H 3MV7D 1GSMA 1J10A 3HC4H 3LQAH 4HG4J 1UYWL 3GJEA 1M05A 4WTZA 3CUPB 2I9LA 1TJHL 4GG8B 2ARJQ 3MJ8A 4PJIA 4LHUA 4K9EC 4LPTA 4PJHB 4PRBA 4ODHH 1Y6MR 1I7TB 5CGTA 3GDBA 2Y5EA 1HH9A 2D7TL 1PLGH 5FO9B 3BD3A 4YFEA 4KV5E 3H3PH 1QVOA 1M7IB 2MMXA 1ZS8B 3BP5A 3HE7A 4JFXB 3WMSA 3QRGL 4WU7A 2B20A 4XPGL 4LCCB 2HRLA 3QUXA 4MA3A 1MREH 4M43H 3U1SH 2DBLH 5F9OH 4GBXA 3RRQA 3BP7B 4GKNA 3RPKA 4JO2H 4PBVC 4U6YB 1Y18A 4UDUB 1JPSH 1E4KA 1HNFA 1JGUL 1EEZA 4K9EL 3B3IA 5H94A 4MNHB 5HBBA 3HNTH 1HQRA 3KNBA 5IFAL 4AEHH 3VFSA 4X7DC 4ZUUA 1RIHL 1U95A 4PR5A 4JRWA 5D1XB 1VA9A 5DJ2B 4P3DB 3BEVB 4XAKD 1NMCB 1UQSA 1SYSB 4KJYA 4L3ED 2Q86B 1RUML 2DQEL 3WNPA 35C8L 2AXGA 1ZVHA 3DMMB 4UT9H 3NPSB 3MLUL 2YBRB 5KSUB 4P57B 2R29H 3AY4A 4Y4FA 1KEML 2YHGA 3W9DB 1JFQH 4XMLH 3V4PH 4JEGB 4Z78A 5IESH 5ISZA 3NZHL 1OP3K 4KDTA 4CVUA 5KANG 3V4PL 2AP2A 4Z7OF 2HG5B 1A7OL 4NRZA 3E3QC 4PJCF 1CQKA 5IQ9A 25C8H 3MV8A 3HRZB 1MOEA 3KPSD 4G6FD 2OI9B 1AHWC 3D69B 3V0WL 3GMRA 5E94B 3KHOA 2EEBA 4X6EB 1ND0A 4PJEF 4BSJA 3GMMB 2AK4B 2F53B 1X4YA 4Q9QL 1VFAB 5E2VH 3VXMA 3VFOB 4JVPA 1LEKB 1J8KA 1F6AB 3T65B 3VWKD 3RWCA 2QLVB 1H5BB 1T83C 1A1NA 4YXKL 4FQIH 4HDIB 4LOUD 1GC1H 1EZVY 3CC5B 1G1YA 4NQDA 3BEVA 2X4OA 3X3FH 4M5YH 1OP5H 4X6DF 3KLAB 4KKNA 1C16B 4HS8L 4XTRC 3MRJA 3U83A 3TA3A 2APVA 1JN6B 3O4LB 1T1WB 4NSKA 1EHLH 5CHNA 2YA0A 3SOBL 4X5WB 2LU4A 3W9DA 4UTAL 4Y19A 4WY7H 2Y5TB 1QLFA 4PB0H 2MCPH 1V7ML 4ZFFB 3BQUD 2NY7L 5D1QA 4RMRA 3BRDA 1E6OH 4YFDB 2E7LA 3VMNA 3CXHJ 1I1AC 2JK5A 4M1DH 4KKLD 2CJUL 3GMRB 5E94A 1H8NA 5CBAA 1AD9A 4HS3B 1DN0A 2EIEA 1NFDB 3QPXH 4YBQD 5CP7B 1KJ2H 4CN1A 3PL6B 3DO3A 4XVJH 1OM3L 1ED3A 5D1QD 3SY0B 1IKNA 4ODHL 3JXAA 4NJ9L 1CZ8L 3LKQA 1P7QD 3W2DL 1S7TB 1RK1A 1I7ZB 5GIRA 4PY7A 3TA3B 2NXYC 2ADFL 1KELL 2A0LC 1SM3H 3DMMC 4LCWB 2GI7A 1MAKA 1I7RB 2L7JA 1S5IH 2CDFA 3T2NL 3DI3B 4QRRE 1S78D 3HLAA 1QKZL 2Y06L 4KUZL 4XPBH 1AFVL 2E8ZA 3EDEA 4JDZA 5I1CL 3NBNA 5J8OA 2HKFL 2IEPA 4Q58C 4HS3A 3IDJB 2WUCL 3BVNB 4EDXA 5HYSG 2Z31C 2IPTH 2AXHA 2D9QB 3FB8A 1SJEA 4XAWH 3VFVA 4HEME 4PJ7B 4PGEB 3KPSA 4LHJB 3EUUA 2QHRH 2AXFB 1LO4H 4HZAA 2RJMA 2RCSH 1P2CA 5DK2A 2OK0H 3B6SB 1F6LL 3VG0L 1LVEA 3O3BB 1RK1B 4OF8A 4CDGC 3WS3A 3GK8H 4MHHI 5I2IB 1FV1B 4KRMB 3RWJA 3LRHA 4FP8H 2FIKA 1CU4H 3KYOB 3IAGC 3OX8B 1I7RA 3U4BH 4X8JA 4HWBH 4UNTA 1JGDB 5DI8A 1OWRM 2K7PA 4X7EC 3IJSB 4G43A 3BYTA 4YNYB 1L7IL 1RUQH 4ZYKA 1Z3GL 3U7WL 4Z7VB 1A9EA 1P7HL 3OJVC 5J9PA 4F7EA 2J4WH 4YWGH 1Q94B 3BPNB 4CNIA 1T1ZB 4OCWL 1FPTH 4Y5XB 4C56B 2J4WL 3LEXA 4YWGL 4JFPA 5E6ZA 1F45A 2OJEB 6FABH 2ICEB 2A6IA 2VTFA 3QDJA 4JG0H 4LNRA 5F6HJ 3MBXH 3QDGD 4QRTB 1MHCA 1YEFL 3ARFB 1AC6A 2OX5A 3MBEC 2W9EL 3QXVA 1C5BL 2DDQH 1F8TL 2V17H 3MGAA 5C0EB 2DDQL 3T0WA 3MBED 3PDOA 3HB3C 3OZ9H 4ZD3L 3SKJL 6CGTA 3U6RA 5E4EB 5E8DH 4LVEA 2BOCA 4YQXH 2BX5A 1E0OB 3BPOB 3NACL 4WI8A 5DHVH 4LSTH 4FXKA 1YN6B 1HIMH 1MUJB 4PREA 4QRPA 1TITA 3HZVA 4NWUH 4MQTB 1AO7D 4R4BB 2CIIB 3UYPA 2V7HB 5DWUH 3JTTA 4XNQA 1MWAH 5FF6B 1YZZA 4WFGD 5EZIH 2Z4QB 4K71C 3U36A 5F3BA 1FFNA 1SMAA 1J12A 3GRWA 3WN5C 4NYLA 3LDBC 4IRZH 5MERB 1FC1A 3U7YH 2XKSA 2AJZA 5FHAH 2YEZB 4LF3A 4KZDL 3QAZB 4DOHB 1NKRA 3RUGB 1KELH 2EXYD 1EGJH 1J8HB 1QSFD 1JNLH 1CXIA 3ARUA 3KPOB 3UROR 3PDOB 4N5UA 3T77A 4G9FA 4H0GA 4WWKC 1A6ZA 1Z9OA 1MJJB 1QLRB 4EN3B 1FSKB 1DZBA 1MWAB 4FXKB 2XKNB 3DGGB 4Z0XA 2QKIB 2W1NA 2VZOA 4PLNC 4L3EE 5EORH 3T1WA 1UACH 1UADC 3X17A 5B8CC 2DQDL 4PV8B 3RUGE 3ULUC 4G8GA 2V5YA 2BNUA 5IVXA 2J7LA 3X14A 1AR1C 4M6AA 4JKWA 4RX4D 1R3IH 4Z8FL 1UH4A 1ZTXH 2F58L 1FH5L 1EAPA 2WIMA 4P2RB 3GHEL 3KHQA 1UXWA 2AERT 1RK0A 1FZOA 1SEBB 1DFBH 3B5TA 4ORGA 1FH5H 4LF3B 3GEWB 1IAKB 3QDMD 3QDHA 1DE4B 4MQXD 2NY1D 2W38A 3BH8B 3BZFA 2Q8BL 3V6BR 4JM4H 2W9EH 3JUZA 5KW9L 2FRGP 3LEYH 1LP9B 1MJ8H 2J8OA 2EO9A 1SYVA 4HEPG 3MNWA 5T33H 1IGCH 5FYKE 4MVBC 2CR3A 3MLXL 5F89A 1AO7B 3QNYA 4JPIB 1OF2A 3ARQA 2X09A 4XNZC 3H9SA 1WBYB 3I3DA 2JB6B 3CSYB 1CCZA 1ADQA 5DC0A 2XN9D 4ODXB 3FT4B 1MRDL 3I50L 1IGTA 1XF4A 4IS6B 2K7QA 4MQ7B 5CWSA 3KS0H 5SV3A 3WFBL 1I8KA 3VFMA 3ZKNC 3D39E 1OAZH 3MYJB 5FXCH 1A7PH 3SDAA 2VITB 4N9OB 1FO0B 2IALB 3C6SA 4GKZA 4NNYA 2UV3A 1DLHA 3DXAD 1Q9KB 5ESQA 2EYSB 1KCRL 2FD6H 2NX5E 5AG9A 4OAWB 1EJOH 2HTLD 5KS9B 1JFQL 1H3TA 4YO0B 3ULUF 4IEFB 4M4RA 4PJFF 3W0WB 4YX2H 4HZLB 1RFDL 5I76A 3OG6B 3SKMB 1NCDH 4AJ0A 3UJIH 3O4OB 2M8XA 3WIHH 4NZUH 5B4MC 3IDIA 3STLB 4FQXA 4R2GB 4U3HA 1D5ZA 4L8DB 1WC7B 3O2VH 5IF0B 4NDMB 2JB6A 4WGWB 4JVWA 3FKUS 2VOTA 1IEBA 1WT5A 2WBJA 4MQ7A 3QQ3A 4PD4K 3MUZ1 3QIWB 5JW4N 2EIBA 2A6JB 1OSPH 1UC6A 4Z7OE 1NJ9B 1ORSB 1V5JA 1INDH 1AP2A 4JKLA 3C6SB 3ARDB 4GKZB 4NNYB 3T4YB 3SDCA 4DK6A 3P0YL 2Q7YB 2ITDA 4IMLB 4AENB 5C6TL 5TGBB 1AJ7H 4DGVH 1AKJD 5DO2C 3BGFB 1G0DA 2KQNA 3OR6A 2DM3A 3R8BB 3W0WA 1XR8B 5CSZA 2X1QA 3LZFL 5A2IH 2Y07H 5HPMA 4M3JA 1BECA 4TUJA 5ENWB 4Y8AA 4WEUD 3EYVB 2A73B 2DQCH 4JZJB 1QRNE 2W92A 3TIDA 3BSZL 4YGVB 5GRUH 3QFJE 1QSFB 5KVGH 1SMOA 2XTJD 2EICA 2VDKL 1AKJA 3LEYL 5D96C 4JZNA 4C4KO 5FUCE 2ICWJ 4R7NA 1P5UA 3NFNA 4XPGH 5MENB 4I0KA 2EIZB 3UP1A 3HI5L 3NABH 5E5MA 5IMLB 1U8OB 5ANMB 4G5ZH 5DJDB 4R26H 4J3TA 1PFCA 3EYUL 4EUPB 2EH8H 4YE4L 1CICA 3PQYB 3MXWH 2XZAL 1OGTB 3VXSD 3WNNA 1XF2A 3FMGH 1DQML 3RVVC 1JGEB 1ZLUK 4LVHB 5D72L 5L8LB 3TIEB 3OXSB 1U42A 1EUUA 4HIXL 1UXSB 3FN3A 2C3XA 4JFDB 1ZVSB 4NKOB 4FQ1H 4XCEB 3VXOB 3JWNC 3WS6A 5HDBF 3MFFB 3O8XC 3TIDB 3S8WA 4TOYL 1PG7L 3MLYL 2GAZA 1NUFA 1RV6X 1E4WL 3B5HA 4WRLA 1QNZH 4MA8H 5MP6H 3W5MA 5ALBL 2NY3D 3UYRL 2HT4D 4LLWA 2NY4D 1I3GH 3L7EB 4QHNB 5CFHA 2E6PA 5BO1H 1XCQB 3UAJD 3ZKXC 1UM4L 1T7VA 3HNSH 3EFDH 3KJ4B 4G8IB 3HC3L 5AZEL 1RMFL 1DP0A 3SPVB 3LHPH 5D7SL 3UAJC 1XF2B 4M6ML 4N0FA 1JV5B 5D2NE 3RY6C 3VWKB 4TVPE 4LGPB 3W9EB 4N0YH 3L9RB 1MCBA 3B9EA 2AKRA 4WWID 5T1DH 3IGAA 3SE4A 1G84A 5HD8C 4O51B 4JR9H 3MRNA 5E9DB 3X11A 4M7KH 2HRPH 4GRWE 2OCFD 3O3UN 4KGJA 4C57C 3S9DB 2X4UA 1P5VA 3GSNL 3BDYL 4CMMB 5ELIA 4N68A 3QXDB 5JPMA 4IIQB 4WNQA 1FCGA 3O6KH 4OFIA 5KSAA 1X5ZA 5J7CC 2JCCB 4OF3A 5F9WC 5IR1B 5HHOE 4HWUA 4GXUM 4EI5C 4O02H 5I1JH 3VXTA 2XY2A 4HPOL 5JO5A 1BF8A 4L1DA 4JFDD 5HY9B 1BQUA 3MRGB 4K7PL 3QEUA 3VWKA 1IC1A 1I9IH 3LN4B 3T0XA 2LTQC 1KLUA 4RX4A 2H26A 5F96H 4AH2A 1HYSD 2HKHH 3BHBB 5I8OL 1OARH 2OXHA 4Y2DD 4YXLL 4NZJA 2ARJA 4J3UA 3TA3D 4FQHB 5BS0E 3IF1B 1ZHNB 1X5JA 4YXLH 5I71B 1EGJA 1A6TA 4ODSL 2BRQA 3U9UB 1JTPA 1Z9MA 5CINL 5SWZA 1WJ3A 1BJ1H 3RNKB 2Y07L 3CSGA 5K59E 1YN7B 3BQUA 4L4TE 2Q8AH 4PJ9A 4X5LA 2VRAA 4M48L 1ZA3B 1RURH 1RUPH 5BMFL 4JQIH 3QEHA 2HAZA 3SDAC 5JHDE 5GRUL 1F90H 2CLZA 3F5WA 1BJ8A 4WV1C 1FNGB 3L5XL 4HFUL 1FFPA 3MRKA 3GMLA 2R4RL 4M02A 4LCWE 1F4YH 4Z7QE 1V05A 2VSCA 3MV7A 1WFOA 1XCTA 3C6LB 5E8NB 2WZPD 2FGZA 4M7LH 1YQ2A 3I6LE 1YNTB 2A6KA 1FLRH 2HN7A 3PWJB 4I5BA 2F8VA 2D03L 2G9HA 2PTTB 3R06A 4LCCA 5KOMC 2DLFH 3OPZL 5F9DC 3V4VL 3D3VB 4HG4K 3PV6A 1FFOA 1ZVYA 1A7OH 2XG4A 1ZANL 4FZ8H 5D1ZB 3TH3T 1OTSC 5FKAB 4O2CB 2FJFA 5DD0H 3DV6A 2C4FU 3IDNA 4JGUA 1JRHI 3HZMA 1FZKA 4MJ5B 5KN5A 4LVHC 4I2XB 3BUYA 3DROA 4O9HH 2OL3A 1BBDL 3MGOB 1YEGH 5SWZB 5BRZB 4PJDF 2R39A 4D3CH 3NCEB 5KSBB 4O2FA 4HF5L 4U6TA 3WL9A 5K9OB 1QUNA 3QCVH 3HS0A 3NCCB 4GW1A 3A67L 1NGYA 3FCTA 3F58H 1N59B 2FSEB 4XXCA 5T5FL 1BZ9A 5JORB 1OVZA 2IF7A 5EUKB 3MLZL 3G6JF 1RIUH 2BP3A 4KI1A 1JE6A 3IRPX 2NCMA 4ZD3H 2LFGA 1F00I 1XF3B 3CDGA 5HTSA 5B22A 4N8VB 5L2KB 2Q76A 4LSPH 4E41A 1F8TH 1B0RA 1J1OL 1R3JB 5BRZE 3CFKA 2VUYA 3BPLC 3KPRA 2IAND 5I73C 1HN1A 2IAMB 3RY6A 5GGRB 5T1LA 2ZOLA 5F7YC 2AK4A 4DFIA 1WWCA 4XCYB 3ZL4H 5CJQH 3VXMB 4X98A 5HGAB 2CKNA 3QUKA 1QFOA 1UH2A 1AR2A 5L88H 2OL3B 3GI9H 4XAWL 5EO1A 5F7DA 3L5JA 1D5IH 1RMFH 3O45B 1X7QA 4Q7DA 1BX2B 5T1DL 3CC5A 3BIBX 3SJVA 3FO1A 2VXVH 4QHUA 1DCLA 1X5XA 1QRND 1N59A 1M6OB 4Y5YA 3HI1B 3RGVA 4ZMAT 3F7PC 2RAMA 4K9EH 3DUSB 1MFBH 5HXMA 4WDIA 4R26L 3WJLC 5GRYA 3MLSH 4AIOA 3VXME 4RRPG 1EEUA 1U58B 4NHUB 2R69L 2XRAL 5E08L 3P11L 5F1NA 1ZEAL 2QHRL 3QH3B 1UJ3C 1FGNL 4JFEA 3WE6B 4K8RL 1IEAA 2R1XA 4HIXH 4NKDB 1IM3A 4RCAA 4XCYA 4ZO8A 2YWZA 3UTSB 4E0RB 2LABA 4OCMC 2O61B 3V6FA 1MNUL 2OL3L 1RUPL 35C8H 2FX7L 2QQLH 1AFVH 5C6TH 4EI6B 3TN0C 3SDXA 9CGTA 4G8EB 2YR3A 1A7NL 5J3HC 4QXGH 1MFEH 2AEQL 5F7KC 1BJMA 4WO4A 1N3NB 4M1CC 4IOSD 4HT1H 3L1OH 1TXKA 4M6NH 4NOBA 2NNAA 3VGAC 3TGXA 5I17B 4U0QB 4XGZA 2XNAB 3ULUH 1CTOA 1CL7L 1S9WA 2PCPB 1G9NH 4P23D 2C26A 2BNQD 4KI5F 4RFNB 3ECBB 4G6KH 3H3BC 3GJEB 5I1IL 3PWVA 4KV5F 2L0DA 3LKSB 4OLUH 1N2RA 3UTQA 2XWTA 4Z7WB 5B3NA 4LVNB 4EDXB 4LLUB 4DJMA 3RPIA 4UDTB 4X6FB 4BH8A 2ADIA 4P2QA 1DQLL 2HJFB 3L3HA 3KG5A 3H7BB 5DEFA 5T5NG 4OCXH 4NO2B 1GYAA 4PJAA 1KIRA 2Z31A 4M9OA 4HQQL 1KTRL 4G42A 4GS7C 1BQLH 3W39A 4POUB 2CUMA 5J6GB 1C5DA 2MQ0A 1N3NA 3IAQA 4FG6D 5F7FA 5B8CB 1G0XA 1PG7W 4RRPA 4YHIB 4NFBA 2GT9A 3DRTA 2VDQL 3FT3A 3GSXB 1BWWA 3PJSA 1U9KA 5ESVB 4HWBA 4PFEA 1HQRB 4MB5A 2FYYA 3RY5A 1R5IB 3AREA 3TT1L 3ARFD 3LN9A 3ZT5A 4I3RL 3DWTA 2ZJSL 2EDQA 3HG1B 1XZ0A 2HFGH 4APQB 4IRSD 2XKUA 3PABB 4Y4HB 4ZAKD 2VNCA 5HDBE 1U8QB 3BXNB 1MFDL 3QR2A 4UUJA 5EC2A 3PWPB 5CZVL 3BT2L 5DD6B 4MX7B 3H3KA 5CUSH 5DDHA 4P59L 4GSDH 4Z78B 3MRCB 3IDXL 4JFED 2P4AB 1T1YA 2MSPA 1KCKA 4NNPH 5DD1L 3BEWB 4G42B 2VLMD 2ADJB 2VL5A 4CVWA 2WIIA 5HSFA 3LRSB 1CGUA 4IOIA 4PJ9C 1HHKA 5EOQL 3FN0H 1EMTH 5DMIL 5ADPL 4Z6AT 5ESAA 3ZMRA 1TQBB 1PD6A 4PY8J 1NBZB 4FFWC 1SBBA 1QBML 5HHVL 3T3PF 5IVXE 4PJ9D 4NQDD 3TFKC 4HXBL 3PJSB 1RVFL 3R1GH 1FIGL 4BH7B 3HPJB 2GY5A 5CEYA 5JQ6H 4L4VB 3HZVB 3MMEA 3UPAA 5EU5B 3CFJB 5D2LB 4RWYL 2J3SA 2HH0L 1ZT1A 4LHQB 4NQDB 3GI8H 2HVKB 4CU6A 5IG7A 4E42A 4JANB 3LIZH 4ZUWB 2GK0B 5DFTA 1YYLH 5MERA 4HIEB 1NPUA 4BSVA 5DJ0B 2OYPA 2X70B 1TZGL 2GCYA 4YDIL 2A9NH 1QQDB 1FYHB 4GT7A 1U8KA 4OD2B 4OKVB 32C2B 2L4OA 4Y5XC 4NC0B 4L9LB 4UZGA 1NLDH 4LCWD 3RI5F 5I19H 2QTEA 3FQTB 3OB8A 1GGUA 4JKMA 1GXEA 1VCAA 5F44A 3GHEH 5IMMA 5SWSE 4QGTA 5JMOC 3RZCA 2J6EA 3RL1A 1IGML 4OCWH 3PL6A 3E2HB 1JPST 2DS4A 4A2LA 5GZND 3CK0H 4AEFA 4GW5B 3SE4C 2X89D 2XTJC 5GSRA 2HVJB 1T0MA 3G5VB 3PHOB 2DMCA 4NWTL 1S7TA 2AJUH 5D5ME 2AV1A 5ETUB 4CVXA 4HIEA 2JELL 4OCXL 4TRPH 4YGAB 4BSVB 3DX6B 4ZTPL 5JA9A 3SBWA 3L5WA 5E8EA 1MRDH 5DZOA 3VDAA 1GGYA 1TQCC 2VLKE 1R5WA 4OFYA 3U0WH 2DQTH 4NGHH 3PGCB 4JFDE 1DBMH 1RZGA 5SWZD 2FWOA 2YD8A 1IL1B 1MJ8L 2Z91B 3K8KA 4OLUL 5HD8D 4KMQA 1CFBA 1JWUA 4KRPC 4F15B 1H0DB 3ARZA 1MIMH 4P5KA 4ERSH 2VR9A 3B2UC 5DRXA 4FA8A 1RFDH 5CLTA 5C2UB 3F6IA 4KMTH 4R9HA 4X4MA 2VLKB 4NPYA 1CFNA 1N6QH 4JQXC 4PJDA 4CUCA 1KJMB 5HDLA 3HE7B 2GW5A 3TC9A 4XBEH 4KZEL 4R8WH 3O41A 3ULVC 1FO0L 2GEEA 3LKNB 2DQUH 3GRWH 1A0QH 5F7EH 4UT6L 3S7GA 3REVB 1GOGA 3ZE1F 5GS2H 5FUZL 3M45A 5GZOD 2OR8A 2V17L 4MNHA 5H2BA 4ELKB 3DX7A 1RHHB 2I9LB 1GGBH 1UVQA 3JZ7A 1XGYL 3H2WA 2C1OA 4M1GL 4XVJL 1LILA 1G7PA 5LGKA 1JGLL 3JWDH 2BSSA 4TVPL 2EH8L 4DGIL 1VEOA 3RAJL 3U2SA 1H0DA 1A1OB 1WBZB 2IADA 2WP3T 1LE5A 1XIWC 3VE0A 1ULVA 4OZHA 2J6EL 3DUUB 1QVOB 4TUOB 3PWUA 4KKCC 4F7MA 1CBVL 4X9FA 5DMIH 1FRGL 3CVIH 2LV4A 4ODVL 2P47B 1HOCB 2VN4A 3L3IB 3QUMH 4PGBB 1QR1B 2Q7YA 1U8LA 4UILH 5L2JA 2OTWB 1MREL 3U1SL 2YZ8A 1A6WH 1H5BC 3PL6D 5E2TL 5JXEA 1DBAH 2LAAA 1CT8A 4FHBD 1MRFL 3K1DA 5FO7A 4HS8H 4S11A 5JOPE 1T66C 4K3JL 5CSZB 5C09E 4LSVH 5FYJE 1U95B 4RWHA 4JQIL 4PREB 1UWEH 4QRPB 2O5XH 1G6VK 1QLEL 2OI9C 5AAMA 2WUBL 5HHMB 1GGIL 1HYSC 4I0PA 4XP6H 1BD2A 4G6JL 2O5YH 5GJSH 1AKJB 4ZQKA 5T1KD 5CIPB 3FFDA 1MCPL 3PQYE 3ARBD 5D2NA 3T1FA 1JK8A 3VXQB 3CMOL 2FBOJ 4NQVB 4U0RB 4FQCL 1WZLA 5DRWA 1UZ8B 1I3RB 1CIUA 1LK2B 1YNKH 5GGVL 3WIHA 4B5EA 3ULSB 3VU2A 3IFPA 5BJTB 4NQXA 2FX9L 5B38G 4Y1AD 1G9EA 5CMAA 4PJEE 2C9AA 4U1HA 1EDQA 2NW3B 2ZZUT 5K33A 3TWCH 4HUNB 3V52H 3RWGB 1INEH 3VD7A 3MFGB 3GSWA 4WFFE 4CJ1A 4MQSB 3WXVH 1MFDH 1GZQA 1DUYB 5C0AD 1RULH 5TE6L 2MNUA 5BV7H 5E6IA 3MUY1 1TQCB 2YS4A 3PGDA 2FX8H 4YHNB 3ABZA 1D9KD 2X4OB 2J5LB 3G6DL 5BXFA 4KK5C 1G1CA 3SO3B 4ALAL 3IXTA 1IAOB 1CGSH 5HVGB 4EEEA 4RISH 4XXCC 3AROA 5I1EH 3G6JE 4PY7B 2GTZA 1TVBA 3MRMB 1OW0A 5EO9A 3K80A 4Y19D 4LBEA 4JM2D 1EHLL 1EJ6A 1QLFB 2HLFD 4WJ5A 1K4CB 5FB8A 4S2SB 5B3JF 3L7EA 4QHNA 3LPGA 2V5SA 5LGJA 5EIQA 1KJ3L 2DKMA 1WZ1H 4GG6F 2HLAB 3HN3A 1KPRA 3MV01 2V7NA 3QPQC 3FRPA 1W72H 3RA7L 3UO1H 2OMBA 1MIML 5IB5A 3MRBB 1FRGH 1KNOA 3HMWL 4F7TA 5GS2D 3CIQA 3MTRA 2JIXA 2Z8SA 4XPFL 5T3XL 4CAGA 1AR1D 5HGBB 1EPFA 3FRPG 5ACLA 1FFRA 1NFIB 3RWIA 5D6CB 1T89C 5E9DA 5KZCB 3WBDA 5GPRA 2W9LA 2ZUQC 4JCMA 3VDCA 3MLPA 1JPSL 1HKLH 1CI5A 5LCVH 3HI5H 3NABL 1RPQA 4L29B 3NH7L 5DJXB 4LLVB 2HJLA 2VLRB 4LCWA 2UYLB 3A6CH 4IRJC 5E2UL 2WWKO 5JPMB 1CDCA 5E2WH 3P30H 4Q9BA 1LD9A 1YPZB 4Z7UB 5J12B 3Q6FB 2DN7A 5TDOA 3C8KA 4WHDA 2A74B 2MTPA 1VGKB 1UA6H 4HLZG 5IESL 3BAEL 3D6GA 2P5ED 3BKJL 5DUBB 2UUDH 1JNJA 3QXAB 1ES0B 3AAZB 1YEHH 1BBJA 3QDME 3IETA 4F7EB 2HKFH 2NTFB 3ESVF 1CE1L 4M8QB 4H26B 3IFNH 5DF0A 1FIGH 3ALXA 1QO3A 3OAZH 4JDTL 2EDYA 4OB5L 4AEIL 4X99A 2R56L 3LD8B 2WBJB 4ZTOL 3WNMA 3T3MF 5DVNA 1RZJL 3SDDB 4Z7UE 4W6XB 3ZT7A 4UAOB 5EZOH 4I3GA 4ZTOH 4MDJA 1Q0YH 1ZHNA 1DBML 3QFJA 1F4XL 1YC7A 2R2HA 5I2IA 4AIXA 3A6OA 2KBGA 1HHJB 2DM7A 5E7FA 3DX8A 1CXLA 4MJ4A 2DWDA 4F57H 2AV7B 3IKCB 3KR3H 1X6NA 1C5CH 5FCSH 2EIDA 4PGJA 4PRHB 3PIQA 1R3KA 4YH6A 1GGCL 3IFOB 1XR8A 4IRSC 4LPVA 2CLZB 5C0BA 2X40A 2R1WA 1S8DB 2PKDA 3X3GL 1IQDB 1I4FB 3RNQB 4XNXL 4Z5RB 1X44A 3Q0HA 1JF6A 1N0XL 4U1IA 1KJ3H 4JFPB 2WWMC 4G7VH 2ICEA 4QF1A 2D2OA 5DT1L 4A6YB 5GJTH 4WUUB 5JIKA 5FHBL 1ZGLB 3HE6B 4GS7B 3BGMB 4D0DB 2H2PC 4HIIB 2ERJB 2EZ0D 1N6QL 2NY7H 4Y5YC 3E6FA 2F54A 1I1YB 2ZUWA 3ARTA 3AXLB 4YDLC 2Y7QB 3P77A 3RBSA 3DLQR 1S7VA 3VGFA 3LY6A 2DLHA 5C70A 2VISA 2ZSVB 3MUHL 1DBJL 5I8KL 1K8DB 1Q72L 1WWWX 5FV1L 3ROOB 4Z76B 2BERA 5TE6H 2EYRB 5F88A 4BSWA 1ND0B 3WL9B 3HS0B 3GIVB 1ZSDB 4M7JH 5SX5H 3VFOA 4PRIE 3H9HB 5EZLB 5TPWL 4XPTL 4NGHL 5T5FH 4MD5B 2XWJA 4PJXB 1I9RL 3RU8L 1Q9LB 3EJYC 4N8CH 4MD4B 2BVOB 3ZO0A 4RSVA 2IQ9H 4R3SB 5J06A 4PV8A 5SWSD 2X9YA 4H20H 2H45A 3LKRA 4JLRB 3UTZB 4G8GB 4LAJH 2F8XC 1G9NL 2YK1H 4RGNC 4JO1L 1AQDB 4RIRA 5I9QC 5IW1A 4HXBH 1S9VA 4LEOA 2VDLL 4NFCA 3TBSA 5HI3D 2FIRT 4DWHA 3D9AH 4I48B 5C8JA 2R56H 4PRNB 4QHKI 5IM7B 3RI5K 1R24A 4ZXBB 4A6YH 5IHZA 4N9GA 1RUMH 1HXMA 5HHXH 4JREB 1OTUC 4ELME 1CS6A 1MPAL 1MSPA 2ZCHH 2ITCA 2QR0B 4JFFB 5KVFL 4GXVH 5C3TA 1VDGA 3L9RA 1NAMB 4HWEH 2C3VA 3KAAA 3QWOA 3RUGF 1X9QA 2YPLB 3VGHA 5K9JL 1XF4B 5EA0L 1A14L 4P48A 1TETL 5CWSB 3F7YA 3CPLB 3HFML 3CNKA 5K9JH 4JJHA 2HA1A 4O2EA 3CMGA 4NN7C 5SX5K 3UTTD 5I8OH 1M71A 5GGTH 3U30C 4L8SB 4QXGL 4U6VH 4OZHE 2EYSA 3CFDA 1CGTA 2R4SH 1SHMA 4G3YH 2E7BA 2O61A 3QXWA 1T21B 3V8CA 4G8FB 4TPRH 1QFPA 1IGMH 3BKJH 4G7YH 1R5VB 2P49B 4YK4C 1M7IA 4YDKL 2DD8L 3FQUA 1A6WL 5JOFA 3SDXB 5L9DL 2P43B 4KQ3L 4OQTA 3Q3GA 3O8XD 3GSNA 4QKXB 5HYFA 3SE9L 4X6BB 4TVSa 3B9KA 5AYUL 3HE6D 5DO2D 5T1MB 3K0WA 3OKOB 1V3KA 2B5IB 1WZMA 3AGVA 3IU3B 3OZ9L 4U6YA 1KIPA 5HHVH 3A6BH 5DMJB 3B3IB 4BQ8A 3T4AB 2VITA 5FA4A 4U05A 2CLVB 2UY7A 4F8TA 1IAMA 4EUPH 3RHWF 1M71B 2VL4A 4R0LB 3HR6A 3V5HB 2HFEB 1H8OA 4O4YH 4FQIL 4H20L 4OIAA 3HZYA 2R0LL 1JGDA 4X6CB 5GXBB 4JR9L 1G7QB 4X7SH 4XMPH 1FG9C 1GIGL 4QRUA 1KYOK 3QUXD 1BFOA 1XMWA 4XI5D 3MODH 3S35X 2XICA 1M1SA 3GSRA 2VERN 3TWCL 1LDPH 2P24A 4IHOB 1LMKA 3C6LA 5BCAA 4HK0A 5FDYA 2WBJD 1OCWH 1UFUA 3RHWK 5ICXB 4I3SL 1NAKH 2LU3A 1FHGA 4XZUB 4HUWA 2WK2A 3RQ3A 2MWCA 4WENB 1C5BH 3L3OA 3WEXA 4H1LB 5EFIA 4BQCA 5DSCA 3IDUA 3DV6B 1ZWIA 5E5MB 2A6DB 4G80B 4IMLA 1I9JH 4LLDA 5I8EA 5J11C 3DO7A 5BRZA 5I75C 5IFHH 2SEBA 1IZJA 5KSBA 4P5TC 1WVZA 1U93A 4X6CA 2EDHA 2HT3C 3EDJA 4TTGA 3PF2A 4FQXC 5KTEH 3FB6A 3P4LA 4NOFA 5D7LB 1NCWL 4JZJA 4M4PA 1MJ7L 2VAAA 1QEWB 2XZZA 4XNQB 5IB4A 1ZVSA 4KPHL 3VWJC 4HKXB 3MGTA 4J3WA 5EZJA 4ISVA 3T09A 3NVQA 4JZNB 2OLDA 5B39G 3GFUA 2IPKA 4OZFA 1FORL 4OV5B 5BV7C 3PP4L 1FZJB 2YPKB 2DM4A 4NBXB 4PYGA 3EO9H 2YRZA 1T7YA 4MNQE 3J8F7 5K9KA 3F7RA 2JE8A 3QCUL 4HUKB 4ODUA 4ODTL 1UM6H 2J88L 1HHGB 4BZ1H 2XPGB 3HE7D 3BQUC 3PHSA 3MREA 1FGNH 1P1ZA 4L1HA 4XWGL 3MA9L 2GSIA 1GVIA 5E2WL 2BVQB 4BZ1L 4GRLC 3FB7A 5D71L 5BS0D 3DGGA 1AXSB 4KKLC 4Z0XB 3UDWC 1EEQA 1KTLB 4J8RA 4TNVF 3KGRA 4U1LA 3MRRB 3VFNB 3O6KL 1QEWA 2CPCA 3C5SB 4MCYB 4KQ4H 1T7XA 3BJLA 1GZPA 4LFHG 1YEGL 5DS8A 4HJGB 1TETH 1WEJL 3MJ7B 1U8KB 1VKXA 3V95A 4PLJC 1RZ8A 4QTHA 1ZTXL 3S96A 1RHFA 3MODL 1KB9J 3VWKC 3KLHC 2YD5A 5M7QA 4OV5A 4NJ9H 5IIEB 3CX2A 1QSEB 3FQNB 1QSED 3ULVH 1IAKA 4H25A 3BKMH 2AVGA 5DR5L 1UM5L 1L0QA 3CZFA 2V2WB 3VXTB 2D0FA 3ARSA 3ZDYF 4GBXC 1MEXL 3O2VL 4HJ0D 3QCTH 4X6DA 5I15L 5FO9A 3S35H 3OQ3B 4BYHA 4XP4H 2N4IA 3QJFB 1CXHA 3EHBD 4NNXA 1DBBL 4I4WA 4G9FE 1HDMA 1CD8A 1YY9C 3FN0L 5C0BE 3P3YA 3QUML 1KXTB 2VDLH 3H0TA 4MAYD 5CJQL 3HAEH 3RWJB 5DRNA 4NP4L 3G08A 3T8XA 5DA0B 3ZDXE 4S0SD 1OAKL 4FQHA 3LKPB 3QXDA 1AXIB 2VQ1A 2CD0A 2E7MA 3AS3A 2IPUG 4UV4L 4P2QD 5DHVA 5DYOB 5HVWA 4GOSA 3RNKA 3ARGC 4HPYL 3WLBB 1YY8A 1F11B 2OP4H 1TZIB 1ERNA 2BNRB 3VWJB 5DQ9A 3VRJB 3WDHA 1YEEL 1PAMA 4QOKA 3TT3L 1OD9A 5E95B 3WFHA 5JHDD 12E8H 3QXTA 1P9MC 3B9DA 2BVPB 3MX0A 4OFKA 1SM3L 4QY8A 5DMKB 5LQBH 5CKAA 1AY1H 3BW9A 1IEBB 4R8WL 4NRZB 2FX9H 5KVDH 4M8VA 3BO8B 5F7NC 1A5FH 3C08H 3SGEI 1DVFA 2APTA 4HV8A 5GGQH 2W07A 5GRJH 4M61A 1IAIM 1DN2A 4OBSA 1ZA6A 3AU1B 2RIKA 2QQLL 4H0HB 4B7LA 5JQHC 1HHHB 3GBML 4IRSA 5IQ7L 3VXSE 3KPNB 4HXAL 4OLVH 4QHLB 3BUYB 3TVMD 4K3JH 1XGRB 5HHPA 3MGOA 4KK8C 4ZPVB 3TCLB 1JRHH 2Z4QA 3OAUL 1MY7A 3U36B 5E2TH 5HPMB 4Z7QF 4XPAH 2VAJA 4K2UH 5ENWA 3DUUA 3TCXA 4Y4HA 4W6YB 3C5ZD 3TZVA 1QG3A 1B0WA 3BXNA 3U0WL 3VI4F 3FOLA 2ZUYA 5EULV 2BVPA 3NCMA 4PJCE 4LVOC 3MRDA 3WSQL 2A6KB 2HN7B 4GW4B 4TUKH 1SVZA 4TRPL 2V2TA 4I5BB 1T1YB 4U49A 3BEWA 3O3AB 2YD4A 3DVFA 4ODWA 2NXZC 3TESA 1JZ8A 3ILPA 4JY6A 3S5LB 3IDNB 1QLRA 2Z9TA 2R1YB 1MCLA 3TZVD 1MHPH 4Q97A 2R0ZH 3T65A 5FUOL 4BH7A 1NBYB 1F4WL 4X98B 4DVRH 5CEYB 3D1MC 5IW6B 3TVMC 1IAIL 1FNHA 3UC0H 1UCBL 5GISH 4ZFGH 4FMFA 1WK0A 3FRUB 1LO0H 1WAAF 4I0PB 3QBTB 1W72L 2NZIA 4EIGB 3UJTH 4RGND 1T3FB 3VFPA 1CFVL 4MJIE 4Z77A 2ZCKL 4XP5L 5ITBL 1CK0L 5KJRH 3NZHH 4MMXC 1D5XA 3EOTH 5DJ0A 1KIUA 1U0QA 3BH9B 2DQIH 4PG2A 4YHLH 2UY6A 4E41D 2H41A 1DL7H 3O3AA 1ZLSH 1RUAH 5FOBA 3QUZB 4HS6A 3W2DH 5AEAA 2AJVL 2R0WH 1A7QL 1OL0A 2BHZA 3CCHA 1H9VA 2P5WE 3P0GB 3RX8A 4Y2OA 7FABH 5HYQA 1U2HA 4J1UB 1MCSA 1RJLB 3VH8G 2ATKB 1W0VA 2EH7L 5FDWB 5HI5D 4P99A 1UM5H 4KU1A 1CXEA 4PJGB 4LDLB 5BXFB 1QA9B 4QGYA 1HH6A 1EHXA 2JB5H 2QV2A 5K9QG 4XPBL 3CZJA 2VDML 4EJ1C 2YPLD 3KPRE 2X05A 3D39D 3WYRA 2FHBA 4O58L 1MCQA 4HJJL 4P9HH 3QNXB 5GRVL 1S5IL 3F6LA 3DARA 4H88H 4JFXA 5I1EL 1KPVA 4RFOH 3X11B 1EZVX 3PGFH 1IC4H 3BH9A 4PIRF 3WKML 4DZ8A 2FATH 3MCLH 4WUKH 5F1NB 5ISZE 5I76B 1RZGB 1FSKC 3KNBB 2AJ3B 4Z95L 4G6AC 2Z91A 3IDJA 3ECBA 3VG9B 4P9MH 1AE6H 3LKSA 1UWEL 5HYQB 1ONQA 1KJ2L 2D7MA 3WXWL 1UQSB 5HHNA 4BQBA 1YMMB 3V6FB 4TULH 2XXMB 4NQCB 1CDGA 4AMKH 1YEEH 3VFTA 4OLYH 3F7QA 1P2CB 1HH6B 1BFSA 2Q7NA 1R6VA 2PW2A 4V2CB 2DL9A 5AYQA 5ISZB 1RY7B 1R3HA 4RGNE 3WN5B 1OARL 3MRPA 3MXVH 1Q0YL 4LLQB 1EEZB 1ZLUH 4EVNB 2ZSWA 2P45B 4YBHA 4R2GD 4PJAE 4TSAH 4LLMB 4LKCB 5I66A 5I1HH 2Y9RT 2P1YA 2Y1VA 4P23A 3S4SG 5CD3B 4XRCB 4IM8A 1N0LA 5C86A 3L3DB 4NRXB 1U8NB 4WFFD 4JB9L 2R4SL 5KBNC 3QDJE 2B0SH 3L7FB 5DJ2A 3MJ9A 3P9MA 2A73A 4R4BA 1RZFH 5T5NF 3MV11 4MJ6B 1I8IA 2FL5B 3BP4B 2VXQL 1P53A 1GGTA 2NTFA 5KSAD 1K6QH 1C5CL 4NUJA 4KKAC 3U2SB 2ZUTA 4LNRB 5HJ3B 2YBRA 5KSUA 5J6HA 2IADB 3EDKA 1G0YR 4NQCA 3QNZB 3PABA 1PZ5A 4KVNL 3N9GL 1XCTB 4PJAB 2X4TA 2AJXH 1Y0LA 3SGJC 4YHYB 3K2UH 4Y1AB 5ISZD 3EKCA 3MV8B 3WN5A 1JYNA 3P4MA 1TLKA 1CICB 3MRPB 1IFHH 1L0XA 3BPNC 4Q0XH 4MZ3A 3X3FL 1E27A 4NQCD 3EZ8A 5CBAB 3SDDC 4LASH 3SGKC 1UXSA 1FAIH 3RWCB 4HWEL 5ABDE 3E8UH 4NRYA 3CSPA 3CVHB 3LD8C 1Q1JH 1MLBA 5K9OA 4GQ9H 3WIHL 4R7DB 4KK9C 4U3CA 4ZAKA 4WW1A 4NUJB 4A6YL 1T1WA 5J6HB 4U1NB 2P5WD 3QZWB 5GIRB 2H9GB 2F54B 4DK3A 2OM5A 3VXQA 3DX9B 2MPAH 5C6PB 3NFPA 3T0VA 4KAQH 3OV6A 2NPLX 2R29L 3CXDL 3O2DA 1WISA 3CDYA 5I74C 4NNPL 1R3JA 3WJJC 5ESAB 4IRJB 2UZIL 1B88A 1JZ5A 4QXUH 3ARRA 4OCYH 3GGWB 4OT1L 3S36X 2EH7H 3DBXA 1IC7H 3WHE0 5CZXC 2JTDA 3BESR 3GSQB 5L9DH 1L7TL 2LVCA 3SGKA 2ZUVA 1KN4H 1NSNL 3JWOL 1AO7A 4NM4L 2IH1B 1K5NA 2Z93B 1GZQB 4MNQD 5IEHB 1CF8H 4PJXA 2DIBA 5ADOH 1B4JH 1J9CT 4FFYH 5E6IB 3O45A 2DYPA 2QL1A 3QHFH 1ZT4B 2EDDA 3IJYA 3X14B 2AQ1A 4KDTC 1UB5B 4QYOB 3TJHD 4X83A 4KKCD 3BE1L 5EBGA 2W0LA 2GK0A 4MAUH 4HUUB 3HC3H 3VD5A 2JJSC 2CR6A 5I1IH 5DK2B 3MJGX 3MLTA 2ZG1A 1ZLWH 4S0TD 3RTQD 1QRNB 4AEHL 5EO9B 2B1HL 2I07A 2X1PA 4CVXB 3D85B 3NGBC 4UU9A 4PJ5D 3STBA 1GAFH 5FA3A 2QSCH 4KVCH 3QULA 4L9LA 5HGGS 4POZD 3GIZL 4MD0A 3UPRA 4OSUL 4WI7A 5L0QC 4UV7L 5ANME 5FO8A 2R4RH 1FLTX 4OFVA 5F89B 5BOPA 1CFSA 5KVEH 2WWKT 2ZUSA 3MJ8B 1I1AB 1LDPL 2IANB 3MV9E 5HY9A 3V0AC 2H1PH 4DKEH 1IRAY 3SO3C 3I02A 1J05A 4NM8H 2VH5L 4YBQC 5L2KD 5DRXB 5C0FA 4J3VA 4EI5D 3G5VA 2ADGB 4PJBA 2ORBH 2PR4L 2PYEE 4M6OH 4XH2A 4NC1C 3CPLA 3TBTB 4BUGA 3HAEB 4NPYB 1CGVA 1DEEB 5TDNA 3V79C 5BQ7B 5KSVB 4RQQA 2DKUA 3MLTB 5CCKL 1QRNA 3BP7A 4GKNB 4JPWH 3KYOA 1Y18B 3G9VA 1R5WB 4WEMB 5ID0B 4HBQA 2PF6A 4XGZB 4LMQE 4AENA 3LKOA 3IJHB 2HKHL 5C0RL 3ZYOA 3C5JB 1D6VL 1NUGA 1D5IL 2NY0D 5IEKB 2J6EH 3WO4B 3D5OF 2HWZL 3DVNA 5H2BB 1MJ7H 3OGCA 1GC1L 3V7MA 5D70H 1JHTB 1D5ZB 4L8DA 4Z7WA 3CXDH 5GHWH 4LSSL 2BSSB 4NO0A 4OQTL 5E4IA 5I1AB 3V6OC 3C60B 2G9HB 4OTXL 2VLJB 1IC4L 4JFYB 3BDYH 5C0JB 4OCNC 2LAGB 4XH2B 2DQUL 3JWDC 2DMBA 5ACZB 1BFVH 2HLFC 3DSFL 3DETD 3DROB 3QHTC 5ITFB 1MH5A 1F3RB 1FGVL 4XPHH 5KG9B 2R0KL 4I77H 4I3SH 3N1QC 3IKCA 1U91A 1FZMB 1KOAA 5D9SB 4ONOA 4HPYH 1L9NA 2EDBA 4TSBH 1NGWA 1N5YH 1HWHB 3TH4T 1BFOB 3MLWL 1MFNA 1NCAH 4DN3L 3VXPB 3LQAC 1XIWB 4N0CC 1A7QH 1FFNB 3PHQA 1F97A 1Z3GH 3U7WH 4L4VD 3FT2A 5HHOA 3R0MA 3STZB 1U8QA 1RJCA 1P9MA 1ZHKA 2EIZA 3RDTB 1FIEA 1U8OA 5ANMA 2F58H 1AD0A 3QG6B 3C60D 4KMLB 3PP3K 4HX1B 4MAYB 3GSVB 4M5ZL 8CGTA 1PSKL 5D1QB 4QXTA 5BV7L 2G75A 1UB6A 3FQWA 4WI9A 1RIVL 1Z0MA 3V7AG 5I15H 4DN4L 1MH5B 1F90L 5E99H 2EEAA 4NN6B 1SY6L 3TLRA 1H15B 4LIQH 3CK0L 2Y23A 3LH2L 1NSNH 1F4HA 3MLRL 4XCEA 4XBPB 4HKJB 3DURA 3I6GA 2W59A 5EU3B 4OLXL 4N0UE 4WDIB 3GKWH 1S9KC 3NA9H 3U4BL 2IWGA 5A2JH 4QOKD 1VACB 4WO4C 5F21B 5F9OL 1IFHL 4OFDA 4WEBH 2O5YL 2ORBL 2PR4H 4N8VG 2BOBA 3GSOA 4BZ2H 5DRWB 1TVHA 3Q1SL 5D7IF 4K3EH 2CH8A 2W9DL 4Y8DC 4OKVA 5I18L 3TBSB 4G8IA 3VRIA 2H1PL 4GQ9L 5D7JC 3U46A 3BD4A 5E03A 1AI1H 1I1RA 3X13A 4C54A 3O6MH 4GG8A 4NZUL 3MLUH 1M7DA 1BQHG 4UOW1 3V52L 1IGJA 5A2FA 1MCDA 1YDPB 4K23H 2VLLB 1UJTA 4HKJA 1IGYB 3FB8B 2QQNL 1W2KT 4ETQA 2Y6SC 1GZPB 5IV2B 2XWBB 1MQ8A 2DQFA 4XC1L 4RBPH 3K8LA 4JAMA 3G5YA 1I1CA 4UQ2A 3UTPE 5I1LB 4OGYL 1A6TB 3DMMD 1AP2B 4B53A 1CN4A 2XFXB 4KXZI 5HI5C 2Z92B 5DMGC 2BC4A 1NKOA 5IHLB 4HH9A 4X9BA 4PLKC 5AZEH 4BA8A 2JIXD 3D87B 4YFLI 5D93B 1AGFA 2OP4L 2PUQT 4M5YL 1RU9L 5HYIA 5AD0A 2EE6A 3QEUB 5DUBA 2H32H 1HXYB 3ILQC 5INCB 1CF8L 3FFCB 3KYKH 3LEXB 3TFKD 1RIVH 3PWNB 1QOKA 4WI2A 2AW2A 1HINL 5DTFA 4WHTB 4YHKH 1IT9L 3VXNA 3B9KB 4I18A 1WCBB 3TZVC 2BSTA 5T1KA 3VDBA 1KCSH 3W11D 3WO3B 1A7BA 3FT3B 3GSXA 2FJFB 4P2OB 4LLVA 4KI5C 1KCSL 1MIEH 1FO0H 4CMHB 3W11C 3WFBH 4EXKA 2VJXA 2VWEE 3VXUB 2VKXA 5TGBA 4PJ9B 1BZ7A 2APXA 1RSFA 5TDOB 2BC4B 4BK4A 5I6XC 4Y88A 4R96B 2A74A 1TZIA 1VFAA 1Z6JT 2DLIA 5FECB 1NMBH 4P3CL 4HLZH 4YEEA 1XGYH 4X4YA 1AQKL 1X5FA 1T0NA 1FL6A 5KVMC 2AGJL 4YPGB 1HXYA 1S3KH 4G5ZL 5DDHB 4OD3H 1F4WH 4GUPB 2A83B 5IT2L 1QRKA 2A9NL 5C08B 2NY2B 5E56A 3PV6B 5DTFB 3O81A 5D1ZA 1CL7H 3VCLA 3WNLA 4Z7UF 5MENA 2X1OA 2AJZB 3GKWL 2YA2A 4O9HL 1JWSA 2P7TA 1FJ1A 1WCBA 1K9TA 4RBPK 4MDJB 3FO2A 5GS3A 3RUGA 4ODVH 1IAII 4M93C 3DV4B 5BZDB 5LWYH 5GGRA 4HCRL 3WFDH 3AU1A 4QEGA 1FAKT 4G9DA 5DEGA 2K3TA 4HUVB 3QWRD 4F9LA 5EU5A 4BQ6A 5JDSB 4EN3A 4ERSL 1MFAL 3TCLA 2Z8WC 3TN0A 3OMZA 4DUVA 4MNQA 5C0AB 2Q1EA 1F4YL 1TPXB 1S7RB 4GMTL 1T04B 2Y72A 1E6OL 5DRZA 3OGOE 5L8KB 3V5DA 5H37G 1MVFA 3X12A 5I0ZA 1UGNA 2YMXL 3GRWL 1KPUA 3NPZB 1LO2H 1U58A 4KTEL 2FO1A 1UXWB 4G6AD 4QWWC 2APWA 2NY2D 1MCEA 3GI8L 1LDSA 3QRGH 4MA1C 4S1DC 2E8YA 3U7YL 4KTEH 3LS4L 1OD7A 1GHFH 4OFPA 3QT2A 2P5EE 2FECL 5MI0C 1WEJH 4N0YL 5DJYA 4MXWL 4PTUB 3HLAB 2I25N 4YBLC 3UCRA 4BSWB 2E3VA 3MR9A 4KHXH 4QHUB 3HMXL 4L4TD 3C5ZB 2X41A 1HXMB 3WFCL 1VPOL 3TN0B 4N1CA 4MD5A 1U8PA 3BI9X 1Q9LA 1IEHA 1UWGH 3PGDB 4ZNCD 4AH2B 1XH3A 3ULVD 4NN5C 4NCDA 1T03L 3ZHKA 3MRLA 3TVMB 1MJUL 4BFIB 4WW2A 4FZEL 3T2PA 2VDPH 5IB1B 2ILLA 5F9JA 4H0IA 4YHKL 2MPAL 1FO0A 1CTNA 2GTZB 3MNVA 3RBGA 4PRDA 5J57B 1LEGB 4QT5B 3PG2A 3WIFB 5M94B 1IM3B 2JCCA 5C2BH 3T04D 4XPAL 4I48A 5D1XA 2DJUA 4JN2A 2NY1C 2XYCA 4PJFA 2HLAA 2ED9A 5FYJD 4M3KB 2X9WA 3FHAA 4MXVE 4NZTH 5IB5B 4X4XB 1EO8H 1XIWD 5JPNA 1TCRA 4G8EA 3VFGH 4Y5VA 3IDIB 3STLA 3QEQA 4Q9CA 2ICWA 4W4NA 2I9TA 1HDMB 1KIRB 2VQUA 3LHPL 1W72B 5DHXB 4ZPTA 3GSNB 1OQOA 5DUPH 1HE7A 3HRZA 2HMIC 1YNKL 3MRLB 3TVMA 3REVA 2DOCA 4PRAB 2XA8L 5GGSY 3INUH 5ECJE 3S88L 3T08A 3VFWA 5D7LE 4J6RL 5ILTL 1OAUH 4NUGL 1A6AA 3BPLB 3MA9H 1R3LB 5DJAB 1I8MB 5BVPH 3WIFA 1J18A 3KS0J 4ODTH 4P2QE 2IAMD 4JM2B 1PKQE 2MFNA 1E4XH 4Y4KB 3C8KB 1PG7H 1AGEB 1A4JA 1FNGA 4BH8B 4TUJB 4OZHB 3ZYZA 3PWUB 2CIIA 5JOEA 3UTOA 3KJ6L 1F02I 3FO0H 4CADB 2O5ZH 2AJSH 5FF6A 3RFZC 3MOAH 5DMKA 2FB4H 3PWJA 1OP9A 1N6UA 2Y5TA 1EHNA 5HHQB 3NCFB 4PGBA 4S1SH 3RVWC 1MQKL 2OQJB 4GFTB 3SCMD 4GBXD 4HJ0C 1DVFB 4GKSA 4FQXD 1UJ3A 5CEZH 4S1SL 5J0BA 4LPYA 3TO2A 2EDTA 3EHBC 3I6KB 4Y2DC 5DVKA 3E6HA 4I2XA 4HFWA 1FP5A 1R3LA 4DKFL 1T2XA 1CR9H 3T77B 2DWDB 2X89A 3ESUF 2OR7A 3PIQB 4MJ6A 1BQHB 3SE3A 1NGYB 1BVKB 1MWAL 4JY5L 4RFEA 1AJ7L 4PJEB 2WQ8A 3L5IA 1BZ9B 5JORA