1OWWA

Solution structure of the first type iii module of human fibronectin determined by 1h, 15n nmr spectroscopy
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
93
structure length
93
Chain Sequence
SGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin first type III module
publication title Structure and functional significance of mechanically unfolded fibronectin type III1 intermediates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1owwA00
1YYLH 1MREL 4Z7NE 3IDIB 1JHTB 1D3CA 1NGPL 4L4TA 5IFAL 5JW3L 2H32B 4Y2OA 5CBEB 3E0GA 4LGSB 2Y36H 3UO1L 3AAZB 3G5ZA 4NKMB 3DRQA 2R0WH 3TN0D 3EW3B 1OAUH 2VQUA 3VD9A 5KSUB 5IB1B 2GJ6B 1AJ7H 3SE8L 4AEHH 3O6KL 1KIPB 4PRPA 1UWGH 3LH2H 1RMFL 2PETA 4OT1H 3P77A 4KKAD 4M61A 5ISZB 1BBDH 5E2TL 5C3TA 5TE7L 2Z92B 4PB9L 2OL3A 4POUB 3MLSL 3BPNC 5TF1H 2IPKB 3INUH 4XGZA 4XNQB 1NPUA 3WD5L 4GT7A 2HJLB 4ERSH 4ORZC 4GG8B 4ZFOB 1VKXB 4HAGA 1U58B 2CMRL 4KJQC 1YMMA 3SE3C 2NY5H 1N2RB 4BM7A 3EJYC 4KK8C 5D2NB 4XXDA 4N8CL 2JCCA 1HZHL 5DURB 2XKSA 1PG7X 4NCC1 3WFEL 4GH7B 4XZUB 3HCVA 3MV8D 1AY1L 1O7SA 4EXKA 5CD5C 2C4FU 1RZKC 3FZUD 4Y16C 3DURA 3H8NA 3QWQB 3MJ7B 3CSPA 3EO0A 1VADB 4DN3H 2BXYA 4NFCA 3AC0A 1C12A 1D5ZB 3GM8A 5GGQH 4PJAB 4OTXH 5AG9A 1U8PB 2ORBL 3CDYA 1UGNA 3TGXA 4XI5D 1AKJD 5BVJA 1KCVH 4EI5D 1AO7B 4Y5XC 3BX7C 3N85H 2NXZD 1V3KA 1A64A 1IBGL 2VLME 1T0PB 3WFBH 5L2JB 4PLOB 2WAHA 1BAFL 5HHQB 3WIFB 1IKFH 3V2AR 4GKNA 3ZDYE 3BAEH 1MCBA 3LKSB 4G6AD 1NLBH 4M5ZL 4JRXE 4NP4H 1FO0L 1VGKA 2NPLX 4L5FH 5CWSB 4OM1H 2VXUL 2YPKA 4LLVA 4YHZH 4NQCB 2A9NH 3KPPB 2XWTB 3RDTD 2DKSA 5DJYB 4Y19B 2NW3A 2YD1A 2JJTA 5K9OB 1ED3B 4G8GA 1IGYB 1TQCB 1L0XA 3QNZB 5EN2B 2AJUH 3EKCA 3DXAD 5MEOA 2FGWH 3FN0H 4Y5VC 3GSWB 3X13B 2IFGA 1IAMA 3ROOA 3X3GH 2ATKA 4K8RH 3RP1A 5A2KH 1KULA 1BD2D 1EHLL 2X4UA 4JO4L 3B9KD 1C5DA 3CSGA 2V6HA 4OV5B 1HYRC 5DJCB 4GKZA 3R1GL 4MJ6A 4OAWA 5MEND 5MEPA 3R8BB 1A4JB 1FSKC 1H8NA 2XZAH 3WJJC 4LSPL 1JGLL 5F7DB 4QXGL 2AK1L 2X9YA 4YFLF 3C60D 1CK0L 2DIBA 4I5BA 3T0VA 1EA9C 2HFFB 3OJVC 3DVIA 2ZCLH 5F6HJ 4L4JA 4YDIL 1NEZA 5HPOA 1N4XH 1XF5B 3D9AH 5DD5L 3IDGA 1IAII 5HYSB 2Y6SC 5DO2C 5H37H 1MY7A 5E00B 3I6LE 4YXKH 5K9JL 1G6RL 1EJOH 3FAWA 1HILA 3VXRB 1L6ZA 4ACPA 1G9NL 4P59H 1T7VA 2ZOLB 5J7CC 1IMHC 1S7UB 5FUZL 1FL3B 4N8PA 1MWAL 2PXYB 2R2BB 3GSVB 4XXCC 1PKQE 1NFIA 4WJ5B 3EJZC 1Q72H 5IBTH 3BRGC 1KYOK 1VPOH 4P2RD 4J4PC 3QRGH 4LHUB 1WCBB 1MAMH 1QP1A 1RZGB 2AI0L 2EC8A 1ZHNA 2MFNA 3MREB 5E95B 4L29A 2P8LA 3MBEC 2FATL 3DMMC 1QRNA 2OTWA 2QSCH 4ODXA 1FBIL 4DQOL 3DX6B 1NEZG 2JB6B 3HMWH 3FQUA 5D96C 5FYJU 4F9PA 1LEIA 1UXSA 5JPNA 5D7JB 3ELAT 5DQ9B 1CICD 4PTUA 1IAIM 2AJZB 1E28A 1TENA 4BQ8A 5I74B 2YD4A 5C08D 4XBPA 4OSUH 3S3JA 2HT3C 3HE7C 4NO5A 2BNRB 3GFUA 3G04B 5GS1B 1KFAL 1XF4B 2SEBA 4WI9A 1FN4A 2A1WL 3MV8E 3IU4L 3TNMB 3HI5L 3G08A 3F65A 4WI5A 1A9EA 2HFEA 4XCYB 2LE9A 4HPOL 4LSTL 1A6AA 1UQSA 1QACA 3MCKB 1W72A 4NNYA 3AS1A 5I1LA 3OF6D 5DRZA 1Y6KR 4HX1B 3BH8B 5I1JH 3P30H 2D31A 4NKDA 3ARFC 3LQZA 4NNPH 4NRZB 1ZLSL 3TJHC 4M1GH 1C7SA 3G6AA 3TBVB 3VWKB 4HEPG 4OCRH 5C0IB 4HIXL 1S9KC 2DB8A 4JN2B 3TO4B 3WLBA 5JDSB 4Q9RL 4P2QE 4R90L 5DEFA 4OKDA 3U9PH 1GL4B 4TUJB 1JWSB 1MCEA 3IVKB 4P46C 4NM4H 3O81A 3BZ4B 3O6FC 5C0RH 4HS8L 5CJ5A 4M6MH 5I16A 3DUHA 2C26A 5DJ0A 5DHYB 4GRWF 1LO2L 2BRRH 4RMVA 5JW4Q 4HDIB 4YJZL 2AEIT 4NWTL 3U0TA 5F7MC 4MD5A 2YN5A 3GMPA 5E99L 2VN4A 4PJBA 5FOJA 1KSRA 1MVUA 1FNAA 3RIAK 3RL1B 3QG6B 5IHUL 1MPAH 1YC7A 2Y4SA 3DROA 4QHNB 5DLML 3QEGL 1JPFB 4XNUH 4OUUB 1A7QL 2VXQL 4MA1B 5C0BD 1K8DA 5KVDL 1S9WA 4WV1A 2A6KB 2ZUSA 3GHBH 1NFDB 4HUVB 1BD2E 1YEJH 5GS3A 3UTQB 1KPUA 1IQDA 3TVMD 4M7LT 3CXDL 3VGGA 4A6YB 5J89A 1RIUL 5C07D 2VXSH 5GPRA 4RGND 2I5YL 5IBLC 2ADFL 2ZNWA 5H8DA 5EZOH 5E9DA 4LVEA 5GZOC 1E4XL 3FO9A 1W0WA 4HZAA 5HI4D 1TJGL 1TMCB 2YXFA 3FQTB 3V6BR 1FFPB 4N0YH 5SWZD 4D3CL 2A9MH 1SYVB 4YHLH 4TRPL 1QSEE 1RVFL 4NFBA 3TWCH 3G5ZB 3PHOA 4Y1AB 2N4IA 3OGCA 4OF7A 3BW9B 4HH9B 4RAUA 5JHDD 3RHWF 1DQMH 3CIQA 4R0LA 1T5XA 2C1PB 2FSEB 3OKEA 4HCRH 1GPOH 2EXWD 2BMKA 4M8VA 3RNKB 3RBSA 5HI5C 3ZYJA 4M61B 2CKNA 2XOTA 5C0GB 2NX5B 3UYOD 4O00A 3VFTB 2VSCA 4PJ9C 2X05A 2OL3B 4NQXB 2EDYA 4XGZB 1R5IB 5GXBB 4P2RE 3V4VH 1NCCL 1BVKB 2V7NA 3ARDC 2AVGA 2CLRA 3MOQA 4BFGA 5D7IB 5ESQA 3T4YB 2RCSH 5DD6B 4KK6C 1JZ8A 3FT4B 1OTTD 3PV7A 1KIRB 3W9EB 4MNQD 5B4MD 5LXGL 3HZKB 4FRWA 5DC9B 1VHPA 4QF1B 1YEKL 4AY0A 4HGWB 1TNMA 4QT5B 2MCPL 1S9VA 3D3VD 4TPRH 1J0HA 3U4EA 5TDOA 3IXAA 1FDLL 3IJHA 4J2XA 3KPSA 3A67H 5C08E 1J0JA 4BK5A 1IT9H 3BSZL 4ZQKA 4BQ9A 1CT8A 1NDMA 5L2KD 4ZS7L 3O3UN 1FVCA 4X0KB 1RK0A 4NOFA 4E41D 4XPAL 4LRNL 1ZVSA 1MHHB 2ZJSH 3QIBA 4E5XA 4LSSL 2EYRB 3E6HA 1UG9A 4IIQB 3ARGC 3A6BL 3L3GA 2CK0L 4U6HA 4ODUB 4GRMA 4Y5YA 1JN6B 1QBLH 3K8MA 1MCOL 1IC7H 4J3OC 2F5BL 5GS0H 5LGKA 1T80A 2YUWA 5ENWB 5IBUG 4MVBC 1IGIH 5GRWA 3WJLC 3NFSH 3OB0H 4PRHA 2GEEA 4NPYB 2UWEB 2W60B 1VGKB 3S96B 1EAPB 5EA0H 5D72H 3AS3A 1JHLH 2PKDA 3MV11 4L4VD 1T2XA 3SKNB 3Q0HA 4KKNA 1WIPA 2E7LA 2VNCA 1N0LA 5LQBL 3RI5F 4DJMA 3V7AE 1TFHA 4JY5L 1WCQA 1IEHA 3ROOB 2DJSA 3O9WD 2ENYA 3WL9B 4MZ3A 1G1YA 3G9AB 2NXYD 1TETH 5CEYB 1NBQA 2X4UB 2ITDA 2Q8BL 5DJ6A 4JGJA 5IW6B 1IAOA 2LV4A 5JHLL 5SV3A 2HJFA 4ZYKA 2F19H 3B2VL 4LCUB 3SDDA 1QPXA 5MEPB 3QO0A 5BRZA 2VDOL 5INDB 3NIGF 3OZ9H 3EFFA 3P73B 1CFTB 3C6LA 5DUPL 4XWGL 3RUGB 4C55A 4ZFFB 1J5OL 2XQBL 2P4AB 4U1NA 5LCVH 2WQRA 3ZDXE 3ZKXC 5IFJA 1NEZB 1MCWM 1ZT1A 3KJ6L 4ZXBC 1CXEA 3IDGB 3OKDB 3S3SA 5D70L 4NO3B 1F4XL 1WLHA 3HLAB 1Q1JH 1XGQB 4JM4L 5C09A 1A7PH 5SWZE 2YZ8A 4NQEA 4Y8DC 2OI9C 5E6IB 1DEDA 4U0RC 3JTTA 3IFPB 3RWJB 4LAQH 5ANME 4Z5RB 2DRUA 1CFBA 3PL6D 4Z7NF 3KYNB 1QNZL 3S35L 1NFIB 4PGCB 4LU5L 5JHDE 1EDQA 3LEXA 1QLFA 1C16B 1NL0H 1ZHNB 4Z95H 4MJ2A 4OCMC 3QBTB 4L29B 4XT1C 4K07A 5DVOA 1UKSA 4YWGL 2P8LB 3GK8L 4RRPA 3S35X 1QRNB 1UC6A 1WBZA 3AM8C 5CP7B 5GS2D 2DQCH 3B83A 2NR6D 3FQUB 4LBEA 3T2NL 1UXSB 15C8L 5CSZB 2LU3A 3MV9D 4PTUB 1F6AA 1E28B 3SDYL 4HH8A 3C87A 5KOMC 4MNQE 1I1YB 1I1FA 4TN9A 2FBJH 2I27N 3ARED 4NO5B 3KPRD 5IMOA 4MA7L 3ILQC 5DFVC 1J1OL 3P4MB 2GY7B 2I9LB 4J3WA 2H1PL 2F5AL 2IH3A 4R9HA 3GI8H 4EDWL 5CZKA 3ZL4L 1K3ZA 1A9EB 4JFYA 4ZNEA 2V5TA 4JRYE 2DMKA 5DDHA 1W72B 4NNYB 5L2KE 2DLHA 1UA6L 1NGQH 4E41E 4P4RA 5KVMC 1NBVL 4A2LA 5T1KD 2R2CA 2D31B 5TF0A 4KTDL 1OPGH 4WDIB 1YEGH 3U7YL 4N1CA 3QXDB 1CXKA 1X5JA 3MGTA 1NC4B 1TVBA 3V8OA 4W6XB 4TTGA 5F9AC 2ARJQ 3BQUC 3JVGA 5IHLB 1ZLUH 1JNNL 3Q6GL 3MNVB 3DARA 3MXWH 4Q6IC 1NAMH 1M6OA 3NTCL 1E4KA 4FQXC 4NN5C 1TZHA 4X6BA 5IT2L 1GJIA 3PNWA 3U7AA 5F7EH 4FA8A 4L4VE 3MLXH 3VFUA 4PS4L 2QADD 4N0CC 5IWLC 2CD0A 4Q9BA 1MCIA 3ZDYF 3GMPB 3SE4A 3QPQC 4OLVL 4M9PA 2F8OA 5CD3A 4XP6H 4CDGC 5INCB 3QUXB 5HGGS 4YHKH 1VFAB 3BP5A 2BOBA 3T2QA 4E42B 1K8DB 4KK9C 1S9WB 4GBXD 4JDZA 5HHMD 4OZFA 1WBYA 4WTZG 2D0GA 4WCYL 1Z5LB 5L6YL 1P84J 2VH5H 1IM9D 1RZIB 4PB0L 4LP5A 5CP3A 1DBJL 1XGYH 3IFOA 4K71B 1HDMB 4FFWD 4HC1L 1KN4L 5LWYL 1DN0B 1MIMH 4KDTC 2UVFA 5JIPA 3CZFA 2IGFH 3WV0A 1JTOA 5IQ9B 1EJ6A 4M62L 3WSQL 2HJKB 1QO3B 3JV4A 4W70A 4R4FH 5C0EA 1CIDA 3P4LA 3B2UC 3T4AB 5J57B 2R4SH 2JB5H 1KB5L 3CDCA 4PGDA 5IMLA 4IHOB 3PHOB 4F80A 1FZMA 5FYKH 3MRGB 4MJ4A 4OKVA 4Z78A 2EDNA 2ICWA 3GJFB 1KG0A 4M93B 3PJSB 3DX8A 4R0LB 2NY1C 2V2WB 4W4OC 2GSIA 2IMMA 1PZUB 4X5WA 5FGCE 2H45A 4L8SA 5FUCE 4LASL 4LSVH 5DMIL 5FKAB 4QTHA 4M7JL 3GM0A 5GRUL 5BZWB 2XACC 4KH2A 1T1XB 4YHYB 3C8HA 5I17B 5I1DB 1I9JH 3LZFH 4F7EB 3WXVH 2OTPA 4IRJA 2CLRB 2PNDA 4APQB 3RWDB 2YEZA 4ZPVA 1GGIH 1WBXB 5HI3C 5T3ZH 1INQB 1KJ2A 3PGDB 4O58H 1U3HA 5IBUB 1AQKH 4K2UH 1HKLH 3VA2C 3NZHH 4HWBL 4XBEL 3UDWA 1P7QD 2X70B 4MB3A 3VFMB 3W0WA 4JQVA 4O2EA 2XZQL 3D0VA 1F02I 2A38A 4HKXA 2X4OA 3MV9E 1BGXL 4RQQB 5TDOB 1B0GB 1Q0YL 3N9GH 3IJHB 3LB6D 4BH8A 4OZFH 5IB2B 4MLIA 1JRHL 3WS6C 4EKXA 1G7MA 4DGVL 3U6RA 4UIMA 3WIIH 3WLWC 4DUVA 3HNTH 1NDMB 2HFGH 3KPRE 2A83B 3RVVD 4XAKE 2D4FA 4WO4A 5F9DC 3CX5K 5IB5A 1ZVSB 3VFOA 3EYFB 1T21A 3NACL 4M7ZC 5JW4N 1HHIB 2C3HA 2W9LA 4RMSA 5FHAH 1ERNA 2J2ZA 4YAQA 3WHE1 3BOVA 4IM8A 4OV6F 3QUYC 3ROLB 5DSCB 1BF2A 4OCYL 3M8OH 4QRPD 4U1LB 2CLVA 4DKAA 3D39B 5JW5B 1I1AA 5E5UB 2XXCB 4GXUN 5DVMA 2IH1B 1U8OA 4FXGA 5EC2A 1ZMYA 1PYWA 5IB4B 2JELH 5HYFA 5E2WH 1AHWC 5ALCL 5HGBB 5FO7A 3QULA 2VZOA 2YR3A 5EO1A 2BVPB 5IJKC 3P11H 4XCEB 5E56A 2JIXB 3NH7L 2FIKA 1QG3A 4EI6A 1S9XB 1PY9A 2FCBA 1EVTC 3HE6B 3EUUA 1V7NH 2W9DH 3LRHA 4R7DA 2XI9A 1LNUA 4FQ1H 2P5WE 4RNRA 4KXZH 1NC2D 4JDTH 5J1TC 4TVPH 1LILA 3BT2H 4KVNL 1JPST 4KV5E 5DC0A 3B5HA 2VZ1A 1A1OB 2MQCA 3ARBD 1GHFL 1R5WB 1LP9B 1D5IL 4HBCL 1NCTA 2E9WA 2VR4A 3IYLW 4JZJA 2MTPA 2ITDB 4GRLD 2DQIL 4D9QE 4L3AA 1KJ2H 5DTFA 4YNYB 1ZHKB 1LEGB 3VFPB 3CUPA 5IFHL 4ZYKB 2J8UE 5DK0B 3RVXD 4NHUA 4J23A 5SWSD 4Q9CA 5HYJB 2E9JA 5EU7E 2DLFL 5CJOL 2I07A 2WWMD 1MF2H 3MYZA 3LCYA 1I7ZB 5A2FA 3WFCH 1HN1A 3AS2A 4HLZG 5GIRA 4I18C 5ESVA 4KJWC 3QI9D 1DQJA 2HT2C 3QDGD 5IFJB 2ZOKA 4J7RA 5KW9H 2CK2A 3MR9A 3VFGL 2JK5B 1O5DT 3MRJB 3BKMH 3WNPA 4QY8A 5C3LD 3FFCE 4L9LB 2Q7NA 4Q0XH 4N5UA 5C09B 1JGUL 1VFMA 1MSPA 4NQEB 3WNLA 3TYFB 3OAZH 3QA3A 3ULVH 2EH7L 3HMXL 4PRDA 1SM3L 1UWXH 2NMSA 4N0FA 4DVBB 4GAJH 4MAUL 4Z7VF 3QWRA 4U49A 4FQLL 1CBVL 4B0MM 5TH2B 5FGBC 3EYSL 3C08H 2G2RA 3NA4A 4R96A 2WBWB 3ULUD 4WU5B 2XN9B 25C8H 1MI5E 1Z0MA 1TCRB 3O2VL 5TE6H 1U8KB 1XT5A 2D03H 4MMXC 1X5YA 2ZCHH 2E8YA 4PLNC 3PABA 2VDKL 5FIEA 5E8PA 1JYWA 4UOJA 2GIYA 4MNGB 1FVEA 4RZCA 5DQDH 4JN1H 3ZYZA 1WBZB 4MXVE 3ZT5A 1K5NA 2R1YB 3KPNA 1N59A 1TJHL 2Z31B 4R2GC 4XP9H 3T77A 1FNGB 4MAYD 5ELIA 1MFCL 3MLYL 3UC0L 4UILL 1I7UB 4QRQA 4DN4H 4P4KA 3QQ3B 5C7XH 4FZ8H 5I1EH 3OKLB 1LK3H 4RWYL 3IJSA 3R06B 5IMOB 2A6DA 5BV7H 1LO3H 4TOYL 3P0GB 2DI9A 3FB7B 4OLXL 5JO5B 4P2OB 5KG9B 2WUBL 3BPLB 3BIBX 1NSNL 5AUMB 2QHLA 4P9ML 3KPOA 5F1OB 2G5BB 2M2DA 5F9OH 1EXUB 4IMLB 3OHXB 4U1HB 6FABH 3QCTL 1FL5A 4ZOEA 4K7PH 1UEMA 4JB9L 4NKIL 4JQXA 4J8RA 3C5ZC 4YHNA 4LPTA 3PWVB 3FO1A 3C9NA 3MGTB 5EZJA 1YQ2A 4QRPE 3FB6A 1TVBB 4GO6B 3LHPL 4WWKC 4M02A 4E9LA 3FOLA 4YGVA 1A6TA 2F54D 1TITA 4HS3B 1MRFL 4TSCL 2YD2A 1FPTL 4LHJB 1M6OB 5DJ2A 3B9EA 3HG1B 4RFOL 3MRCB 4K7FA 3CVIH 5JUEL 5FYJD 1S9YB 3VFUB 1MFDH 3LRSA 4AIZA 4EQ3A 2I60H 4F37F 1W0VB 1X5XA 5DQJA 4NO0D 3SCMD 2FIRT 3GNMH 3C2AH 5KSVA 4DEPC 2EDXA 1L4IA 1SVZA 5EU4A 4QGYA 1UKQA 1YPZB 1N0XH 5KS9B 1YQVL 2AJVL 4NUGH 1U36A 3REWA 2ZPKH 1REIA 1D9KB 4YLQT 4PB9H 1BVLB 4I0PC 3T0DA 4MX7A 1P6FA 4MCYA 1GH7A 4HJJL 1F11B 2HVKB 2K3TA 5J11B 3Q5YA 1NANH 3IB4A 5MP6L 3MCLH 2H2PC 4GLRI 2CMRH 3MJGX 5I15L 1RZFH 5GRJH 3HI1A 3RGVB 3PWLA 4QXWA 3QDMB 4ODWA 2YN3A 2VC2L 1WZMA 1P4LA 1NLDH 3UXFA 1WICA 4OFDA 4HK0B 4MJIB 43CAB 1II4E 4YUEL 5AD0A 5C0EB 3QIWD 3BJ91 4DOHB 1QYGL 3QDGE 1DTUA 1P4IH 1NCUA 3CFDA 4P5TA 4G6FD 1GZQB 1JGEB 4JGUA 1ZLVH 3RL2A 2F9BT 2VDLL 4QHLB 1RZJC 1C5CH 2H8PA 3PWUA 3ZDXF 3DX8B 3RAJL 1AE6H 1QFWI 5T1LA 5DGQA 4X98A 2GSIB 3D69A 3HRZA 1RQ5A 1FG9C 5D93B 3CK0L 3B9DA 2D7TH 1DSFL 1F13A 3QUZC 4KQ3L 3W11C 1JWMB 2VZVA 2YA1A 3LPWA 3RVUD 3F6IA 4UAOC 1XMWA 1BAFH 2RJMA 5D1ZA 3ULUE 1MWAA 3OPZH 4DZBA 3E2HB 4GW1B 4ZUVA 4JVUA 1NCAH 3FQWB 2VDRL 3CCHA 3CFEA 3PWPD 4M5ZH 2YEZB 3OB0K 5L8KB 5ADPH 4D0DA 1INDL 1U3HB 3L3KB 3CAFA 2XWJA 3D0VB 3UMTA 5C86A 4N90E 4G80B 5DEGA 3HRPA 1CFNA 5DHVH 3AXLA 5KSAA 2PTTB 4Y4FA 5HSFA 1G7HA 3GKZA 1G7MB 3EDEA 3SGEI 2K9UA 4X4ME 1A6PA 2L4OA 5L8JB 3JV0A 2PTUA 4LKXA 4OUOA 3VFNB 3LS5L 3WHXA 4CJ1A 2VZ3A 1TVDA 5HYQA 5C0AE 3NA9L 1I8LC 4H0GA 3MQIA 4M03A 2B1HL 2DQTL 1DJSA 3PG2A 2EKJA 3RU8L 3IDNB 3ULUL 4LSPH 2H3NA 4U6XB 4KJPD 2O61B 2PO6C 1PKQA 1N3NA 2CLVB 3D2UB 4LVHB 1F4WH 2R0ZL 2KL6A 4TTDD 4ZD3L 1PYWB 3UTOA 1SY6L 2PYED 2DQDL 5ITFA 5L0QC 4AENB 2J4WL 1PKOA 4XAWL 5EO1B 4D0BA 3TA3B 4E0RB 5KAQG 5D4QA 1RULH 3VXME 2F54E 4Q2ZB 2IPUG 4FTVB 2R1XB 3AMLA 3IDMA 4JAMB 1U8JA 3PGFH 4X7DC 2X4PB 1Z0NA 4RNRB 1F2XK 2E27H 1B0RA 3S5LA 4GJTB 1CIUA 4XVTH 5A3IC 4M7KL 2NQCA 1MWAH 4HXAL 4JPWH 5FYJE 1H9VA 5F1NA 2Z9TA 4K94H 5DUML 2LFGA 4DVRH 4XPHH 1UJ3C 2X1QA 4JZJB 1NCWL 5EO9A 2V9RA 4G6KH 1H3UA 5IOPA 3KPQA 2IWGA 3MV8A 3EO9H 2AI0H 3WDIA 3E6FA 3QQNA 4NHUB 4IS6A 4Y8AA 5DD0H 5T5FH 2FATH 1ZGLA 3P40A 2XNAB 3HUJE 1RHHA 3TFKC 2O5XL 1BOYA 4PJGF 1FCGA 3MRQA 3RTQC 5C0JA 1KEGH 2WINB 2A73A 2L7UA 1K6QL 2XG4A 4PRIB 1YEHL 3SGDH 4F3FA 2EE9A 2VDQH 1J0ZA 1D7FA 2YA0A 3O0RL 2HKFL 2WM0A 1IFHH 1YNTB 3CPLA 4QY8B 1A6VH 4P2QA 3KPMA 4U6YA 1TTFA 2P44B 1LDSA 1KFAH 3L7EB 1KEML 1BF8A 5HHNA 1JPTH 3IU4H 3LV3B 3QA3B 4PRDB 2J8HA 2O26U 4KJQD 5FYJL 4YX2H 3BDBA 5IROC 4LSTH 3CXHK 4GG6B 5F88A 3EOTH 1CWVA 3VWJD 3EJYD 2ADIB 4KK8D 4FQ2L 5TFSL 4R6UA 5CINL 4ZDHB 3RDTA 4BZ1H 2WBKA 3GMOB 3JWOL 2W1NA 3WDHA 5ISZD 8CGTA 5CD5D 3VGAB 4UT9L 4Y16D 2WK2A 3PABB 3U46A 4LLYA 2DI8A 4RGMB 2NLJA 1JFQL 3WN5B 4JHZA 2HAZA 5IVZA 3F58L 4JFDB 3OKOA 5K59E 3PIQB 2JE8A 3PWPE 1ZLUK 3IGAA 1T7YA 2DWDB 1RV6X 1FVDA 4F7CA 1DUYB 3BH9A 1RPQA 4Z7VA 1LO2H 1J05A 1DBAL 2B2XL 1UH2A 1I1RA 4LCWA 3PGCA 3SKUD 3DBXB 3QJFA 3I75A 1MH5A 2GJJA 1HHHB 4OFYA 5F7UA 5B39A 3MRPA 1MHCA 1UCTA 5IHUH 4AMKL 1QSEA 2OP4L 1OY3B 4Z77B 4JO2L 3MV01 4FFYH 1DR9A 5KVDH 2V17H 4NJAL 2NY0B 3SO3B 4KDVA 4KQ4H 1DQDL 4PV8A 3MOBL 2P24A 5JZ7C 1WT5C 1VGEL 4QOKD 4LLAA 1G0DA 1FV1A 2GQHA 2I5YH 2UVEA 2D2OA 2GITA 1DBBL 4IRSA 4CADB 4KMTH 1E4XH 2JJVA 2GTWA 3FB6B 1KCSH 4JHAH 1HXYA 2OJZL 1A6TB 4D3CH 4P2RA 2QTEA 1IM3B 4PJFB 3DNKA 2ZUWA 3I2CL 5IJVB 4PGZA 5H94B 3KWWA 2G5RA 2CKBH 2X41A 4QYOB 1FFNA 5B39G 4MCZA 4Y19D 5BQ7B 1FO0B 4AIZB 5DD1H 4MA3A 4OD3L 3C5JB 5KSBE 5GJTL 3VXQA 1XCQA 5KSVB 5GGVL 1CICA 1DANU 1ZKAA 4X7CC 1OGAB 3ARUA 4JFXB 5C08A 1YECH 1U8QA 2NNAA 1TZIB 1UB5A 3CVHH 2A0LC 2Y6SD 5DO2D 3S98A 1ACYH 3U82B 1GGBL 1A7RL 4MX7B 4MCYB 5ADOH 2KUTA 3EOBB 5DD3L 2ARJB 3S88H 3H3PH 3T8XB 5D1QC 1IAIL 2M1KA 1R24A 3L5JA 2YKLH 3TO4C 1AD0A 2MKWA 2EEBA 4MD4B 1H5BB 1PSKL 3DGGB 1VCAA 2VSDA 4ODWB 3WIHL 1XH3B 3B6SA 3EJZD 3SBWC 3TC9A 4J4PD 1K4CA 4EQ2A 1T89C 4FABL 1CL7I 3HZVA 4GQPH 3ZHDA 5AD0B 2J8UF 5F1SA 1ZHBB 5EG6C 1UM4H 4JRXB 1HXMA 5AZEH 3MLRH 4P5TB 3DMMD 4S1RH 3TV3L 5JNYA 3PDGA 2NY5C 5A43C 2EDOA 2VWEE 4ZS7H 4D2NA 1HQ4B 2AXFB 1F97A 3NPSC 5D6DA 5LGHH 1EX0A 2YPLD 3BPOB 2CJUH 1RZKH 3QB7C 4LVNC 3T09A 2OR8A 3LPFA 4ZFGH 2Z93A 2VAAB 1G6RB 1FFRA 2BVQA 1UYWL 4U1GB 5JIKA 1I85C 5J3HD 2HT3D 3F8UB 3HE7D 3V0WL 4KROB 3BZDA 2X6MA 3K7UA 5I0ZA 1A4KA 5TDNB 2YBRB 2F5BH 4O9HH 1DVFB 4ZUVB 4P23A 5CGMA 1DQQA 5ISZE 3SE9L 2P5ED 3QEUB 1DP0A 4I3GA 2NY6C 3PQYD 5IMKA 4D0DB 4BZYA 4JM2C 2F58H 4KPHH 5D7JD 1ITBB 2XA8L 2XWJB 1S7XB 3T0EB 5DJZB 2XXMB 5CZXC 1G0YR 1NGYA 3BWAB 3ARFD 4NC1C 5DEGB 3JXAA 4K23L 3TJHD 4CL7A 1T5WB 3ARWA 3GSRA 5F9WB 2IPTL 5D2NE 1G7HB 1KUMA 2BNRD 4H1LH 1RK1B 4MGXA 3QHFL 3H42L 4N8VG 4NN6B 4P5KA 4MXVF 3UZVB 5IVNA 3HC3H 1NMCC 4FQCH 4OLZL 3M17B 3TH4T 3RWIB 5EU6D 4LKXB 3MNZA 4HF5H 5GHWL 3V7AG 3WHXB 2QQKH 4P46D 4EDXA 3O6FD 4UT6H 2IQ9L 3RIFK 3RWCA 1EERB 8FABA 3O6LH 5LVEA 5GISL 3B2VH 1KJVB 1FNFA 3I50H 4UBDC 4UV4L 5ANMA 5B8CB 5MEQB 3WNNA 3V6OE 3TN0B 4J3SA 4QNPE 5DUPH 4YDKL 2VDPL 2OJEA 1BMGA 4QOKE 1ZGLP 1OGTA 2MPAH 1UZ8B 2VN7A 5ITFB 3IDYC 1XF3B 2BNUB 3ZSSA 2W0FB 2ERJB 3L6FA 2Z35A 4NZTH 4XCNB 5J12C 4D0BB 3NBNA 2CGRH 4ZS6D 5SX4H 2W92A 5GJSH 4KTYA 3ZLQC 1P9MA 4M48H 3IDMB 2IFFL 3CFCH 4WTXA 1AI1H 4TUKH 5IBLD 3U30B 3OAZK 4OZIE 4JLRA 5EUOB 1GYAA 3UPRA 5GZOD 4XHJD 5JOFA 4PJ8C 4Y19E 2HWZL 1QNZH 1I7TA 3KPLA 4U2YA 4H8WH 3C5SB 4ZAKB 4MA8H 3QIUD 5D9SB 4FQIH 1T2QL 4LLDB 2DJ4A 4WENB 1EHNA 1V5JA 1J1XL 4RFNC 4LCYA 1TCMA 1ZGLB 4G6JL 4JRYA 3FN9A 2UZYB 2FL5B 3DYPA 4MNHA 5L2KA 4K3JH 1R3KA 1GGCH 2VLKA 2EDQA 1Q9LA 2A73B 4E41A 4NNXB 5HI5D 3QR2A 3S34L 1CXLA 3LIZH 5E8NA 2MQ3A 2FX9L 3HFMH 1AKJB 4PGEB 4EI5B 3BKCL 5CBAA 5I30H 4G9FA 4PJ9D 2NXZB 4HC1A 2HG5A 4PTTA 4XTRC 1BECA 2JJTC 5BS0B 5FK9B 3SKMB 3TO2B 3UTSD 1OD9A 2X42A 3GO1L 1V05A 2J88L 1RUAH 4M7LL 3W39A 5HHNB 3VFSB 2ZG3A 4UDUA 3B8YA 3ILPA 4KK6D 4NQSB 3LQAH 1NUFA 1YY8A 4U6VL 3G9VA 3T0AA 3U4BH 3BKYL 1J7VR 5F88B 1AIFA 4BKLA 3ULSA 4L4VA 4X4YB 1KB5A 4KY1H 3RDTB 3X3FH 3MRHA 1UA6H 1L7TL 2VLRD 3MNWB 4P99A 4PJGA 5I1GH 2CH8A 2NX5D 4TNVK 3NCYP 3DXAB 3RI5K 5CEXB 5CKGA 5T1MB 3O9WA 4YO0B 4MQ7A 1BD2B 2NLJB 4WI3A 5IVZB 3MJ9L 5D1XA 1C08B 3B9KB 3QCUL 3FT3A 1ODAA 4DKEL 1JNNH 3OKOB 1SQ2N 1JF1B 3ARGD 4LPCA 1FAIL 5DA4A 4WIQA 1HHKB 1FNLA 5DHXB 4K3DL 5MENB 3PQYE 3BUYB 3S9DB 2CDEA 5CFHA 1FVDB 2XTJC 1YJDL 4DK3A 3JV5A 2YD5A 3THML 1SMOA 1B9ZA 3QJFB 1RU9H 2AP2A 4MVBD 5F3HA 3I75B 3C60B 3GIZL 4HWBA 1WC7B 5B39B 1YMHB 4Y4KA 1MHCB 3GEWB 4RX4A 1LK2A 4PRBB 3HI6H 1BFVL 3LSOB 1KC5L 1YYML 2CXGA 2BNRE 4LPYA 2LTQB 2QBWA 4DUXA 1SJHA 3BZEA 2XFXA 5EU6E 5MI0C 5DJDB 3GSNH 4FXLA 5HPMA 4OLWH 1TTGA 4LQFL 2ADJA 4U05A 2PW1B 3NAAL 3I6KB 4FQQB 2BSTA 2NY7H 1AGCB 4OJFL 4ENEC 4WUUD 2AKRA 2ESVD 5CILL 2GTWB 2W65A 1HXYB 2MKLC 5D2LE 3V0VA 3REVB 4IDJL 4P2RB 2EYTB 3QXAA 3DOSA 3OQ3B 3OG6B 5LGJA 1H3XA 5EOCL 2QSVA 4YBLC 4K9EH 4R8WL 1MJJA 1KBGL 2XRAH 2Q3ZA 4ONFH 4CUCA 3VA6A 1TLKA 2R8SH 2GK2A 1ZLVK 4OIIH 4O5LH 4G9DA 3WNMA 4JY4A 5BCAA 5HHXH 4KI5C 1CICB 1MCRA 3MV9A 1R0AH 3CMOL 4OD2A 1OARH 4ZXBD 2FZ3A 2ZSVA 4G3YL 1DLFH 5C08B 3U9UB 1XGTA 2NNAB 4GMTL 1JK8B 4LF3A 1AGDB 1SEBA 2AEPH 4P2CG 1KJ3H 3QSKB 5DMGD 3AREA 5IVXE 1TTUA 3RY6A 3KPRA 1J88A 5CJXC 1XF2A 1AP2A 4F2MB 3OGOE 4PJCE 2H9GA 4XPTL 1SVCP 3MLWL 4F7PA 5E70A 4XBEH 5JLZA 3B6SB 3NGBC 3HPLB 1YUHA 4LOUC 4OZGF 4O2CA 5GSVA 4RGOL 3HZVB 4GQ9L 3V4PL 5DVLA 1EGJA 5T1KA 2W9EL 5I8KL 3LMJH 3SPVB 3ZE2E 1X6LA 1V8HA 3CSYB 3QAZC 3HUJF 4ETYA 5EUKB 2EO1A 1V3JA 3UTSE 2BERA 1IEBA 2UZIL 5KVFL 3WFHA 4FFZH 2GT9B 1RUQL 1AXSA 3EAKA 3IAQA 4DGYH 3IRPX 3AROA 4QTIL 5CJQH 4BUHA 4N8VB 1IL1B 2P5WA 1S7VB 1U2CA 5TPWL 4X7SH 4WV1C 4JKWA 3VFVB 2A77L 4HFWB 2BVQB 4XPGH 1OQOA 3HMXA 5JPMA 4YZFE 4JREC 3N50A 1WIOA 4OCYH 5SV4A 1U3ZA 3BVNB 3IF1A 3ILQD 5DFVD 2G75A 5F97E 4YHOL 4XVUC 4G6ML 4UUJA 1F45A 1Y18B 1W0YT 4LVOC 3FMGL 2NX5E 3ZT7A 3ZDZE 3MACH 5FDWB 2J8UA 1T0NB 4WFFD 5CSGA 1TZGH 4A6YL 2IAMA 3HC4L 5C0BB 1P53A 3FOMB 3U1SH 2OZ4L 1CU4H 1OAKL 4GBXA 1NKRA 2KH2B 3BYTA 3D87B 1NGXA 3LEYH 1WZ1H 2EIBA 1IM9A 5GS0C 3TVMB 1Z3GH 3K2MC 1L9NA 1KV3A 3LVEA 3QPXL 4QRSB 5BVPL 5C07B 1ND0A 1GAFL 4RGNB 1RUPH 4NJ9L 4S10A 4ZUWB 4RFEB 5GRYA 3GSRB 1NGZB 1GCFA 1CFQA 4U7MA 4R0LC 4PRNB 3BQUD 1U8HA 4EIGB 4XCCL 4I0KA 1TXKA 3TBTA 1JZ7A 2N1KA 3FFCA 3MNZB 2EDDA 5K59F 4EDXB 4R7NB 3I3BA 5SWZB 2P48B 3E3QC 1FIGL 1OAQL 4FQXD 5IFHH 3GIVA 1MY5A 2VZUA 1MCLA 3QQ4B 4XPBL 4N0CD 5D8JH 2RFXA 2VOTA 4Z6AT 3TT3L 4OD1H 3KHOA 4NSKA 3UTPD 3TNNA 1EGJH 1V7ML 4XC1H 3QPQD 3QNXB 5JHDB 1I4FB 2DTML 3O41A 2EEDA 1OHQA 4XNZB 1CDJA 1MI5A 3O2DL 4UNUA 1J1PL 5DVKA 3OBAA 3D18A 3C09B 4WHYG 3TIDB 3DRTB 2IMNA 3L6FB 5C6TL 4WUUE 1QPPA 4Z7UE 5CMAB 1BM3L 5DJ8B 3SGJA 3VMOA 1DFBL 4UINH 2YK1L 1DBKH 4OCSL 3TZVA 1U92B 1LVEA 4XPFH 3K4AA 4ELMB 5H35A 4KZDL 1ZEAL 2HT4C 1P2CB 1B88A 1RY7B 5C6PB 1EIBA 5DT1H 3UAJC 1OSZA 3X17A 5C0DB 1JL8A 3KXFA 2QJDA 3UPRB 3UBXB 2DQJL 4MNQB 4EUPG 3QIBC 1P7QA 2QQLL 3AGVA 5DRNB 3D25A 4HIJB 3M1BA 3B2UD 4JFFB 3FT2B 3V5DA 1CGVA 3D3VB 5E6YA 1A1MA 4JR9H 2Q86A 3VXNA 1J0KA 4MB5A 1U41A 4Y5YC 2DLGA 1HYSC 5KSBF 4NZUH 4PUBH 1U8IA 1KXTB 2V7HA 2B0SH 1DZBA 2J3SA 2P8PB 4WGVB 1CE1L 2ED7A 2NY1D 3OKMB 3MRIA 1R3KB 4XCFL 5L2KB 4MHHI 5E8OB 3P9MB 2ZCKL 3MLYH 1MHEB 1EO8H 5IB3B 4U3XA 1T3FB 1YNLL 2IANA 4XVJL 4Z8FL 1W8NA 2D7PA 2DMBA 4NO2A 2HG5B 4PTTB 1NAKL 4QRPA 1LE5A 2E7LC 4G5ZL 4I3SL 4JPKH 3CLFH 4G42B 1U8NB 4UDUB 1DBML 4F15C 3TLRA 1QKZH 3S3PA 3FQXB 3STLA 4JPIA 1GOHA 5I6XC 2R0KH 4L4VB 5IKCA 2DLEA 3WHE0 3QZWG 1HNGA 4LSUL 4DFIA 5F7NC 1HKFA 4TSAH 1B2WH 3SDDC 5FB8B 1YN6A 1PBYA 1YZZA 4OB5H 1CGSL 4JB9H 4PLKC 1NC2A 1S3KL 1JPGB 3C6LC 4LQ1A 5EO0A 3ZHLA 1NAMB 3ARRA 5FHBH 4BSWB 4LCIL 2C1OA 3ARBA 3LHPH 4N0UE 3GI9L 2NXYB 2OLDA 5F96H 2VL5B 3ZTNL 2Z4QA 4HWEL 1KCRH 1MNUL 1S78C 5EC1A 3H3KA 4OF5A 3AY4A 1D5MB 4C83B 4B53A 4ISVB 3QUYD 1XGUA 1I3RB 1RJZA 2CRYA 3QH3B 5CUSH 1JV5A 4MQXC 1JNLH 5HVHC 3IFNL 1IKNA 1MIEH 3NCEB 4PRAB 5F3HB 5D6CA 2ADGA 5F89B 1UACL 5EOTA 4CKVX 1M7DB 2AJVH 1EEZA 3QI9A 3QDGA 3MYJB 2UZXB 5FO9A 1JYNA 2HVJB 3FQNA 1ZVHA 5HPMB 2XICA 4OZHB 1YDPB 1N64H 1XZ0B 2DYPA 4UB0L 4Q9QH 5MP6H 5IQ7H 3FO2A 4S2SB 4OGXH 2BSTB 5FGCB 5LJYH 2Q76B 1FL6A 3DV6A 1E6JL 5AYUH 3QFJA 3PL6B 4KZEL 3ZSTA 2CUIA 3UTPE 4AG4L 1HCFX 3G5XA 1O0VA 4DW2L 1JHKH 4GOSA 3GKWL 3NABH 4PV9A 5DJXA 1YN7B 4KUZH 1KENL 4PR5A 5LGJB 2ZUQB 5ICXA 1KOAA 4HIEA 3MO1A 3LKOA 5T3XE 3HE6D 2VRAA 5DJAA 1SYSB 1OAYL 4NM8L 3BRFA 2FEDC 3PHSA 4GAFB 4NN7B 4Q74A 2VDLH 4P5MA 1FH5H 5IHBA 4P3DA 3FCTB 4GAGL 4X4ZA 4WFGD 4JY4B 3MV9B 4KJWD 4MAYA 2HT2D 4OD2B 2IC2A 5GRVK 2D9CA 2FZ3B 4NDMA 5D71L 2VABB 4KQ3H 1ONQA 1IQWH 2VZTA 1BZ9A 3DVNA 4LF3B 3U0PA 1KLUB 2VLJA 1KIQB 4NUJB 1RD6A 1K9TA 3F5WB 5L8LB 3AREB 3KPRB 2ZSWB 3KR3H 5GGUB 5KOVC 5C0AA 3VGFA 3EO1B 1XF2B 2G9HA 4H26B 3MLZL 4Y88A 4XWOC 5HHPB 1ZSDA 3VXSD 3TYGL 1MCQA 1JPSL 2AGJL 1FNEA 4ZPTB 1XIWA 2EECA 3MUGA 1X4YA 1D6EA 3RBGA 3VMPA 1A2YA 4FG6C 1SBSH 3NZ8B 1CLOL 3RWFA 2VJXA 1E4KC 5GGRB 5E8EA 5T1KB 3GHEL 5T3XL 4QRUB 3RVWC 4X9GA 3V6FA 1QFPA 4PGJA 3AU1A 2ZKHH 5DK2A 2VERN 3FTGA 3S6CA 3GMMB 4AQOA 1WTGT 4GS7B 4WFHE 5TGBA 1LQSR 4LCCA 2XKUA 3VXMA 1IEBB 4R2GD 5EBWB 1CR9L 1DE4A 4LIQE 4ONGH 2F54A 5T1DH 4TULL 2FWOA 3WKMH 2Y9RT 4QXUL 4I77L 3GMRA 1F90H 4Z76A 2X4QB 3HNSL 4OQTL 5IIEB 1MQKH 2QADB 4H20H 3SDAA 5J11C 1OP5H 1G9MH 2R0ZH 2UYLA 1ZANH 4F37K 1CD1A 3TPUA 1RFDL 2MHAA 2Y23A 4OZGA 1JI2A 3O4LD 4LSRL 5CIPB 2RIKA 3UBXI 2J8UB 5ECJE 3HC0A 2B39A 1Q9KA 3MA9L 4HIIA 5BMFH 1CLYL 4GBXB 5HHMB 4FP8L 3HUJA 1LEKB 4YIQB 1BP3B 1IC5H 1IM9B 2AK4D 3EDFA 4UV7H 2F74A 3C5ZD 1ND0B 3LN4A 5ID1A 2YRPA 1E6OH 4HXAH 3TIEA 3CSBA 4WWKD 3QXUA 4KK5C 4LIQL 3ZKNC 3GJEB 1U8HB 5DUMH 3QRFM 1TPXB 3MMEA 1RZ8A 3BHBA 3E1F1 5HTSA 4YR6A 4P2OD 3WNOA 5D7LA 3TT1H 4L8SC 1RURH 2DI7A 5HBBA 1N5YL 3GIVB 2IG2H 1UM6H 1YNKL 2IQAA 4EUPB 3BIKA 3OV6A 4JJ5A 4JFPB 5EBLB 3IAPA 1HH9B 4OF6A 4Z7QF 3TNNB 1A3QA 4PLJC 4IRJC 4XB7A 1VB9A 5F9JA 4UOW1 5CEZD 5FA3A 4HUUA 1H3PL 3PWNA 1R3IL 1MEXH 2P7TB 3RY4A 3UDWC 3ZKMC 2COQA 3VXUD 4O02H 2BDNL 4PP1C 3D39E 1C5BL 2HKFH 4Z0BL 4I0PD 1LO5B 4ZTPH 4PGBA 3WXWL 4PFEA 4NIKB 3KHQA 5T33H 4XP5H 4MSWB 3WYRA 5I18L 4DAGL 2FLRT 4NGHH 2H2PD 2PUQT 5TQ2H 2LAAA 3PWPA 1MJ7H 4DGIH 3ES6B 1EEYA 12E8H 3MJ8A 4IOIB 3WO3B 1Q0XH 5ICZB 1AQDA 1UCBL 5D2LF 4WO4C 1ZTXL 1CG9A 1P7QB 4YFLI 1BVZA 4CN1A 4WFGE 3V5DB 3BIAX 4D94A 1KELH 3IJYA 3VG9C 1LP9E 4FN0A 3QZWB 3QDHA 4GKOA 1I1AC 2DAVA 3QG7H 1FHGA 5IHZB 2W59A 2XPGB 1VFOA 1F4YL 1AGBB 3L95B 2X4NA 1EVUA 1S7SA 2CQVA 4P2YA 3MRIB 3BUTA 3MGOB 1A6WL 1BX2B 4HJGA 4JO3L 1EFXA 3QUZD 5GGSA 1HE7A 2VDNH 4JFEA 3K3QA 3VXSE 4KHXH 4NZRH 1QFWL 5IVXF 4G8EB 3QP3A 2IALA 4QRPB 5I76A 1LDPL 1WAAF 1SBBA 2VKXA 1LO4L 4P57A 3RZCD 3WIHA 1JP5A 3LS4L 1CTNA 3O4OC 2AJSH 1OT1A 3KJ4C 1VFUA 3IDUA 4AL8H 3BE1L 5DWUL 5KSBA 1R3JA 5IW1B 3KLAA 5BV7C 5DXWA 1BZ7A 3DI2B 2KKQA 4KHTL 4JO1L 3ZE1E 1NC2B 2E9BA 4HZLB 5SX5H 3IDJB 5F3BB 2GSGA 4M6AA 2WP3O 3ARBB 4S1DC 2NCMA 5CZVL 1IEAA 3BYYA 3Q1SL 5EC1B 5FV2A 3WFDH 4GRLB 3O4LE 3UJTL 3DUUB 5IV2B 4LEXH 1G1CA 4ORGA 3VW3H 2B4CL 1NCDH 1OVZA 3IETA 4ZUUA 1FZJA 2EC9T 2PO6D 2VE6B 5SWSB 4CNIA 1RJZB 2AV1A 1RUKL 5SWQB 4XP4L 2AK4E 3ZDZF 2EKSA 2ADGB 4WI4A 3N1FC 2LQRA 3G5VA 4U1IA 3FB5A 4G7YH 2DICA 3QI9B 4OBRA 1RJYB 2B5IC 1KXQE 1JHTA 4M5YH 3O2WL 4NHCH 1GGBH 4F33B 3FONB 3BXNA 2H32A 5CBEA 3MOAL 4FOMA 2XTLA 1N6QL 2HN7B 3QCVL 4PY8J 1MFEL 4OF3A 5A3ID 4RGMC 4HUKB 1PZ5A 1CD8A 1PSKH 3QDJD 5KSUA 5B38G 5F21B 2EYSB 4OCWH 5IB1A 4I8DA 3VWJA 3WIHH 2GJ6A 3MGAA 3F7RA 1FC1A 4UMGA 3VD4A 5DJXB 4PIRF 1CTOA 4OLUH 5CEZE 5ISZA 4P4KC 5ICXB 3TA3D 4FQPA 3MODH 1AXTL 1NCBH 1ETZA 2Z92A 2AXJA 2P43B 4EOWL 1DQLH 3GMNA 2W0LA 3VXUE 1BLNB 1QZ1A 2ICWI 3VG0H 4XNQA 1A14L 4FQJL 3TFKD 2HJLA 3OXSA 2HRPL 3RTQD 1P84K 3ISWA 1VKXA 1A6ZB 2WSKA 5L7XH 3HG1E 1JNHA 3EHBC 4MAYB 1PQZB 5KTEL 3HA0A 4Z7UF 4KXZI 3BDYL 3SN6N 3SHSA 4YPJA 4NDMB 1N2RA 3UJIH 5D2NA 1RZJH 2AAVA 2UWEF 3UPCA 3HNVL 4XZUA 4JQXC 1DL7H 3ZE0F 4ZSOE 1IGTB 1YPZE 1ZLWH 5JA9A 2GAZA 5CCKH 2WBJB 3MJ7A 3WFZA 1GZPA 2P46B 4KMLB 1OM3L 5DHVB 3ZT6A 4PJHB 3V6OA 1D5ZA 1D6EB 3LKNB 4PJAA 4H88L 3G6DL 5CEZL 3G6JE 2DF3A 3BGFB 7FABL 4XC3H 5E8EB 3EYQD 1W8OA 5IGXL 1EH9A 3DECA 3C8DA 2EEAA 3AU1B 3WMSA 2H32H 1I9IL 3FTGB 3H42H 3WIFA 4ZFZB 4HQQL 2FHFA 2EDBA 2VMFA 5BJTB 2F54B 4AH2B 2IQ9H 4MXQC 3HKFA 3UJJH 2QQNL 2FWOB 3RUGF 5DMKB 2FO4B 3P9LA 4V1DD 1AD9B 3ABZA 1I1CA 3OSKA 4BK4A 2N7AA 1A3RL 2XWTA 4FS0A 1QFOA 2ZUXA 3ZYIA 1QOKA 4Y19A 6CGTA 4YDKH 5K9OA 1ED3A 2MNUA 2YHGA 1IGYA 4NO0B 2F8VA 3SCMB 5FYKU 3QNZA 5EN2A 5I2IA 4IJ3B 2JJSA 3X13A 2FX7L 2R1WA 4H0IA 4GKSB 1FORH 5LG1A 2X2YA 3DO7B 3L5HA 4N0RA 4OV5A 5F1IA 5J13C 5E0QA 5DJCA 3PP4H 4JHWL 3SOBL 1M7XA 5C0NC 5FM8A 1OTUC 4P5TC 1A4JA 2VITB 3MJ9A 5I9QC 1KTDA 2UY7A 3LEVH 9CGTA 3QUML 3LN4B 5FKPA 1B6DA 3UTZB 4DUWA 2YOCA 3U7WL 3JV6B 3HR5B 1A3LH 4YR6B 2HFFA 4BFIB 4HJ0C 2P1YA 1QQDB 3S37L 1G9NC 3QIWB 1XF5A 4IEFB 5C1MB 5HYSA 5D1ZC 4G6FB 4N1EA 3VH8G 5E00A 1ORQA 2AJXH 4BH7A 1VA9A 3VXRA 1TQBC 1J11A 5E5MB 4JFQB 2YMXH 2ZOLA 4HK3N 3V0AC 1S7UA 4FXKB 4LL9A 4F7MB 1FL3A 4S1QH 4YE4H 2FX9H 3GSVA 3B8SA 3TBSA 4M1DL 3LN5B 5BOZG 4MDIB 2A0LD 4U31A 2Q8AL 4WJ5A 1CVSC 5EDXA 1MRDL 4HUWB 4AEIL 1WCBA 2FNBA 3FHQA 1RZGA 3K4ZA 4JFZL 3MREA 5KSAC 4Y4FC 5D1QD 3ECBB 4MB4A 4EEEA 1VACA 4XNYL 3PWPB 2EC9U 4L8CB 1L0QA 4IMKA 3DX6A 4KU1A 2JB6A 3P2TA 4FTVE 3TCLB 1KJMB 5D7JA 5DQ9A 3OAUL 2OBGA 2LAGB 3EYOB 2P47B 5LBSL 2AJZA 4YK4C 1A7OH 2VDMH 3TBWA 4M6OL 5C0CD 2APFA 1ZWIB 4X5XA 5HDOA 3O6ML 5AZ2H 2AJ3A 4MMZC 4QHUB 2RAMA 2BNRA 1CL7L 1EAJA 2ATPB 3G04A 5GS1A 1AFVH 1YA5A 1F58L 1FP5A 2X4NB 2R0LH 5EU6A 4ALAH 4G8FB 3MJ9H 1C1EH 3HB3C 3TNMA 3NIFE 3O6FA 4YQXH 1WEJL 1DUZB 1LD9A 1NANI 3S4SB 3MCKA 5B3JE 1MUJB 1YJDH 2NZIA 1QEWB 4WEBH 2IALB 3L5WB 2H41A 3BH8A 4HX1A 1WWAX 5D2LA 4NRZA 2ED8A 2WUCH 1I3GL 4YDJA 1JYVA 1FGNL 2PYEB 3KG5A 3TBVA 2NY6D 4JN2A 1D6VL 5JDSA 2E6JA 4JM2D 4L4TD 4PJ7B 3MV7D 4TUJA 1T0MB 2E3VA 2Z8VC 4TNWF 3IVKA 4HG4J 3BZ4A 5CZXD 5DZLA 1YEIH 2OR9H 3EYUL 2ZNXA 1MFAL 2X1XR 3AB0B 4BELD 5DHYA 2DWEB 2IBGA 3GRWL 1F8TH 4V1DE 5IEKB 4NBYB 4UTBL 4DTGH 1FQ9C 4WW2C 4PRPD 1OB1B 1L7IL 3CZJA 3EOAB 5IVXA 1IEAB 3RL1A 3EJJX 2HYMA 2EDFA 3QIUA 4XI5C 1JPFA 1KCUH 5B38B 1WAAA 3MXVH 2NXZC 2X9XA 4K3EL 4NRXA 4JQIH 4UBDD 2A6KA 4XMLL 3FO0L 4HUVA 2AABL 4ZODA 3UTQA 1FZJB 3V95A 3T0ED 2OSLB 3V79C 4A6YA 3CVHB 1KPRB 2EE3A 1ZV5A 2Q7YB 2DD8H 1JWUB 1YMMD 2GFBB 1QRKA 5JOEA 3CH8A 1TJIL 1ZA6B 3ARZA 2HKHL 2Z8WC 3FB5B 2DL2A 2VXTH 3SQOH 1ROWA 3FQTA 1FFPA 2R69H 4JDVB 1WITA 3NCYS 3BPNB 4X6CE 2WZPD 1SYVA 3BXNB 5KN5B 4RIRA 1OAZL 1G7JB 3DUSB 4UT7L 2G60L 2CDGB 1A0QL 1QFUL 4OM0L 2CR6A 1MFNA 4Y1AA 5HGHB 2BVYA 2DQGH 3BW9A 1PZ5B 3IKCB 4HH9A 3QHZL 4PJ8D 4ODVH 1CN4A 3VWJB 2C1PA 2FSEA 3SJVD 4ODTH 1PAMA 3RNKA 2MSPA 3DETD 43C9B 2RGSA 3AS0A 3MRDB 5I8KH 1MCNA 3KYKH 5C0GA 1HH6A 2NX5A 1IC4H 1ETZB 2VZSA 3VXOB 4LSDA 3VFTA 3ME0A 4Y16B 3GMNB 3O2DA 4NQXA 3U79A 5I8CA 1CCZA 1R5IA 4HD9A 2KDGA 4NT6B 3OXSB 4PJFE 5HGAB 2UZIH 1BVKA 5EIQA 3OWEA 1MJUH 1PG7L 3D1MC 5D7IA 1CFVH 3T4YA 3BD4A 5I1IL 5DD6A 1JNHB 4YDLC 5HYIA 4YXHL 4F7TB 4JG0L 3FT4A 5I1HH 3FL7A 4Y5XB 2GYSA 1CF8H 4M6NL 5A40E 1KIRA 3W9EA 3HZKA 4QF1A 4XTRD 3L3DB 4HGWA 4QT5A 1MCWW 4G8GD 4ZAKD 1W2KT 1A7NL 2BCKB 3MBXL 4JFOB 1RAMA 2X1PA 4HBQA 5ALBH 3MLUH 1OP5K 2FH6A 3MFGB 2APWA 1OGAE 2PR4H 2EZ0C 2GAZB 2ICEB 5FUOL 5IM7B 4IRSC 2QV2A 1GZPB 1YYLL 4A6YH 2DQEH 3QFDB 1X5AA 4PJDB 4X0KA 1MJ8H 1M05B 1MHHA 2Y36L 1LHZA 1T7ZA 1E0OB 3MX0A 2EYRA 3B3IB 4QOKB 4IIQA 5FEBA 1HQRB 1LP9F 4C57C 2R0WL 1G7PB 1OAUL 4ODUA 2DKUA 3P4OB 4Y5VB 4N5EC 5BS0D 3SGDI 1JN6A 2DQUL 4Z7UA 2ITCA 1QBMH 1AJ7L 4AEHL 2BJMH 5ENWA 1UWGL 5I19H 5HHVH 4OT1L 3LKPB 4NPYA 1BBDL 2UWEA 2W60A 3O11B 3S96A 1EAPA 2XT1B 3I85A 4AIOA 1U95B 1VFBB 4Y2DC 2BSED 3P9LB 2XTJD 4LDLB 4OZIB 3I6GB 5TF1L 3INUL 3SKNA 3MV7E 1IZKA 1LO0H 1NMAH 1ZT4B 1VENA 5I0DA 4KMQA 2DIAA 2DTMH 4I4WB 5J9PA 2VR5A 1JGVH 5I2IB 2OL3H 3VH8B 1BIIB 4KVCH 5HHOB 2R1WB 3WL9A 1A6UL 4YC2C 3KYMB 5CEYA 4PRPE 1NUNB 4J6RL 1AH1A 5BZDB 4XMPH 5IW6A 4KZDH 5F1IB 3ZE1F 2A6IA 4LCUA 4MZ2A 5D5ME 4I9WD 2I26N 3IU3A 3QEHB 1EMTH 1KTDB 5INDA 4ENED 1OAXH 1H3VA 3P73A 1CFTA 4DN3L 4LPXA 1FYTD 4WHCA 2OTUB 1UXWA 5FKPB 3RUGA 4YHMH 4ZFFA 5GGQL 3T0EE 5D6DC 5TDPA 4OTXL 1S5IH 2NY4C 4RAVB 2C3VB 3N85L 3T3PF 1XAUA 4X6EA 4M4PA 3A6CH 1RIVH 3OKDA 3WFBL 4KRMB 4NO3A 5IUSA 3MBEB 1HHGB 2JCCE 3DMMB 1T1WB 1XCTB 1XGQA 3HLAA 2YWZA 1IKFL 3WUWB 1ORQB 4P23C 4DZ8A 4BH7B 3BAEL 1A5FH 5E6IA 1WUNT 4OLYL 1UT9A 4XCFH 3B43A 1NLBL 5D96B 1FZKB 2GJZB 3IFPA 4H8WC 5EORH 5M95B 4NP4L 4KI5D 3RWJA 4L5FL 4HKBB 4Z5RA 4OM1L 2YPLB 2XKNB 5JDJA 1FNSL 1J8HB 5GGTA 1JZ3A 5JA8B 3KYNA 1MCPH 3TBSB 1K4DB 3UZEA 2VUOA 4PGCA 2PCPB 3HE7B 3SJVE 1E4XI 4U6TA 1C16A 5DZOA 4N0UA 4NRYB 2AJUL 1NJ9B 2FGWL 2ICCA 3FN0L 5K93A 1E4JA 4HPYH 3X3GL 2P5EB 4K8RL 1VACB 3Q3GB 3PQYB 2GHWB 5CP7A 1EEUA 2FYYA 2BVOA 4LOUD 3C8KB 3OJDB 5CSZA 3VRLE 2HLAB 3MRLB 4AM0B 3TBWB 5I75C 1Q94A 2OCFD 5EUOE 3ARFB 1MCJA 2XZAL 4M00A 3LQAC 4J1UB 4X5XB 1I1YA 4G8IA 2AJ3B 4XNXH 2XQYK 4QWWC 1FNHA 2IBZX 1G9EA 4R26H 4QCIB 3MRKA 5L9DH 3BQUA 5SX5K 5FF6B 3P4MA 2I9LA 5EU6B 4LSQL 3ZTNH 1KNOA 2ZCLL 4P46B 3O6FB 1N4XL 3D9AL 1LD9B 4R97C 2Q3AA 4OCXH 4GW5B 2VXVH 3V4UH 1YEDB 4YXKL 1P9MC 5IWLA 4NCC2 1QA9B 1EJOL 1Y6NR 1YPZF 5KS9F 4P59L 3BD5A 5D2LB 5FFLA 4JPVH 3MLVH 4WDIA 4YDJB 3GSNB 1AGEA 3NVQA 3O3BB 3QXDA 5E9DD 4L8BA 1UACH 4F57H 4L8DB 1NC4A 5BS0E 5DK3A 5B4MC 4CVZB 5EFIB 1Q72L 5IBTL 1VPOL 3H7LA 4C4KT 3QRGL 1CDIA 1MAML 4QO1A 5GS0D 1PLGH 3MNVA 5GGTH 2XYCA 5E03A 5BW7A 5EPMB 5DA0B 5C2BH 3O3DB 4L3EB 2QSCL 1I8IB 1E6JH 3HMWL 2QEJA 3IKKA 4AG4H 4Z0XB 5IVXB 5INCA 3QUXA 1HNFA 5GGRY 3QIUB 1VFAA 3DXAE 2NZ9C 4E42A 3T65B 3MRMB 4NRXB 32C2B 4OSUL 5MERB 4XP1H 4PJCB 2VKWA 5FM5O 3E8UH 5C8JB 1Z5LA 4JKPH 4BUGA 1RZIA 4DKFH 4HW6A 5M94B 1HDMA 4GAGH 1T7WA 3JWDH 5MENE 4I9WE 1DN0A 4YEEA 4JHBA 4HULB 1BFOB 3H2WA 3B5GA 1FYTE 5IQ9A 3DX9B 4K9EC 5EULV 4PJ9B 4TSBH 2HJKA 3HZYB 1QO3A 4ODHL 2MOVA 3WUZA 3GSOB 3WO4C 5I1JL 3P30L 2HT4D 3UTSB 4RIRB 4NNPL 3L3IB 3KPSD 3BEWA 3T4AA 4RMQA 4M1GL 1Q8MA 3UAJD 4TQEH 3CFBB 3ARDB 1W72H 4HMDA 4IHOA 4X7TB 5HGDA 3L5XH 1ZLWK 1U2HA 2BHYA 4O4YH 3IXTB 3O9WC 3U9PL 3MRGA 1JPSH 2AGJH 3W2DH 3GJFA 5D1XC 3PJSA 3B5TA 3QIBD 2P42B 4NM4L 2V2WA 2X4RB 1OCWH 1WFTA 4W68A 5FO8B 3IS1X 5M7QA 2VLRB 1UADC 3S97C 2DQHH 3GHEH 1JUFB 1HH6B 3SDCD 2BRRL 5FKAA 4KTEH 2YS4A 4W4NA 1HYSD 3J8F7 2RHEA 5JR1H 5I8CB 2FD6H 2OK0H 1VERA 4U1SB 4YGAB 5BZWA 1T1XA 1BQHG 5SX4I 5I17A 5I1DA 1RZ7H 4D8PA 4F7EA 4Y4KC 1MPAL 4XNMA 4APQA 1WZKA 3RWDA 1WBXA 1INQA 3PGDA 2VIRA 4QXUH 3ARGB 3GHBL 3NIDE 1YEJL 1QLEL 3ZO0A 5I66A 2X70A 3VFMA 3DI3B 5J0BA 3ET9F 1ADQL 3K46A 4JFFD 4PJIB 4X8JB 2VXSL 4RQQA 1B0GA 1Q9OA 1RFDH 5FUCC 3V52H 5IB2A 5EZOL 2BHUA 4ELKA 5LAXB 4L3CB 2MWCA 3TBYB 4FHBD 4N0YL 3VD5A 2A83A 1CE6B 1U3JA 1CLYH 2A9ML 2YA2A 2CLZA 4P3CH 4WY7H 4YHLL 3FRUB 4UQ2B 4U7KA 3EYFA 4RCAA 3SDDD 5BRZD 4PLKD 1HHIA 4PD4J 2EXYC 1B4JH 3C6LD 5DSCA 3ROLA 4U1LA 3FRPA 4WUUB 4Z7UB 1CLZH 1DQML 1RJLB 2ITCB 3D39A 5JW5A 4HCRL 2ESVB 1GPOL 2IH1A 4S1SH 3NIFF 5IB4A 1S78D 3MTRA 1KTKE 3O3AB 4MS8D 5HGBA 3X11A 3JUYA 5I8OL 4XVSH 3GJFH 5B3JF 2Z91A 2CIIB 2BVPA 4B7LA 5DEZA 4XCEA 2JIXA 3RY6C 4MQXD 2AS5M 1S9XA 3HE6A 3V4VL 4NQUA 4HV8B 4HT1H 5C92A 3LOWA 1G7IB 2BXZA 2CDFB 3CC5B 1NMBH 5J9PB 4HLJA 2RCSL 4PJ5B 4U2ZA 5DRWB 2X4TA 1A1OA 2P45B 2Y07H 4UI2A 1FFOB 4ZXBB 1R5WA 5I1KH 1LP9A 3F7PC 1KN2H 4TPRL 1JIBA 5AEAA 2Z8SA 3FRPG 1ZHKA 1LEGA 2OI9B 3A67L 4YNYA 3VFPA 1F3DJ 2A6IB 4U0RB 4GG6F 5DK0A 3IU3B 1IT9L 4LNVA 5C0BE 3VFWA 5HYJA 4FZEH 3AVEA 1UXWB 3TH2T 2AEQH 5TDPB 1OP3H 2ZJSL 4BYHA 1I7ZA 3H9SD 3QJHB 5C07E 2FEEI 1AC0A 5C0FA 4RGNE 2QKIB 3EDDA 5I73C 4X6EB 2JK5A 4XX1E 4LPUA 3MRJA 2MQ0A 1QBLL 5AWNH 4QRRD 1ZXQA 1IC7L 4L9LA 4OQ1A 4X9FA 5GS0L 3HAEG 2ENSA 1IGIL 4DZ8B 2AERT 3TYFA 1GIGH 3KPSE 5H2BB 4DVBA 2GY5A 4WHTB 4DKDC 1IGCH 5EA0L 1JHLL 4IRZH 2IAMC 5TH2A 5JOPD 1WFUA 4ODBD 2Y06H 2YC1B 4GBXC 5EU7C 2R23B 1X3DA 1HI6A 5HJ3A 1I8MB 4X6CF 5FYKD 4WU5A 2XN9A 4N0UB 1TCRA 3L1OH 1U8KA 4HKJB 4XWOD 3O4LA 4FNLL 4MNGA 4OGZA 2CRIA 3RPIB 1MCSA 1TETL 4ELME 4KKBC 2R1YA 2FYYB 2BVOB 2Z31A 2ZUVA 4FG6D 4U1MB 1MELA 4YHIB 5F71A 1FNGA 2F19L 3B9VA 3NFNB 2E7BA 4JO1H 2CR3A 1I7UA 1Q94B 3RVWD 5FOBB 3OZ9L 4G7VL 3QQ3A 1DDHB 5T3ZD 3F12B 4YH6A 1OF2A 3OKLA 1BWWA 4G8IB 1U42A 1KTRL 2HH0H 3R06A 4PJFF 4NWUL 1MFBH 5LCVL 3MRKB 1JE6A 3BQUB 4M8QB 4JFFE 3I9GH 3D3VE 3FB7A 3OR7B 5JO5A 2YPVH 3EDKA 1KNOB 4P2OA 5KG9A 4LGRB 2XZCH 4M43H 3CDGA 5AUMA 35C8H 4Q6IB 2G5BA 4WVRA 3SGJC 4NN5B 4FQXB 3L3OA 1EXUA 4IMLA 3OHXA 5JORB 3DV4B 4G43A 4GSDH 4U1HA 3TZVC 1Q1JL 3V7MA 4JG1H 2Y7QA 3KS0J 1A7PL 4ODSH 3TF7C 1UM5H 4LAQL 5FCUH 5BRZE 1QHOA 1AGEB 3PWVA 4WTZA 1EHAA 4I2XB 4L8BB 5FYLH 4NFDA 3LKRB 1IILE 3VXUA 3STZB 1OW0A 2YD6A 4AZ8A 1S5HB 2DN7A 4HS3A 3FFDB 3JSSA 1NL0L 4ZUTB 4JCLA 4Z95L 2OXHA 1S8DA 3HG1A 3MRCA 4UOW0 1S9YA 1IGJB 4P0DA 1U8LB 4KK5D 1W0VA 1IARB 2DQCL 3ZKND 3SDXB 3RVVC 4HIHA 1OSPH 5E2VH 4Z18A 4LLQB 2O5ZH 1KTLA 1RUMH 5IESH 1SEQH 1MLCB 2UY6A 4ZSOA 5HY9A 1YPZA 5KS9A 3I3EA 2YXMA 4TVPD 4JM2F 1AXTH 1D9KA 3GGWA 3LY6A 2A74B 4W81A 2FBJL 1BVLA 1K3IA 3PXHA 5C9JB 1T1YB 1F11A 5FCSH 2HVKA 4PLJD 4IRJD 2KZWA 2NY2C 3GI8L 2NY1B 2Y5TA 5A16B 2E8ZA 3BDYH 2Z0BA 1BQHB 2V2TB 3RGVA 3ZKMD 4PP1D 4BZ2H 1NUDA 3QDMA 5ESAA 3W0WD 1BEYH 2R4RH 4NKQB 5TQ0H 3GSUB 1CI5A 1NGQL 2H6PA 5E4EC 2E5EA 4HK0A 4MJIA 4Y4HC 1HSBB 43CAA 3P0VH 4NZDA 5HDQH 3H9SE 4KAQL 5D5MF 3BEWB 1OPGL 4XRCB 3VE0B 3UTTB 1YEGL 3RZCA 2QR0B 3U0WH 1GZQA 5HGDB 4BA8A 2DBLH 1JGEA 3ARBC 1OD7A 4QRRE 3U36B 4AIXA 4QHLA 4WO4D 1P6AB 2C4XA 4LRIC 4NC2B 5KAQF 4OZHE 4AQ1B 4CGTA 2AQ3A 2VQ1A 1ACZA 3AY4C 1NAML 3S36H 5K9QI 4YXLH 2X9WA 3ULVD 4ZNEE 5F7EL 4ZTOL 3MLXL 1JWMA 1ES0B 2JCCF 4XMKH 4P3WA 4X9IA 5EZLA 1I1AD 3BKJH 2DTSA 5FYKE 5I8EA 1IKNC 2H2SD 4GW1A 4XP6L 5E2UH 4D8PB 5HVWA 1MCFA 4YHKL 3FQWA 2J5LC 4JKLA 4XNMB 1I8LA 4F9LA 4M4RA 4M9OA 3QI9C 3LD8C 4M7ZB 4XH2B 2VIRB 1E4WH 1MAJA 3L3KA 3IAGC 3RWHB 1A3RH 3QUYB 5I66B 2VL4A 2VH5L 2PO6A 1GC1H 1PY4A 1FE8H 4G80A 4I3RH 1XGYL 4PYGA 5EZIH 1E27A 3P3YA 2DDQL 1Q9OB 1NBZB 2XWBB 1D5XB 1MIML 2PTTA 3K74B 5KVEL 3GBMH 3W5MA 1AHWB 3OR6A 2IGFL 4P9HH 3R4DA 3ALXA 5T3ZE 4F8TA 5CLWA 4ELKB 4JZNB 5CP3H 3LDBC 4RDQF 2DM7A 4X6DB 2BY0A 4JKKA 2R56H 4ZOCA 3VFNA 3N1GC 1BQUA 3WCYA 4R4FL 2CLZB 1UWEL 4K3HA 4LP4A 2R4SL 1G9MC 3BMVA 3TJEH 5EUOF 5I71C 5DYOB 3VXTB 1X5ZA 3IDNA 3ZTJG 4GRWH 5FYKL 4U6XA 2O61A 1OT2A 3O8XC 4WNQB 3D2UA 4S1DD 3GSQB 1INEH 1CVRA 3DX7B 3RWGB 4OIBA 3SKOB 4LSVL 1HWGB 3X11B 5EU5B 4AENA 2EDLA 3FKUS 1K85A 2Z91B 3TA3A 3SKJH 4E0RA 2PYFB 1YEFH 1FLRH 1KB9J 1I9JL 1JZ5A 4Q2ZA 3S36X 3LZFL 4FTVA 2R1XA 4JAMA 3WXVL 1QUNA 2X4PA 3EFDL 3QWRD 4FMFA 4F58H 1R3HB 1GGIL 5T3ZL 3OKKA 2YRLA 4I1NB 2X4TB 3HAEB 4I18B 1AQKL 5GGSY 2JKXA 4K2UL 1HKLL 1XIWC 3NZHL 3MRFA 1YY9D 3P0YH 1S7TB 3GRWA 2OMBA 5KJRH 2CIKA 3A0OA 3F7VB 1EPFA 3N9GL 1LE9A 1N8ZA 4JFZH 2R29H 1U9KA 2V9TA 1I9RH 3K2UH 1BFSA 1HHJA 4TVPE 4XNYH 2FJHB 1FJ1B 4KKCD 5HHME 3VFWB 3WIIL 2XNAA 4EBQH 3HNTL 2HFGL 4LCCC 3VXSB 3X12B 2WINA 3OAUH 3EYVB 5C0FB 1HEZB 4P4KD 4PRIA 5ILTH 1CZ8H 4B50A 3GB7B 4YHPA 3M8OL 1YNTA 4MXWH 3W0WE 1FC2D 3SDAC 3TM6A 1KCLA 1FGVH 3L7EA 4X99A 5JW4R 1N7MH 3IS0X 5E2WL 3JWOC 4R2GB 3LV3A 1S7RB 1WEJH 3EHBD 4RMUA 4LNRB 4HFUH 3EZ8A 5F7FA 4GG6A 3P11L 2ADIA 5HJ3B 1HI6B 4CN4A 1V7NL 2W9DL 4ZDHA 3GMOA 4TYUA 1G7QB 4X4XA 3R0MA 3PV6A 4FQ1L 2BFVL 3DSFL 1A8JH 1HCVA 4TVPL 3BT2L 3CNKA 3FN3A 3L3HA 3ULVE 3H7BB 3DTXB 3QISA 3O4LB 4HLZH 4ZG1A 5FM5M 4J3VA 1BWMA 2EE2A 3U48A 3OMZA 5KZCD 3WN5A 4JFDA 1I7RA 1KJ2L 4ZOBA 2V2XB 3PIQA 4J12A 3V5HA 4MWFB 2AK4B 3RZWA 2DWDA 2JLLA 3C5ZB 3GRWH 1DUYA 5BXFA 4WUKH 1OF2B 4X7FC 4KRNA 2VLLA 4NBZB 3DBXA 4WWKB 3HPJA 5ACZB 1HINH 3WFCL 1HHHA 4X6CA 5ACLA 5EWIH 2WBJD 3CDGB 4MXQD 4EN3C 5KW9L 3ARYA 3KLHC 3NIDF 5F44A 4Z77A 4LEOB 3BKML 3Q6FB 3L3OB 4QLRA 4G43B 1B0WA 2R2EB 4YBQC 3VXPB 4Q0XL 2Y7QB 5DFTA 3ULVL 4OGYL 1HOCA 4GAJL 2VTFA 3RJDA 4DEPB 1TJIH 3C08L 4CADA 3BP6A 1TNNA 2EH8H 1IGML 1MREH 3VXUB 2Q20A 25C8L 1NGPH 2XZZA 4I0PB 5IFAH 5JW3H 1XR9A 5TE6L 1IM3A 4PJFA 3BZFB 1FG2B 2ZCHL 5C0ND 1OTUD 4HHAB 3UO1H 1JGDB 5IJVA 5H94A 1S8DB 2FDBP 1J9CT 3FHAA 4QYOA 5DQDL 3WS3B 4JN1L 1FO0A 5BQ7A 3MRBA 1MLBB 1AXIB 5DUBB 3C5JA 3RNQA 5EIIB 1BBJB 1OLLA 4CMHC 4HIHB 4AT6B 3SE8H 4PP2A 4XP9L 3O6KH 4HJ0D 1KTLB 1RMFH 5CGYD 4ZSOB 4DN4L 1ZA3B 5HY9B 3ARQA 5E2TH 1PVHA 4J3TA 1OGAA 5C7XL 4FZ8L 4JFXA 5TE7H 5I1EL 1PD6A 3GGWB 2ILLA 1TZIA 5D1ZD 1LK3L 5ID0B 3MLSH 3K80A 2X89A 1LO3L 3WD5H 1X4ZA 1H0DB 2D9QB 3HZMB 3F7QA 4RMRA 3DVFA 3EOBA 2B7DT 2D4DA 2ARJA 4DWHA 4NCDA 3I02A 3T8XA 2Y5TB 1CDCA 5EBMB 5F7LB 3G6JB 1PFCA 3BN9C 4OF0A 5F9OL 1XF1A 4MD4A 1H5BA 2P49B 2QHRL 5SWSE 3DGGA 6FABL 3QUZB 3BPCB 5ESAB 1XH3A 3NCFB 2H6PB 2AJYL 4UAOB 3QUMB 4N8CH 1HZHH 1ZT7B 4K7PL 4JY6B 3WFEH 1AY1H 5KSAD 4Y4FD 2BY1A 1ZHBA 1CQYA 3RZCB 2WNGA 4JRXA 1CLCA 5E7FA 3BP4B 2F8XC 4EJ1C 5IK3B 3MROA 1F6LL 4JM2A 5AAWA 3EGSB 3I6LD 4BSJA 5JXEA 1HQ4A 3MV7A 2AXFA 4K7PX 4AK1A 2VQ1B 2ORBH 4K55A 4MD0B 4TNWK 3HTLX 2VAAA 1G6RA 1V3LA 4PY7B 3CVIL 1MFDL 1GVIA 1IBGH 2Q6WA 2I60L 5EZLB 2NY3C 2E7MA 2DQUH 1XR8B 5I8EB 3KDMB 5TDNA 2YBRA 1DVFA 3GNML 3C2AL 3HB3D 2Q1EA 2EICA 3QEUA 1NGWB 1N0XL 2BOCB 4NUGL 5F6IC 1FO0H 2ZPKL 3OJ2C 5D5MA 2BRQA 1GOGA 2EDTA 4Z9KB 2VXUH 3NN8B 2VWEC 3CFJB 3GJFK 1S7XA 2PO6B 5CS7A 3T0EA 5DJZA 4K3GA 3BWAA 3MCLL 2CO7B 1E27B 1T5WA 2ICES 4QHKI 5DS8B 5L0QB 1RZFL 4CMMB 3OR6B 1DANT 5GRJL 4F33A 1RK1A 4ELMF 3VWJC 1A6UH 1NLDL 1T04B 3M17A 1EHLH 3RWIA 3CU1A 4JO4H 1TVHB 4J6RH 3MLTA 4UQ3B 2HMIC 3DLQR 3R1GH 1P4IL 4HWZA 1G7LB 5HDBE 1KJVA 5B8CA 1PG7W 3QNYB 4X80L 1FZOB 5MEQA 4PJHE 2FGZA 4D9RD 1JGLH 4NYLB 3TN0A 1GSMA 1NBYB 4QXGH 2AK1H 4PJ8A 1C5CL 1AGFB 3QDJB 1AE6L 4GUPB 1CK0H 1CFSB 3SJVA 2X1WL 3A6OA 1UJ3B 3CH1B 5BO1L 1UZ8A 2EDWA 3ALWA 1OP3K 5FM4A 1R5VB 1XF3A 2D7TL 2BNUA 4RSVA 2W0FA 4YDIH 4XCNA 5D2NC 1FIEA 5DD5H 4P2QD 2N7BA 3ARXA 2HLFC 2O5YL 3OPZL 3U83A 3L7FB 5K9JH 3VJ6B 1G6RH 4OLYH 1NCAL 3GUTA 2NW2B 3RTQB 3VCLB 4LPVA 1G9NH 4U1JB 5ADPL 1DN2A 3OKKB 2JJWA 1FNSH 5EUOA 5FUZH 4KRPD 4U1KB 3V6OC 1U8MB 1QR1B 4QHMB 3MRFB 1X7QB 1KT2A 2CIKB 3C5SA 4ZAKA 1QD0A 5D9SA 4LLDA 1LE9B 1N8ZB 4PG2A 5H37G 1HHJB 2Z8RA 1K2DB 1MCHA 2GUOA 1FBIH 1VSCA 2OQJA 4DQOH 4TUOB 2FL5A 3MUHL 4YPGB 4HEME 5ICYB 1BQSA 3QYCA 2Y25A 4NNXA 3MJ6A 2OMNA 1AKJA 4RDQG 4PGEA 4EI5A 1JTPA 1KLFA 4YHPB 4LCWD 4MDJA 5DI8B 1F4WL 1FLTX 4HAFA 5BS0A 5FK9A 1EBPA 3SKMA 3TO2A 4ZNCD 4WU7A 3ZMRA 1TQCC 3DJ9A 4OFYD 1XGPB 3D0LB 4MQSB 1Q9WA 4X99B 4LSQH 2A1WH 1QSED 2JJSC 3VFSA 1ZHLA 3HI5H 4NQSA 1OWWA 1A1NB 4OZ4B 5J8OA 4HPOH 3RX8A 2WIIB 4X4YA 1RULL 4V1DB 3NFPA 3BWUC 4D0CA 1M71B 3BEVA 4MJ5B 2JF1A 4X4XB 3MNWA 3PGFL 2FO1A 3PV6B 2O93L 2E27L 1QSZA 5J1AA 1SJEB 3L3HB 1IRAY 1QVOA 4XVTL 1ZLSH 2EZ0D 2B1AL 1BJMA 4IRSD 4OCLC 3DXAA 3QWOB 4JPWL 5CEXA 2DMCA 2ZZUT 4K94L 4HIXH 5EU3A 3JTSB 5T1MA 5IEHB 4Q9RH 4R90H 4YO0A 2A6JB 4DVRL 4OZHF 4XPHL 1YJDC 1BD2A 4WW1B 3KYOA 3GSXA 4G6KL 1C08A 3B9KA 1I7RB 5IMMB 3EO9L 4B5EA 4HS8H 2R2HB 1JF1A 3V5HB 1HHKA 1M1SA 5MENA 5DD0L 3BUYA 5T5FL 4LLUB 1SMAA 4N5ED 1JYXA 4GW4B 5BXFB 4ZO8A 4KJYB 4NWTH 1FYTA 4CW1B 2VLLB 1KEGL 3HPJB 1M7IB 5E99H 3C60A 1I3VA 2BSRB 1WC7A 2APVA 4X6CB 1YMHA 7CGTA 5DFWH 5E7BA 1U93A 2FJFA 2PXYC 5DLMH 1ADQA 3QEGH 4JZOB 4PRBA 2VDQL 4ETQB 1QHPA 4NQVB 1A7QH 1GGTA 2VXQH 3LSOA 3QO1B 4Y2DD 5DRXB 5TE4L 3RPKA 1IFHL 2V5SA 4I48B 5J3HC 1A6VL 1EZVX 3GMLA 5DJDA 4N1HB 3QUKB 1ZK9A 3CXDH 5DMYA 1JPTL 1RIUH 4ZMAT 3U2SB 1HOCB 4YX2L 2PW1A 3I6KA 4FQQA 4Z7WB 1AGCA 3OG4B 4JANA 5FA4B 4IMKC 2ADFH 3EOTL 2R9HC 4D9RE 4ZOAA 3BP6B 3P4NA 1TJGH 5D7JC 4BZ1L 1T1ZB 5HD8C 4ODHH 3REVA 1Z9MA 5I74C 2YD3A 1XR9B 5J4MA 2EYTA 2PYEE 4JVWA 3PWJB 4HCRA 4TRPH 1RVFH 3K8KA 5CJXA 3VDBA 2GTZB 5C70A 2PW2B 5D1QB 3O3EB 4PJ7E 1GRWA 4MHHG 1P7KB 5GS1C 1TIUA 3MRBB 4M3JA 3KNBB 4Q58C 3RNQB 4BQBA 5KANI 3VDAA 4NQDD 4N9GB 1CQKA 4PG9B 2BC4A 4PP2B 3GDBA 2NY4D 3DO3A 1YC8A 5FAAA 4LLWB 5HHOD 4H25B 3IFLL 4LARL 3LQMA 3U9UA 4BQ6A 5C0CB 4PREA 1JK8A 1AGDA 1MCCA 1NDGA 3DHJA 4P23D 1NCCH 4FQHB 1UVQB 3SGKA 3NPSB 3I02B 2EDHA 4KV5F 4PBWD 3VWKC 2A2QT 4F2MA 4LVNB 1DQTA 1WSST 4FFYL 2EIZB 2V17L 1I8KB 3H9HA 5J1SC 2I9TB 4KQ4L 4ZS6C 5LXGH 1QLEH 3HPLA 1YEKH 2MCPH 3OF6A 1ADQH 2AXGA 2AW2A 1FDLH 3I84A 3EOYG 3SPVA 4Z7VE 4KMTL 3MBED 3CSYA 4XHJC 2NY6B 4U3HA 3BSZH 5EUKA 3D5OF 4LCWE 1KCSL 3NMEA 3MROB 4JHAL 4JM2B 3RIFF 4L4TB 3MV7B 5A2LH 2GT9A 3QIUC 1J87A 4XPAH 4LRNH 2DJUA 2GK0A 4MA1C 1IL1A 4N8VA 1J8HD 1S7VA 4LSSH 2I24N 2N56A 3DSNA 2CKBL 3VFVA 3A6BH 4HFWA 3DRQB 1F4HA 1A22B 2CK0H 2J6EL 5E1HB 5DD1L 2Q6WB 3BVNA 4QWWD 3OKNA 1MCOH 1NMCB 3BO8A 4PRPB 1C7TA 1Y18A 1HSAA 3P77B 1A21A 2W0PA 5FDWA 1T0NA 1YECL 5D5MB 5I8OH 3CVHL 5C0BA 3F6LA 1ACYL 3FOMA 4GFTB 3ZYOA 2DLTA 5ADOL 3UYRL 3TVMA 3S88L 3H3PL 3ULVF 4R4BA 4QRSA 5C07A 5LQBH 2YKLL 2XY2A 1YMMB 4ZUWA 4RFEA 3IDYB 1NGZA 4JY5H 2CO6B 1SJVA 4PRNA 2WW8A 5J12B 4XXDB 4I0CC 4HK3J 3VI3E 2JCCB 2Q8BH 4R7NA 3MLTB 5SWZA 3HCVB 5JHLH 5J6HA 1UM4L 4HWZB 5AZEL 3MLRL 1BJ8A 4S1RL 3DURB 2VDOH 3QQ4A 2QSQA 1N5AA 4M3KB 4JRYD 3EO0B 4PJDE 4M1CC 4XWGH 3HR6A 1EHXA 1FFQA 1C12B 4PJ8B 2VLKD 3QNXA 5JHDA 1J5OH 1I4FA 5LGHL 2XQBH 3T0XA 5GRVL 2CJUL 1RZKL 3SJVB 4ZFGL 3RHWK 1TDQA 4X5LA 5BVJB 3TIDA 2NZ9D 5B21A 4G9FD 3DRTA 3KJ6H 1WQVT 3Q48A 5CMAA