1OWXA

Solution structure of the c-terminal rrm of human la (la225-334)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
113
Chain Sequence
HHGSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lupus La protein
publication title Structure of the C-terminal domain of human La protein reveals a novel RNA recognition motif coupled to a helical nuclear retention element
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08777 RRM_3 RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1owxA00
3H2UB 5IQQA 1WEYA 2DGVA 2LCWA 1M1KT 1WHXA 3UE2A 4CQ1A 3TP2A 1ZZFA 2F9DA 3NNHA 2MQMA 1KQSR 1WI8A 4WFAQ 2DO0A 3MDFA 2KXNB 1X4AA 2I38A 3S01A 1Q86T 2FPHX 2LEAA 5DDOC 1FHTA 1VC5A 3VAFA 3BEGB 3VAHA 2U1AA 2CQIA 2OTLS 1A9NB 3VAGA 1FT8A 4OZ0A 1NU4A 2DITA 1U1OA 4CIOA 1SJQA 1OPIA 1XN9A 1WTBA 1K9MT 5CYJA 2Q79A 5BJRA 2KRRA 2KHCA 2KM8C 2G4BA 2KRBA 3LPYA 1U1MA 1JJ4A 3ZZYA 3SXLA 1ZZNA 2M2BA 2MQOA 2EK1A 3BO2A 3VAKA 3LQVA 1UAWA 2QA4S 2DNOA 3ZZZA 1VQ7S 2BZ2A 3ULHA 1S72S 3J7ZT 3P3DA 1Q81T 1VQKS 4CH0S 4CH1A 5LJ3Y 3DXBA 3UD3P 2FY1A 1KOOA 1WHWA 1SXLA 2OSQA 4ZKAA 1G2EA 1F9FA 1FJEB 2KU7A 2PE8A 2L9WA 1NJIT 3BO3A 1VC6A 1YJWS 3CF5Q 1X5OA 2MKIA 2WBRA 2N82B 2MKSA 2CPDA 2ZJRQ 1VQ4S 5CXTA 2XSFA 2DB1A 1FXLA 1JJHA 1QVFR 2DHAA 1FNXH 5D78A 1WWHA 4LIRA 1A7GE 2ERRA 3IRWP 2LEBA 4EGLA 2KG0A 4Y00A 1SJRA 4ED5A 4TU9A 1KD1T 2LA4A 1N54B 3S8SA 3EGZA 2DISA 2DH8A 3D2WA 3VAJA 1U2FA 1HL6A 1WI6A 5IFMA 2MY7A 1M5PC 3CCQS 3CUNA 1X4HA 1L3KA 3R1HA 1BY9A 2HGNA 1VQLS 1DBDA 3CC7S 2MB0B 2AYEA 2DNKA 2MY8A 3VAIA 3VF0B 2JVOA 3THTA 1X4GA 5CA5A 2KI2A 2HZCA 2DHGA 2HGMA 2NLWA 1RK8A 2G1DA 5DM6Q 3NNCA 1DRZA 1K73T 2K8GA 2KXHA 4A8XA 2OJ3A 3RW6A 1WG4A 4W90B 2X1AA 2J0SD 1WF2A 3N9UC 2RU3A 3CCSS 1H6KX 3CMAS 2PEHA 3Q2TC 3CPWR 1WF1A 1KOHA 2LQ5A 2GHPA 2YH0A 2LYVA 5IM0A 5MLCV 2MKKA 2XS5A 2CPZA 2DNGA 1YJNS 3FEXB 4BS2A 3CCMS 2DGQA 1VBYA 2B0GA 1X4FA 2MZTA 2CPJA 2RS2A 3G6ES 5LSOA 1WEXA 2KT5A 2SXLA 2DNHA 1HD1A 3CMES 2MZSA 2RT3A 3I55S 1W2BR 1YI2S 2M9KA 3HI9A 4Z2XA 1SJ3P 2DIVA 2DHSA 2LA6A 4C0OC 2DHXA 4WCEQ 3US5A 2MQLA 1QVGR 1H2TZ 3MXHP 1R8PA 1DZ5A 4OZ1A 5DDPC 4YUDA 4F26A 3FEYB 5JVGQ 3B4MA 5FJ4A 1OWXA 2VODA 1X5SA 2CQBA 2RRBA 3R27A 2MHNA 2DNNA 3P49B 2VOPA 2CQ2A 5IM0B 2LKZA 3NNAA 3NS6A 5GAGU 4UY8T 1VQOS 3CCJS 2M52A 2MQPA 3SDEB 2KG1A 5LXYA 2DNPA 4PRFA 2DGTA 3UD4P 3MOJB 3UCUP 1Q82T 1U6FA 2DNRA 2MPUA 3VALA 2LECA 1M90T 1VQ5S 1O0PA 2KM8B 2OSRA 3CD6S 1ZH5A 2DGWA 1M5KC 2X1GA 2DGXA 2GO9A 3SMZA 3DLLQ 2F3JA 1URNA 1D9AA 1JMTA 3UCGA 5JVHQ 2DGSA 5DDRC 3PIOQ 2XNRA 3U1LA 1VQ6S 1WHYA 1M5VC 2CQHA 1AUDA 2YH1A 1H2UX 5ITHA 4TU8A 1U1PA 1N52B 1B7FA 1SJFA 1K8AT 2J76E 2DNZA 3MD1A 3S7RA 3V4MA 1YTYA 3CCVS 2KH9A 4WIIA 2DO4A 3MUMP 2DNQA 4RU2A 3TYTA 2JVRA 4LJMA 2RRAA 1DHMA 4IUFA 1WG1A 1VC0A 4M5DB 1YHQS 3B4DA 1NO8A 1X5PA 2AYBA 2M88A 2DNMA 3CC4S 2K3KA 3NMRA 1HA1A 2MKJA 2AD9A 5GADU 3HHNB 2E5IA 2M4MA 1U1KA 1IQTA 2D9OA 1U1RA 2E5JA 3I56S 2KYXA 1PO6A 3RW7A 3G9CA 2CPXA 3BS9A 2OIHA 1UW4A 3IWNC 2LXUA 2ZJQQ 4WFBQ 1VBZA 4YOEA 2U2FA 2CPFA 1N88A 2CQ1A 2RVJA 3UCZP 2RQCA 4QU7A 2MKCA 2FC8A 2MSSA 1P27B 4PKDB 4QPTA 2MGZB 3CULA 1YWXA 1SJ4P 3MUVP 3SDEA 4QQBA 2J8AA 3BO4A 2VONA 1PGZA 2CJKA 2YTCA 3P6YC 1D8ZA 5GAHU 2CQDA 2I2YA 2CPYA 5HO4A 1X5TA 3R1LA 5EN1A 3G8TA 1OO0B 1X4CA 2DH7A 2MZJA 4WKRA 3H2VE 4PR6A 2MKHA 5DM7Q 1VQMS 4WFNQ 5D77A 2CQ0A 4TLQA 2DGUA 4J5OA 3CXCR 2E5HA 1RKJA 1U1LA 2ADCA 1X4DA 1Q7YT 4C7QA 2X1BA 2AYGA 2J0QD 2XS7A 3G8SA 2ZJPQ 2YWKA 3MUTP 3MI7X 2HGLA 2D3OR 1X0FA 3P5TL 2QEXS 5DDQC 3G96A 2XS2A 4TU7A 4LMZA 2M70A 2MQNA 3EGNA 3NS5A 2MZQA 3U1MA 2LXIA 1VBXA 2M8HA 1QM9A 2XNQA 1VQ8S 2G0CA 3CTRA 4Y0FA 1R8HA 3G71S 2AYMA 4FXWA 1UP1A 2KFYA 4ERDA 2DGOA 1UFWA 1M5OC 2N7CA 2HYIB 5GAEU 1VQNS 5DETA 1P1TA 1WELA 2M0GB 3J7YU 2MZRA 1S79A 2LMIA 2UP1A 2MQQA 4UQTA 3UWTA 4IO9Q 2KXFA 2RS8A 3CC2S 3Q2SC 1HD0A 1X4EA 3L3CA 2ADBA 2MYFA 2D9PA 1YJ9S 3G4SS 1FO1A 4WF9Q 2RNEA 2MGZA 3CCLS 4IOAQ 5LJ5Y 1FJCA 2N3LA 1FJ7A 2E5GA 3CCRS 2EK6A 3VAMA 3EX7B 1VQ9S 4C4WA 4F02A 1X4BA 2MXYA 2V94A 2KN4A 1N8RT 5HL7Q 3JB9k 2JWNA 2MSTA 5GMKa 4V19X 2M7SA 2NZ4A 2CPEA 2OTJS 3TO8A 2YKAA 1YITS 4W92B 4YB1P 1U1NA 2A3JA 1OIAA 1WEZA 3OW2R 2JX2A 1WF0A 2BOPA 2HVZA 2FHOB 2FC9A 3PIPQ 2N3OA 1YIJS 3CCUS 2CPHA 5LXRA 2DIUA 2CQGA 2DNYA 1JJ2R 2X1FA 2RUGA 2XB2D 2O3DA 2JRSA 1WHVA 2CPIA 2DH9A 2F9JA 3MURP 1VQPS 1U6BA 2MZ1A 2VOOA 1WG5A 2DNLA 2M8DB 4P6QA 2E44A 3S6EA 2L08A 4F25A 2EVZA 3THPA 3CCES 2KVIA 4FXVA 5GVQA 2RQ4A 4IOCQ 1U1QA 5LSLA 2DK2A 5H1SV 2MMYA 4QU6A 2MJUA 1KC8T 3MD3A 4U67Q 1H2VZ 2CQ4A 2QFJA 2MJNA 3K0JA 2CQPA 2L41A 1CVJA 2CQ3A 2CQCA
chains in the Genus database with same CATH superfamily
1N5VA 2HKEA 2NXCA 4DV7F 2GJ2A 5F8LA 3V81A 2FPHX 1T9XA 4ENOA 4X2BA 2E1CA 1PBAA 5LOQA 1MROA 2Y1IA 3LA0A 3E01B 2YQ0A 5DGBA 3PRDA 1K9MT 2YNFA 2W2PP 2CJ9A 1ZZNA 4LQ3A 2H54B 2DNOA 2G2OA 1YBUA 1BQNA 4FN5A 2Z58B 2BBEA 3OHAA 3F0NA 4CH0S 4DL4A 5I4MA 2BYCA 5CD4H 4NLSA 4ZP7A 1FJEB 5DG8A 2NUUG 4RPFA 1BWVA 3CJ5A 1TKZA 1QVFR 2FVSA 2QTWA 1WWHA 4LIRA 1TK0A 1NK8A 2YKOA 1IKWA 1PC4A 2G9OA 5H9EK 2H5JB 4YFUA 2XMTA 4HACA 4NLUA 4F4YA 2J6SA 1N6QA 3THTA 2Z2LA 1S1TB 3OQ2A 4MYUA 2HGMA 1YKWA 3NNCA 4HDGA 4LQ9A 2X1AA 2WTFA 2QRRA 3N9UC 2K7KA 1CJVA 5IM0A 5T7LB 2MKKA 3QAUA 1QSSA 2DNGA 1K1QA 2XLIA 4MKVA 5H9EJ 4OV6A 2B0GA 3DHXA 4WU2A 1EKRA 2SXLA 3BB5A 2XZTB 3GB0A 3MM9B 4DFPA 1SJ1A 3KLFA 2LA6A 2IDLA 3ZC4A 1RE1B 4KV8B 4ZHRB 2PA3A 2ILZA 3GFHA 4YUDA 3PW2A 2DR6A 1SQGA 2O1PA 4A4JA 4RNHA 1S59A 2R9LA 3NRBA 1PJ6A 5F0WA 1BMQB 2HIYA 2YWEA 3LH2S 3J80U 1CJUA 3UCUP 2MPUA 4ZK7M 2IM1A 4O0IA 4I6WA 1K47A 3H7HB 1ITPA 2GO9A 4F4KA 5J1EB 2XMKA 1RQ0A 1RT5A 3H40A 1U25A 3W3SA 2CFXA 1TQLA 2YH1A 1JXLA 2MTLA 2AZ1A 3PX0A 4MFBA 1G1XA 3L95X 3HSGA 3AJ2A 2JVRA 4LJMA 5J1PA 5J1NA 4K2XA 4IR9A 1HA1A 3HHNB 1SL2A 4DCPB 4NL5A 4BC9A 1IQTA 1N5QA 2CG4A 4Q45A 3R2DJ 2XG8A 2YQ1A 2CIMA 1UW4A 4FVCA 4ALZA 5EWEA 3CJRA 2G0JA 3NBPA 3SDEA 3O8WA 1SKUB 3C15B 1ZA1B 3TEGA 2VIHA 3N5FA 1D0EA 2CQDA 2I2YA 2VG6B 1SV5A 1X4CA 2C28A 1G6BA 2RB7A 3RB6A 2PC6A 4DUYF 3DFEA 3BGRA 1WKKA 4U7UD 4ECZA 2BR0A 1WC5A 4O0NA 3MUTP 2L9NA 3Q24A 2D3OR 4NCAA 4LMZA 1HNZF 4LUBA 2MZQA 1NMEB 1VBXA 1FF2A 2EKNA 1RP5A 4PUOA 4IH5A 4B9MA 1TL3B 5G0RB 4MAKA 4CLUA 4M5GA 2V4QA 2V8PA 2ALYB 1P1TA 4P71A 1VRUB 1HNIB 1RT6A 3MEEA 1F5BA 1TUGB 2F8HA 2ADBA 1FKOA 3LP1A 3GV7B 2MGZA 2VQEJ 5LJ5Y 1WC1A 3TNVA 2XWYA 2ZHOA 4NXMJ 1KVJA 4O3SA 4A46A 4Q2LA 2KN4A 2FQQB 4DJBA 4QR1A 1OIAA 1YBAA 2YNFB 5E41A 3IR5B 3N5BA 1UEUA 4JI1F 2KJWA 4NYPA 3FFIA 7FDRA 1F1BB 2BX6A 2HWHA 2XB2D 4MKBA 4JI8J 1WHVA 4J37A 1PG5B 5F8GA 1BQNB 2DNLA 2R8JA 3RAMA 4OI3A 2YVSA 2FVPA 1NSQA 3QJJA 2QV6A 3FK4A 2YWGA 3KNAA 3DYAA 3FQKA 4DV0F 3OTCA 2HQGA 4U67Q 5DQIA 8RUCA 4LRFA 4WKYA 1IKWB 2CQCA 2BANA 1FDDA 4OI6A 5IQQA 4ANEA 4BWJA 5IQ6A 4NLTA 1A0OB 2F9DA 3NNHA 1T3NA 3CJ0A 5AXNA 4HACB 2UVVA 3G8QA 1N6QB 1FHTA 2PSZA 3Q8PB 4K5SA 3CGIA 1UL3A 1SJQA 1FFWB 1S57A 5D4LA 5K8MA 3DN9A 2VH7A 3TW0A 1T94A 1WSVA 3BPDA 4N76A 4DV6J 3SXLA 3J7AN 4ZPVR 1QAJA 3T5LA 2QA4S 3ZNUA 3N6NA 4LFCF 4LF9F 3GSDA 5EUHA 3KLFB 4HLBA 1G2EA 1NJIT 4Y28C 1X5OA 4WZMA 2D1CA 5AXKA 5IV4A 1VQ4S 3GIMA 4I4BA 2IA0A 1MU2A 5K14B 3GU0A 1A7GE 3LAKA 3AD8C 3S8SA 3VAJA 3D2WA 2DY1A 1WI6A 1Y4ZB 1RJJA 4G1IA 4I67A 1XNRF 4TN2A 2DEIA 1P8GA 2MB0B 5KT7A 4NLXA 1X4GA 2NLWA 1RK8A 1CC7A 3WZ0A 1FK9B 2HFUA 2ZH2A 3N0VA 5CH7B 4ZPWR 4ZLJA 3RB4A 3HVAA 2N4CA 3G6ES 3PKMA 4MFBB 4ZJLA 1Q16B 1IR2A 3RJMB 2QLXA 4O4GA 2R2TA 4L3KA 2HBYB 3HHLA 2BVZA 3UN3A 1U48A 4DCOB 2CJQA 2HBRB 4X65J 2WBMA 1B0TA 1K0TA 2WZ1A 4LRBA 3M32A 3SDEB 4NLYA 1Q82T 1U6FA 2GCFA 4GVBA 1V3SA 2FZGB 3M8RA 4LFAJ 2DGXA 2IY5B 4B9NA 4HVZA 2AT1B 2QJ3A 3U1LA 2B51A 3BSNA 4C98A 4IRKA 1CJTA 1MN9A 1YVFA 4FS1A 1DQAA 1H2UX 5DQHA 2AQ4A 1TUVA 1QD1A 3QIPA 1NPKA 3CCVS 2Z30B 2F63A 1SB6A 4ZJOA 2YWHA 2RRAA 4PUOB 4CNYA 3B4DA 3PW7A 2M88A 2K3KA 4DX8H 1JJCB 3QO9A 1RT6B 3Q8SB 3TJ9A 3RRHA 2HLTA 3B6BA 1HIYA 2ROPA 5KG6A 1UPPA 1IQZA 1WC3A 4NXNJ 1PYTA 4ZCKA 2L9DA 2CNKB 1FKOB 2V4JA 2OPQA 2MGZB 2BE2A 4CLSA 1IKVA 1XWLA 2Y8YA 3CIZA 2EBEA 4ZP9A 1RYRA 1F5AA 1J27A 1S6QA 1OO0B 3QRQA 4C2MA 2KFZA 2HQ3A 5M2RA 1VJWA 1FEEA 3IG1A 4DS5A 3IWXA 5LMUF 2HWIA 3CDEA 3WHIA 2X1BA 3W63A 3M4XA 4DPUA 2IRUA 1FTRA 4P7TA 3P5TL 4I56A 3EGNA 2KZMA 4C8ZA 3BN4A 4DN0A 3G82B 1NEEA 3D3CJ 2E1PA 1EB0A 2NCKL 3DYAB 5GAEU 2DXEA 1WSRA 2MZRA 3EVMA 2LMIA 4BBYA 3JSMA 4WYLA 1X4EA 3GIKA 2QIFA 2FLNA 1FO1A 1A6LA 4DQSA 1WC6A 4JYAJ 3LTOA 3TA1A 2UXCF 1L3UA 1RBOB 4RW8A 1XMQF 3QMQA 1TR0A 5CCMA 3D6HB 3KKFA 4DR5F 1RHKB 4DSFA 4RUAA 4OZ2A 3OL7A 1D09B 5EGYA 4KJIA 5L1JA 1R8BA 2Q1LA 3M2UA 5E3PA 4XPCA 1JJ2R 2UUCJ 2AP6A 4OHWA 4QIGA 5HVFA 3Q0AA 2PO4A 1JXVA 1M1GA 3OV7A 1OY8A 1R0AA 2OO4A 4UT4A 3DU5A 1MU2B 2JJ4D 2AGQA 1NJXA 2JFKA 2RRNA 3EM1A 4TYBA 3H2UB 2LCWA 1I1GA 1S7IA 2HWTA 2KO1A 3KNGA 4KKOA 4RU9A 3OFFA 1WI8A 1KVKA 5B0EA 2GFFA 2YNIB 1BGXT 4BWMA 1Q8BA 6AT1B 2W9BA 2U1AA 3A8KA 3GYXB 1BD6A 5BJRA 5DZ6A 1TKTA 3DRYA 4RW4A 4K4ZA 4DU7A 4EI2A 5E3CA 1XNQJ 3SCJE 4DZDA 3OL8A 2YPZA 2IPOB 1CSJA 1WOPA 5U47A 1VQ7S 3M2RA 1S72S 1SH3A 1WHWA 4ZKAA 2UUBJ 3C6UA 1I5OB 1S97A 2DD8S 3HHLB 4DV1J 3IBFB 1BLUA 2Z2ZA 3IRWP 5JUMA 2RH3A 4DL2A 5F8NA 3OVBA 5ETKA 3ISZA 5IFMA 1BE4A 2V8VA 3M32B 1VQLS 2Y9HA 3D5MA 3MM7B 4ZCLA 4GVBB 1B7YB 1N5YA 5E3AA 1UVIA 1Q7LB 2LVWA 3FSXA 3SQGA 1CJTB 2LQ5A 4DR6F 4NLVA 1FESA 4YB7A 4CNZA 3BSOA 3P4UB 3CMES 2CG8A 3MAHA 4ED8A 1W2BR 5AE1A 1JLEA 3HZEA 1U0HA 2BKOA 4P2FA 4MIAA 2RSQA 2MQLA 4EZ6A 4CM0A 3LGHA 1FE4A 1GMUA 3HHEA 2EG1A 2Q43A 1HWKA 2B9YA 4KQZA 2IMOA 3EMTA 4NCBA 3GJSB 5IZHA 2V4JB 4NZ6A 3H4BA 1LWCA 1IKVB 2VPXB 4XIUA 4NCGA 4C0HA 2GVDA 2IJNA 3GV5B 1S6QB 2DRDA 3HM9A 3DOLB 1BUXA 3G2XA 2PI4A 3BKUA 3IG1B 3PIOQ 2UVWA 5K20B 3QT6A 3CW2C 5J2PA 2WB4A 4TU8A 2FY8A 3TA0A 1K8AT 2IHR1 3CJTA 4WIIA 2DO4A 4WYWA 3TVKA 1WG1A 1RTIA 1VC0A 2RJZA 4LSLA 3VV2B 3JSMB 4F4XA 1Z4UA 4Y3CA 2W4DA 2OIHA 2B9EA 1VBZA 1RWNB 4DR2J 3NOGA 1UA1A 2V50A 2LDYA 4RNMA 3K5MA 4NLGA 4RW8B 3LOUA 3ZTQA 1B0PA 3LUYA 3IR6B 3M30A 5I3UB 2C2OB 1T05B 4HYKA 3MM5A 4O3PA 4OYAA 3V5RA 3KTQA 4JI6J 7FD1A 4NZ0A 4X64J 2UU9F 4DQRA 3KK3B 3DLGA 3NGRA 4DL0C 4FXWA 1I51B 1UMJA 1R0AB 3BGFA 4CDIA 1TKXA 1VQNS 4U96A 3MZIA 1NK4A 1LW2A 1FRXA 4QIVA 3BQ1A 2ASYA 3L3CA 1RWKB 1YJ9S 3WC0A 1NB2A 2KHDA 1S4EA 4KKOB 1FJCA 3IN5A 1RAAB 3CCRS 1NDPA 2AX0A 4F2RA 2HQFA 1HNXJ 1WACA 4LBHA 5HN0A 3EZUA 2W9BB 2CPEA 3MTKA 2BJ8A 3LANA 5KFMA 1GK8A 5AXLA 4B3SJ 5I42A 2BOPA 4C8OA 1TKTB 2FC9A 4RW4B 4EBDA 1MMNA 2JZ5A 3SSRA 3CCZA 3I0SA 2HHPA 4PYDA 2B4OA 1LXNA 1HNWJ 5HQMA 4EUVA 1ZTTA 3FEZA 1RWWB 3M2RB 1MN7A 3LWMA 1IUJA 3IMQJ 4P6QA 3KJFB 3D0HE 2EG2A 5CQGA 1XMOF 1VRTA 4MT1A 1G4CA 3C6UB 5H1SV 2W2NP 1YRTA 2CZ4A 3H42A 2FJEB 3VGUA 2HVIA 2BW7A 1DAXA 4UZBA 2ZH1A 5L8RC 2BJDA 4P52A 5EWGA 7AT1B 1KQSR 1HKAA 4PCQA 5IT4A 4CO0A 3MR6A 1UFLA 2ZUAA 2VBWA 2ACMA 3TJ8A 4ZMMA 1N5YB 1H73A 1NJZA 1YJUA 3A8IA 1U1OA 2EFVA 4QCLA 2J5AA 3SQGB 2NPIA 5CZXA 3M6VA 1U8SA 4F67A 4JI7J 3C6TB 3LQVA 2R7TA 2CAJA 3I5AA 2EC0A 3B82A 3DXBA 1JLEB 8AT1B 2OSQA 3KLGA 1EQ0A 2ZNYA 3D6MB 4L76A 2MKIA 3G6YA 3KHHA 1UJ5A 3GR1A 5FD1A 4B3RF 3OT9A 1RWOB 4K4SA 3VGVA 2A2CA 1FXDA 5FIIA 2DHAA 3PV8A 3W65A 4J91A 3DCAA 1S0OA 1Q53A 2FJAB 2O66A 1LWCB 1M1HA 2OPRA 4RKUC 1HBUB 2R2RA 4NCGB 5A8WB 3LP2B 4NE9C 3Q8RB 1GAOA 2JVOA 4DV4F 4QYZK 1FRLA 2V8DA 3W9IA 1PKUA 3DRPB 4EO6A 2NXUA 4B3TJ 3NMAA 2RU3A 2XLKA 3CCSS 3CMAS 1Q95G 4TVAB 1Z2ZA 2RE1A 2W01A 2O5DA 2GQQA 4OYXA 4AD6A 4B9UA 2JC1A 1IXKA 1B3TA 3DOMA 4WP3A 4OJ1A 1XEZA 5GADI 4D3HA 2DHSA 1RTIB 3US5A 5HJYA 4LSLB 4F0HA 1C4CA 2JC0A 3L09A 4LF6F 1R8PA 1DZ5A 4ES3A 1U26A 1TFWA 4PQAA 1X5SA 4F04B 3A3NB 4X4RA 1FWPA 3DGVA 2DNNA 3W2WA 3HF5A 1E6YB 2I5JA 4U8VA 4YB5A 1HBMB 2M52A 4E2FB 1N4LA 2MQPA 3OSPA 3LGNA 5HK4A 2Z4PA 1DARA 2WSCC 2HVDA 4FXDA 3RBDA 3PCOB 3UDCA 1M5KC 2IA6A 2C3YA 2KB2A 5D0RA 4LF1A 2EFGA 2DGSA 2QLWA 4ZCIA 3M1VA 3FCHA 3M30B 4FF3A 4YDXA 5ITHA 3MM5B 5IS2A 1U1PA 3V6HA 4F50A 3T6JA 1KDNA 4YHHF 2WONA 2UVRA 1SH2A 1HNVA 3DLGB 4XTTA 1B70B 1VLYA 1YHQS 2XWXA 2MEWA 3T1HF 3HCXA 2M3DA 1TKXB 1EIYB 2OKQA 4AQYF 1L3VA 2QT7A 3BS9A 4N41A 4DSJA 2U2FA 2FC8A 1F3VA 1LV5A 3DRSA 1RU1A 4PXBA 3T5JA 1UZDA 2VONA 1UVKA 1GQEA 4JUZA 2UUTA 2R7UA 4L3NA 1RCOB 4CRJA 2ZHAA 1N0UA 2BJEA 4LF2A 4PWWA 1UVNA 4WKRA 3CDBA 2FHJD 4UOFA 4CLPA 2KTQA 1T02A 5I42B 3TZXA 2C2EA 3IAM9 3AOBA 3I0SB 3CO0P 3D1OA 2AYGA 2VPZB 3G8SA 2ZJPQ 3Q23A 3PX6A 4DS4A 1IR0A 2QEXS 2GIRA 4ZP6A 1UVLA 1HBNA 4PEOA 2RIJA 2QA1A 2C2NA 1RACB 3J7YU 3DLHA 4ZP8A 4DI6A 3CC2S 4TLRA 3FZBA 4U7CA 4TY8B 4C3LA 3PVXA 2E5GA 3AHPA 4Q8EA 2RDIA 2HLUA 4P73A 1RT4A 1YG0A 4O44B 2V94A 1FVSA 2XGQA 4KY3A 5DLFA 2ZZNA 4W92B 3CDUA 2B5JA 1U1NA 2JX2A 2FHOB 5ETTA 1N32F 4P72A 4I2PA 2UXBF 4OYBA 1KWMA 1WG5A 3D7SB 1RDRA 4X84A 4ECUA 5A8RA 2RQ4A 4ZLLA 5LSLA 4J9NA 1UJ4A 2E9ZA 3TANA 1C1BB 3QSIA 3H90A 5F8MA 2MMYA 2BE9B 1N33J 1KC8T 2Z8QA 5L38A 3MD3A 3TAQA 1H2VZ 4A47A 2ZKTA 2K7JA 2ZOFA 3K0JA 1PYOB 3TVYA 2GGPB 4USUA 2FYXA 2DGVA 4NLDA 3UPFA 1C1CB 4AE5A 3S01A 2H4WB 5ETVA 1KEKA 4HHHA 1VC5A 1QAYA 3M05A 4KGVB 2WCXA 1RWMB 3ZZOA 2BQRA 3D1HA 3JYTA 2AX1A 2VDIA 3DOKA 1YJVA 5KT5A 2G4BA 4ZS6A 3FMWA 2CDRB 3H98A 2F40A 3ZZZA 3DOMB 5E2QA 1Q81T 3JAMY 3UD3P 3IP0A 5T14A 2OFHX 3N6LA 3J81U 4IH7A 4LSZB 4LBIA 1VC6A 1P6TA 1UFKA 3HMJG 1AFIA 3AFGA 2K3IA 5GAGI 4P10A 2YBVA 3FSYA 1RAGB 3FBBA 3KJVA 4FF4A 4MIWA 3FC9A 3IFEA 3W2WB 3GG1A 1ZM2A 3EGZA 3A1YG 2I5JB 1ZBTA 5RUBA 1HNZJ 2AYEA 2VBZA 4NA2A 4UZCA 3R7NB 2NXEA 3R8YA 1SI9A 4HEA9 3C66A 2J9DA 4URGA 1K73T 4LF8J 4JI0F 4DFJA 1WF2A 2YX1A 3H5XA 1HMVB 2ZITA 1DTQA 2YH0A 1KKHA 3M1VB 5B09A 4LF5J 4C6AA 5IXUA 5HQLA 4NA1A 4OHZA 3HXMA 2HHUA 3IRXA 2YNGA 3A3PB 1FRIA 4X4UA 2H5IB 2J0XA 3CCWA 1T9YA 3HI9A 2VDHA 1TP7A 1HNVB 1NSPA 2YQ3A 4YMEA 3FUYA 5DRKA 1HW8A 1RAEB 5KFRA 3MMAA 2IM3A 4F26A 2NZCA 1OWXA 2GAGC 4B3MJ 1U2CA 1S48A 3BSCA 3UR3C 1HPZA 4FZVA 4OI4A 2WSEC 4F3OA 1VCTA 3DRSB 1RAJA 2GVZA 2KG1A 4F4ZA 2DNPA 4FVMA 1WUUA 3CO9A 2LECA 3K17A 1YJRA 4DF4A 3SFGA 3DLLQ 1RT7A 1D9AA 1O5JA 5AXMA 3ENAA 5BR8F 3D9BA 3R7BB 4WU3A 2RU9A 4JV2A 2P6SA 1D9FA 3UDLA 3RUBL 5K5MA 3F56A 3ENQA 3A3OB 1LWFB 3PKYA 2E1AA 3TYTA 3BYPA 3TWZA 4P2SA 3O44A 2W2OP 2HQCA 1GX6A 1U1KA 1AA1B 3ZTRA 5J2QB 2CNLB 2CPXA 2BQUA 2VBYA 4GKJF 5CAAA 4JI2J 3KDNA 2RVJA 3UDEA 4ECRA 2MSSA 3H25A 4ILRA 1P1LA 2HS3A 4LFCJ 3KLIA 1RT4B 4LF9J 5HMYA 4DWIA 3H8YA 2MKHA 1PBUA 2RF2A 2B5JB 1FDBA 1G7CB 1U1LA 1W7WA 1YX2A 5KFUA 1ROFA 1RYSA 2CJYB 3JQKA 2CWKA 4I2PB 5DDQC 1MMLA 4L72B 3K89A 2XM3A 2YXLA 2XNQA 2F8EX 1R8AA 2E9TA 4DR3J 4UOGA 5A8RB 3GONA 2AYMA 2ZBRA 2VHGA 1UWBA 4ED3A 2GMLA 2NPFA 3RBZA 3PXGa 1Y00A 2V2QA 1HWIA 4G1QA 4F7VA 3JTNA 1VGYA 2MYFA 1LEOA 4L6V3 3LPEA 4HI2A 3HKWA 9RUBA 4W4MA 3FBCA 4FKYA 3V6KA 2KVQE 2XYHB 3DLEA 3VAMA 4RUCA 4C4WA 1IBCB 4OX7A 3PRBA 4X4NA 4OX9F 1S1VA 4OIXA 2XZDB 3SCIE 3OXFA 1O8BA 2E9RX 3R5JB 2JEFA 3KLHA 1YIJS 4ECSA 1RBLA 4RZRA 3W66A 3FGVA 2ZOGA 2RUGA 5DS7A 4ECTA 1FI4A 2BRLA 4AUKA 1RAFB 3M8QA 2XO6A 4J9PA 4CCHA 1U1QA 1EARA 4LFBF 1U24A 3TQEA 3K8VA 5IV3A 1C0UB 2L41A 1ZAVA 2YKQA 2QYCA 1I6JA 3T1YF 1LXJA 1V9OA 1LNQA 3CDWA 4HT5A 4KHPJ 2AKWB 2I38A 4WE1A 3QZ7A 4K4WA 1GH8A 3ET6A 4LBPA 3QIDA 1RZMA 1A9NB 1RTHA 5K8OA 3NP5A 1PILA 4NLOA 2KM8C 3PR4A 4QYRA 1DTQB 3R5AA 2M2BA 4U8YA 3IRXB 2YNGB 3K5NA 2BZ2A 4C11B 4OYWA 3R5CA 4MH8A 1FCAA 4YP3A 2W2MP 4F4AA 5KFSA 2ZVSA 2BKPA 4ZPDA 3ZTSA 1CQMA 4EWTA 3GFXA 1SBRA 2BM0A 2KG0A 3N6MA 1HPZB 3MWBA 1N54B 4OFZA 4OI1A 2GVZB 2POKA 3R1HA 1QAIA 2BDPA 2ZC4A 2FGCA 2I1RA 2HZCA 3AD7C 1M5HA 2W8LA 1H3DA 2UV8G 2AU0A 1EP4A 2C42A 1RT7B 4ZVGA 2HIQA 4MKYA 2KT2A 3TR5A 3D28A 1YSJA 2PA8D 1J5EF 2VPYB 2DGQA 1VBYA 2RS2A 2YWFA 4ETZA 3T5HA 2QL9B 2F4FA 2OEMA 2RMLA 3I82A 4Z2XA 2QSWA 2HEKA 1D8YA 4O3NA 3N4WA 1YJ7A 3AH6A 2GMHA 4LF4J 5K8PA 3N28A 2ATCB 1LWEA 1R6YA 5GAHI 2HMIA 2FLPA 4HR2A 3OVAA 3GYGA 4N7TA 2VQFJ 1JNZB 2E5LJ 3KK2A 2LQBA 2W9CA 5A8KB 5HROA 2BQ3A 5JVHQ 1FEHA 1BQXA 4DV2J 2Q6BA 1B7FA 3DDNA 2E66A 1TTHB 4LVNP 4DEZA 3T6BA 1REVA 2R4FA 5F8HA 4HT7A 5C42B 3G9CA 4G1QB 3R6LB 4B08A 2ZNZA 3I5CA 4KPYA 2LXUA 4MYTA 5B7WA 4BHQA 4YOEA 1U49A 4ER8A 1JLCA 3Q8YA 1SIZA 3G6VA 5C5JA 3DLEB 4PPDA 1PGZA 1D8ZA 2Y1LB 4X4OA 4BCAA 4L73A 1QTNB 3CD0A 1JLBA 4YS2A 2ABYA 4ZVQB 2A6MA 1S76D 4J90A 1KRPA 3ZTPA 2BJ3A 2QC3A 1IM4A 2EFQA 3EZ5A 3FNNA 2KYZA 2AF6A 2IAJB 4H4KA 5F3TA 2IC3A 3M8QB 4R8UB 1PYSB 1R8HA 1UP1A 4I1TA 5DETA 2V67A 2HNYA 3IGNA 2C2RA 2DR8A 2KXFA 2OPPA 4FDFA 4TXSA 4GC7A 2QA4G 4DR7J 2RNEA 2VKZG 3KG0A 4Q7AA 2GW8A 1CS4B 4WE1B 1NK0A 3ET6B 3TO8A 4DMZA 4P74A 1YITS 1D3WA 5AE2A 3MMBA 4M5KA 4CLTA 1WF0A 3PIPQ 3CCUS 2HFNA 2V69A 5D4PA 1MSWD 2P6TA 2GS8A 1ICEB 5DO2A 3TQ1A 2GIFA 2XBPA 4CLLA 3NGKA 3C2PA 4WZQA 1PC5A 1IR1A 1RHJB 2A1BA 4YR3A 2F8MA 5D15A 3EGWB 3OLBA 2B56A 1SUQA 4OL8A 4DL7A 4OYMA 4ZLNA 3PFEA 3IXQA 2W1BA 5KG2A 5DGAA 4PPZA 2PFDA 1K1SA 1ZOTA 3UI3A 2CQIA 1FT8A 2HPUA 3NS7B 5CYJA 3Q89A 2A10A 4QIFA 3ZZYA 3SCKE 2E7WA 4USIA 1SQEA 1NHKL 1S1WB 4XDCA 2MKYA 3J7ZT 3M9MB 1AZSA 1IN0A 1S1TA 3OR1A 5DQGA 3CCTA 1RHMB 4UUXA 1AFJA 2PE8A 3KK1A 2B9XA 2N82B 1R3NA 2NXJA 5HQ8A 2DB1A 1DY3A 1FXLA 3OTEA 1EQMA 5KFXA 1S0NA 1HWLA 1X31C 1ZM4A 2HMIB 2AV5A 2Z2YB 2MY7A 2OP5A 1EJ7L 3F44A 4U9RA 2DNKA 4PWDA 3KK2B 2D69A 2UU9J 4KV8A 2DHGA 4ZHRA 3HSJA 4J9OA 4OZ3A 1CLFA 2W9CB 1FE0A 4W90B 1NK9A 3QWUA 1DURA 5KG0A 5F9LA 2LYVA 4OYOA 1YDLA 2ZM6J 1NRKA 4DPYA 4JV5F 1UZHA 4R5PA 4W98A 4J9RA 3W1YC 5THWA 1KN6A 1RBAA 2ZDPA 3MEGB 5HAOA 4ZIWA 4MJKA 4KAIA 2CKWA 4IH6A 1REVB 2VC1A 2AGPA 2HBZB 5B0FA 1R0BG 3OR2A 3SZ2A 4CO5A 3QRRA 4WJBA 3FEYB 3V4IA 1UPMB 4RUHA 1RT3A 2E7XA 2WAQD 2DT9A 1JLCB 3HO1A 4UY8T 3N01A 3BSAA 3W8GA 5LXYA 5ETLA 3MOJB 2B8QA 4K0KJ 3WX4A 4ED0A 3D4JA 2R7XA 1XMOJ 3TJAA 3JQMA 3AJDA 2LQ9A 4YEAA 1VQ6S 1M5VC 4DHVA 3K57A 5A6PA 4YR2A 3C15A 1AB8A 3ZZRA 5C2CA 3W62A 1F5CA 2KH9A 1NJWA 2VG6A 1RB0A 2XCAA 1Q8IA 3HULA 5KFNA 3A12A 1R6VA 2DYAA 2MKJA 2M4MA 1YZ6A 2D3O1 3UN5A 2HNYB 2KYXA 1PO6A 3K5LA 3R5BA 2OPPB 3QLHA 3PYEA 1CBKA 3MAAA 1H74A 1VQYA 4ECVA 1JKHA 3I4PA 2XY7A 2V2VA 4NXMF 3BO4A 1TL3A 5G0RA 2HHVA 1OY9A 3HP6A 1T7PA 1VRUA 2MZJA 1HNIA 5C25B 4EMDA 2PT0A 3MMBB 3D66A 3TA2A 2E5HA 4CLFA 5DG7A 1OY6A 5ETNA 4M1KA 4JI8F 3CJKA 3D67A 4TU7A 1TMJA 4WPAA 1VQ8S 1GTEA 3T3FA 1YK9A 3BR9A 4Y0FA 1FXRA 4NMXA 1FJGJ 3GG0A 3H20A 1X9WA 4DV4J 3KLEA 4FF1A 2HHWA 1QAXA 5HSPA 1SUQB 1Z2LA 5FLXY 3KWMA 2D9PA 3M7VA 3M6WA 4CLZA 1XK8A 4A8FA 1Y0HA 2N3LA 3W8PA 3DU6A 3BKFA 2Q6CA 5EHHA 4WBFA 5KT6A 2D7SA 2OTJS 4NLRA 2WW4A 4USKA 2HHSA 3HD1A 3M6UA 4DQIA 2JSXA 4LF6J 2KL8A 1PAEX 4JI4J 3AAWB 4OQJA 1AZSB 2Y8WA 3TEHB 3KFWX 3OR1B 2FZKB 2KVIA 3K58A 3RAQA 3KK1B 2XHCA 1SC4B 4C0BA 1Z1ZA 3JSRA 1Q8KA 3BH6B 3TVZA 1NAQA 3A8JA 1ZYQA 4QW8A 2CQPA 2LDIA 2OD4A 4FPIA 2LLZA 3IS9B 4N47A 4P2MA 1ZA2B 2HFVA 3CEDA 4AL7A 1WEYA 4A8YA 3UE2A 3TP2A 3BDEA 4J9KA 3VGTA 5ETMA 4FPRA 1U2RA 4PXDA 2EWHA 4PWDB 4YHHJ 2UXDJ 2XMMA 1RSCA 4CWBA 3PX4A 2OD6A 3VAHA 4WTYA 2XMVA 4OZ0A 1UWAA 5K14A 1WTBA 4OLPA 3TZZA 3C16B 1ZPWX 3UN2A 5A76A 3D0GE 1NM2A 4ES1A 2B4PA 3QT5A 4NLWA 4NRUA 3W5YA 4R5PB 4Q2MA 5LJ3Y 4ID8A 3GMGA 4PAAA 4AXJA 1FK9A 2HVEA 3ICLA 2W9AA 3CF5Q 2GA7A 2CPDA 3OR2B 4KBIA 1CULA 2XSFA 1DJ0A 1HYSA 3V4IB 1RT3B 3DRXA 4EGLA 4GKKF 1JX4A 1E6VB 4M5HA 4QIWD 4GC6A 3PHTA 2V34A 1HL6A 5H9FJ 1SC1B 2AW0A 1PIEA 5BYSA 4EBEA 1MWYA 2VFUA 4LFAF 2ZD1B 2K06A 1F0XA 2I9SA 2OJ3A 5KFZA 3OSNA 4CYUA 3TX0A 1S10A 4YQWA 4PXCA 2XS5A 4RWXA 2VL1A 3LF0A 4FKXA 1X60A 4Q43A 2RKIB 1HD1A 1RKIA 1RLDA 1TK5A 3LAMA 2FGOA 4LRDA 2P9CA 2HFZA 1GX5A 2DIVA 4DR4F 1ZM3A 4K5RA 4CT8A 4B9LA 1CG2A 1QVGR 4ED6A 1ULRA 4QOTA 1KSPA 3MXHP 2BA9A 1XMBA 5JVGQ 2IVYA 2CQBA 3QLHB 4NXNF 2HG4A 3OFGA 2LKZA 4EFAC 1UW9A 4LIWA 2BW2A 3MAAB 4AYBD 4C9DA 1FRHA 1JKHB 2JH3A 3HFVA 3MTJA 1Q78A 1LOUA 3IO1A 2KM8B 3NGUA 4RO0A 3UDVA 2V8HA 4ZPBA 2QYGA 3RG6A 3HVRA 1S7HA 3BGUA 1S6UA 1HARA 4LR8A 1MG7A 1UVJA 2RQKA 1AUDA 4OHVA 4KFBB 1RHQB 3CJKB 1X7VA 3ENVA 1ZAWA 2OMOA 2AJ2A 1VLOA 4DUZJ 1OYEA 4Y2AA 3MMCA 1X5PA 2AYBA 3AD9C 3GWCA 2W8KA 3CC4S 3NMRA 5GADU 3KLEB 2R8GA 4DCJB 2OPSB 4RW7A 3RW7A 1RA7A 3OL9A 4K4XA 3R3TA 1C4AA 3RBXA 4WFBQ 3H59A 3UCZP 2CQ1A 2QMUB 3G82A 3DI6B 3KJNB 1T9UA 3BBFA 3AJ1A 3JTOA 3HSZA 3R1LA 2R2SA 1XJWB 4ZCMA 3MR3A 2K1RA 2DGUA 2IRXA 3OFHA 4WFYA 4DDFA 4ZDNA 1JWWA 3FVYA 4HH1A 5C7PA 3CDAA 1Y10A 2V9WA 2QZ8A 2UUWA 2FHJA 8ATCB 1S79A 1LW0A 2UP1A 3AQOA 2QE5A 4JI0J 4UQTA 1NSKL 1KTQA 2FLOA 1WC0A 1NKCA 4PG5A 2I0XA 2BEFA 1EAYC 2CYYA 1RTJA 2HFSA 1XIQA 3GV8B 5HL7Q 2V5HG 2EFPA 5GMKa 3UFCX 2NQPA 3H4DA 1XBWA 3DGPB 4NA3A 5HJXA 3EGVA 4FBUA 1AUSL 2KT3A 2CPHA 4HDHA 2YNIA 1I94J 1AROP 4PWUA 5SZTA 1WJ9A 2E7VA 1OJ4A 2XO7A 3D6FB 4J9MA 2JDJA 1CULB 3HJVA 1NDCA 1HYSB 4J7CA 1CVJA 1HQEA 3EDRB 3ZXWA 4QW9A 5J2MA 3MPUB 4RBVA 2QLBB 4A48A 1OMSA 3VWSA 2LQ8A 4YDDB 5M2PA 3R6GB 3ISNC 4ED7A 3AB4B 1VK8A 3QJPA 1IBMF 4LR9A 1OPIA 4CYUB 2HSEB 5KG3A 2Q79A 5AJ3F 4DLEA 1UAWA 4QWEA 1SH0A 1Y3JA 3MM7A 3A8EA 4CH1A 4L75A 1EETB 2P9EA 3ONQA 1FERA 3KMSA 2CXEA 5KG4A 2AGOA 1Q5VA 4YB6A 2R8KA 4R0EA 4B9TA 2DISA 2ASDA 3CJ2A 3CCQS 2RHQB 1URRA 1NK7A 3KLVA 4OHYA 1HI0P 2GJFA 2R7SA 2KXHA 3R9LA 4IQMA 1WG4A 4CO2A 2CJBA 2YX4A 3OPKA 2MLXA 1HR0J 3OL6A 2IRYA 3AY0A 4F36A 2GHPA 4RNOA 4KHMA 3FEXB 4UW2A 5F8JA 3NLCA 2MZTA 2NR0A 2KT5A 3MCSA 1PCAA 3DOLA 2ZWPA 1NLKL 4LSNA 2WVCA 2WVDA 2P9GA 3MMCB 2B3TB 6FDRA 4RW7B 3R7SB 2VODA 1NPRA 2AIRB 2MHNA 3HK2A 1ACMB 4ID5A 3NS6A 5GAGU 3VZIA 4DR2F 3BPSP 3DLJA 1NXIA 3NGTA 4EU0A 4NLPA 4IYQA 1VQ5S 3P5BP 4CTAA 4LT6A 4WK3A 1UETA 2HQDA 1T03A 4LFBJ 3MF5A 2YKPA 2K1RB 2XNRA 3OFEA 1KR4A 1Y5LB 1S0MA 1SC6A 3UR0A 1LKZA 4FYYB 4OJ3A 1R7IA 4OZ5A 4JI6F 2HBQB 1YTYA 1KQFB 4DZ6A 2BUNA 1NKEA 4WIQA 3KHLA 3R5GA 4ELVA 3GFZA 3JXOA 1CEZA 1LW0B 5I3UA 1ZTWA 1T05A 5J2NB 4NYOA 2B8PA 2ZJQQ 1X9MA 4C8NA 3FCWA 2AJ0A 2AZ3A 3KK3A 4IRCA 2ZH5A 4QQBA 1RTJB 3BQ0A 2CNNB 2PMZD 3P6YC 1HNXF 1CJKB 3AXMA 2DH7A 3TI0A 1NHUA 3H2VE 2IDEA 3SBMA 4IOBA 3OTOJ 3ZZUA 4B3SF 1GMWD 3CXCR 5DG9A 4ZVPB 2ADCA 1X4DA 1Q7YT 2XEXA 3GJQB 4G6VB 2V68A 2RDDA 1HNWF 1EHWA 2LXIA 4QWBA 2M8HA 3AT1B 2NYHA 1RCXB 1KLMB 3G71S 4ERDA 1HLWA 4JV0A 5LMNJ 4X4SA 3G86A 4XAKA 1RAIB 2VC0A 1QE1A 4IO9Q 2RS8A 1HQEB 3Q2SC 2KJVA 5J2MB 1J5EJ 3FRYA 4Y65A 4QR2A 1FJ7A 3UW1A 3PW5A 4CI0B 3MR2A 3FZ2A 1RABB 4KGMA 3NCRA 3RTVA 1SL1A 3MR7A 1KBRA 1WEZA 5EDWA 2W24A 5LXRA 4CLWA 2OUGA 4UOHA 2CQGA 3H5SA 5L9XA 3GE9A 4DSIA 2CPIA 1S49A 3U02A 4DF8A 4USJC 1N5SA 3OHBA 3QGHA 3THPA 2J7KA 4A8SA 2D74B 1XR7A 5HMWA 1BHNA 2HHHJ 3LGMA 4Q0BA 3PW0A 3BGLA 3GIRA 2W25A 4N8NA 3C6TA 4A8KA 3FSIA 3EDQB 3QT8A 1WHXA 3L7PA 2Y0BB 3HHKA 1IWGA 1U8WA 5DDOC 1V6HA 2UZAA 3DM2A 4LF7J 1H38A 2UUAJ 1S9FA 4KC5A 3ZFVA 1X0PA 2PFFB 3PEHA 3I31A 1U1MA 4M5IA 3C3LA 4ELUA 4TQRA 5ADZA 2LU1A 5KFAA 1HBUA 3PDNA 5A8WA 3LP2A 3ULHA 3GFYA 5KG7A 4ED2A 4Y2MA 3K7RA 3OUYB 1KOOA 4DQPA 2ZBPA 3DRPA 4LSNB 2LFVA 3HT0A 3RRGA 5CXTA 1W2IA 1LWXA 1FTCA 3C19A 5EWFA 1X9SA 1V3ZA 4ZPAA 1KHWA 4Y00A 5HVGA 3NG8A 5DLGA 4IR1A 4ID5B 3BF4A 3RYLA 3CUNA 3UVJA 4ZITA 4DL3A 3D3BJ 5HBMA 3JSBA 1GXTA 2MY8A 5KFGA 4TQSA 4CTAB 3FKBA 5DM6Q 2WRMA 1CQNA 3GCXP 1T03B 1RWPB 4P2XA 3J80Y 3W2VA 2DRAA 3NY0A 4ZVEA 3EVOA 1NK5A 1WF1A 5HMZA 1E6YA 5C24A 1HBMA 2JEGA 1RA6A 1FRKA 1TU0B 2IYIA 4EYHB 2XMWA 2N7YA 5CYQA 3HVTB 2ATLA 2RT3A 1K44A 4KE5A 5KFKA 4PXEA 4ZJQA 2W7OA 2VASA 3GZ7A 2FDNA 3B4MA 2C3MA 4NASA 1J5OA 2QG9B 2IM0A 2EKYA 3SIPB 1F9EB 3DDKA 2HW3A 4M95A 1N0VC 3EZOA 1SC3B 4U95A 2DXDA 2DNRA 3VQTA 1R43A 2XCPA 4ECYA 1TVRB 1WHYA 1CC8A 3MFIA 3SSSA 3OJUA 4O23A 2J76E 2BJ7A 3MCNA 3W60A 4U6PA 3KOAA 4DFKA 4ILLA 1NO8A 2GX8A 4WTOB 5HMXA 5KFEA 2AD9A 2JNJA 5IOLA 2E5JA 2HK3A 1QE1B 3IBCB 4Q44A 5KOWA 1IKYA 3M8SA 1OPZA 2VFSA 1TKDA 1QSYA 2E1MC 3QWPA 3QFHA 4JI3J 3NWRA 5GAHU 3CNQP 2CPYA 3AODA 2DY9A 4DN9A 3TAMB 4ZVFA 2ROGA 2V9KA 2D41A 4TY8A 4K59A 1YZ7A 5KFJA 4O44A 3D0IE 4ATNA 1U0SA 2H5EA 4HKQA 3K5OA 3MPWA 3MM6B 4Z7CA 2M0GB 1N33F 1YGYA 3AA9A 1F2GA 4DG1B 1RISA 4Q0BB 4Z37A 3KHGA 4F8RA 2BM1A 3HVWA 3MOZA 4OZLA 2YKMA 2AHOB 4J9QA 4JV5J 3RRKA 3TX8A 2EK6A 2V0NA 4A8QA 2J9EA 1C1BA 2MSTA 2ZZMA 2VICA 3DM2B 4OJGA 3H5YA 1NZ8A 2VU5A 2A3JA 2GGPA 2HNDA 1OSDA 2H65B 2DIUA 5B0CA 1U4BA 4V19J 2Y0SD 2PMWA 3MM8A 5IC6B 2XSJA 1Q1KA 1C1CA 3MURP 1HWUA 2QGFB 3O1LA 3GTYX 2E44A 2L08A 3CCES 3POTA 4H4OA 4G3IA 3AQPA 3QPIA 1BXNA 5KFFA 3MHYA 2YNHA 2DHHA 3TUIC 5L46A 2QFJA 3AA8A 4PQUA 5DJBA 2B7BB 1IJFB 4JP8A 2MLYA 4LVOP 4K4YA 5LT5A 3NWGA 2X7IA 4DQQA 4J9UE 3UVJB 3MDFA 4JI5J 5HBMB 1FNMA 5AT1B 2VD3A 4LR7A 3UNGC 4LF8F 1NU4A 2FVQA 3W2VB 1JLQA 4KRWA 5C24B 1TL7A 4LF5F 2EK1A 3W7BA 4LREA 5CYQB 1VQKS 4IFVA 1AXQA 5KOXA 3V81B 3WQPA 3AB2B 2F4VJ 1HMVA 1MROB 2NYIA 1UKUA 1J5OB 4B3MF 2CVEA 1IJEB 1XQIA 1YJTA 3PJ9A 1KD1T 2LA4A 1S12A 5KFQA 3AOCA 3PJXA 3Q8UA 2WK4A 1F6TA 4DV7J 4XO0A 3VAIA 3ELHA 1Q8LA 1NHVA 2DR7A 5CA5A 3SQOP 5EX0A 1DRZA 2H51B 2PGCA 5B08A 2FJBB 1MMDA 1TKZB 3CPWR 5IC4B 2VV5A 3F41A 5LSOA 2VJVA 2MZSA 1XTZA 4ZVUB 4WCEQ 3EPGA 3PZPA 2CWXA 5CZVA 1C0TA 4O3QA 1H2TZ 2QL7B 5KAKA 5E3QA 3UNYA 1NNDA 4UUWA 1UEKA 2DKOB 1XR6A 5F3ZA 1IKYB 4RNFA 4JI2F 1CJVB 2FD2A 5IM0B 1LWFA 3OXGA 1D9DA 5IT0A 2A18A 3C14A 2QLFB 5D3GA 3ZZ0A 3O6QA 3ILLA 5J2QA 3UQSA 2F3JA 2P5VA 1JMTA 4H4MA 4PYAA 2PIIA 2HHXA 4IQXA 3M8YA 1Y5NB 3NKYA 2Z2MA 1S6OA 4X66F 2ACYA 1P9QC 4AT1B 1VIXA 5KT3A 2WVFA 1RWXB 2VG7A 3RZAA 4DR3F 1DHMA 2DCLA 1CJUB 2O01C 2AJQA 4X4PA 1S4FA 1T95A 5ETOA 1RHRB 1Q5YA 1EZZB 1RT5B 1HHSA 3VHQA 2YPYA 2R7WA 4C8MA 1VRQC 3QZ8A 4OLOA 3Q8VA 2RQCA 1JIHA 2MKCA 4N77A 4QR0A 3CULA 4QPTA 1SJ4P 2YKMB 4C8KA 2H48B 3VCDA 3MMJA 4DPXA 1YQHA 4RW9A 1YRUA 1ZETA 3LO3A 2CNOB 4ZPTR 3RAXA 5KFIA 2HNDB 1HFEL 2XS7A 3MM8B 1NPPA 1NKBA 2XSJB 1YBTA 3MI7X 3KG4A 3OLAA 4GKKJ 3G96A 4OZNA 4GMKA 3NBPB 4C3KA 3POTB 4H4OB 1LFWA 2R8IA 4M5NA 2YNHB 1SV5B 1WELA 1TL1A 3ILOA 3BZQA 5KFTA 2E29A 1OYDA 3PM9A 4PQUB 3BGRB 1L5UA 3E2EA 3K59A 5L1KA 1MLAA 1JQGA 1FRJA 4I2QA 3M8PA 3WX8A 4KHPF 1VQ9S 4F02A 4Y2IA 4H4KC 3CJSA 3SFUA 4CT9A 4DR4J 2NZ4A 1QTMA 5IWAF 5KFBA 1C0UA 4TYAA 2W7PA 4DUYJ 2GV1A 3WC2A 4TY9A 1TELA 3IM9A 4AFFA 3MEKA 1JLQB 3CIMA 2PN6A 1TL7B 3MEEB 1RT2A 3RB3A 1PJ5A 3CB4A 5KFHA 2FVCA 2XULA 4USWA 3V6JA 3LP1B 4IFVB 2EFOA 2OHDA 2CJAA 2EVZA 5JXSA 3W61A 2R3VA 4I0WA 2MJUA 1APSA 5EX3A 4K7QA 3OD2A 4DX6A 1NSAA 2FTRA 2LQJA 2OELA 1UJ6A 4R25A 4DUTA 4C11A 3FFIB 2MHEA 1N36F 1RAHB 4EEYA 4OYZA 4RBTA 3DKDA 2DTJA 1RTZA 3BM7A 1Q86T 4DPWA 4RX6A 4OZJA 3SCLE 2C2ZB 3L7OA 3VAFA 1V5VA 1SL0A 2VA2A 3J81j 5FDLA 2DITA 2IJFA 3K8WA 4UOCA 3VTIA 5D6GA 2KRRA 4JI1J 4RW6A 1SVDA 1HQ2A 3LPYA 3OTBA 3BO2A 3VAKA 2GNKA 4FS2A 3I0RA 1KTVA 3LP0A 2BANB 1RUSA 2LEPA 1IBLF 3EVWA 3KMQA 2DPIA 1L3TA 3QT7A 2L9WA 1JB0C 2JEIA 1C0TB 1QSLA 4ZN1A 4DV0J 1R31A 1FNXH 2HAIA 4LF4F 3EXYA 1SJRA 2G1HA 4ED5A 1U02A 3MPVA 2OH2A 3C14B 3FBEA 1S77D 5D3GB 1DBDA 2FHKA 3I9ZA 2VQFF 3VF0B 2E5LF 3DDIA 2KI2A 1VR6A 5E5NA 2ROEA 3X3UA 2IYGA 4FYVB 4J9VA 3RW6A 3ZTOA 3E51A 3JAMU 4H4MB 3P8BB 1JLGA 2QX0A 3CD7A 1JXEA 1KOHA 3VQSA 3DLBA 3NXZA 3FBFA 4DV2F 5GMEA 3V6DA 4YN3B 2VG7B 4NEZA 2ZH8A 3QJLA 1GEHA 4F3QA 5F0UA 5DZ7A 5A8KA 4ZOSA 2NS1B 3KYLA 4DSKA 1REGX 2XLJA 4Y6IA 1N34F 4D3GA 4A8OA 3P49B 4MK9A 4ZVRB 3T9ZA 1VQOS 5KT2A 1MW7A 1XNRJ 2QLJB 4TNOA 4RW9B 1XR5A 2OAUA 4O3RA 2OSRA 3PFOA 5C42A 4O4GB 4OV1A 1URNA 1F9HA 3UCGA 1U09A 1YRXA 3FCVA 5BYRA 2ZC3A 4CLYA 1I3OB 3BV8A 4DBQA 1RT1A 3VZHA 1DLOA 1SJFA 2C3OA 2B4VA 1WNEA 4WFZA 2JEJA 4B3OA 3NGDA 3BKTA 2R7OA 4YY3F 4KIAA 4MTPA 4H54A 1W26A 3O3LA 2VG5A 1OQ3A 5D8HB 1EX8A 5KG1A 1TL1B 1IBMJ 3BGOP 2DPJA 5AJ3J 4A8MP 1F2HA 2IAJA 3GIIA 2YX7A 2F5GA 2X3DA 4PKDB 4DR7F 1DQ8A 4I2QB 1YWXA 3KDOA 4R8UA 3M8PB 4DR1F 5A0YA 3QIPB 4N8OA 2VFTA 1X5TA 1Q79A 3VGSA 5L1IA 4WWSA 4PR6A 3DRRA 5DM7Q 1S99A 2VJUA 4IFYA 1VK3A 1RLCL 2CZ9A 3QO9B 4J5OA 2VZ9A 4CLKA 1DTTA 2IMWP 2D3UA 2VPWB 2J0QD 1RT2B 4QIEA 1CS4A 1TZ0A 5ETQA 2G2YA 1H7WA 4ES2A 2ASJA 1QJHA 2W4PA 1QM9A 2OPQB 4X62F 2BE2B 3CJ4A 2G0CA 3GILA 3GLJA 3LWLA 2CUYA 5LM7E 2KFYA 2DGOA 3BN7A 2B6AA 2VF3A 1GNKA 3KUGA 5B0GA 3U7JA 3UWTA 2RQMA 1JLAA 3EJMA 3DC2A 2NSCA 3WIVA 4ITSA 2DR5A 2B7CB 2DEJA 3GPAA 3P45B 1LK5A 2ZE2A 4OI0A 2RAQA 5E33A 4RR5A 2EI5A 2R7RA 2J7WA 2W7AA 5B0AA 5FDLB 5KG5A 4BDPA 1OQ6A 3OJSA 2HVZA 4RW6B 5LMUJ 3PG9A 2DNYA 1N5TA 3MPDA 4PG6A 1Q0NA 1FNOA 2O3DA 1TUWA 2JRSA 4NOHA 4USTA 3I0RB 3OXLA 2GQ2A 3LP0B 1VQPS 4KPCA 2C2DA 3GCWP 1B99A 1VFJA 4IOCQ 1WTFA 3CJQA 2WSFC 2ZUGA 2VKRA 5M2UA 4JB8B 4DV3F 1RADB 4ZLPA 2IBKA 4ECQA 2FJXA 3I6PA 1S1WA 2BXJA 3M2UB 3CT9A 4UF4A 2QSFA 4WFAQ 2DO0A 4XPEA 3NAHA 4X4TA 2B4UA 2UXCJ 2DR9A 1SKSA 1S0VA 1S1UA 1XMQJ 2R7VA 3BEGB 4ZVSB 2OTLS 3VAGA 4GO5X 4DR5J 1VHFA 1XN9A 2ZKUA 3KUHA 2KHCA 3CVKA 3IC1A 1ZS6A 3S1TA 1JLGB 4EZ9A 3H0PA 2J7UA 4IDKA 5A6WA 2ZM6F 4ANCA 3V6DB 4Y2CA 2MDAA 3NEKA 1NK6A 2HAFA 1B64A 1ELOA 3E3XA 2FY1A 3W9JA 1F9FA 4E98A 2IJRA 3PYGA 1TAUA 3QQCD 4EO8A 3PJWA 4NYZA 5D78A 5CYMA 1WDTA 1FVQA 2ERRA 4TU9A 3RBEA 1RAOA 4QZVB 3MEGA 5BXIA 3HHDA 4PG7A 1VBKA 4K0KF 1U6ZA 4GVLA 2J8SA 1G3OA 4C8YA 4HTJA 4A8XA 1S9GA 2J0SD 5E7OB 1IVZA 1IBKF 4MK8A 4ECWA 1YJNS 3CCMS 2XZWA 1RT1B 1WC4A 4JOUA 2IM2A 4DV5F 1DLOB 3Q86A 1T9VA 3SI8A 1UVMA 1FD2A 3EYZA 4OX8A 3I55S 4A8WA 4B3OB 2CA9A 1SJ3P 2WHOA 4C0OC 2DHXA 3RR8A 2VG5B 2BRKA 1AW0A 4ZVHA 4HTIA 3IWLA 4OZ1A 1ZAXA 1BQMA 2VB6A 1AYEA 4KO0A 4M5LA 2ZH7A 4IKAA 4HI1A 4I6AA 3NNAA 1J2VA 2Q3PA 4ANDA 1HBOA 1V5IB 3OTDA 5A0YB 3UD4P 4F0KA 4E0DA 1ZPVA 3SMZA 1U0HB 3DRRB 2ZWOA 3T1AA 1VYAA 2AMCB 2BJ1A 3QSYB 4U7UK 1UTAA 1KQGB 4IFYB 1QUPA 4L74A 2XYPB 2EPIA 3ADAC 4B02A 2F7VA 3QNWB 2VA3A 2IVMA 1DTTB 4QWAA 4DR6J 4F4WA 2Z57B 5T41A 3S7RA 2HNZA 2RHSB 2Z0GA 1XC9A 5C25A 1FJGF 2GVDB 2B6AB 2DNMA 4EYIB 3NOCA 2E5IA 2J6UA 3BDPA 2W4CA 4F2SA 2IVFB 3DXSX 3U27A 1JLAB 4ZPCA 4XK8C 5L1LA 2CPFA 5J2PB 2XMUA 4QU7A 4WXOA 2OI2A 5D4NA 3CSKA 2ZE2B 2CJKA 2XGPA 3BQ2A 2VFRA 3G8TA 2G0IA 3A4TA 1HI1A 1WOOA 3SV3A 1VISA 2Y1RI 3TUJC 4QYZJ 4NRTA 5D77A 4TLQA 3J7A1 2H1YA 1GMVA 3LALA 3EICA 2CVIA 2ZDOA 1WKLA 4JI4F 1T0TV 2ZZTA 3PRVA 1X0FA 4DSEA 3NS5A 1HW9A 3PR5B 5D0GA 1VMBA 2K2PA 4USVA 2N7CA 2HYIB 1HQUA 3KUEA 4G1PA 1FKPA 3NAIA 1GMWA 2VUGA 5SUHA 5L9NA 1EKSA 3QAEA 1HD0A 1FFSB 2BMBA 2FIUA 4I64A 4HL9A 1K0VA 2WVBA 3CJ3A 1X4BA 2ZBQA 3JS9A 1S1UB 2PI5A 2UXDF 1KS2A 3JTPA 3KHRA 2M7SA 2AWZA 4CO4A 1NCLA 2XHWA 1QDUB 3QBCA 4YB1P 1CPZA 4ECXA 1NH7A 3IS9A 3ILIA 3DMJA 1LW2B 2ZH3A 4RLEA 1KFSA 2X1FA 1H7XA 2FHMA 4IDKB 2V4RA 4B9SA 2F9JA 2MZ1A 4GO7X 3ETMA 2M5YA 1FKAF 4QWCA 4F25A 2OMLA 1F60B 2ZBIA 2DCUB 3KJQB 5L39A 2FZCB 2BOAA 2DK2A 3L4BC 3ETOA 2CDQA 3C16A 4Q5VA 4QU6A 3I87A 3LW5C 4ILMA 4NWBA 5CYMB 4J9LA 3J81Y 5CABA 4QBUA 2KXNB 3BJYA 3EPIA 3KG1A 1V3RA 2OGUA 2Y3YA 1NB7A 1IWAA 1VRTB 4CIOA 1S9GB 4JV1A 2MQ8A 2RDJA 1E6VA 4CZCA 2I8EA 4FBTA 2XYGB 3GP9A 2MQOA 3M2VA 4DLGA 3AOAA 1JLFA 3TARA 3TZYA 5HVHA 4ZVOB 3C8YA 2ZD1A 3HPOA 4DX5A 2PDAA 2IIHA 2FJVA 4FNIA 3ZZTA 3BYRA 1RWVB 2HRUA 2OEJA 3BH7B 4WP8A 4EK2A 4V1Ak 1BQMB 4DL6A 3V2UC 4KO0B 4ZIVA 5B0BA 2LEBA 3Q83A 1WD6A 4KH1B 2N4DA 2RKIA 2RUSA 3HD2A 3BBCA 3P96A 1H98A 3ZNJ1 1HBOB 2O67A 2HGNA 3CC7S 1HI8A 2P8IA 4IRDA 4HHJA 2R7QA 2BACA 3KLGB 3PO4A 1O6XA 4PG8A 3HHLD 4CM2A 4B17A 5CHCB 2PEHA 3Q2TC 2C3PA 3TOQA 2CPZA 4CO1A 4I68A 2VQEF 3HZGA 2EC2A 5F8IA 3ILJA 2L3MA 1QLNA 1MWZA 2HNZB 5HP1A 4OJHA 4DUZF 2GHVC 2OPRB 4XDDA 3DNCA 3PHEA 1FX2A 2V2ZA 1O51A 2KFNA 4B3RJ 3HLUA 2QFIA 5KFOA 3M8ZA 1Y9OA 5DDPC 1LFPA 4KR0B 4KFBA 1TL5A 1R89A 2KZZA 3VR1A 2BE7D 1U7LA 3R27A 1RI7A 1NH8A 5AE3A 2CRLA 4NI2A 1R0CB 3HDSA 3D68A 2NREA 5K8NA 3HX9A 1D1UA 1VHIA 4AL6A 2R8HA 2CADA 3D6TB 4FYXB 3CD6S 3MEDA 2HURA 2OPSA 2JLEA 3E8OA 4P9SA 3T41A 4ZN3A 2IBOA 1FFGB 3B8HA 5DDRC 1ZM9A 3T9NA 1TL4A 3QYYA 3DI6A 4OYIA 1VDHA 4M5JA 4RBUA 1KQKA 2XY6A 1N52B 2DNZA 3MD1A 5GAEI 1TK8A 2DNQA 1FWKA 2JOQA 1P9YA 2ZFHA 3Q22A 1KHVA 3KXDA 1HQUB 3TAPA 1FKPB 4DV6F 1U1RA 2HFOA 3ITHA 1VIOA 4PG4A 3RR7A 3W5XA 2J6TA 3R2CJ 1KP6A 1N88A 1N48A 3MUVP 4M63A 1T8EA 2J8AA 4PZVA 5HO4A 2H9ZA 2WONB 4K8RA 3GR0A 1VQMS 3M8WA 3B78A 2CQ0A 1RKJA 3DMJB 1MNEA 5MAOA 4KHRA 1I94F 1VQSA 2M70A 1UA0A 5KFCA 3MR5A 3R97A 3DGPA 4M5DA 3T1HJ 1MWQA 1UFWA 5GMDA 3JSYA 1T9TA 3M9OB 4UQGA 3HFZB 4AQYJ 3QGPA 1IKXA 1QY7A 3CE8A 5H9FK 3FMBA 1WORA 2COLA 1FDNA 4Z7YA 3CCLS 3HKZD 2E1RA 3BREA 5CCLA 2MXYA 2YWWA 1N8RT 3JB9k 3HT3A 1HBNB 2JFDA 1PJ7A 2XY5A 3CWJA 5I3QA 1H0HB 3ZO7A 4N5SA 2A0FB 1JK9B 3WBZA 2Q66A 4IG3A 4X65F 2P2CB 2EW9A 4LRCA 3M2VB 4B9VA 2DH9A 3O2IA 1JLFB 2H3EB 1U6BA 2VOOA 2M8DB 4ZVTB 4USHA 5GVQA 4FXVA 5KFPA 5FLXU 2GQCA 4I7FA 4KB7A 2MJNA 2CQ3A 4FF2A 3PEJA 1SKWA 3TRGA 2ZHBA 4X66J 1M1KT 4LRAA 4CQ1A 3ENWA 2MQMA 1EETA 5E0OA 3SEOA 1X4AA 1RXOB 3NL0A 1QUVA 2RILA 4EBCA 4NEYA 2HVHA 1N32J 1HR0F 2KRBA 1GFWB 2G13A 3HFKA 3W64A 3GJTB 1RTDA 2W2QP 2JL9A 2QN6B 2UXBJ 1Y7PA 4Y2KA 5HP1B 3MFHA 1SXLA 5F9NA 1NBEB 5D0EA 3BO3A 4KH0B 2WBRA 2MKSA 4Y34A 2ZJRQ 3K5PA 2ZBCA 3B54A 5ETSA 1FD8A 4TKTA 3JYTB 1NZAA 1BC6A 3DOKB 3QGIA 2X51A 3I5BA 4K4VA 1VS3A 2PEBA 4ED4A 1GXLA 2DH8A 1U2FA 1VI7A 3W9HA 2DJWA 2LXFA 4NI2B 1M5PC 4K50A 4P7VA 4OYPA 1L3KA 1NDKA 1OSCA 2HZAA 1UCNA 2PD1A 3OVSA 2DRBA 1IM6A 2G1DA 4DX7A 5LL6d 3MEDB 3IM8A 2AJ4A 2B43A 2XC9A 4C3MA 3CMQA 2GJIA 2ZH9A 4S0MA 5MLCV 1Y5IB 5G4DA 3KJVB 1HWJA 2CPJA 4JYAF 3H2LA 1WEXA 4QPXA 2J9CA 1S5ZA 4NX9A 2AEMA 4KGKA 3OBIA 2M9KA 3SV4A 4IG0A 3PYDA 5D0HA 3FDSA 4WFXA 1W25A 4NLQA 3PYFA 2DBBA 3HJFA 3MECA 5IWAJ 4WK1A 3ITHB 5FJ4A 2ZOMA 2UUCF 3IGVA 2A2DA 2RRBA 4X4QA 3ZZPA 2LP4A 5KFLA 2GO8A 4X4VA 3I96A 2CQ2A 3CCJS 5KFYA 4F3MA 3MCMA 1SPBP 4PRFA 2DGTA 2I6WA 1M90T 2RD5C 3VALA 4DFMA 1RWUA 5ETRA 2B9WA 4GRSA 3C46A 3G6XA 1H72C 4DSLA 3RGIA 4ELTA 1UEVA 3OTOF 5J2NA 2EBGA 4KT0C 1KVIA 2AJFE 2NSBA 3THVA 1SIWB 3MMAB 4CH7A 4KYZA 1DFDA 4KTQA 1N36J 1CJKA 3MUMP 4K4TA 4RU2A 3IAS9 3I32A 2WOMA 4M5DB 2FB0A 2EXUA 1WKJA 2FJDB 5LMNF 2C3UA 1SQFA 4WXWA 2J0WA 1IKXB 1XNQF 4HH0A 3DLKA 4ETXA 4AXIA 2D3ZA 3IWNC 5A2QY 3F73A 3PACA 4BLGA 1P27B 3U1NA 1KLMA 1WDDA 4MK7A 2BJ9A 3QRPA 2UUBF 2YTCA 1IBLJ 3I9V9 4OX6A 1R8CA 3DHWC 1M5SA 5B0DA 2C22A 5BR8J 4DV1F 1NJYA 4WFNQ 3X1LB 2JLFA 2GIQA 4IG3B 5D4OA 4C8LA 4YR0A 2X3GA 3RU0A 2HGLA 4ICLA 2XS2A 3T5KA 2Y1JA 2MQNA 3H5UA 3WDOA 4K4UA 3U1MA 4RL1A 1FA0A 3JQJA 1TV6A 1B4SA 4JBCA 2GAHC 3KLIB 4I7FB 3QATA 6FD1A 4G65A 3TZWA 2HHHF 2BKNA 3MAQA 1LK7A 2MQQA 4R0JA 2RF2B 4GKJJ 4CP5A 4URQU 3VVTA 3T19A 1S6PA 3G4SS 3BR8A 4O3OA 4WF9Q 4IOAQ 3ISND 2YKNA 4K2JA 2EFNA 1B0VA 3QFWA 5HLFA 5CD4A 1AT1B 2EEYA 2JWNA 1S9EA 2PMHA 4RWWA 4WP9A 4LF7F 2VBXA 1UWBB 2NUHA 2UUAF 1S1XA 2GC8A 5E3RA 2ZH4A 1RTDB 4DPTA 5KFDA 1N34J 1L3SA 4NZ7A 5F41A 2L48A 3SYZA 4M8LA 2HS0A 4KGZB 2HS4A 2C2KB 3FQLA 1GT8A 3EXCX 2KKHA 4Q8FA 4C48A 2GMJA 1BWEA 2HRYA 1S1VB 4P75A 2APOA 3A13A 1XERA 2CQ4A 1FDAA 3FRZA 4OMFG 1NUEA 3KLHB 3PO5A 3PTWA 2QMWA 2FVRA 3IA0A 3SSQA 1ZZFA 2V8GA 3OUYA 3QGGA 2WW8A 2WVEA 3W5ZA 2LEAA 3TUPA 5IT9Y 2HHQA 3GIJA 4OX9J 1F3FA 4O4RA 4DU8A 4YY3J 5A2QU 3AXKA 5HANA 1R27B 2AEFA 2ASLA 4KSEB 1Y3KA 1JJ4A 2F65A 2Z56B 3UO0A 4F0MA 2G2ZA 5HATA 1VJQA 3P3DA 4OI2A 4DR1J 1KFDA 4IG0B 2KU7A 2BABA 1YJWS 3M6XA 1HHTP 2HZVA 2QL5B 3MECB 2HRTA 1JJHA 1RTHB 2QA2A 3MPYA 4MKAA 2V2KA 1GXUA 4FNHA 3GQCA 4AL5A 4DOZA 3CD5A 1SKRA 3HVTA 4X64F 3T1YJ 2ZH6A 2JLGA 1N56A 1RGVA 1X4HA 1T9WA 2FUG9 1BY9A 2QMXA 2ZVIA 3M9NB 4X62J 4KGXB 1SCJB 4ZA1A 2NXNA 2ALZA 2K8GA 3E01A 3L9ZA 1FWLA 3D1QA 2H4YB 4IO1A 2MLZA 4DL5A 1H6KX 3TUZC 2HK2A 2DVIA 2ILYA 3BBBA 4BS2A 1Y11A 4FYDA 3PNIA 1X4FA 1HHQA 2DNHA 1PSDA 2A6OA 1YI2S 4PABA 2OLWA 1WOSA 2WOMB 1NDLA 1TVRA 3G87A 4URSA 5K9FA 1TFYA 1U47A 1EP4B 5ETPA 3DLKB 3N79A 2UV8A 3NCPA 4MMOA 1KONA 2V63A 2GHWA 3VVUA 1FX4A 2VOPA 2F1FA 5KTQA 4JI3F 1O0PA 4MIBA 1ZH5A 2DGWA 2X1GA 2ZEJA 5KFVA 4QJVA 4DV3J 2J9DE 5T7LA 2CQHA 4M5MA 3RB0A 1TMMA 2XMJA 3GJRB 5IT9U 3D54A 3K2YA 1LWEB 2LU2A 4ICLB 4J9SA 3V4MA 3MM9A 3J7YI 2AEJA 2DXFA 1TV6B 4IUFA 1OS5A 3J7Z5 4ED1A 4FYWB 3TAMA 2FJWA 5JMNA 1M0SA 2D9OA 3I56S 3Q8QB 2AJ1A 4QWDA 4JI7F 4OHXA 5HROB 5KT4A 1GTHA 2VFVA 2UVUA 1S6PB 4I6YA 4I69A 2XI3A 2YKNB 4DPOA 4N56A 5HLFB 3MM6A 2XI2A 2XTJP 5EN1A 4E8UA 1X8DA 2BV3A 1S9EB 4UTGA 5J1EA 4DG1A 2HQIA 4NMLA 1Q4RA 5BYQA 4CO3A 2GZOA 5HI7A 4USMA 2HHTA 1S1XB 2C2MB 5KFWA 4C7QA 4RUBA 4RNNA 2YWKA 2CZVC 1LQ9A 2OEKA 1JNRB 3CTRA 5C2GA 2XMAA 2XQCA 1PAUB 4NPOA 2KDOA 3GYNA 1M5OC 4B3TF 3EWGA 4DXLA 1TAQA 1IBKJ 1KNZA 3R5DA 3I4HX 3PY8A 1YLXA 3GSIA 1JLBB 1DQ9A 4C97A 3O5TB 2YY3A 3MCOA 3HHLC 2QO3A 2V6AA 5I3PA 4DV5J 1KLNA 4M94A 3EX7B 4JI5F 4BC7A 3NGSA 4UY85 3HSDA 2IC3B 3FJ2A 4V19X 1FRMA 1U45A 1VOMA 2YKAA 1RHUB 3EUNA 2WB1D 3OW2R 4FP9A 2N3OA 5JJBA 3IR7B 9ATCB 3L7UA 2R2UA 3WIUA 4RJVA 3EE3A 3S6EA 2R42A 3PW4A 1T3OA 2C1EB 2IFXA 1RU2A 1T11A 2F4VF 2OFGX 3NCQA 5LSRA 2FLLA 3CJ8A 3UD5A 3MGJA 1C2PA 2CJXB 3IBWA 2JHEA 4HHUA
chains in the Genus database with same CATH topology
2BXJA 1N5VA 4QW9A 5J2MA 2DGVA 3M2UB 3CT9A 4RBVA 4DV7F 4NLDA 2QSFA 4A48A 4WFAQ 2GJ2A 5F8LA 3V81A 2DO0A 3UPFA 1C1CB 4XPEA 4AE5A 3NAHA 3VWSA 4X4TA 2B4UA 3S01A 4YDDB 2FPHX 5M2PA 2DR9A 1SKSA 3ISNC 1S1UA 1S0VA 1KEKA 4X2BA 4ED7A 3AB4B 2R7VA 1VC5A 2E1CA 1QAYA 3BEGB 1VK8A 3M05A 1MROA 2OTLS 2Y1IA 3VAGA 3QJPA 2WCXA 1IBMF 3E01B 4GO5X 1VHFA 5DGBA 3ZZOA 1OPIA 2BQRA 3D1HA 3PRDA 3JYTA 1XN9A 2ZKUA 1K9MT 2AX1A 2Q79A 2YNFA 5KG3A 2KHCA 3CVKA 3DOKA 3IC1A 1YJVA 3S1TA 5KT5A 5AJ3F 1JLGB 2CJ9A 2G4BA 1ZZNA 4EZ9A 4ZS6A 4DLEA 4LQ3A 2J7UA 3FMWA 4IDKA 5A6WA 3H98A 2ZM6F 2F40A 1UAWA 4QWEA 3V6DB 2DNOA 4Y2CA 1BQNA 1SH0A 4FN5A 2MDAA 3ZZZA 2BBEA 1Y3JA 1NK6A 5E2QA 3MM7A 3OHAA 1Q81T 3A8EA 4CH0S 4CH1A 3JAMY 4DL4A 5I4MA 2BYCA 1B64A 5CD4H 1ELOA 4NLSA 3E3XA 4ZP7A 3UD3P 2FY1A 1EETB 5T14A 2OFHX 1F9FA 1FJEB 3N6LA 4IH7A 4E98A 1VC6A 1P6TA 1TAUA 5DG8A 3HMJG 2NUUG 4EO8A 1AFIA 2P9EA 2K3IA 3ONQA 1FERA 3KMSA 3CJ5A 1TKZA 3PJWA 5GAGI 1QVFR 2FVSA 4NYZA 3FSYA 1WWHA 5D78A 5CYMA 4LIRA 5KG4A 1FVQA 1TK0A 1NK8A 2ERRA 2AGOA 2YKOA 1IKWA 3KJVA 1PC4A 4YB6A 4FF4A 2R8KA 4R0EA 2G9OA 4MIWA 4TU9A 4B9TA 3IFEA 3W2WB 3RBEA 3GG1A 1ZM2A 2DISA 4QZVB 3EGZA 3A1YG 2I5JB 3MEGA 2ASDA 3CJ2A 1ZBTA 4YFUA 3CCQS 1URRA 1NK7A 2XMTA 4NLUA 4F4YA 2J6SA 2AYEA 3HHDA 3KLVA 4PG7A 2VBZA 4NA2A 4OHYA 1N6QA 3THTA 2Z2LA 1HI0P 4K0KF 1S1TB 1U6ZA 3OQ2A 2R7SA 1SI9A 2HGMA 4MYUA 1G3OA 4C8YA 3NNCA 4HEA9 3C66A 2J9DA 4URGA 1K73T 2KXHA 4HTJA 4A8XA 4IQMA 1WG4A 4HDGA 4LQ9A 1S9GA 4CO2A 2X1AA 4JI0F 5E7OB 2J0SD 2CJBA 2WTFA 4DFJA 2YX4A 1IBKF 1WF2A 2QRRA 2YX1A 4MK8A 3OPKA 3N9UC 3H5XA 2K7KA 1HMVB 3OL6A 2IRYA 3AY0A 4ECWA 2ZITA 1DTQA 5IM0A 2GHPA 2YH0A 5T7LB 2MKKA 3QAUA 1QSSA 4RNOA 4KHMA 2DNGA 3M1VB 5B09A 3FEXB 1YJNS 4UW2A 3CCMS 1K1QA 5IXUA 2XZWA 1RT1B 4JOUA 4NA1A 5F8JA 4OHZA 3HXMA 2XLIA 3NLCA 5H9EJ 2HHUA 3IRXA 2B0GA 2IM2A 1DLOB 2MZTA 2YNGA 4DV5F 2NR0A 3DHXA 3SI8A 4WU2A 2SXLA 2KT5A 3MCSA 3BB5A 1FRIA 1UVMA 3GB0A 4X4UA 3MM9B 1FD2A 3EYZA 2J0XA 3CCWA 4OX8A 3I55S 4A8WA 4B3OB 3DOLA 3HI9A 1SJ3P 1TP7A 4DFPA 1HNVB 1SJ1A 3KLFA 2LA6A 2WHOA 4C0OC 2DHXA 4LSNA 3RR8A 2VG5B 2YQ3A 2BRKA 1AW0A 2P9GA 3MMCB 4ZVHA 3ZC4A 4HTIA 4YMEA 3IWLA 5DRKA 1HW8A 4KV8B 2B3TB 4ZHRB 2PA3A 2ILZA 5KFRA 3MMAA 4OZ1A 6FDRA 3GFHA 1ZAXA 2IM3A 1BQMA 4YUDA 4F26A 3PW2A 4RW7B 2O1PA 2VB6A 1OWXA 4A4JA 4KO0A 4RNHA 2VODA 1S48A 3BSCA 3UR3C 2MHNA 2R9LA 1HPZA 3NRBA 4FZVA 2ZH7A 4IKAA 4HI1A 5F0WA 3HK2A 4I6AA 3NNAA 4OI4A 2UUCF 4ID5A 3NS6A 1J2VA 5GAGU 2WSEC 2YWEA 2Q3PA 3LH2S 4F3OA 3VZIA 4DR2F 1HBOA 3DRSB 1RAJA 3DLJA 2KG1A 3OTDA 4F4ZA 2DNPA 5A0YB 3UD4P 4FVMA 3UCUP 2MPUA 3CO9A 4NLPA 4IYQA 4EU0A 4ZK7M 2LECA 1VQ5S 2IM1A 4O0IA 4I6WA 4CTAA 4E0DA 4LT6A 1YJRA 1ZPVA 3SMZA 2GO9A 4DF4A 4WK3A 3SFGA 4F4KA 1UETA 1T03A 3DLLQ 3DRRB 5J1EB 3T1AA 1RT7A 2XMKA 1RQ0A 1RT5A 3MF5A 1D9AA 1O5JA 4U7UK 5AXMA 5BR8F 3H40A 1KQGB 2YKPA 4IFYB 1QUPA 4WU3A 1U25A 2K1RB 2EPIA 2XNRA 3W3SA 2RU9A 2F7VA 4B02A 2VA3A 2IVMA 1DTTB 3OFEA 4JV2A 2CFXA 1TQLA 4QWAA 1KR4A 1Y5LB 2P6SA 1S0MA 2YH1A 1SC6A 1JXLA 3UR0A 1LKZA 1D9FA 3UDLA 4OJ3A 4F4WA 5K5MA 3F56A 1R7IA 3PX0A 4MFBA 4OZ5A 1G1XA 3ENQA 4JI6F 5T41A 3S7RA 2HNZA 1LWFB 3L95X 1YTYA 3AJ2A 1KQFB 2BUNA 3PKYA 1NKEA 2Z0GA 2E1AA 3TYTA 2JVRA 4LJMA 3KHLA 1XC9A 4P2SA 3O44A 5C25A 4ELVA 3GFZA 1FJGF 5J1PA 5J1NA 2B6AB 2DNMA 4K2XA 4IR9A 4EYIB 1HA1A 3HHNB 1GX6A 2E5IA 2J6UA 1SL2A 1U1KA 4NL5A 4BC9A 3BDPA 1IQTA 1CEZA 1N5QA 5J2QB 2W4CA 1LW0B 2CG4A 4Q45A 5I3UA 1ZTWA 2XG8A 4F2SA 2CPXA 2IVFB 1T05A 2BQUA 2VBYA 4GKJF 2CIMA 5J2NB 1UW4A 3DXSX 4FVCA 3U27A 1JLAB 4NYOA 4ZPCA 4XK8C 2ZJQQ 5L1LA 1X9MA 4ALZA 4C8NA 2AJ0A 2CPFA 2RVJA 5J2PB 5EWEA 2XMUA 4ECRA 4QU7A 4WXOA 2MSSA 3KK3A 3H25A 4IRCA 4ILRA 3NBPA 2ZH5A 3SDEA 4QQBA 1RTJB 3BQ0A 3O8WA 5D4NA 3CSKA 2ZE2B 1P1LA 2HS3A 2PMZD 2CJKA 2XGPA 3BQ2A 3KLIA 3P6YC 3N5FA 1D0EA 1RT4B 1HNXF 2CQDA 2I2YA 2VG6B 2VFRA 3G8TA 1SV5A 1X4CA 2C28A 1G6BA 2RB7A 2DH7A 5HMYA 3TI0A 3RB6A 4DWIA 1HI1A 1NHUA 3H2VE 2PC6A 3H8YA 2MKHA 3SV3A 4IOBA 2RF2A 2Y1RI 4DUYF 2B5JB 3ZZUA 1FDBA 3TUJC 4B3SF 4QYZJ 3DFEA 4NRTA 3BGRA 5D77A 4TLQA 3CXCR 3J7A1 1G7CB 3LALA 5DG9A 1U1LA 2ADCA 2CVIA 1X4DA 1Q7YT 2XEXA 5KFUA 2ZDOA 1ROFA 4JI4F 4G6VB 1RYSA 4ECZA 2BR0A 3MUTP 2L9NA 3Q24A 2D3OR 4NCAA 1X0FA 4I2PB 1HNWF 5DDQC 1MMLA 4LMZA 4DSEA 4L72B 3NS5A 4LUBA 1HNZF 2MZQA 2LXIA 4QWBA 1VBXA 2M8HA 2XNQA 1FF2A 1HW9A 1KLMB 2F8EX 1R8AA 2E9TA 1RP5A 5A8RB 4PUOA 3G71S 2AYMA 4IH5A 3PR5B 4B9MA 1TL3B 5G0RB 4MAKA 4ERDA 1UWBA 1VMBA 4JV0A 2K2PA 4ED3A 2GMLA 2NPFA 2N7CA 2V4QA 4X4SA 2HYIB 3G86A 1HQUA 3PXGa 1Y00A 4XAKA 1P1TA 4G1PA 1FKPA 1VRUB 1HNIB 3NAIA 1RT6A 2VUGA 2VC0A 5SUHA 3MEEA 1HWIA 1QE1A 4G1QA 5L9NA 4IO9Q 2RS8A 1F5BA 1HQEB 2F8HA 3JTNA 1HD0A 3Q2SC 2KJVA 3QAEA 2ADBA 1VGYA 2MYFA 2FIUA 4I64A 4L6V3 4HI2A 5J2MB 1FKOA 3FRYA 3HKWA 4HL9A 3LP1A 4Y65A 3GV7B 4QR2A 2MGZA 1K0VA 5LJ5Y 1FJ7A 3TNVA 2XWYA