1OWXA

Solution structure of the c-terminal rrm of human la (la225-334)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
113
Chain Sequence
HHGSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal domain of human La protein reveals a novel RNA recognition motif coupled to a helical nuclear retention element
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lupus La protein
total genus 18
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08777 RRM_3 RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1owxA00
2RS8A 1M5OC 4U67Q 2DGQA 2NLWA 2M8HA 5HL7Q 3UE2A 4WF9Q 3UWTA 1WHXA 3CCQS 2SXLA 2MQOA 5IM0B 1M5KC 1DHMA 1VC5A 3P49B 3CF5Q 3CCSS 2DNRA 1X4CA 2E44A 3VAFA 2MKHA 4QQBA 2CPXA 5BJRA 2FHOB 1UW4A 2PEHA 4WFAQ 1M5PC 2D9PA 2KYXA 4V19X 2KXHA 3DXBA 1D9AA 3B4MA 2ZJQQ 1VQ8S 3Q2SC 1RK8A 2MZSA 2FY1A 5LJ5Y 3I55S 2D3OR 4Z2XA 2F3JA 3CMES 2X1GA 1WF0A 1X4GA 4YB1P 1SJFA 1WEXA 5DM7Q 1KOHA 3UCUP 2VOPA 2N82B 2M4MA 3NMRA 3PIPQ 1B7FA 3TO8A 2F9DA 2DNOA 1YITS 1IQTA 2MZJA 1SJ4P 1ZZFA 3VAJA 1U6FA 5DM6Q 2ADBA 3H2VE 3IWNC 4YOEA 2MXYA 3EX7B 1OO0B 2HYIB 1VBZA 3BO4A 3HI9A 2M9KA 1P1TA 3S6EA 2DHAA 1JJ4A 1PGZA 1U6BA 1NO8A 2MQLA 5LSLA 4UY8T 3MUMP 2CQ3A 1P27B 1QM9A 2G0CA 2DNMA 2DB1A 2MY7A 3CTRA 3NS6A 3MI7X 4CIOA 3G96A 2HGNA 1OPIA 3PIOQ 2FC8A 2DGSA 4LJMA 2CQ4A 3BS9A 1URNA 2XNRA 1N88A 2MY8A 3CULA 1H2VZ 3J7ZT 2DNNA 3VAIA 2XNQA 2JWNA 1A7GE 3S01A 3UD3P 4FXVA 2ZJRQ 2LA6A 2CQPA 2DGVA 3OW2R 4BS2A 1U1OA 2OSRA 2M88A 5JVGQ 2DIUA 2OTLS 2E5GA 2J0SD 2U1AA 1BY9A 5GAGU 5D78A 3LPYA 4EGLA 4PRFA 2LA4A 2X1AA 3G4SS 1WEZA 3MOJB 4F02A 5GAHU 4IOAQ 4C0OC 2ZJPQ 2DNZA 3J7YU 2HGMA 2LKZA 3VALA 4WKRA 1HD1A 3P5TL 4C4WA 4C7QA 1JJ2R 3CD6S 1KD1T 2M52A 2YWKA 2MKKA 2V94A 3NNHA 2LMIA 2DO4A 4TLQA 3MUVP 4RU2A 2AYEA 5IM0A 1YHQS 5LSOA 2VONA 4QU6A 1UFWA 4ERDA 2LQ5A 5DDOC 2DGWA 1WI6A 3BO2A 2EK6A 2YKAA 1ZZNA 2MYFA 1WG4A 1O0PA 1VC6A 2M70A 3ZZZA 1K8AT 2LECA 2DH8A 1DZ5A 3CC4S 2DNPA 2MMYA 1FXLA 4IUFA 1U2FA 2VODA 2FC9A 2RS2A 3MDFA 2DNYA 2GO9A 2B0GA 2MQQA 1X5PA 1VQ4S 2CPEA 3THTA 3US5A 3VAGA 2MJNA 3G71S 2UP1A 1VQKS 2EVZA 5IFMA 2DHGA 3VAMA 1KQSR 2JX2A 2D9OA 4CQ1A 2KHCA 1U1PA 2LXUA 3DLLQ 2CQBA 3H2UB 2QA4S 1VQ6S 2KXNB 1X5OA 2MSSA 2AYBA 3G9CA 4TU9A 2QEXS 1D8ZA 1WELA 1WHWA 5CXTA 3R27A 3FEXB 4PR6A 4LIRA 2KM8C 2G4BA 2XS2A 3IRWP 2DGTA 2QFJA 2I2YA 1OWXA 2DK2A 2CJKA 1WF2A 2M0GB 1DBDA 1X4BA 5GAEU 5LXRA 2AYGA 3RW6A 2EK1A 2X1FA 3VF0B 2CQ2A 2DNQA 3N9UC 3RW7A 1FNXH 3SDEB 4QPTA 2F9JA 2CPIA 3MURP 4ED5A 3CXCR 3I56S 3G6ES 3U1LA 5JVHQ 1SJRA 2MKSA 1YWXA 3B4DA 5HO4A 2CPDA 1YJWS 1VQ5S 5ITHA 3K0JA 2CPZA 5EN1A 2RRAA 1FO1A 2U2FA 1VBXA 1WF1A 2M2BA 2KG1A 1VQOS 3R1LA 2M8DB 3CCUS 2DHXA 1VQMS 4IOCQ 4WFBQ 4F25A 1YI2S 2KI2A 1FJEB 1WG1A 2RNEA 4WFNQ 5GMKa 4WCEQ 3NNCA 2MJUA 4PKDB 2Q79A 1X4EA 2CQDA 3MUTP 1X4FA 3EGNA 4YUDA 1VQNS 2XS5A 3EGZA 2LEBA 4ZKAA 3CCES 2O3DA 2RRBA 2K8GA 3CCRS 1FJ7A 1YJ9S 2KVIA 1M90T 1Q86T 2JRSA 3S8SA 3S7RA 1OIAA 1VQ9S 1NU4A 3CC7S 1U1KA 5GVQA 5H1SV 2MHNA 2MPUA 5DDQC 1DRZA 2E5JA 3P3DA 3CPWR 5DDPC 2KRRA 3V4MA 2X1BA 1JMTA 1RKJA 2DGUA 2DHSA 2KFYA 2KU7A 1KC8T 2J8AA 1X4DA 2BZ2A 3D2WA 2AD9A 1H6KX 2LCWA 2DGOA 1WHVA 1FT8A 2DNKA 2XS7A 1NJIT 4QU7A 2DIVA 1VC0A 1AUDA 3G8SA 1K73T 2NZ4A 2VOOA 3FEYB 2MZTA 3HHNB 1H2TZ 3CMAS 1VQLS 1S79A 5DETA 2J0QD 2CPYA 1K9MT 2MKJA 2MGZB 4Y00A 3MD1A 2WBRA 1Q81T 1ZH5A 2KT5A 1A9NB 2MSTA 4TU8A 2DISA 3U1MA 2KN4A 2CPJA 3UCZP 4J5OA 3ZZYA 4IO9Q 2E5IA 2LXIA 2ADCA 2JVRA 1S72S 1QVGR 2CPHA 4TU7A 1L3KA 1X5SA 3THPA 1JJHA 3CCJS 1H2UX 3MXHP 2I38A 2DO0A 3TP2A 4F26A 1HL6A 2G1DA 1X4HA 2A3JA 2LEAA 2XB2D 2DITA 1G2EA 3VAKA 2AYMA 2K3KA 4WIIA 1YJNS 2PE8A 5D77A 1VQ7S 1PO6A 2CQHA 2RQCA 1WWHA 1N54B 2MZRA 1N52B 2KG0A 4Y0FA 1SJQA 3SMZA 3TYTA 2RT3A 2L41A 3BEGB 1UP1A 3MD3A 2N3LA 2E5HA 2RUGA 1HA1A 1YTYA 1N8RT 2DNGA 1YIJS 1XN9A 2HGLA 1CVJA 3ULHA 1VBYA 2JVOA 2YTCA 2HZCA 2MZQA 2L9WA 5MLCV 3CCLS 3LQVA 1R8HA 1WEYA 2XSFA 4CH1A 2ERRA 1W2BR 2KH9A 5IQQA 1U1NA 2KRBA 2MQPA 1M5VC 1U1RA 2MQNA 2YH0A 1Q82T 3Q2TC 4P6QA 3SXLA 2BOPA 2MB0B 1FHTA 2CQCA 1U1MA 2MKCA 2KXFA 1WTBA 5CA5A 3NNAA 2OIHA 2N7CA 1UAWA 2DNLA 1HD0A 4UQTA 3CCMS 2CQ1A 5GADU 2OJ3A 2RQ4A 1U1LA 2OTJS 5LJ3Y 1U1QA 1KOOA 2CQIA 2RVJA 5DDRC 1SJ3P 2DNHA 4CH0S 4OZ1A 1M1KT 2YH1A 3P6YC 4W90B 3UD4P 2MGZA 1X4AA 2MZ1A 1QVFR 2OSQA 4M5DB 4A8XA 5CYJA 3CCVS 4W92B 1FJCA 2M7SA 2MQMA 2DH7A 1WHYA 1WI8A 3UCGA 4LMZA 2RU3A 1WG5A 2KM8B 3JB9k 1SXLA 2CQGA 5LXYA 1Q7YT 3CUNA 2L08A 3L3CA 4FXWA 3G8TA 2N3OA 3NS5A 2FPHX 2LYVA 2DGXA 2J76E 1X0FA 2DH9A 5FJ4A 3BO3A 3SDEA 2HVZA 2GHPA 3R1HA 2CQ0A 1F9FA 2CPFA 3VAHA 1X5TA 1R8PA 4OZ0A 3CC2S 2MKIA 1VQPS
chains in the Genus database with same CATH superfamily
3PJ9A 1WD6A 2EFPA 3FCVA 2XZDB 1M5OC 4YHHJ 5F8NA 5KFOA 3DLKB 3VVTA 5A8WB 3HDSA 2P2CB 3R5DA 4O3PA 3FRZA 2BE9B 3I6PA 4C98A 4CLFA 3ITHA 3UE2A 4E8UA 3RAXA 3SSSA 2YNIB 2E1MC 2DXFA 1S9EA 3QPIA 2COLA 4L3NA 5IM0B 1EAYC 1ELOA 2Z56B 3TARA 3D6MB 3R2CJ 1WSRA 5MAOA 3T1YJ 4CYUB 5KFJA 1HNIB 2VPWB 1FK9A 1X4CA 2YVSA 3W5YA 3VAFA 4LFCF 2MKHA 2ZWPA 4QQBA 3M32B 3V2UC 3ENWA 3LGNA 3AJ1A 2KTQA 2XMUA 4A8KA 5CD4A 2IYIA 4KB7A 5HQMA 1YVFA 2KXHA 4RU9A 1T9YA 5HMWA 2NYIA 5K5MA 2XGPA 3PX6A 1VQ8S 2ZC3A 3Q2SC 1C1CB 3W8GA 4C0HA 2XMWA 1S1TB 4DL0C 4L6V3 4NEYA 1KTVA 3PIOQ 1D3WA 4DUZJ 4MT1A 2NYHA 1GEHA 2LQJA 2Q1LA 4F8RA 1N32J 1I94F 4Z2XA 1JLCB 2F3JA 1CC7A 1TL4A 4HDHA 2NXCA 5E41A 1WF0A 3J7YI 2V9WA 2LXFA 4PWUA 5A0YB 1SJFA 2HVIA 3PJWA 3BR8A 1WEXA 3MFHA 4WP8A 5KFAA 3QFHA 4FP9A 3A12A 2VBWA 1X9MA 5IC6B 2BKOA 3AAWB 1RBAA 2D7SA 1FTCA 1FEHA 4XO0A 2BM1A 2WSCC 2M4MA 2ZFHA 4JI8J 4URSA 4CP5A 4K4XA 1JLBA 1UVJA 3ENQA 2F9DA 3Q8RB 1NH8A 2J6UA 2FYXA 4NXMF 4O4GB 1UWAA 1EKRA 1GMUA 2IM2A 3QT7A 4CO1A 4ZIVA 2FUG9 5BXIA 4PQUA 4ED0A 1JXEA 2L3MA 2O67A 3AJ2A 3HKWA 2DKOB 2R7UA 4ALZA 4RNOA 3AOCA 3KHRA 1S6QB 3O44A 1V5IB 1Q1KA 2FZCB 4TNOA 5KT5A 1M0SA 1S6QA 4QWCA 4ECQA 4EK2A 3S6EA 1R3NA 3OL8A 2HFZA 4WFZA 1Q8KA 2XM3A 3KLFB 3I0RB 5B08A 4AD6A 1P6TA 2V69A 4WU2A 1NO8A 1Q53A 2FY8A 4PWWA 4TYAA 3SBMA 4ER8A 2C3YA 4CI0B 3LP1A 3MUMP 5HP1A 3MMBB 3RB3A 4UY8T 1P27B 1F6TA 1WC1A 4F67A 1QM9A 3V6DB 1LXNA 2IJFA 3ONQA 1FFWB 2MY7A 3I31A 3GCWP 3H25A 1RKIA 1RA7A 2QLJB 3NS6A 1JKHA 4B9LA 4U7CA 1CEZA 3TA0A 3IO1A 2L48A 1EJ7L 4CIOA 1PILA 2HG4A 3AY0A 4O4RA 3G96A 4F0KA 1HLWA 2ZH8A 1BD6A 4LJMA 3BS9A 5A2QY 5G4DA 3HT3A 1URNA 1N88A 2MY8A 2QN6B 3GLJA 1RB0A 1H2VZ 3IBWA 1AUSL 3TOQA 1JLAA 1VJQA 4N5SA 2DNNA 2VHGA 1S49A 2V4RA 1IBLJ 2NZCA 5JMNA 1EZZB 3ENAA 1IN0A 1IR1A 2DR6A 1GK8A 3C66A 1AZSA 2OPRB 3S01A 4JV0A 5AJ3J 4RUCA 3CT9A 3V81A 1HI0P 2AGOA 2PI4A 3GV8B 2XMKA 5EX0A 1SB6A 3GONA 3OW2R 1R0BG 2EWHA 4DSEA 2ZKUA 2UUWA 2BOAA 3F41A 4OZLA 4UOGA 5JJBA 3M8ZA 3L95X 4KHPJ 1TV6A 5KG3A 3PVXA 2IPOB 2GIFA 1OY9A 4RJVA 2M88A 4ANCA 3ZC4A 1TELA 2D41A 3BGRA 4DPXA 5JVGQ 2XLIA 4K5RA 4C8NA 1TUGB 2J8SA 1F9EB 1T9TA 3QT5A 1BY9A 1UW9A 2A6MA 4LSZB 5D78A 3OFEA 5KG6A 4EWTA 4F0MA 1B70B 1S1VB 2FZGB 2OELA 3HHKA 4CNYA 1CG2A 1TKZB 4K5SA 3SV3A 5DLFA 3DYAB 3IBCB 1U1KA 1NK4A 2VB6A 3G4SS 5J2MA 2F1FA 3QYYA 4RW4B 5HQ8A 1N5TA 2QT7A 4GVLA 4DXLA 3D6FB 4OL8A 4DV1F 2HHVA 3BN4A 3M2VB 5LSRA 1RAAB 2LKZA 2VF3A 1JIHA 4NLSA 3VALA 1D8YA 1JLEB 2FLNA 4AXJA 4K4VA 1F2GA 1HKAA 4C4WA 1UETA 1ZA1B 2QA1A 1NDCA 4TKTA 3UO0A 3GJQB 4NZ0A 2ROEA 4C7QA 2AWZA 4HKQA 4Y65A 1B0VA 1Q78A 1GAOA 1SIWB 2F8EX 2HQ3A 3R6LB 2VQFJ 3PNIA 3OTOJ 3C14B 2R2UA 2LMIA 3ZNUA 4I64A 4TLQA 2G13A 4I0WA 2JFDA 2HFVA 4K59A 3MUVP 4YEAA 1KN6A 5IM0A 4P7TA 3EVMA 4HHHA 1BQMA 4OI1A 5LMUF 4HL9A 2NR0A 2VONA 1UA1A 2RQMA 3JSBA 3CDUA 5LT5A 1FJGF 3MM6A 3LAKA 1WOSA 3OR2B 3UD5A 3BQ1A 4QWDA 2OEJA 4G6VB 2Y1RI 3ILIA 1OYEA 1R8BA 1A6LA 4V1Ak 3QLHB 4U7UD 2R8JA 3MCNA 2P9EA 4LSNA 1K8AT 3CMQA 1BQNB 3HFKA 4IFVA 2YNGB 5THWA 3ZZTA 2OD6A 1Q0NA 4R25A 1RTHA 1NSKL 2QO3A 4UTGA 2MMYA 4YB7A 1YBAA 1MMDA 3KHLA 1FXLA 2YWHA 4OHWA 4CZCA 2RRNA 4ECXA 2UUAF 4IUFA 5I4MA 1U2FA 4WFYA 1O6XA 4WJBA 3C16A 2RS2A 4KGVB 2DD8S 1RT5A 2IFXA 4DUYJ 1S0MA 1IBKF 1VOMA 3W5XA 4ICLA 2XY7A 2DEIA 4NYZA 1MN9A 1FVSA 4ZVTB 1OMSA 3SSRA 3US5A 3MMAA 5C42A 4FPIA 3VZIA 2WOMA 1KSPA 1ITPA 3OQ2A 5HVHA 4B08A 2EVZA 1VQKS 5IFMA 5A8KA 2QA4G 2ZH7A 1NDKA 2UXCJ 2VH7A 1UZDA 1RT4B 3TEHB 1WNEA 1Q95G 3UN3A 1SJ1A 2D9OA 3DN9A 4ETZA 1U1PA 2ZHOA 4UOHA 1GTEA 3V6JA 3NOGA 4DX7A 5A6PA 3HVRA 2V8PA 4TQSA 4LF9J 3KNGA 4IG0A 4ZCMA 1S6UA 2V2VA 4K4ZA 1XERA 3IFEA 1D8ZA 3HHLC 1WHWA 1OY8A 3D1HA 3FGVA 4R0EA 4U7UK 2E7XA 2BA9A 3R27A 1ZOTA 4LIRA 1U24A 4LR8A 3IMQJ 2W7PA 3KLEA 1B0PA 1GT8A 4YB6A 2P9CA 4PXEA 4JV5J 4GMKA 1GTHA 1R0CB 2DK2A 2ASDA 4M5NA 2E9ZA 1WF2A 4KV8A 1JLFA 2ZOMA 4WK3A 4NX9A 2X51A 3BGLA 3KLFA 3GIIA 3MR7A 4KV8B 1LFPA 3L7UA 4MIWA 5A8RA 3I9ZA 3HZEA 3OR1A 3W9HA 2RDIA 5LMNF 1AFIA 5F8MA 5A8RB 1PBAA 1CQNA 4OJ1A 2AYGA 3K17A 2EK1A 4F3OA 1FDDA 3D0IE 1HPZB 2XCAA 4USHA 3EYZA 1LQ9A 1FNXH 2DR7A 1XMOF 2F9JA 3MURP 4DF4A 1HPZA 2HFUA 4IQMA 4DFKA 3H4DA 4IQXA 2A2DA 2K7JA 4DU8A 4DG1B 1T7PA 2DXDA 1UJ6A 2V6AA 2ZE2A 5JVHQ 3BDEA 1CJTA 5HROA 1HNIA 5E3AA 2LQ9A 2ZE2B 4DV2J 4JI5F 2F8MA 3GSIA 1YWXA 4ZVPB 5CYQB 2CPDA 2O66A 3K59A 3OHBA 1RT1A 5ITHA 2I8EA 4J9RA 4DV4J 4DR5J 1VBXA 1X31C 2KG1A 4WZMA 2ASLA 2W9CB 4G3IA 1XNQJ 2OPQB 2W24A 3DRRA 1RT2B 4FYDA 5D0EA 1WJ9A 4LF8J 3FBFA 1HIYA 1QAIA 2F63A 3W64A 3HFZB 1HNXF 3D5MA 4IDKB 1HBMB 4DFMA 4F25A 2ZC4A 2CJAA 4Z7YA 4EUVA 4J9LA 2F4VJ 4WCEQ 4PKDB 2VA2A 5J2QB 2BW7A 3QZ8A 4OQJA 4U9RA 1RCOB 2YBVA 4YUDA 4YP3A 1UPMB 2LU2A 3IS9B 3AH6A 3EPIA 2B6AA 2LEBA 3QATA 3KJFB 2DR5A 1CS4B 2E29A 2YKMB 4ZP8A 1RAFB 2UU9J 2W4CA 3CCRS 4ECSA 1HQUB 2GMHA 3G9CA 3MM8B 4I6AA 3ZFVA 2HNZB 4WK1A 2R7VA 4OFZA 4JI7J 5B0CA 4HI2A 2JRSA 5J2NB 2CYYA 4NLYA 2Q3PA 3S8SA 4X4VA 3K8VA 1S9FA 4X4SA 3S7RA 1ZTTA 4X4OA 1RDRA 4YDXA 1VQ9S 2BV3A 2V4JB 1XQIA 3EZUA 5KFYA 9ATCB 3QFWA 1HQEB 2P8IA 5D0HA 1RTJA 3CD0A 2ZWOA 5H1SV 1RADB 1DRZA 3DI6B 3GJRB 3HSJA 3P3DA 3QJLA 1EETA 3FBCA 3BJYA 1FFGB 2W2NP 1G3OA 3A1YG 1B0TA 2KRRA 1JMTA 1HWJA 5CQGA 3M9OB 2B51A 1M1GA 2H5IB 4ELUA 2CG4A 2GW8A 2XYGB 1R8CA 2BJ3A 2BZ2A 3HT0A 4LF1A 2AD9A 4RW7A 5IV4A 1KFDA 3LP0B 4ETXA 1L3VA 5LMNJ 4PQAA 1NSAA 1RCXB 3V4IB 1V3RA 4CLLA 4B9NA 1KKHA 1S77D 1GH8A 2IY5B 4MIBA 1H0HB 1R6VA 2BJ1A 1NJIT 3C6TA 1R89A 1VC0A 2Z2MA 2FGCA 2G2OA 1TFYA 4KGXB 2NZ4A 3AODA 4FYVB 3B6BA 3FEYB 2MZTA 3QLHA 2CG8A 4NWBA 3HHNB 3CMAS 3MM9B 3SI8A 3LALA 5DETA 4M5JA 3ZZPA 4FN5A 5C25A 1T8EA 2J0QD 3JQKA 5I3UB 2NPFA 8AT1B 1VS3A 3K7RA 2MGZB 2E1CA 2R9LA 3MR6A 2KT5A 1U2RA 2MSTA 4TU8A 3H20A 4QBUA 2ZHAA 4QW9A 2CVEA 2XI3A 3KXDA 4Q44A 1SV5A 3KK1A 1OPZA 2Y8YA 2BRLA 2OMLA 2ZBIA 4QIGA 1BGXT 3ZZYA 3DM2B 3CJ3A 4LR9A 4C3MA 2BJ9A 2QLXA 5T14A 3OBIA 4DI6A 3M8RA 3TAPA 3M8YA 1XNQF 2OPRA 2HMIB 5EGYA 1QVGR 1NKBA 4A8SA 4TU7A 4K2JA 4RNNA 1WOOA 1VRTA 4LF8F 1L3KA 1X5SA 4PCQA 3T41A 3AXKA 3OJUA 1PYSB 2AEFA 1HL6A 3DLGB 1X4HA 3FK4A 5DZ7A 1WDDA 1G2EA 1F1BB 4WIQA 3LOUA 1KQKA 2VG5B 2B4OA 1H3DA 1OQ3A 1E6YB 4KKOB 1IKYA 5D77A 4F2SA 3VVUA 2NSBA 1HWLA 2GMJA 4PG7A 1B7YB 1N54B 4C8LA 3KMQA 1TKZA 3NP5A 4HI1A 2UVWA 1HHQA 3THVA 2HS4A 3VZHA 1ZAWA 4KO0A 3SMZA 3TYTA 1REVA 1NB7A 3H2LA 1KQFB 5AXLA 4CLZA 3PYDA 3CJSA 2B3TB 4QIEA 4Q5VA 1T95A 1X9SA 1HA1A 3U02A 1RU2A 1RP5A 1AFJA 3H90A 5DO2A 2A1BA 1XN9A 4Q0BB 2HGLA 2X7IA 3M7VA 5G0RB 1TL7A 1GXLA 2PD1A 3HVTB 4XK8C 2VQEJ 1VBYA 3V6DA 4ZIWA 4K0KF 4PAAA 3PHTA 1SL1A 1QSSA 4ECVA 1FRHA 2W2PP 2YKQA 3GCXP 3LP1B 4MIAA 5HP1B 3OR1B 3TJ8A 1HR0J 3QJPA 3LQVA 4EYHB 2H4YB 1ZM4A 3UVJB 3KLIA 2BXJA 5A76A 1H38A 4QR2A 1LWEB 2JDJA 2Y3YA 3DRPA 4CH1A 2UUCJ 3TQ1A 2KH9A 1JLGB 3UDVA 5RUBA 3LW5C 3C3LA 2FVCA 4C8ZA 2E7VA 4HACB 4WFXA 2HBYB 2KRBA 4YFUA 3W66A 1CJTB 2G2YA 5HROB 3N0VA 2I0XA 4E98A 2XQCA 3EPGA 3D1QA 4U6PA 3CNQP 3POTA 2FLOA 5HMXA 3M8PB 2K1RA 3JS9A 3KHGA 2LQBA 2I1RA 2BOPA 1H73A 4A46A 4ZOSA 1PG5B 2FJEB 1VRUB 1RAJA 1RHMB 2MKCA 3D3CJ 3FKBA 3R5AA 2XTJP 4OHXA 3TVZA 1KVIA 4RUAA 3MMJA 4OYIA 5ETOA 4NLDA 2V8VA 3W65A 3G8QA 1NPPA 2CQ1A 5GADU 2B5JA 2OJ3A 4DUZF 1U1LA 4O23A 3HCXA 3K8WA 4DCJB 2GS8A 5HJXA 1KOOA 4NLOA 1OSCA 1XJWB 2CQIA 1SVDA 5A0YA 5U47A 4ES1A 5HSPA 4EBCA 2PMHA 3CIZA 2PIIA 4ZVOB 4MKYA 1C2PA 4RW6A 3PO5A 5KT3A 5I3QA 4FKXA 1WSVA 4LQ9A 1WORA 2OEKA 3TWZA 4W90B 3TI0A 4LSLB 3CDAA 1NJYA 1JLBB 1VHIA 4DS4A 1PC4A 3NCPA 3UD4P 3CJQA 3UDCA 4OX9F 4FXDA 1NK8A 4M5DB 1T9XA 4OJ3A 5AXKA 5CYJA 1EP4A 3CCVS 1FKPA 5K9FA 4F4KA 1FJCA 2GJIA 3CJ0A 2MQMA 3D67A 1S10A 4UY85 4QYRA 3SCIE 1U0HA 2R2SA 4MAKA 5KFLA 4LBIA 3ZXWA 4DU7A 2ZDOA 2HHPA 2VG6A 4OYXA 3TJ9A 3OL9A 4KAIA 5C24A 1S0OA 4UUWA 1KNZA 1QUVA 3ET6B 2GHVC 4RX6A 1YJRA 2HVDA 1IR2A 3RBZA 1NLKL 2LVWA 2CQGA 4LVNP 5KFPA 1Q7YT 2ROGA 3KLHA 2ZHBA 3DOLB 4FXWA 4FBTA 3G8TA 3H5SA 4I1TA 4V19J 4I2QB 3NS5A 2N3OA 4OHZA 4M63A 4JI3F 1PSDA 1FEEA 3KHHA 4XPCA 3QQCD 3H4BA 4DR3J 4ECWA 1BQMB 4H4MB 2ZBQA 1X0FA 5KG4A 1V6HA 1SBRA 2D1CA 2WVFA 4OV1A 4DF8A 3VTIA 2HVZA 3SZ2A 2MLZA 2CQ0A 3TNVA 2XHCA 2CPFA 5D15A 3ZTQA 2WONA 2LU1A 5E7OB 3ZNJ1 5B0BA 3DDIA 4F4WA 3KUGA 4OI4A 4WXWA 2VQEF 4U8YA 4ENOA 1G1XA 4ECUA 2ABYA 3TR5A 1UVMA 4OI6A 1IQZA 4LFAJ 3B82A 2CJYB 4M5IA 4U67Q 1L3UA 2DGQA 6AT1B 1W25A 4EFAC 5EWFA 2W9CA 2WOMB 1PYOB 3N28A 5J2QA 2OLWA 1M1HA 3UWTA 3RBXA 1T03A 1ZM3A 1WHXA 4NL5A 2XMVA 2YNFA 4R8UB 3R6GB 5AJ3F 3CCQS 4ID5A 3QT6A 3PKMA 3UNGC 2SXLA 2GQQA 5KT6A 2MQOA 3Q23A 4DR1J 1TV6B 2MKYA 3CJ2A 2I5JB 1J5OB 4C9DA 3P49B 3BREA 4TLRA 3CCSS 3M4XA 3KUHA 2BMBA 3CCWA 4NLTA 2V4QA 4EBDA 2E44A 2KJVA 1S1UA 2GO8A 4ZLLA 4ED1A 2HPUA 3R5JB 2J5AA 2BQ3A 3FSXA 1UW4A 4URGA 5D0RA 4A4JA 1H7WA 4NCGB 1SIZA 4ZPBA 2D9PA 1KDNA 2QLFB 1HNVA 3HSGA 3DRYA 3MEEB 4V19X 5GAEI 1UEVA 5F8IA 3B4MA 1FFSB 4JOUA 4OYBA 2FJXA 3D9BA 4K4SA 1RK8A 3IRXA 3RGIA 3Q22A 4NOHA 2V2QA 1VI7A 2FY1A 4AXIA 3QGGA 1NJXA 2EC2A 5LJ5Y 2AEJA 6FD1A 3I55S 4LF6J 4L76A 3UR3C 2CZ9A 4Q7AA 1RYRA 3O8WA 4P7VA 3DMJA 3OFHA 4QIVA 4WE1B 5A8WA 3RU0A 4QCLA 3JXOA 5L39A 5DM7Q 4F2RA 1KOHA 2V2KA 1LWFB 4GC6A 3EICA 3UCUP 3IG1B 3A13A 2Z2YB 3PXGa 2AGPA 1N56A 5BYRA 2VOPA 3PFEA 2GIQA 3NMRA 4DL2A 3H98A 2DY1A 3W60A 3TO8A 2GJ2A 1SKSA 2DNOA 2Y1LB 1JLAB 3VAJA 2DR8A 2J9EA 2JFKA 1QSLA 3IBFB 1SI9A 1U6FA 5DM6Q 1KVJA 2ADBA 3U27A 3H2VE 4CTAA 1RTDB 4M94A 3G86A 2XMJA 1OO0B 3DFEA 3EX7B 1E6VB 2IC3B 2W2OP 3MEGA 3TZYA 1VBZA 2HYIB 5DZ6A 1NPKA 3HI9A 4KGKA 1U09A 1TK8A 3DDKA 4GKJJ 2OPSB 3FCWA 1N0UA 1EB0A 2QLWA 3EVOA 3MECB 3PEHA 4AYBD 2LLZA 2W9AA 1UVLA 1NCLA 4J7CA 4KGZB 1TK0A 4IDKA 2MQLA 2OMOA 1IKWA 5IT4A 2FHKA 2CQ3A 1FCAA 3SSQA 1BQXA 1NUEA 2G0CA 2L9DA 3DRSA 2WHOA 4LREA 1D0EA 1MG7A 4I4BA 2FLPA 1U48A 3CTRA 4NI2B 3J80U 2MHEA 4I6YA 4A8YA 2ZOFA 3A8JA 2GC8A 4JB8B 1B99A 3A8KA 3HD2A 5ETPA 4ED2A 4IG3A 3T1YF 2UXCF 3GYNA 1T9VA 5D4PA 1ZPVA 1WDTA 4I2PA 4DSKA 1WKLA 1SH2A 2XULA 3H59A 2RILA 4J9UE 4LSLA 1PBUA 1MN7A 3G6VA 3NGRA 2XNQA 3HLUA 1U0HB 3D68A 4B3TF 1IUJA 3NLCA 4W98A 2JWNA 3DOMB 4OMFG 4KHRA 3I4HX 3KYLA 1SKWA 3UD3P 1MROB 3GG0A 1S7IA 1RXOB 2ZH6A 2ZJRQ 1HHTP 1U8WA 2LA6A 3OTBA 5E33A 2XLKA 1VK3A 3D0GE 2WBMA 1N36F 2GVZB 1UFLA 4BS2A 2MTLA 4RW9A 4BWJA 4I56A 3HM9A 3O5TB 2BJ8A 3QAEA 3J81j 1U1OA 4ECTA 1WC4A 3GP9A 1PYTA 4NA3A 2RF2B 2XY5A 2JH3A 4K2XA 1VLOA 4P9SA 3K57A 2J0SD 3A3PB 3PW4A 1YK9A 3OL7A 3T1AA 4B02A 1S6PA 1BE4A 3H0PA 1KFSA 3J7AN 4ES3A 4JYAF 4CO2A 2V68A 2YNGA 1RT3A 5KFUA 2JC0A 4RPFA 2HNYA 1WC5A 2MLXA 3GJSB 2F7VA 1DURA 3BBCA 1FTRA 4YHHF 1FKAF 1C1CA 2D3O1 5GAHU 3NXZA 4HACA 4F4YA 4IOAQ 4C0OC 2ZJPQ 2QL9B 5HN0A 1XNRF 4Z7CA 5CYQA 5AE2A 4WKRA 4ITSA 4WU3A 1IBMJ 3ZTRA 4OYMA 1AROP 3PEJA 2H5JB 5C42B 1FWKA 4DR5F 4O3RA 3D28A 2OPQA 2HHXA 5D8HB 2OFHX 2YNFB 2JLGA 1QAXA 5K14B 4HR2A 3UNYA 2FLLA 3AQPA 2V94A 3NNHA 4PUOA 2DO4A 1ZS6A 2OPPB 4JI0F 2Q66A 4UW2A 5D4OA 1CJUA 1UCNA 2VG5A 1FVQA 3JQMA 2ATLA 1YHQS 3CJ4A 2J6TA 4QIWD 4B3RJ 2UZAA 3GR1A 1UFWA 4NXNJ 4RKUC 1HBNB 4ERDA 2O01C 4IG0B 2NXEA 1P8GA 2DPJA 4OX7A 2DGWA 4QR0A 4WWSA 4Y2IA 4CO0A 5L38A 3BO2A 2EK6A 5ETKA 3HD1A 2VV5A 5KFMA 3PX4A 4KYZA 3M6XA 3OUYA 1U8SA 4OHVA 4DEZA 1KEKA 2DH8A 2KO1A 2KDOA 4L3KA 2LECA 4ZVHA 3OTDA 3ILJA 4X4PA 2XWYA 3B8HA 1REVB 3LANA 3QO9A 4RW8A 4OX8A 2VPXB 5E2QA 2E7WA 4LF7F 3IRXB 3MDFA 5HVFA 1C1BA 2HLUA 2GO9A 4C8MA 3PYEA 4DQQA 1HNZJ 4JP8A 3LWMA 2VFVA 3KFWX 3ZTSA 2VFSA 1FDNA 3I5CA 1F5BA 1RBOB 1SQFA 2JOQA 1K1SA 2FVRA 4KHPF 5ADZA 3VV2B 3R5BA 2DHGA 4E2FB 1S9EB 2DYAA 3VAMA 4MKBA 2UVUA 4HDGA 4NLUA 2VL1A 2HS3A 3KMSA 2ASYA 4UF4A 5SZTA 2K3IA 5F3ZA 1VQYA 3NL0A 2HMIA 4CQ1A 2KHCA 2W25A 2B9XA 2Z2ZA 4F4XA 1J2VA 1XEZA 4HH1A 2CQBA 1XC9A 1DFDA 2ZVSA 3MAAA 2GIRA 6FDRA 2UUBJ 2M3DA 4OLPA 2AYBA 2RDDA 5CAAA 2XSJA 5ETQA 1R43A 1WELA 2IRYA 4K4WA 3PY8A 3ILOA 3AD7C 3FQKA 5F8GA 3OT9A 5IWAJ 2XS2A 1YSJA 3NGKA 4H4OB 5H9EJ 1QE1B 1RHRB 4DV1J 1F3VA 1OWXA 4EZ6A 2FHJD 1U26A 2PDAA 2CJKA 1DBDA 1Y7PA 3KLVA 4KIAA 3KJVA 4CLSA 5GAEU 3MPDA 2FJDB 3HVWA 3Q24A 2C3OA 1YBTA 4N41A 4EYIB 1ROFA 4ANDA 1VRTB 3GIMA 3MCSA 3VF0B 1QTMA 3KNAA 3F73A 1RQ0A 4WZQA 3RW7A 2XYPB 2R42A 2CPIA 2NS1B 4ECRA 3MM8A 4ED5A 3DLGA 1NAQA 1RACB 1ZAXA 3CXCR 4FKYA 2J7WA 3W2WA 3VGVA 3U1LA 2QJ3A 3I56S 2V8GA 5LMUJ 4EEYA 2VUGA 4ILRA 4KFBB 2NCKL 2D3UA 2YQ0A 3MM7B 3R97A 1TQLA 3DOMA 4J9VA 4M8LA 5HO4A 4ZPDA 1N6QB 1VQ5S 1RTJB 2RUSA 1Q5VA 4TYBA 4H4KC 2B43A 2OD4A 5F0WA 4ZVFA 4ZVQB 1WF1A 2M2BA 3F44A 2VU5A 4FYXB 2FDNA 1RI7A 3GE9A 4QOTA 3CJ8A 3TZXA 4ILLA 3CCUS 1TU0B 3AA9A 3MTKA 3NAHA 1HNVB 3DLBA 2BJEA 1V3SA 1MLAA 2BKPA 2UUAJ 1DY3A 2KT2A 2HHTA 5BR8J 4WFBQ 1YI2S 2QL5B 3ZTPA 1IBLF 4WFNQ 3TZZA 2IJNA 1IM4A 5GMKa 4DLEA 2ZKTA 3SEOA 3OVBA 1TL7B 3BR9A 2P5VA 3HVTA 2VC0A 4QW8A 4DCOB 4X64F 4HHUA 3JYTA 1X0PA 2PN6A 3BPSP 3M30B 3R8YA 5KOWA 4ZKAA 3JYTB 2O3DA 5KTQA 2IVFB 2K8GA 3N79A 4FZVA 1RT3B 3RRGA 2WVEA 3C19A 3T19A 1N33J 4DX5A 3HHDA 2IHR1 5KFNA 2KVIA 3IP0A 1RTHB 3L7OA 3IR7B 4H54A 3GV7B 2AX0A 3J80Y 4B3SF 3QZ7A 2BUNA 4DPTA 1OIAA 3CC7S 2HURA 2OO4A 3EVWA 4IOBA 1FX2A 1A0OB 3CVKA 1FKOA 1RT1B 3MPWA 2MPUA 2BANA 2H65B 1RBLA 1FKOB 3IAM9 4EMDA 3J81Y 2HHUA 5DLGA 2J7UA 2DJWA 3FSIA 1VRUA 1RKJA 4DLGA 2DHSA 2PT0A 2WRMA 3LWLA 2ZDPA 1YZ7A 5HK4A 1KC8T 2J8AA 5ETVA 1RT4A 1SPBP 3DU6A 4OV6A 2HIQA 5KFXA 1H6KX 1EX8A 2LCWA 2CJXB 4FYWB 3M2UA 4XDDA 4YDDB 2B5JB 1WHVA 3CDBA 4NASA 4RBVA 3PJXA 2XS7A 4DR2F 3HSZA 4QU7A 2AZ1A 1Q8IA 5HQLA 1AUDA 4PQUB 2PO4A 2VQFF 1K73T 1XMOJ 4D3HA 2HBRB 2M5YA 2EFQA 1H2TZ 2QSWA 2WB4A 1MWQA 2KL8A 4AT1B 2XO6A 4P10A 1Y11A 4N7TA 4ELVA 3M2RA 1G4CA 1K9MT 1Q8LA 3BGFA 3DOKA 3KLEB 3JSRA 4I2PB 3TANA 2UV8G 1PAUB 5ETLA 1UVIA 4NLQA 4U96A 2FHMA 1C4CA 1RE1B 3IR5B 4X4TA 3U1MA 2KN4A 3QSYB 1JWWA 4J5OA 1S99A 4JI6F 2E5LJ 1IKVA 1FNOA 4X62J 3ITHB 2YKOA 2LXIA 5KFQA 4NYOA 2JVRA 4X65J 1NDLA 2AEMA 1S72S 1NJWA 3DLKA 1N5YB 5KG2A 4X4NA 4LFCJ 3PTWA 3DMJB 4F50A 1KRPA 3CCJS 1H2UX 3A8IA 3TAMA 3MXHP 2I38A 1G7CB 5KFDA 3QSIA 4Y3CA 2A3JA 2LEAA 2GV1A 3DLJA 2XC9A 1JLQB 2VFRA 3SFUA 3W62A 4WKYA 2RU9A 2FJAB 4O44A 4XAKA 4X64J 3CJ5A 1TKXB 3EM1A 4CO4A 4YQWA 2C22A 4ZVSB 1YJNS 2PE8A 1PO6A 2W9BA 4NA1A 1QDUB 2Q6BA 2RQCA 2BW2A 3GYXB 1WWHA 2BJDA 3I5BA 4OYPA 3KUEA 1N52B 1I94J 3FUYA 5DS7A 3UN2A 3BKFA 5BYQA 3OTCA 3H40A 2HHHF 1KWMA 2JLFA 4H4OA 2V63A 1NMEB 4ZJLA 4NRTA 2O1PA 2KZMA 3EMTA 2FVQA 1FXRA 2GX8A 2AV5A 2V2ZA 7FD1A 1RT5B 1SKUB 1YIJS 2CVIA 1FI4A 1S1TA 1RWMB 2C3PA 5LM7E 3ULHA 4UZBA 5IT9Y 1JB0C 2JVOA 3DM2A 3Q8QB 4AL7A 2IM0A 2VPZB 2YTCA 4PABA 4FF1A 4ZCLA 2DRDA 5C5JA 2UXBJ 3RTVA 1S1VA 2QYGA 4PUOB 4K8RA 4DFPA 1WEYA 3WHIA 3BKTA 3DXSX 1NK7A 3G82A 2KT3A 3MR2A 2HNZA 3C15B 1LFWA 3DLEA 1CJUB 4B3SJ 3HK2A 1WACA 3P4UB 4TVAB 1U4BA 5IQQA 1ZTWA 2OI2A 2W2QP 2C28A 3DHWC 4J90A 1V9OA 2WW4A 2XMTA 3QWPA 1SH0A 5HAOA 2V8DA 2MQPA 1M5VC 1Q16B 4USKA 3MM7A 4ED4A 4ZLJA 4NLRA 5KFTA 1RWPB 1YQHA 2D69A 1Q82T 7AT1B 4NXMJ 3OLBA 4P6QA 3MPVA 1GQEA 3EJMA 3SXLA 5K20B 2IIHA 2WB1D 1B4SA 4P2MA 2GVZA 4DL7A 2KXFA 2ZUGA 2RAQA 3N6LA 5CA5A 1WTBA 4KTQA 3NNAA 4JI5J 5HLFA 4KH0B 1UAWA 2IMOA 1EHWA 1T94A 2XYHB 2YPYA 3I82A 4RBUA 4DSJA 1TL1B 4UQTA 1S0VA 2YNHB 2AMCB 3HJVA 4HHJA 4J9OA 4CRJA 2YWEA 5E3PA 1HI8A 1HNWF 1UVKA 3AHPA 1ULRA 2J9DE 3IM9A 2ROPA 1H74A 4H4MA 1FE0A 2R4FA 2AF6A 4IO9Q 1HNXJ 1U45A 3P45B 1U7LA 4OZ1A 2YWFA 4C6AA 2RDJA 4J9PA 3GWCA 2BE7D 2IMWP 3J7Z5 2HNYB 2ZVIA 4UOFA 2MGZA 1BWVA 1Z2LA 4LIWA 4DL5A 3DRPB 5KFGA 2AJFE 2ZUAA 1RAIB 2WZ1A 1S4FA 4FVCA 3LF0A 4CM0A 5AE1A 4OI2A 2EFOA 1LV5A 2M7SA 5ETSA 1X60A 2PGCA 2BQRA 4JI4J 2HWTA 1DAXA 1RWVB 1RTZA 2UU9F 1HARA 3UCGA 1NPRA 1OSDA 4LRBA 1VHFA 1F5AA 3I4PA 2XLJA 1Q8BA 3W61A 3Q8SB 3PFOA 4JBCA 1WG5A 2KM8B 2VASA 3MEKA 5EDWA 1RLCL 1S1WB 1SXLA 3KG0A 2J0XA 5IS2A 3CIMA 1S9GA 1UEKA 3CUNA 3K0JA 1LWXA 1S1WA 3FQLA 2QLBB 3OL6A 2BQUA 5KG0A 4X84A 5T7LB 2RRAA 3NGSA 2LYVA 2NSCA 3M2UB 2DGXA 2J76E 1MWYA 4IH7A 5B09A 8ATCB 5DQHA 1VGYA 2XBPA 2UXBF 4UZCA 3LP2B 2ZNYA 2DH9A 4PXCA 3IS9A 4O3QA 4R5PA 3OV7A 3RBDA 1QLNA 3QNWB 2C2ZB 3AD8C 2GHPA 2IAJB 3UQSA 4DV6F 1OY6A 2VBXA 1GXUA 3NWRA 5CABA 5J2NA 2V50A 1ZYQA 1X5TA 2UUCF 5IOLA 5B0GA 5B7WA 2Y9HA 1RGVA 1I1GA 3NG8A 3OUYB 1BMQB 1TAQA 3H7HB 4FYYB 4OZ0A 2GVDA 2I6WA 3FBEA 4DSFA 2PC6A 1NK9A 4GVBA 3ETOA 3K5MA 3A4TA 2HZVA 5B0FA 2NLWA 1DQ9A 2M8HA 3BH7B 5KFFA 3QGPA 2FVPA 1U25A 1S48A 2H51B 2QFIA 1Q79A 2YNIA 5KFVA 2JEJA 2Y0BB 1TL5A 2UVRA 1SL2A 3GMGA 2CXEA 4L75A 4IRCA 3KG4A 3NGDA 2HS0A 2PSZA 3ZZUA 1X8DA 4WXOA 5ETRA 2GJFA 3QRQA 4YR2A 3FCHA 1M5KC 4LQ3A 2YX7A 4DG1A 3FSYA 1VC5A 5IQ6A 1O51A 3EGWB 2ZH3A 5L9NA 3TUPA 1BWEA 4A8MP 1VK8A 4P74A 2R7RA 2DNRA 2FJBB 3OR2A 3QIDA 3PRVA 4P71A 3MM9A 3VCDA 5BJRA 2CPXA 2FHOB 3BYPA 1C0UA 3POTB 4FNHA 2R7OA 3UFCX 2PEHA 3O3LA 3MAAB 2H3EB 3PO4A 4JI1J 2B9WA 1FA0A 2G9OA 3MR5A 3DRRB 2KJWA 2XSJB 3DXBA 2P6TA 4QYZJ 5I3UA 1D9AA 1QSYA 4JYAJ 2ZJQQ 2MDAA 3WX8A 1NHVA 3MCMA 3T5JA 4DZDA 4G1PA 3ELHA 2MZSA 1FRJA 3PYGA 4TY8A 2UP1A 1FRMA 3TVKA 5GAHI 3M6VA 1UKUA 3OLAA 3Q8VA 2D3OR 2HBQB 2QMUB 3H42A 2X1GA 3OVSA 4DV7F 1X4GA 1CJVA 1JLCA 5ETNA 2DBBA 1HMVB 1TUVA 3V6HA 1VIOA 4S0MA 2VPYB 4C11B 3Q8UA 4XIUA 1WC6A 1IBKJ 1UFKA 3ILLA 4UT4A 2ZM6F 3G6YA 4AL5A 2N82B 2C2RA 3RRKA 3EGVA 2HNDA 1B7FA 1J5EJ 3MTJA 4DR3F 1YITS 4Y28C 1U1QA 2HHWA 2VFTA 2J0WA 3UN5A 1HI1A 2HQIA 4WP9A 1ZZFA 1IQTA 2Z30B 3HKZD 3LGHA 5KT4A 2C3MA 1HR0F 3TJAA 4CM2A 3WBZA 3IWNC 2MXYA 1RU1A 2HAIA 1T9UA 1N6QA 5F0UA 5B0EA 2PMZD 2ZH9A 3BO4A 2RD5C 3FZBA 2M9KA 4EO6A 1P1TA 2N7YA 3M9NB 1YJ7A 3ET6A 3G6XA 3TAQA 1GMWD 2DHAA 1JJ4A 2BDPA 3H5XA 1C0TB 1RT7B 3M8SA 4CLTA 1U49A 4CO3A 4LFAF 4NLXA 3QWUA 3W3SA 1CJKA 2BKNA 1FRKA 3CDWA 5LSLA 4A8FA 4MTPA 4B9VA 4FVMA 3SV4A 1YDLA 2YNHA 2KVQE 2A2CA 2DNMA 2QL7B 2DB1A 1KLMA 2HRYA 5ETMA 3C6TB 3CDEA 3ZZRA 1N5YA 2XNRA 4ILMA 1FRIA 1YJTA 1LWFA 3PV8A 1URRA 3ETMA 4O0NA 5HBMB 4DR1F 1RYSA 3MI7X 4I68A 3GSDA 5C25B 2FC8A 1KONA 3QGIA 5M2UA 3MOZA 4QZVB 2B7CB 2CFXA 2CQ4A 2YY3A 1T3NA 3J81U 4B17A 2HK3A 2D3ZA 1GNKA 4MH8A 3CULA 1RT6B 5DG7A 1VJWA 2CWKA 2JSXA 1FWLA 3NAIA 3PRBA 3JTNA 4MYTA 3J7ZT 3VAIA 1HWUA 1KQGB 3QRPA 1S12A 3T5KA 1AZSB 5DQIA 1F2HA 4LR7A 1QAJA 1A7GE 1ZAVA 2BVZA 2N4CA 3D3BJ 3PG9A 1REGX 3AQOA 1BHNA 2OEMA 1EQMA 5HMZA 4B9SA 2DGVA 1LKZA 1RT2A 1IVZA 3I32A 3QRRA 3MECA 2YPZA 4DR4F 2BJ7A 3SCLE 4KHMA 5JUMA 2QIFA 2MEWA 2VBZA 3PRDA 4NE9C 1YJUA 1UWBB 4DWIA 1RAHB 4LT6A 4KY3A 4FS1A 2HIYA 2PEBA 4M5GA 4JI1F 4W4MA 3F56A 3LPYA 4PPZA 4EGLA 4TQRA 3VHQA 5LL6d 4OI3A 1RHUB 2LA4A 3LP2A 4ZHRB 2PI5A 1NZ8A 3AJDA 2KKHA 4DPYA 2QRRA 2CZ4A 2X1AA 4DV5J 4RW4A 4DV3J 1JNRB 2QSFA 1NK5A 1VQ6S 4CLKA 1G6BA 3PCOB 4RWWA 1MWZA 3VGTA 2ZD1A 2AJQA 1NXIA 1CULB 2C42A 1FWPA 4DDFA 4BDPA 2DNZA 4DV7J 4ZDNA 2QG9B 3KJNB 2HGMA 4X66J 1OS5A 1AA1B 5D0GA 1FDAA 4ZJOA 1QAYA 3HF5A 4B9MA 3KLGA 4OZNA 3CD6S 3UI3A 5IXUA 3WQPA 4N77A 4P2SA 4DR7J 2ZM6J 4OI0A 4ZCKA 2M52A 1TZ0A 2YX4A 4G65A 1XR6A 4ID8A 1CBKA 1NSQA 3SFGA 4OYWA 1N48A 1QY7A 2BYCA 4ZPCA 2ALYB 3LPEA 3V4IA 2CUYA 2WCXA 1AT1B 3T1HJ 1LWEA 2AYEA 3Q86A 5SUHA 1U0SA 4DV0F 4LF5J 3W1YC 4QU6A 4CLPA 3M8WA 3M32A 4FBUA 5DDOC 1YX2A 1NK0A 1BUXA 1YRUA 1FK9B 2W4PA 1S4EA 2FIUA 3FC9A 1N5VA 3VWSA 4ZJQA 1S6PB 5F8LA 1ZZNA 5I3PA 3U1NA 1WC3A 2J6SA 1VC6A 1KBRA 2LDIA 2HVHA 1N32F 2APOA 2LQ8A 1FXDA 4RWXA 1R27B 3VGSA 1DZ5A 3CC4S 1BQNA 3G2XA 3TX0A 4A48A 1XR7A 1OJ4A 5FD1A 3JSMA 1S0NA 2JEGA 2E9TA 4MFBB 3SQGA 5KFKA 4ED3A 4B3OA 2R3VA 1YRTA 2DNYA 1TVRA 5AT1B 2B0GA 4J37A 2BANB 1Y3KA 4LVOP 4I7FB 1R7IA 2MQQA 3VAGA 1ICEB 3Q8PB 2DCLA 1SKRA 2RH3A 1RISA 3PZPA 3MAHA 2Z58B 4UQGA 2HQDA 1MU2A 2WTFA 3BKUA 4JI2F 4N76A 2E1RA 5KFZA 3W2WB 3BSNA 1R8AA 1RUSA 2CJBA 2JX2A 3HZGA 3M1VA 4U95A 3K5PA 1KQSR 3WC2A 4JV2A 2LXUA 1RWUA 3C15A 2XZTB 4YY3J 3ZO7A 3H2UB 4FPRA 1Q5YA 2KHDA 2QA4S 4B9TA 2KXNB 1VFJA 2GQCA 3L9ZA 2MSSA 3NRBA 4KO0B 1K0VA 2F4FA 3MEEA 1LWCB 2GAHC 4C3KA 2E66A 4G1QB 2EXUA 3RRHA 3FVYA 2GAGC 2R7QA 4USJC 4NCGA 1W2IA 4CLUA 3FEXB 5CXTA 1EKSA 2G4BA 2NPIA 2XG8A 4HVZA 4ZS6A 3C2PA 3HHLA 4HEA9 2QFJA 2GZOA 3GFZA 2I2YA 2UUTA 4L73A 2ILZA 4JUZA 3HHLB 2EG1A 3UPFA 5L1KA 4A47A 2M0GB 3DNCA 4FF3A 1MSWD 1X4BA 1SC3B 3D0HE 5IZHA 2C2MB 2XGQA 2P6SA 4B3OB 4IH6A 5E5NA 3IC1A 5K8NA 3MWBA 3FMBA 5LXRA 1KVKA 3R2DJ 1ACMB 3RW6A 3I0SA 2CQ2A 2DNQA 5DRKA 4DQRA 4Q8FA 4I6WA 4QPTA 3R7SB 2C2OB 1NDPA 4JI0J 5DGBA 4GKKF 2OP5A 3MGJA 2J9CA 3P5BP 4OZJA 5KT7A 3B78A 4DV0J 4O44B 1T05A 1SJRA 2A10A 1U6ZA 4USWA 1RWNB 2UV8A 2A6OA 5HVGA 1FD2A 2CKWA 2QTWA 2L9NA 2BBEA 5JXSA 1FO1A 2U2FA 5ETTA 3R1LA 4OJGA 2Q6CA 1VQMS 5J1PA 5F8JA 2DXEA 2ZZMA 1HBMA 1Y4ZB 2WSFC 5L1JA 2HHHJ 1F5CA 4KSEB 4O3SA 5HATA 4IOCQ 2UVVA 2KI2A 5AXMA 1FJEB 1WG1A 2RNEA 2JJ4D 2YQ3A 3EDRB 2VKRA 1Q7LB 5KAKA 2Q79A 1ZBTA 3KJVB 2LDYA 1HNZF 1V3ZA 3P8BB 3BGRB 3MUTP 1X4FA 3EGNA 2E1AA 3IGNA 1S1UB 2YKMA 5FIIA 1TTHB 2GHWA 3FRYA 4N8NA 3RAQA 4B3MF 4C11A 4DL3A 3DLHA 1RAOA 2DT9A 4QIFA 4DX6A 3N5FA 3V6KA 4RW6B 5A2QU 4JI2J 2R8KA 1YJ9S 3M2RB 2EI5A 3EUNA 5H9EK 1XNRJ 4M5DA 1UA0A 1N34J 1M90T 1HQUA 1M5SA 3FFIA 5KFSA 1GXTA 3HSDA 5D4LA 2VFUA 5E3CA 5KFCA 4QWEA 3GFHA 2WSEC 4PEOA 3RYLA 1VQSA 3LO3A 3KTQA 1FESA 4ZP6A 2XHWA 5GVQA 4EO8A 5KFBA 1IKVB 1U2CA 1ZETA 2CZVC 2RE1A 4NLWA 3T9ZA 1IJEB 2MHNA 3CO0P 3UR0A 1S6OA 4DL4A 1HQEA 2E5JA 1MW7A 2JLEA 2OAUA 3IAS9 5HI7A 4F0HA 1D1UA 4B9UA 4DR6J 5DDPC 2IVMA 4RW9B 1NEEA 3V4MA 2X1BA 2V5HG 1SL0A 2FVSA 3KLHB 1UEUA 1UL3A 2KU7A 2KFYA 4B3RF 4USMA 2J9DA 4NZ7A 1X4DA 4RNHA 1RHKB 4CNZA 1YJVA 3D2WA 3EWGA 2CWXA 1JK9B 2DGOA 4AE5A 2DR9A 2VG7B 1R0AA 1FT8A 3LP0A 2DNKA 1LK7A 4ZVEA 5FLXU 1EIYB 1F60B 1HHSA 4KRWA 4QWAA 4DQSA 4ZP7A 1LW0A 4DQIA 4LFBF 3TA1A 2W8LA 3G8SA 4LF2A 2CJQA 1JKHB 2AW0A 4AQYJ 4M1KA 1VQLS 4ED7A 1FX4A 2B8QA 2ALZA 4KT0C 3C8YA 4KQZA 3MD1A 2WBRA 1ZH5A 4D3GA 2EC0A 1A9NB 2OPSA 3K58A 2DISA 4MFBA 3SQGB 2QGFB 1FJGJ 2CPJA 4NYPA 4P75A 1RWWB 1GX5A 3T5HA 2UXDF 1IKWB 1DJ0A 3WZ0A 2E5IA 3C16B 3A3NB 1KLNA 2CPHA 2QZ8A 3DRSB 4R8UA 2LEPA 2ZITA 3WIUA 3JAMY 1IXKA 4FF4A 1F3FA 4GC7A 1EARA 1NJZA 1GMVA 4NI2A 1JJHA 2EFGA 3MMAB 3QAUA 4MK8A 5EUHA 2DY9A 2NXUA 3CO9A 4F26A 1NH7A 5H9FK 1LW2A 4IG3B 1P9YA 1K1QA 3O2IA 1ZM2A 3FDSA 4OX6A 3DHXA 1TP7A 2KB2A 2AYMA 1W7WA 2F8HA 2K3KA 3C6UB 3E01B 4WIIA 3VAKA 3UW1A 2XY6A 3N4WA 1FD8A 2CQHA 4K4UA 4P52A 3PYFA 2CDRB 2R2RA 5D3GB 2MZRA 4LF6F 1IKXB 2CRLA 3LUYA 4ZHRA 2ZBPA 2JEFA 1VMBA 1SJQA 1TR0A 1N34F 3DGPB 3HO1A 2RT3A 2L41A 1UP1A 3BYRA 3MD3A 2N3LA 2E5HA 2IRUA 2FB0A 1YTYA 1IWAA 1ZA2B 3TQEA 2C1EB 4QPXA 3MAQA 4E0DA 2FD2A 3D4JA 4JI8F 1CVJA 1RAGB 4RUBA 2VJVA 4Q0BA 2PFDA 4QJVA 4BLGA 2R2TA 1WOPA 3KLGB 4Q43A 2LP4A 2MZQA 4MYUA 4C97A 2L9WA 1B3TA 1Y3JA 2EPIA 1RLDA 4Y34A 2HWHA 3CCLS 3PDNA 4GO5X 2ZOGA 3SCJE 4Q45A 4CWBA 4C8KA 4K4TA 4DV2F 3G87A 4R0JA 1T05B 3D1OA 2GGPA 1RJJA 2ERRA 1W2BR 3BDPA 4P2XA 5C7PA 2RQKA 3MCOA 2VZ9A 3MM6B 1RHJB 1RT6A 2MQNA 4PPDA 1VBKA 2IC3A 4WYLA 4DN0A 3WIVA 2CA9A 2RKIB 4DR6F 2XI2A 4LRAA 3Q2TC 5BR8F 4CCHA 1RTDA 1XMQF 3FZ2A 1IJFB 3X3UA 1QUPA 3BF4A 1UJ5A 3MEGB 3E2EA 1U1MA 3T6BA 5B0DA 1IR0A 1PJ6A 2NUUG 3K2YA 4JI6J 1SC6A 3GR0A 1DTTA 2DNLA 3GFXA 1Y9OA 3BSCA 1HD0A 3ADAC 3HMJG 3PW5A 2UXDJ 2W7OA 1Y10A 1FF2A 2RQ4A 3EE3A 2H9ZA 2IRXA 3IR6B 4X65F 2OTJS 2BABA 1RTIA 1CJVB 2NUHA 4C8YA 2RVJA 4ZPAA 3MM5B 4NPOA 2DNHA 1HW8A 4RL1A 5DDRC 4DHVA 4J9KA 2B9EA 3A8EA 4U8VA 1JXLA 3MM5A 4WTYA 2RMLA 1M1KT 2AQ4A 4OYOA 2IJRA 4DMZA 2ZH5A 2HNDB 3EDQB 1XMBA 2AJ0A 3EZOA 3M05A 5EX3A 4O3NA 2MZ1A 3DYAA 2XWXA 5J2PB 3ENVA 1H72C 2OSQA 3JTOA 4Y2KA 4WPAA 3N5BA 4A8XA 1NSPA 2Z4PA 4W92B 3Q89A 1NM2A 4KR0B 4RW8B 3AA8A 2AX1A 4BCAA 1WHYA 2N4DA 5DJBA 2QX0A 2F65A 2V4JA 4ECZA 1TL3A 2AJ4A 2BEFA 1N33F 1Y0HA 5CZXA 3R5GA 1KTQA 2J7KA 2G1HA 2H4WB 3RG6A 1PJ5A 2RU3A 2XMAA 4OLOA 4DFJA 3PW7A 1ZM9A 1EETB 3JB9k 2ASJA 3NGUA 4MJKA 5IT9U 4QYZK 3ICLA 3AD9C 3DOLA 4CT9A 4L74A 5KFWA 2EEYA 3V5RA 3L7PA 1QJHA 2L08A 3GB0A 1Q86T 4HTJA 3OTEA 4Y2MA 3NWGA 2RF2A 1NK6A 3D66A 3M30A 2FPHX 4LUBA 4NCAA 2H54B 2C2KB 2HKEA 3MPUB 2W9BB 3H8YA 2VDHA 4PG6A 1RWOB 1VQOS 3BO3A 3MF5A 4EZ9A 2BX6A 3Q83A 1FRXA 3BBBA 3BH6B 5H9FJ 3W8PA 3RB0A 2IDEA 3GYGA 3OXGA 5AE3A 4G1IA 3VAHA 4Q2LA 2AT1B 2HHSA 1LOUA 1N0VC 1L5UA 1I3OB 3SIPB 4FS2A 3M8QB 4XDCA 3CC2S 5L1IA 4EBEA 2RS8A 4N56A 4Q2MA 2MQ8A 1T9WA 1LNQA 4CT8A 3ISZA 4X4QA 4A8OA 3JSMB 5HL7Q 1HYSA 1S7HA 1KHWA 4BHQA 4WF9Q 1IBCB 1P9QC 3GFYA 4I7FA 2BE2B 2EFNA 3AFGA 3W2VB 1IBMF 5CZVA 2DHHA 1UTAA 4NMLA 1DHMA 1GX6A 3OXLA 5D4NA 1AB8A 2C2DA 1DARA 3MPYA 1PIEA 2JL9A 3F0NA 3W7BA 4ZK7M 4TN2A 2R7XA 1LW2B 3CF5Q 4ECYA 2CAJA 3OTOF 5BYSA 2EBGA 3CSKA 1VYAA 4CO5A 1RZMA 4NLGA 3M6WA 1X9WA 2CNLB 1KHVA 2ZBCA 4ZVUB 2AJ2A 4ED8A 5CYMA 5K8OA 1VRQC 2DTJA 4WFAQ 4J9MA 4USVA 1NZAA 4DUYF 2KYXA 1M5PC 2K7KA 1Z2ZA 4MK7A 4OIXA 4DV3F 4MMOA 2DCUB 2ZD1B 3N6NA 4ZN1A 5DG9A 5HLFB 4JI4F 4I67A 1BC6A 2Z8QA 1HYSB 3ZZOA 2W1BA 4RNFA 3HP6A 1IM6A 4DSIA 2QV6A 5F3TA 3CMES 1Z1ZA 5G0RA 4OZ2A 4NLVA 4YB1P 5EWEA 2VIHA 4YMEA 1S59A 2GNKA 3A3OB 4M5MA 4LF7J 4ATNA 2G0JA 5FLXY 4IKAA 7FDRA 3LA0A 4F4ZA 2H1YA 3MHYA 3RZAA 2WK4A 3PIPQ 2AJ1A 4PG5A 4ELTA 4IR1A 3CD7A 2MZJA 3NS7B 1SJ4P 3I9V9 5EHHA 2V34A 5LOQA 3T1HF 4OZ5A 1F9HA 5E0OA 1DTQB 4PZVA 2K1RB 3HULA 4YOEA 2HLTA 2IBKA 3SCKE 4LSNB 2B7BB 2FHJA 2B4UA 2HRTA 3N6MA 1TK5A 2AIRB 2AKWB 3BBFA 4DL6A 3PR4A 4FF2A 1QE1A 4QWBA 4F04B 4F3MA 5IT0A 4A8WA 1PGZA 3W9IA 2KZZA 2PFFB 4NEZA 5IWAF 3AXMA 1U6BA 3T5LA 1XIQA 1DTTB 1AXQA 1WUUA 4WYWA 3RJMB 5HANA 4JV1A 4F36A 5CH7B 4JV5F 3UDLA 1GMWA 1OYDA 4ICLB 1CQMA 3NKYA 1DQ8A 1YKWA 2NQPA 1SQEA 1FERA 3GG1A 4DPUA 1RTIB 2BM0A 4RUHA 3JSYA 5KG7A 1RABB 5A8KB 3BQ2A 2W4DA 3JTPA 3NCRA 3OHAA 2HGNA 1OPIA 5DQGA 1CS4A 2ACYA 2DGSA 2HZAA 2VBYA 4TY9A 2EFVA 3D6HB 4K7QA 4C2MA 1Y5NB 1Y5LB 3K5LA 3AOAA 3GTYX 2HK2A 1SUQA 2EKNA 5D6GA 1IKYB 3Q0AA 3M2VA 4J9SA 1Q4RA 2V9KA 1L3SA 3HHLD 1SCJB 3L09A 2F4VF 5C2GA 2CDQA 4BBYA 2WW8A 5DG8A 3BV8A 2F40A 4H4KA 2IM3A 4CH7A 4FXVA 2V67A 3SQOP 3KKFA 2VC1A 4DOZA 4EI2A 2YKPA 2CQPA 4USTA 4OX9J 1M5HA 1TL1A 3KK3B 3BZQA 2A18A 3I87A 8RUCA 1H98A 2NXJA 2OSRA 3DU5A 3TZWA 3OPKA 1UJ4A 2FGOA 3BB5A 3RUBL 1TKXA 1LW0B 4Z37A 2DIUA 2OTLS 2E5GA 3OXFA 2ATCB 2QMXA 2YWWA 4I2QA 3VGUA 3FMWA 3LTOA 2U1AA 4N8OA 5GAGU 1R0AB 3I0SB 2DEJA 3DKDA 2YQ1A 3GZ7A 2CNOB 2YKNB 4DBQA 1V5VA 3CCZA 5A6WA 4ZITA 2YWGA 3RB4A 2ZBRA 3OD2A 5CD4H 2GGPB 1T3OA 1WEZA 2I9SA 3MOJB 4F02A 2HBZB 4CLYA 4LBPA 1UPPA 3IN5A 3J7YU 1HBOB 4JI7F 4KGMA 1HD1A 3KK1B 3P5TL 5I42B 5CCLA 1YZ6A 1BXNA 3CB4A 3MZIA 3K89A 2VKZG 4MKVA 4PYAA 3BQ0A 4K4YA 5KFHA 1JJ2R 4UOCA 1LEOA 1KD1T 1K0TA 1YRXA 4M95A 3W2VA 4DN9A 3R5CA 2B4PA 3QIPB 4O3OA 2YWKA 5M2RA 1XBWA 2MKKA 2ZH1A 1J5OA 3MR3A 2OPPA 2X3DA 4Y2AA 1RA6A 5K14A 2RIJA 1I6JA 4PWDA 5EWGA 4KE5A 4RU2A 4RZRA 3VQSA 5LSOA 4LRFA 2PA3A 4J9NA 3RBEA 2AGQA 2P9GA 2YX1A 3NGTA 3R9LA 2LQ5A 3TX8A 4ZN3A 4NRUA 2IBOA 2RSQA 3EXCX 3C6UA 2B6AB 3E01A 3UDEA 1WI6A 2NXNA 2VJUA 5L8RC 4R5PB 1LWCA 2YKAA 2MYFA 2QE5A 4YR0A 4DV4F 2F5GA 1WG4A 2XZWA 4X62F 2K2PA 1O0PA 3CWJA 2IAJA 2M70A 3ZZZA 3I96A 1IKXA 1WKJA 1IWGA 5CYMB 1RWXB 2DNPA 4OJHA 3TW0A 1CLFA 1RWKB 2OFGX 2LFVA 4I69A 3DOKB 1RT7A 4Y2CA 3TRGA 1FKPB 3R7BB 3AOBA 3R3TA 3MMCA 2VODA 1U47A 2FC9A 1NRKA 1QTNB 3U7JA 2DRBA 3D7SB 5F8HA 2EBEA 1CSJA 4NLPA 5C2CA 1NKCA 3DI6A 1C1BB 1X5PA 2VG6B 2CPEA 3HX9A 3THTA 1C4AA 3AB4B 2MJNA 1XTZA 1VQ4S 1XR5A 2E5LF 1J5EF 3PW0A 4DR4J 1T0TV 2IVYA 2MLYA 2XO7A 5L1LA 2GQ2A 4C8OA 3OFFA 4DX8H 2ZZTA 3OFGA 3IG1A 2YXLA 2R7WA 3NY0A 1VLYA 2KFZA 4DJBA 3NOCA 2QC3A 2VG7A 3ISNC 1JJCB 2OUGA 2DVIA 2FJWA 3DLLQ 3BGOP 1APSA 4ZVGA 1HQ2A 4LRCA 1RAEB 4YB5A 1X5OA 1FDBA 1DLOB 1UMJA 3CW2C 3RAMA 1E6VA 1Z4UA 3VR1A 4TU9A 2QEXS 4LFBJ 1WC0A 3R7NB 2FZKB 1PCAA 3QBCA 4CTAB 2ZH2A 1SH3A 1NBEB 3GJTB 4PR6A 2KM8C 2VA3A 3RR8A 2OKQA 3DDNA 3IRWP 4TY8B 1NKEA 4LF4F 1ZPWX 2DGTA 2BACA 2C2NA 3PHEA 4ZMMA 5GADI 2K06A 5F41A 3WDOA 3LH2S 1I5OB 1MMLA 1S9GB 3E8OA 3KK2A 4ED6A 2HAFA 1EQ0A 3SYZA 1DQAA 1UWBA 3M9MB 1S5ZA 1T02A 3GV5B 1UZHA 2Y0SD 2WVDA 1BLUA 3NCQA 2X1FA 3IXQA 1HMVA 2BE2A 4OYAA 4AUKA 1HWIA 3N9UC 3BPDA 4GO7X 3G82B 1JXVA 2AHOB 3DRXA 3SDEB 9RUBA 4USUA 4CDIA 2Z0GA 2RB7A 1FNMA 3ISND 3FFIB 5KFEA 3G6ES 1PAEX 1KS2A 3DLEB 4ZCIA 1D9FA 1CC8A 2ACMA 4RNMA 2MKSA 4P73A 3PR5B 3LAMA 3B4DA 1FHTA 4KFBA 1YJWS 2HFOA 4IRKA 2CPZA 2QA2A 5GMEA 5EN1A 1AYEA 1TL3B 1NHKL 3S1TA 3TUIC 5F9NA 2AU0A 4GRSA 5HMYA 2M8DB 2EKYA 3QJJA 2DHXA 4C3LA 4DPWA 1MNEA 1C0TA 2JZ5A 4URQU 1S76D 3TUJC 3KWMA 2O5DA 3ZZ0A 1CJKB 2R8IA 3BN7A 4HT5A 4KC5A 4HYKA 3GILA 3OSPA 3M6UA 3HHEA 2G2ZA 3MMBA 4PYDA 1S57A 4AL6A 2HSEB 1N5QA 4EU0A 4X4RA 2GMLA 1KLMB 2MJUA 2ZEJA 3JQJA 1X4EA 3NNCA 4CYUA 3PM9A 4N47A 2CQDA 5K8MA 4OYZA 2IM1A 4ZP9A 5HBMA 1VQNS 3KDOA 3DC2A 2XS5A 3EGZA 4NCBA 2FJVA 3G71S 3CCES 4X2BA 4Y6IA 2RRBA 2QMWA 3CJKA 3RR7A 3UVJA 1HNWJ 1WTFA 4ZPTR 1PJ7A 1YG0A 5KG1A 3HXMA 1FJ7A 2WAQD 4O0IA 2Y8WA 2HQCA 1UVNA 4PWDB 2B56A 4X66F 4KPYA 1R31A 2AP6A 2C2EA 1JLGA 3J7A1 4M5LA 4ES2A 1RSCA 1SV5B 3X1LB 1NNDA 1NU4A 3HJFA 4DR7F 4IO1A 2PA8D 3M8QA 5HJYA 1KR4A 2RKIA 5DDQC 2HW3A 3O1LA 3T6JA 3TA2A 1HBUA 3CE8A 3MEDB 4NMXA 4MKAA 3CPWR 2Y1IA 4X4UA 1HBUB 3DCAA 3MEDA 3FNNA 4LF4J 1YLXA 4ID5B 2BRKA 2DGUA 4YR3A 3T3FA 5F9LA 3IM8A 1TMMA 3K5OA 1T03B 4IH5A 1MU2B 5T7LA 4NXNF 4DS5A 2DRAA 3OVAA 3IGVA 2RHSB 3IWXA 3HFVA 1PKUA 3WX4A 4LF9F 2CADA 1F0XA 2W01A 2GFFA 1E6YA 1HWKA 2I5JA 3PACA 4IYQA 4KKOA 4O4GA 2Q43A 3BM7A 4PXBA 4ZLPA 2A0FB 2DIVA 3NEKA 4KH1B 4IR9A 2VOOA 4IFYA 3N01A 2CNNB 3GQCA 3B54A 4GKKJ 1D09B 1S1XA 1S79A 2RHQB 1HFEL 3O6QA 4G1QA 1S97A 2CPYA 4IRDA 2CIMA 1VCTA 4PG4A 2MKJA 4Y00A 2HVEA 1Q81T 3OSNA 3RB6A 5GAGI 4LF5F 1O8BA 1RHQB 1TKTA 1JLEA 4DV6J 4PG8A 2GVDB 2B4VA 3UCZP 3GIKA 1U02A 2HWIA 4ANEA 2EG2A 4HT7A 3CD5A 2V0NA 4FDFA 4GVBB 4C48A 5KG5A 1MROA 2ADCA 1K44A 2E9RX 3IWLA 4DPOA 2POKA 2OHDA 4M5HA 4WP3A 5C24B 3C14A 3TAMB 3FEZA 2ZNZA 3D54A 3THPA 5IV3A 1VISA 4OZ3A 3W63A 4BC9A 2C3UA 2CJ9A 1YBUA 3HVAA 2FTRA 1XWLA 1JLQA 2DO0A 2HFSA 4RBTA 3TP2A 4CLWA 4YY3F 2XCPA 2G1DA 4DCPB 5CCMA 3H5UA 3H5YA 4RW7B 2W8KA 3EZ5A 2R8GA 2XB2D 2DITA 1XK8A 4OHYA 2UUBF 1FE4A 1AW0A 4BWMA 4YS2A 5L46A 1VQ7S 2VD3A 1D9DA 1SQGA 1LXJA 2ZH4A 3TEGA 2XEXA 3PKYA 4C0BA 4ZLNA 2KG0A 3M8PA 3WC0A 4Y0FA 1C0UB 1DTQA 1W26A 4DUTA 3KOAA 1DLOA 3AB2B 2HQGA 4DZ6A 4RO0A 4F3QA 3BEGB 5CHCB 3V81B 3GIRA 4J9QA 2RUGA 2ILYA 5J1NA 1N8RT 3LGMA 3E3XA 3Q8YA 2DNGA 4PRFA 4PXDA 4HTIA 1N4LA 2HHQA 2PMWA 5I42A 1Y5IB 1JQGA 2IA6A 1TVRB 3KK2B 4RR5A 4JI3J 2HZCA 4F4AA 2JHEA 4NZ6A 4P72A 2Y1JA 3QIPA 4XTTA 5MLCV 5FDLB 5J1EB 2R8HA 1O5JA 1WKKA 2EW9A 3M1VB 1TUWA 1R8HA 5FDLA 3NBPB 5J1EA 3BSAA 2XSFA 3PX0A 4BC7A 3NBPA 5J2PA 1CPZA 2Z2LA 2JC1A 2V8HA 1XMQJ 1EP4B 3W9JA 3JAMU 1CULA 1FRLA 4ZVRB 1U1NA 1H7XA 3GIJA 1U1RA 2YH0A 2W7AA 1YGYA 3QMQA 4HH0A 4XPEA 5K8PA 2HQFA 2JNJA 2XMMA 5KT2A 2JEIA 2FQQB 2KYZA 2QYCA 2B8PA 2CQCA 3DGPA 1NB2A 2MB0B 4AFFA 2HEKA 3I0RA 3KK3A 4K0KJ 3CGIA 1JLFB 2OIHA 4UUXA 2N7CA 2B9YA 3KDNA 2H48B 2H5EA 3T9NA 5M2PA 1TKDA 3MMCB 2HFNA 2AZ3A 2DPIA 5E3QA 3CCMS 1OQ6A 2E1PA 3QGHA 2R7SA 1K47A 1L3TA 4ZPWR 4K50A 1SC1B 5LJ3Y 4MK9A 1QD1A 4ZPVR 4WE1A 3D6TB 1PC5A 3P96A 2VICA 5T41A 5DGAA 1SJ3P 1N5SA 4J91A 3IA0A 2KFNA 3L4BC 2OH2A 3CJRA 3CJKB 4CH0S 2Z57B 4HLBA 2HRUA 4NA2A 3C46A 5B0AA 3AT1B 3NMAA 2YH1A 2GA7A 3P6YC 3KLIB 4USIA 4IFVB 2ZZNA 4P2FA 1X4AA 4A8QA 4F7VA 3MFIA 2YKNA 1QVFR 3QT8A 4KPCA 1VR6A 1JNZB 1N36J 1NHUA 3CJTA 4LRDA 4TXSA 5E3RA 4B3MJ 2W2MP 2DH7A 4RLEA 5KFIA 1WI8A 4KBIA 3TVYA 3FJ2A 2G0IA 2IYGA 2R7TA 1I51B 1HBOA 3BGUA 1VDHA 4LMZA 3KG1A 3I5AA 1GFWB 3EXYA 2NREA 2IA0A 4WTOB 4B3TJ 1B64A 2CNKB 2GCFA 1TAUA 3CEDA 1R6YA 3ZTOA 5LXYA 4DQPA 1X7VA 1VIXA 3DGVA 3OJSA 1MMNA 3L3CA 4KJIA 2OGUA 3CCTA 4M5KA 5KOXA 4FNIA 3GPAA 4LBHA 3PW2A 1T11A 3KJQB 1J27A 5KFRA 1HBNA 5GMDA 3W5ZA 4AQYF 2BR0A 1KP6A 4WBFA 1LK5A 2IDLA 5L9XA 2RJZA 1TFWA 5D3GA 1JX4A 1S1XB 5FJ4A 5IC4B 3SDEA 1SC4B 3TUZC 3E51A 3HPOA 5J2MB 3VQTA 4IFYB 3R1HA 4ZA1A 1F9FA 1P1LA 2WVBA 3GU0A 4Q8EA 3BSOA 1TMJA 5AXNA 3K5NA 4DSLA 1TKTB 2VDIA 4L72B 2D74B 1HW9A 2WONB 4YN3B 1R8PA 4QR1A 3QO9B 2WVCA 4DR2J 1SUQB 3FBBA 4GKJF 2X3GA 1Y00A 2MKIA 1VQPS 4DV5F
chains in the Genus database with same CATH topology
1WD6A 2EFPA 1M5OC 5F8NA 5KFOA 3DLKB 5A8WB 3HDSA 3R5DA 4O3PA 3FRZA 4C98A 3I6PA 4E8UA 3ITHA 3UE2A 3RAXA 3SSSA 2YNIB 2E1MC 1S9EA 3QPIA 2COLA 4L3NA 5IM0B 3TARA 1ELOA 5MAOA 5KFJA 1HNIB 2VPWB 1FK9A 1X4CA 2YVSA 3VAFA 4LFCF 2MKHA 4QQBA 3M32B 3V2UC 3ENWA 3LGNA 3AJ1A 2KTQA 2XMUA 4A8KA 2IYIA 4KB7A 1YVFA 2KXHA 4RU9A 5HMWA 2NYIA 5K5MA 2XGPA 3PX6A 1VQ8S 2ZC3A 3Q2SC 1C1CB 4C0HA 3PIOQ 2XMWA 1S1TB 4DL0C 4L6V3 1TK8A 1KTVA 4A8FA 1D3WA 2Q1LA 2LQJA 1I94F 4Z2XA 1JLCB 2F3JA 1CC7A 1TL4A 4HDHA 5E41A 3J7YI 1WF0A 2V9WA 2HVIA 2LXFA 4PWUA 5A0YB 1SJFA 3PJWA 3BR8A 1WEXA 3MFHA 5KFAA 4FP9A 1X9MA 2VBWA 3AAWB 2D7SA 1FTCA 1FEHA 4XO0A 2BM1A 2WSCC 2M4MA 2ZFHA 4URSA 4K4XA 1JLBA 1UVJA 3ENQA 2F9DA 3Q8RB 1NH8A 2J6UA 4NXMF 4O4GB 2IM2A 4CO1A 2FUG9 4PQUA 4ED0A 1JXEA 2L3MA 2O67A 3AJ2A 3HKWA 2R7UA 4ALZA 4RNOA 3KHRA 1S6QB 3O44A 4TNOA 1Q1KA 5KT5A 1M0SA 1S6QA 4QWCA 4ECQA 3S6EA 1R3NA 3OL8A 2HFZA 4WFZA 3KLFB 3I0RB 5B08A 1P6TA 4WU2A 1NO8A 1Q53A 4TYAA 4UY8T 2C3YA 4CI0B 3LP1A 3MUMP 5HP1A 3MMBB 3RB3A 1P27B 4F67A 1QM9A 3V6DB 1LXNA 2IJFA 3ONQA 2MY7A 3I31A 3H25A 1RKIA 1RA7A 3NS6A 1JKHA 4B9LA 4U7CA 1CEZA 3TA0A 3IO1A 2L48A 4CIOA 1PILA 2HG4A 3AY0A 4O4RA 3G96A 2ZH8A 1BD6A 4LJMA 3BS9A 5A2QY 5G4DA 3HT3A 1URNA 1N88A 2MY8A 3TOQA 1NK6A 4N5SA 1H2VZ 3IBWA 4F8RA 4K4SA 1JLAA 2DNNA 1S49A 2V4RA 1IN0A 3S01A 3C66A 2OPRB 4JV0A 4RUCA 3CT9A 3V81A 1HI0P 2AGOA 2PI4A 3GV8B 2XMKA 5EX0A 1SB6A 3OW2R 2EWHA 4DSEA 2ZKUA 2UUWA 3F41A 4OZLA 5JJBA 3L95X 1TV6A 5KG3A 2M88A 3ZC4A 2D41A 3BGRA 5JVGQ 2XLIA 4K5RA 4C8NA 1BY9A 5D78A 3OFEA 5KG6A 4EWTA 2XY5A 4CNYA 1S1VB 3HHKA 3SV3A 5DLFA 4PRFA 1CG2A 1TKZB 4K5SA 3DYAB 1NK4A 2VB6A 3G4SS 5J2MA 2F1FA 3QYYA 4RW4B 5HQ8A 1N5TA 2QT7A 4OL8A 4DV1F 2HHVA 3BN4A 3M2VB 5LSRA 3VALA 2LKZA 1JIHA 4NLSA 4K4VA 1D8YA 1JLEB 2FLNA 4AXJA 1F2GA 4C4WA 1UETA 2QA1A 4TKTA 4C7QA 4NZ0A 2ROEA 2AWZA 4HKQA 4Y65A 1B0VA 1Q78A 1GAOA 1SIWB 2F8EX 2HQ3A 3PNIA 2R2UA 2LMIA 4I64A 4TLQA 2G13A 4I0WA 2JFDA 3MUVP 4K59A 1KN6A 4YEAA 5IM0A 4P7TA 2NR0A 1BQMA 4OI1A 5LMUF 4HL9A 2VONA 1UA1A 2RQMA 3JSBA 3CDUA 5LT5A 1FJGF 3MM6A 3LAKA 3OR2B 3BQ1A 4QWDA 4G6VB 2Y1RI 1R8BA 1A6LA 3QLHB 2R8JA 4LSNA 2P9EA 1K8AT 3HFKA 1BQNB 4IFVA 2LECA 2YNGB 5THWA 3ZZTA 2OD6A 4R25A 1RTHA 2QO3A 2MMYA 4YB7A 1YBAA 1MMDA 3KHLA 1FXLA 2YWHA 4OHWA 4CZCA 2RRNA 2UUAF 4IUFA 5I4MA 1U2FA 4WFYA 4WJBA 2RS2A 2DD8S 1RT5A 2IFXA 1S0MA 1IBKF 1VOMA 4ICLA 2XY7A 4NYZA 1KSPA 3SSRA 1FVSA 3US5A 5C42A 3MMAA 3VZIA 2WOMA 3OQ2A 4B08A 2EVZA 1VQKS 5IFMA 5A8KA 2QA4G 2ZH7A 2VH7A 1RT4B 1WNEA 1SJ1A 2D9OA 3DN9A 4ETZA 1U1PA 2ZHOA 1GTEA 3V6JA 5A6PA 3HVRA 4TQSA 3KNGA 4IG0A 4ZCMA 1S6UA 4K4ZA 1XERA 3IFEA 1D8ZA 3HHLC 1WHWA 3D1HA 4U7UK 3FGVA 4R0EA 2E7XA 2BA9A 3R27A 1ZOTA 4LIRA 1U24A 2W7PA 3KLEA 1B0PA 1GT8A 4YB6A 2P9CA 4PXEA 4GMKA 1GTHA 2DK2A 2ASDA 2E9ZA 1WF2A 4KV8A 1JLFA 2ZOMA 4WK3A 4NX9A 2X51A 3BGLA 3KLFA 3GIIA 4KV8B 4MIWA 1LFPA 5A8RA 5LMNF 4EYHB 3I9ZA 3HZEA 3OR1A 1AFIA 2RDIA 5F8MA 5A8RB 4F3OA 1CQNA 4OJ1A 2AYGA 2EK1A 1FDDA 3D0IE 1HPZB 2XCAA 4USHA 3EYZA 1LQ9A 1FNXH 2DR7A 1XMOF 2F9JA 3MURP 4DF4A 1HPZA 4DFKA 4IQMA 4IQXA 3H4DA 2A2DA 2K7JA 4DG1B 1T7PA 1UJ6A 2ZE2A 5JVHQ 3BDEA 5HROA 1HNIA 5E3AA 2LQ9A 2ZE2B 4JI5F 2F8MA 1YWXA 5CYQB 2CPDA 2O66A 3K59A 3OHBA 1RT1A 5ITHA 2I8EA 4J9RA 1VBXA 2KG1A 4WZMA 2ASLA 2W9CB 2OPQB 2W24A 3DRRA 1RT2B 4FYDA 1QAIA 1HNXF 3D5MA 4IDKB 1HBMB 4DFMA 4F25A 2ZC4A 2CJAA 4EUVA 4J9LA 4WCEQ 4PKDB 2VA2A 5J2QB 3QZ8A 4OQJA 4U9RA 4YUDA 4YP3A 2LU2A 3IS9B 3AH6A 3EPIA 2B6AA 2LEBA 2DR5A 2E29A 2YKMB 4ZP8A 2W4CA 3CCRS 4ECSA 1HQUB 2GMHA 3G9CA 3MM8B 4I6AA 3ZFVA 2HNZB 4WK1A 2R7VA 4OFZA 5B0CA 4HI2A 2JRSA 5J2NB 2CYYA 4NLYA 2Q3PA 3S8SA 4X4VA 3K8VA 1S9FA 4X4SA 3S7RA 1ZTTA 4X4OA 1RDRA 4YDXA 1VQ9S 2BV3A 2V4JB 3EZUA 5KFYA 3MR3A 1U1KA 1HQEB 1RTJA 3CD0A 5H1SV 1DRZA 3DI6B 3P3DA 3QJLA 1EETA 3BJYA 1G3OA 3A1YG 1B0TA 2KRRA 1JMTA 1HWJA 5CQGA 3M9OB 2B51A 4ELUA 2CG4A 2GW8A 1R8CA 2BZ2A 2AD9A 1L3VA 4RW7A 3KMQA 1KFDA 3LP0B 4ETXA 4PQAA 3V4IB 1V3RA 4B9NA 1GH8A 4MIBA 1H0HB 1NJIT 3C6TA 1R89A 1VC0A 2Z2MA 2FGCA 1TFYA 2NZ4A 3FEYB 2MZTA 3QLHA 4NWBA 3HHNB 3CMAS 3MM9B 3SI8A 3LALA 5DETA 3ZZPA 4FN5A 5C25A 2J0QD 5I3UB 2NPFA 1VS3A 3K7RA 2MGZB 2E1CA 2R9LA 3MR6A 2KT5A 1U2RA 2MSTA 4TU8A 3H20A 4QBUA 2ZHAA 4QW9A 2CVEA 2XI3A 4Q44A 3KK1A 1SV5A 1OPZA 2BRLA 2OMLA 2ZBIA 4QIGA 1BGXT 3ZZYA 3DM2B 3CJ3A 5T14A 4C3MA 2QLXA 3M8RA 3TAPA 3OBIA 1XNQF 2OPRA 5EGYA 1QVGR 1NKBA 4A8SA 4TU7A 4LF8F 4RNNA 1VRTA 1L3KA 1X5SA 4PCQA 3OJUA 1HL6A 3DLGB 1X4HA 1G2EA 3LOUA 1KQKA 2VG5B 2B4OA 1OQ3A 1H3DA 1E6YB 4KKOB 1IKYA 5D77A 4F2SA 2NSBA 1HWLA 2GMJA 4PG7A 1N54B 4C8LA 1TKZA 3NP5A 4HI1A 2UVWA 3THVA 2HS4A 3VZHA 1ZAWA 4KO0A 3SMZA 3TYTA 1REVA 1NB7A 3H2LA 1KQFB 5AXLA 4Q5VA 2B3TB 4QIEA 1X9SA 1T95A 1HA1A 3U02A 1RP5A 1AFJA 5DO2A 2A1BA 1XN9A 4Q0BB 2HGLA 5G0RB 2PD1A 1GXLA 3HVTB 4XK8C 1VBYA 3V6DA 4K0KF 1SL1A