1OWXA

Solution structure of the c-terminal rrm of human la (la225-334)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
113
Chain Sequence
HHGSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lupus La protein
publication title Structure of the C-terminal domain of human La protein reveals a novel RNA recognition motif coupled to a helical nuclear retention element
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08777 RRM_3 RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1owxA00
3NS5A 3G96A 2OJ3A 2D9PA 3IWNC 2KHCA 2AYGA 2DGSA 3S01A 3MUVP 2OTJS 1DBDA 1ZH5A 2ADBA 1PGZA 1N54B 1X5TA 2XB2D 3CD6S 3NNAA 1SJ3P 5CYJA 3RW6A 1YTYA 1X5PA 1DHMA 2J0SD 4QU7A 1WF2A 3MD1A 4C4WA 1OPIA 2DNHA 3PIPQ 3I56S 3OW2R 3J7YU 3PIOQ 2JRSA 2KFYA 1FJEB 2LEBA 3SXLA 2WBRA 4WFNQ 1FO1A 2X1FA 1AUDA 4WIIA 3TYTA 2A3JA 2M70A 2CPZA 2KYXA 3P3DA 2HVZA 3EGNA 1YI2S 1VC5A 2L41A 4LIRA 2LYVA 3G8TA 4WF9Q 2HZCA 2LCWA 2KU7A 3THTA 1VQ6S 5LJ5Y 1VQ8S 1K8AT 1U1RA 2L08A 2LA6A 2UP1A 2KN4A 2MB0B 4OZ1A 4YUDA 2CQ3A 2VOOA 2CQHA 3CF5Q 2VOPA 2DGXA 2EK1A 1U1QA 4LMZA 3TP2A 2KM8C 1RK8A 2HYIB 2CQ0A 1WEZA 2HGLA 3B4MA 5DDRC 3G8SA 2MZQA 4PRFA 2BZ2A 2KXHA 1WHXA 1WF1A 2MZSA 2DNRA 3VF0B 2ADCA 5JVHQ 1M5PC 2MPUA 3FEYB 3U1LA 1Q81T 3R27A 2CQ4A 1DZ5A 2X1GA 1U1OA 4QU6A 4F02A 1UP1A 3CC7S 1NJIT 1JMTA 2DO0A 5IM0B 2MGZA 2KXNB 3VAJA 1FJ7A 1H6KX 3UD3P 1SJFA 2X1BA 1D9AA 1WWHA 1X4GA 5LXYA 4Y0FA 3G71S 3MUMP 1X4CA 1U1MA 4V19X 1VQ4S 2XS7A 5HO4A 2RQCA 5GAHU 2J76E 3VALA 1A7GE 1O0PA 3D2WA 2RS2A 5IM0A 3NNCA 5IQQA 3CPWR 2VODA 2DNLA 2B0GA 2DGUA 4A8XA 2DGQA 4CQ1A 1WEYA 1PO6A 3U1MA 2LA4A 2AD9A 1A9NB 2DNZA 1UW4A 3L3CA 1WG5A 2X1AA 4F26A 3N9UC 1VQMS 2CQPA 2MY7A 5BJRA 4TLQA 2D9OA 2E44A 2DGTA 3P6YC 1X5SA 2G0CA 4WKRA 5LJ3Y 2FPHX 4LJMA 3ULHA 3VAIA 3UE2A 3CC4S 2KG0A 5GVQA 2RNEA 2LECA 2MZTA 1SXLA 2DB1A 1KQSR 1VQLS 2MYFA 1X4AA 2XNQA 1KD1T 2KI2A 4Z2XA 2MQLA 2MQQA 2MQNA 2ZJRQ 3CCSS 1VC6A 3J7ZT 2CQ1A 2PEHA 1OIAA 1BY9A 1M5VC 2HGNA 1QM9A 1RKJA 2XS2A 2CQBA 3CCLS 2RUGA 1YHQS 2MQOA 2DNNA 1FXLA 1HD1A 1VQ5S 3S6EA 3THPA 1VQKS 2L9WA 4Y00A 1X4DA 5JVGQ 3CCJS 1YIJS 2RVJA 2CJKA 1UAWA 4FXVA 2PE8A 2GHPA 2CQIA 2AYBA 1F9FA 3LPYA 3SMZA 1ZZFA 2BOPA 2M8DB 3B4DA 1M5OC 1X5OA 4P6QA 2DGVA 2F9DA 1IQTA 1X4EA 1L3KA 3FEXB 1VBZA 2DNGA 2V94A 4QPTA 2CQGA 1K73T 2KM8B 3MOJB 1U6BA 2KH9A 3CCRS 3NNHA 1WEXA 3V4MA 1WG4A 3TO8A 1YJWS 4EGLA 2MJUA 2CPEA 1SJQA 2JVOA 2YWKA 5GAEU 2EVZA 2CQDA 2CPXA 1KOOA 2KT5A 2DITA 3US5A 3VAHA 5CXTA 3RW7A 4RU2A 1YJ9S 2O3DA 1FT8A 1WELA 3NS6A 4PKDB 5GADU 3VAMA 1S79A 2NLWA 2MXYA 5H1SV 1YWXA 2OSRA 2CPHA 2M88A 3BO4A 2DH7A 2M2BA 2J0QD 1UFWA 5LSOA 2DISA 2QEXS 1P1TA 2DO4A 5HL7Q 2LEAA 3G4SS 1H2UX 2KVIA 2XSFA 1Q7YT 1VQPS 1U1NA 1U1LA 4YOEA 3CUNA 3R1LA 2MSTA 2N3LA 2MZRA 1VC0A 4ERDA 2MJNA 3CCQS 1X4HA 1WF0A 1X0FA 1H2TZ 3BEGB 3DLLQ 2FC8A 1W2BR 2MY8A 2RQ4A 4YB1P 3UD4P 1X4BA 4IUFA 3CMAS 2ZJQQ 5DDQC 2LXUA 1M5KC 1URNA 3EX7B 1FJCA 1JJHA 5CA5A 2N82B 3G9CA 1X4FA 2MHNA 1WI6A 2MSSA 1H2VZ 3UCUP 3Q2TC 4ED5A 2RS8A 2MKIA 2FC9A 2LMIA 1WHVA 2DNQA 3H2VE 4OZ0A 2KG1A 3UCZP 2CPJA 2JX2A 1G2EA 2G1DA 2AYMA 1VQOS 3CMES 4TU8A 1VBYA 1OO0B 2JVRA 3CXCR 2MZJA 2RRAA 2U2FA 1WHYA 2DNOA 1U1PA 4BS2A 1HL6A 1Q82T 2DH9A 2N7CA 3R1HA 3P49B 4F25A 2N3OA 2DK2A 2DGWA 3ZZYA 4U67Q 3VAGA 3CCVS 2M0GB 1S72S 1HA1A 1WI8A 2F3JA 2M52A 4FXWA 1R8PA 2DNMA 2AYEA 2FHOB 2MMYA 2MZ1A 2MKSA 1DRZA 4CH0S 2FY1A 2MKHA 2RRBA 4TU9A 5GMKa 1JJ2R 2QA4S 2G4BA 2M4MA 5LXRA 1U2FA 1U1KA 1P27B 1ZZNA 1WG1A 3G6ES 2YH0A 3VAFA 2K8GA 1NO8A 3VAKA 2KRBA 2E5HA 4C0OC 2F9JA 3DXBA 3MXHP 2MKKA 1XN9A 2SXLA 5ITHA 1HD0A 2XNRA 1OWXA 5DM7Q 2M8HA 3IRWP 3LQVA 2MKCA 1M1KT 2DHSA 4ZKAA 3CCMS 2I2YA 1N52B 1N88A 2YH1A 2KRRA 3SDEB 4WFAQ 1KC8T 2YTCA 2M7SA 1Q86T 2CQCA 3BS9A 2NZ4A 3I55S 3JB9k 5EN1A 2DIUA 2E5GA 2DNPA 3CTRA 3P5TL 3MDFA 3SDEA 4TU7A 3MURP 4UY8T 4CH1A 2OSQA 3ZZZA 4CIOA 4IO9Q 2CPDA 5GAGU 5DM6Q 3CCES 5DDPC 2CPYA 2JWNA 2I38A 2DGOA 2MGZB 2RT3A 1QVGR 2MQPA 3CCUS 2U1AA 2CPIA 2CQ2A 3UWTA 4M5DB 2E5IA 1FHTA 4PR6A 1QVFR 1VQ9S 2M9KA 2DNKA 5IFMA 3HHNB 1N8RT 2KXFA 2YKAA 2OIHA 4WFBQ 2HGMA 1SJ4P 2QFJA 2ERRA 3CULA 2MQMA 2DIVA 2D3OR 2K3KA 2E5JA 4IOCQ 1FNXH 3UCGA 2LKZA 5MLCV 4C7QA 1WTBA 5FJ4A 2J8AA 1CVJA 2GO9A 3HI9A 1YJNS 2VONA 2ZJPQ 1WHWA 1D8ZA 4J5OA 2DNYA 3S8SA 2LQ5A 1VQ7S 4W90B 4W92B 2DH8A 3H2UB 2RU3A 3MUTP 1U6FA 2Q79A 5DDOC 1B7FA 5D77A 3BO2A 5DETA 1K9MT 1SJRA 4UQTA 2XS5A 3Q2SC 3MD3A 3EGZA 1R8HA 1VQNS 1YITS 3CC2S 1M90T 4WCEQ 3S7RA 2OTLS 2DHXA 2DHAA 2DHGA 3MI7X 2LXIA 1NU4A 3K0JA 5LSLA 1JJ4A 2MKJA 4QQBA 2CPFA 2EK6A 4IOAQ 5D78A 3BO3A 1VBXA 1KOHA 3NMRA
chains in the Genus database with same CATH superfamily
5M2PA 1Y11A 4CLUA 2R7SA 4IH6A 2HNZB 3AQOA 2VKZG 1ZH5A 4HL9A 2NYIA 2IBOA 1X5TA 3PW2A 1UVKA 3TA0A 2GC8A 2J5AA 2HQIA 4LF5J 1RT1A 4DZDA 1V3RA 2Z4PA 4TXSA 5KFMA 3HMJG 3MR2A 4N8OA 3PCOB 2QC3A 1R8BA 1XK8A 3C14B 4H4KA 2C2KB 4ANEA 1KR4A 3DN9A 2MPUA 2OEMA 2R42A 4X64J 4F3QA 3KLGA 2DO0A 3GILA 1YLXA 3IFEA 3RBZA 3KLFA 4YEAA 2CG8A 1IJFB 3FMBA 5KG3A 1UTAA 4X2BA 2AJQA 1GX6A 4U8YA 4BCAA 1L5UA 4QW8A 2LQJA 2YQ1A 1JB0C 2UZAA 3QNWB 2J9DE 1QSSA 4QYZK 3DCAA 2BKPA 5K14A 4ECXA 3VAIA 3ZTQA 3UE2A 2CJXB 2FJAB 4DQPA 2KI2A 3UNGC 1QAYA 2GIRA 1NDLA 1I94J 2CQ1A 4HHHA 5ETSA 1H7WA 3MFHA 1TKDA 2B43A 2RVJA 2BJ3A 3MPUB 3A3OB 2AZ3A 4ZDNA 4Q7AA 4K7QA 3B4DA 4K4ZA 3OHAA 2H5IB 3MOJB 1CC7A 4DS4A 5KG7A 1Y0HA 4ZJQA 3EYZA 2V4QA 3NWGA 5HVHA 1HQ2A 1DY3A 4RU2A 2P9CA 3KTQA 4NLXA 5F8NA 5H1SV 2IM2A 1WSRA 3EZOA 1N4LA 5CQGA 5KTQA 4GO5X 1JIHA 3MEDA 1KWMA 4P75A 4LF4F 1M5SA 2ABYA 2GQCA 4X4PA 1YBAA 3UN5A 1V6HA 1F9HA 1WF0A 4ZCKA 2E1RA 2RDJA 5GMDA 1S1UB 2LXUA 2HIQA 3G9CA 4O3OA 4OYWA 3DGVA 2FHJD 2MHNA 4ANDA 2MSSA 1FRXA 2YWWA 2MKIA 3LOUA 2VPXB 4FN5A 4A8YA 4UW2A 2HWTA 2ZUGA 4PWUA 2IY5B 2DH9A 1IBMJ 1RHKB 2DGWA 4DFPA 4U7UK 4HTJA 3MR3A 2M52A 4ICLB 3GE9A 2RJZA 2AYEA 4FYYB 1TP7A 4NLYA 1RBOB 4DWIA 4DPXA 4K8RA 2GV1A 2VB6A 5AE2A 5HVFA 3VAKA 2MDAA 1RXOB 3MM6A 1OQ6A 1LNQA 3HZGA 2ZOFA 5IOLA 2Y8YA 3MM8B 1ZM9A 2ROPA 2FVQA 3H5XA 3CCMS 3K17A 1G4CA 3MAHA 2JSXA 2GVZB 2ZD1A 1J2VA 4F4AA 2E66A 2YNIB 4WJBA 3UI3A 1RAEB 4KIAA 2CPDA 1FDDA 4H4KC 2CPYA 3QZ8A 4KPYA 4OX9J 1XNRF 2V63A 4KYZA 2MHEA 4BWJA 2Y1JA 3J81Y 1JLBB 3T9NA 1S6QB 3PHTA 2YKAA 1S1XA 2W7OA 2ERRA 3CULA 1HPZB 2VA3A 2D3OR 1DTTB 3IR7B 3IBWA 4FBUA 2P9GA 4UF4A 2LKZA 5MLCV 4IDKA 2K1RB 3HK2A 2V2VA 5E3CA 2W2NP 2GO9A 3HI9A 4PXBA 2HNDB 2B4VA 3KG4A 3CJ5A 3C8YA 5LSRA 3JTOA 1HQUA 2H5JB 3QQCD 1WJ9A 1T9VA 2HZVA 4DR2F 3JSMA 1Y5IB 3GJTB 4B3TJ 3NGTA 4UT4A 4USMA 3QWPA 4QWEA 3VCDA 1S6OA 2AJ4A 4QQBA 4ZK7M 4LFBF 1CJVA 2HRTA 4ZPBA 1V3SA 1OSDA 2A2DA 3MCMA 2DGSA 5F0WA 2V4RA 3ILLA 4MT1A 1CJUA 3O44A 3JAMY 1YTYA 1PAUB 3V6KA 2J0SD 3MMAA 5KT7A 1VHIA 3QATA 2A18A 1REVB 4RW6A 3MOZA 4RBUA 3UO0A 4PQAA 3VVUA 3J7Z5 4EZ6A 1YRXA 2LA6A 2VOPA 3GG0A 2RRNA 4E98A 3K89A 2BE2B 5KT2A 1HHQA 3FFIB 3DMJB 3Q0AA 3RRGA 2BE7D 3OVAA 4F02A 1DLOA 2KL8A 2GJIA 3VAJA 2IDEA 1SC6A 5AJ3F 3UNYA 1X4GA 3ITHB 1IKWA 2XS7A 1GMUA 5HO4A 2RQCA 2BW7A 1A7GE 4LIWA 2L9DA 2RE1A 3OSNA 4WTOB 1RTHB 5K9FA 4DR7F 2RKIB 3IA0A 3QLHB 2OKQA 2NUUG 1ELOA 4ZVSB 1EETA 2E7XA 3HHEA 1NK9A 4NCAA 4CTAB 2WSFC 4GMKA 3EICA 4QIGA 4IG3B 2MY7A 4DL7A 5L46A 4RR5A 3W2WB 3Q8YA 3AODA 2FPHX 4LJMA 4DV6F 5HQMA 1TTHB 1KQSR 2WBMA 2JDJA 1U8SA 3CCSS 3SEOA 4DUYJ 5CCLA 4Y65A 2B3TB 1RKJA 3ZXWA 1F2HA 1KRPA 4DQQA 3H40A 1C0TB 2EFVA 5J2MB 2W7PA 3DHWC 3Q89A 4DSIA 1VOMA 1FDAA 3GYXB 5HSPA 4NLWA 3NGKA 2H51B 4FZVA 4M5KA 3TX8A 3BBBA 4M5HA 1K73T 1C0UA 1HQEB 3PFOA 1T9TA 2JH3A 4MK9A 3Q8VA 3CE8A 4Q8EA 3H4DA 1VFJA 4P73A 2NYHA 1NH8A 4JV0A 1TKXA 3LF0A 2BV3A 2G0IA 1RAFB 1WTFA 3UDEA 2EFPA 3I5AA 2VPZB 4OZJA 2VFVA 4G1PA 3Q24A 3QRQA 5BR8J 2YQ3A 3SQGA 5A6PA 4DR3J 1Y7PA 4LRDA 3LP2A 2GMHA 3N79A 4L74A 4C0BA 2A1BA 3A12A 3R1LA 1KLMB 4M1KA 2MJNA 1NK6A 3H25A 3MWBA 4NLDA 4DPUA 7FD1A 4MKAA 3Q8RB 4DF4A 5ETPA 2I5JB 1UMJA 3KLIA 1YRUA 4KGVB 1LXJA 3W3SA 4X66J 1RT6B 3IM9A 3WX8A 1RTZA 3N6LA 5AXLA 2HG4A 1YDLA 4XO0A 3VGTA 1UWAA 1HWIA 3POTA 4CWBA 2N3OA 2DK2A 2ZC3A 4ZLLA 5HP1B 4RW9B 2D74B 4FXWA 1VRTA 2RH3A 4Y28C 3FUYA 3Q83A 2M4MA 1U1KA 1P27B 1TL3A 3BGLA 3A8EA 1EQMA 1KVIA 2Y3YA 4IFVA 4I64A 2CNOB 1N6QB 1HBNA 2YPYA 4YR0A 1IQZA 4OHWA 1LWEB 4DV3F 3TUJC 4WFAQ 3OXFA 2Y8WA 2W7AA 4H4MB 4M5LA 2M7SA 1RYSA 1MLAA 1T7PA 1AA1B 4TNOA 2DIUA 5DZ6A 4TU7A 4DX8H 4PWDB 2PFFB 1LV5A 5KFDA 3SCKE 3M2RA 4Z37A 3CJQA 3LH2S 3R2DJ 3M8QA 1NNDA 2QL5B 1VJWA 2YKOA 1HNZF 2QLWA 5D0RA 1FTRA 4C8KA 2JNJA 4F7VA 2J8AA 3MMJA 4CLKA 1K1QA 1YJNS 1D8ZA 4YB6A 4G6VB 1ZTWA 2ZC4A 4A47A 4DSJA 2KJWA 2PDAA 1KKHA 4L3NA 4Q8FA 1JXVA 4N76A 3MM7A 1XWLA 3K5LA 3I5CA 2FHMA 5AXKA 3NP5A 1SIZA 4ED4A 2DY9A 4M5JA 2EKYA 2DHXA 3FJ2A 2HHPA 2KHDA 3MGJA 3C16A 4G1QB 1TELA 4MIAA 1SUQA 2HWHA 1XMQJ 4LF2A 4JI2J 4HKQA 2BKNA 3EWGA 2PMZD 1OPIA 5HANA 1VBKA 3OW2R 4ECWA 3SXLA 4DUZJ 2XYGB 3V81B 2YX4A 2R8IA 2CPZA 3PW0A 3ZZRA 5C25A 3DYAA 4PG8A 4I7FA 4K5RA 4YB5A 1MMLA 2IRXA 3HVRA 2EK1A 5HJXA 3EXYA 2JLGA 4CO2A 1K44A 2D3O1 2MZQA 1HBMA 4IOBA 1LWCA 4E2FB 1U47A 3TZZA 1DZ5A 4QU6A 5SZTA 3CC7S 4DPWA 2WSEC 3KLFB 3GQCA 3MUMP 5AE1A 3PW4A 1I1GA 3KLHB 4ZPCA 2B0GA 2GQQA 3NKYA 3OFFA 5B0AA 3SIPB 3L3CA 1B3TA 1KP6A 2X1AA 1CSJA 4B9MA 1WUUA 5EWEA 3QGIA 2GGPB 4ZVPB 3P6YC 1KSPA 4TLRA 1EAYC 5KFTA 3ULHA 3WBZA 2HW3A 5GVQA 1C1BA 2ACMA 2DB1A 1X4AA 3K57A 1DJ0A 4M8LA 4Z2XA 3FSXA 3KXDA 2LDYA 2LFVA 4LF5F 1Y5LB 5IWAJ 3VZIA 2XHCA 2XZDB 2V9WA 1TVRA 3W2VA 3LTOA 4GKJJ 5ADZA 5U47A 1RISA 2MLYA 5I42A 2ROEA 3JAMU 4LQ9A 2E5LJ 1FRJA 3QJLA 1KTVA 3OTEA 5A8KA 2DRAA 3FC9A 1SJQA 4P74A 5F3ZA 5RUBA 2DPJA 4DX5A 4JB8B 5G0RA 1RUSA 3PZPA 3TAQA 3CCZA 3GFZA 2RF2B 1G6BA 4DFJA 2AV5A 2M2BA 5KT6A 3FQKA 2VJVA 4YP3A 1RHQB 1U1LA 4GVBB 3BSAA 2V67A 4UZBA 1NAQA 2V5HG 3SSSA 3KLEB 1JX4A 1APSA 4O0IA 4ZVFA 4YB7A 4EWTA 2Q66A 4UOFA 2FY8A 4DV0J 1I94F 4NEYA 2QYCA 2N82B 3CGIA 3I4HX 4NYPA 4ZJOA 3HHLA 1ZAXA 2C3PA 1WHVA 1CJKA 3M9MB 2W24A 2YNHA 2IM0A 1D09B 2WONA 1UZDA 2D7SA 1XQIA 3UDLA 2LU2A 1S9EB 5K8NA 4KFBA 3CB4A 3TJ8A 2OUGA 2JEJA 2F4FA 1IUJA 4NRUA 5GMKa 4WE1B 1FEEA 5LXRA 1B0VA 1GMWA 1S12A 4JI3J 2ZVSA 5E3QA 1IXKA 3L4BC 2IVMA 3MM9A 2MKKA 3HHLD 2XNRA 2OD4A 2IPOB 1PSDA 2K3IA 2G0JA 1Q16B 1F2GA 4CLFA 1BQNA 4I69A 3D1QA 3KJVA 1V9OA 1Q86T 2A2CA 3M2VA 3KFWX 4FNIA 4F2SA 3UD5A 2OPSB 1RQ0A 2HFOA 1S1XB 3D6HB 2IAJA 2R8JA 5KFGA 1UVJA 3NAIA 1WKLA 1GMVA 4DU8A 1TU0B 3MAAA 3EDRB 3TZXA 2HGMA 2QTWA 4IDKB 4F0HA 4CLWA 2C2ZB 3EPGA 5DG7A 3PYDA 3KHRA 3OR1B 3W9JA 1CVJA 1IBMF 2ZJPQ 1HQUB 2ZKTA 4J5OA 2NSBA 3PKMA 3JSMB 3Q8QB 4KTQA 2JFDA 2AGPA 2CWKA 4PG7A 4PYAA 1T11A 4K4TA 3BKUA 1Q53A 1RAAB 1NZ8A 2LQBA 2OTLS 3DLJA 1BWEA 3IRXA 4OL8A 4TQRA 2QSFA 2GZOA 4PG6A 3CJ3A 4ILRA 3G96A 3CEDA 5DS7A 1HHSA 3MMAB 2B9WA 1R0AA 1DBDA 3P5BP 3EXCX 4I68A 3GSIA 3T6BA 1SJ3P 3PACA 1RWXB 3BSNA 3DRPB 4RNNA 3I56S 3PV8A 2VICA 5D4OA 2J0WA 2K7JA 2X1FA 1N0VC 4OX9F 3JQJA 2G9OA 4JYAJ 1JKHA 4CP5A 2IRYA 3RB4A 3RBXA 1RTIA 4LFCJ 5J1EB 2ZNYA 1DLOB 4LUBA 5KFLA 2CADA 3OSPA 5E3AA 2W1BA 4B3MJ 3UD3P 3JYTA 1ZOTA 1VQ4S 3JQKA 3DOMA 2GHWA 3DLKA 1EETB 2ZWPA 4ED0A 4CO4A 4RJVA 4B3TF 1RT5A 4WBFA 2HEKA 4OYXA 2HVDA 4FKYA 1ITPA 5CHCB 1CEZA 1WC0A 4KT0C 4MTPA 5DQGA 4FS1A 5KFZA 3HHLC 3ENAA 3BSOA 1OPZA 2EBEA 2KYZA 4EZ9A 1U8WA 2HKEA 2HHSA 1IKYA 4DL5A 1S4EA 1J5OA 1MN7A 4YFUA 4AT1B 3B82A 1G7CB 2HGNA 2XS2A 4ES2A 3HM9A 1FXLA 1BQMB 2BE9B 4WIQA 2UUAJ 1Y00A 3SBMA 5J2PA 2CJKA 4LT6A 1CJTA 3M9NB 2GHPA 2AYBA 1C0UB 5T7LB 1AXQA 2DGVA 3M1VB 4J9PA 5GAEI 2DNGA 1EKSA 1EKRA 2WK4A 4KKOA 2MJUA 1FXDA 2CPEA 2M5YA 3SV3A 1FVQA 3OLBA 1PYTA 5GADU 4NXMJ 4M63A 3LP2B 2KDOA 1Z4UA 3G6YA 2E9TA 1S0OA 5DZ7A 2UVWA 3G4SS 4EBCA 3M7VA 2D41A 4K4SA 3ENQA 4BBYA 1GTEA 2B56A 2MZRA 1HNIB 5HQLA 2XULA 4Y2MA 4NE9C 3V4IA 3RB0A 1RWOB 1ULRA 1H3DA 4W98A 3KLIB 3GIMA 1URNA 4DUYF 3H59A 4A8KA 1ICEB 2B6AB 1VLYA 3BN7A 2EXUA 4WZQA 2QMUB 1U0HA 2QA1A 1NSPA 3T1HJ 1HL6A 1Q4RA 3R1HA 4H54A 3D0HE 3RBDA 4U67Q 4OI1A 1U0SA 1RJJA 1S72S 2OO4A 2F3JA 1HWJA 1QE1B 4NA2A 2JEIA 1TL3B 3RJMB 4JI8J 4DZ6A 2FVSA 3D6MB 4ID5A 4C8MA 4IFVB 3TEHB 4L3KA 1N5QA 4LF7J 4KE5A 3PO5A 1JK9B 2OD6A 2DR5A 5LOQA 3O8WA 2UVVA 1YX2A 4C11A 2HFVA 5GADI 4DV2J 4XK8C 4DR3F 1QSYA 3ILOA 2DHSA 4WK1A 2YH1A 2UUWA 3E3XA 3BS9A 4ES1A 1RCOB 3T1AA 4ZLNA 2EFQA 2VZ9A 2ZHOA 3MURP 3OT9A 2DY1A 2V4JA 3M8QB 1RWVB 4L76A 2CPIA 3UWTA 1RAJA 3BKFA 1Z2ZA 4X66F 1JNZB 1RADB 3QBCA 1SJ4P 2MQMA 4ECVA 3CVKA 4NZ7A 3T19A 4JI7J 3MPDA 4ED1A 2P6SA 4HH1A 3ELHA 4OV6A 3IWLA 2VONA 1WHWA 3G6XA 1AT1B 2LQ5A 3OFHA 1VRQC 2VQFJ 1B0PA 2IJRA 2H4WB 1SQGA 3H98A 2CNKB 2NQPA 2OPQB 1C4CA 1KQKA 2VH7A 4RUAA 3C16B 2FLNA 4FF2A 1FXRA 1SUQB 4FYDA 4USUA 1LW0B 2EK6A 4R5PA 3PW7A 1FKPA 5ETOA 3KLVA 1NK0A 3IWNC 1MNEA 4FF4A 1UL3A 2PGCA 3NNAA 2QZ8A 2RB7A 3OTDA 1WF2A 4NEZA 3PIPQ 4ZCLA 1YSJA 1Q5YA 1WORA 2ZBIA 5C25B 1BUXA 3IG1A 3BPDA 5HATA 2M3DA 1T02A 1HBMB 4CCHA 4LMZA 3KHLA 2HYIB 4K4UA 1LWCB 2HGLA 3G8SA 4NCBA 2ASYA 2HHWA 1S6PA 4X65J 1WF1A 4C0HA 3HSZA 4OHVA 1Q1KA 1P6TA 3QAEA 1WWHA 2AGOA 3KJNB 1IR2A 2C3UA 1T94A 4DL6A 5KT4A 1PC4A 3NNCA 2DGUA 1ZTTA 1WEYA 3M2UB 3AD7C 4DDFA 2LA4A 2R2TA 2FUG9 2FJBB 3AFGA 2DNZA 4GC7A 2IYGA 3BREA 4IO1A 3CJ8A 2CQPA 5D3GA 1M1GA 5K8OA 3SCLE 2HAIA 3HKWA 4TLQA 3GONA 1F3FA 2E44A 4ZHRB 1XMQF 1C1BB 2IVYA 1X60A 3ISZA 4JI2F 3BR9A 2QE5A 3QYYA 3ZNUA 4QBUA 4DUZF 2N4DA 3W2VB 5IQ6A 2WZ1A 4U6PA 1TV6A 4OYMA 3RB6A 2N7YA 5ETVA 1SIWB 1S0NA 5I42B 2ZH6A 2RAQA 3R2CJ 2LDIA 3SYZA 2E1PA 1OY8A 1UAWA 2PE8A 1D3WA 3V6DB 2VA2A 3W9IA 1RLDA 5A8KB 2XLKA 2BOPA 2E1CA 4DR4J 2DJWA 2GA7A 3CCWA 4CI0B 4U7CA 2C2OB 4OI3A 5G0RB 1NHKL 5HN0A 2G1HA 3TARA 3AQPA 1G3OA 4WXWA 2Q43A 2YWGA 3ZZPA 5B0CA 3EPIA 4PUOA 4HACA 8RUCA 3ONQA 4AUKA 2HQCA 3HX9A 4ELVA 4J9UE 2DISA 4O44B 3RRKA 3SCIE 3X3UA 3LW5C 4O4GA 3GV5B 2AHOB 2KVIA 3BKTA 5B08A 5KFKA 3AXMA 1VQPS 2N3LA 1FX2A 2IIHA 3C66A 1T9WA 1EP4A 4EU0A 3BPSP 2RQKA 1Y4ZB 3HHLB 2EI5A 1CJKB 3AHPA 4OYPA 1U6ZA 2HBQB 1CLFA 5IWAF 4BC7A 2KG1A 1KFSA 4IH5A 3UR3C 2AYMA 2MZJA 1YRTA 2DNOA 4OI0A 3NS7B 3CDAA 2N7CA 4OI2A 3W5ZA 2QFIA 1MWQA 3LGMA 4LRBA 2ATCB 2DRBA 2IM3A 2VDIA 2B4PA 1URRA 4DX7A 4ECRA 4F2RA 1NM2A 4J9SA 2ZZNA 5KFAA 1HD0A 2BQUA 3HKZD 4DSKA 1F6TA 1WOPA 1BQNB 5HLFA 5THWA 4F4WA 3KJVB 1HBOA 1XR6A 1ZPVA 1HNXJ 1VQSA 3QJPA 1GFWB 2CQCA 5HMXA 3PXGa 1NDCA 4UY8T 2RILA 4CH1A 1FNOA 2OSQA 4TY8A 1CULA 4IO9Q 3TWZA 4BLGA 5IC6B 4DV0F 1RZMA 3TAMB 1LWFA 4DJBA 3NBPA 1H7XA 5DLFA 2U1AA 1EX8A 1HIYA 3DDNA 5E3RA 3N0VA 2BRKA 1H38A 4DOZA 3H7HB 2VHGA 4TN2A 4DPOA 4RNHA 3CD7A 5E41A 3EJMA 3C15A 3T9ZA 3GR1A 2DNYA 3S8SA 1SL1A 4G1IA 1VQ7S 5DDOC 3IXQA 4NLOA 2WVCA 3OQ2A 3G86A 2FLLA 4JI3F 3K8WA 4NRTA 3PJXA 5HJYA 4Y2AA 3EGZA 2WW8A 1VQNS 3KK1B 2VFUA 1EJ7L 3OXLA 5DG9A 3TAPA 1AW0A 3GFXA 1Q8IA 1T8EA 2ILYA 2VIHA 2OJ3A 2D9PA 1X9SA 1Y10A 2W2OP 2QN6B 1TUVA 1VRUA 2DR8A 4L75A 3DOKB 2QT7A 4C4WA 3PG9A 4X4SA 1ZS6A 5CZVA 2JRSA 1JKHB 1GH8A 1KLNA 3BQ1A 2W25A 4NZ0A 4P71A 4B3SJ 4ZLJA 3P3DA 2HVZA 2XCPA 2UV8G 4DPTA 1WACA 1Q0NA 1NUEA 2BJ9A 4D3HA 2XMJA 3MM5B 1L3UA 3GCXP 4DV7J 1CC8A 2BW2A 3JYTB 2N4CA 2IBKA 1IM6A 2CQ4A 3DOMB 3DRRA 3UVJA 2MGZA 3MECA 2X1BA 4Y0FA 4M5DA 5EGYA 1RT5B 1Y9OA 4KAIA 3OV7A 3VALA 5C5JA 3F73A 2WCXA 2QL9B 5C24A 4U8VA 1F1BB 2QLJB 3QAUA 3AD9C 4AL5A 4OV1A 3M4XA 4JBCA 2FJWA 4X4VA 1AUSL 3BQ2A 1S7IA 1IKYB 3NY0A 3M6WA 4RW4B 5ETQA 4MKVA 3HF5A 2NPIA 1T0TV 2BQ3A 2HMIA 2MYFA 2FJDB 4USVA 1YZ6A 4RUBA 3SZ2A 1VC6A 5L1KA 5J2PB 4JYAF 4CLYA 2L9WA 3CCJS 3M8YA 5L1IA 1MMNA 4LFCF 3MAQA 3RAQA 3U02A 3MMBA 1XTZA 3ICLA 1PC5A 3M05A 2VBXA 3NOCA 2V50A 3GG1A 1R89A 2B4UA 1R6VA 4RBTA 4B3MF 4OI6A 2KH9A 5F9LA 4LFBJ 3QT5A 4PXCA 1WG4A 4OYZA 1LK5A 5KFQA 2CQDA 5BYSA 2O3DA 1FT8A 3TVKA 2J9EA 1WKKA 1QAJA 2ILZA 3ISNC 2XQCA 3OTCA 3MPWA 4K5SA 3ZTPA 3VZHA 2M88A 3LALA 1UFWA 2QEXS 5KT5A 2Y1IA 3V4IB 2UUCJ 2AMCB 1CG2A 4A8FA 5B0DA 5CYMA 2ZITA 3MEEB 2NXNA 1X4BA 1M5KC 4N47A 4TVAB 3KK3A 5D0HA 4P72A 2YNGA 1U0HB 2OPPA 2V8HA 5F8MA 5E2QA 4A8MP 3KUEA 4CLZA 1S77D 2JX2A 2UUAF 2BYCA 4XTTA 1JLAB 1OO0B 1R8AA 3AB4B 1HW9A 4NI2A 4I2PA 4FBTA 3VAGA 2ZM6J 2EC0A 3C6UA 1HARA 2PA3A 1SQFA 4ZN1A 4YDDB 4LR9A 3QSIA 2BA9A 2PI4A 3G6ES 2YNFA 3EVOA 3I31A 4O3QA 4NXMF 5L9XA 1XN9A 4DV6J 1S57A 4ZVTB 1S1WB 2WOMB 3IRWP 1F3VA 4DLEA 3C3LA 3HFZB 1RGVA 1TL1B 2VPWB 2E7VA 2V0NA 2YTCA 3GR0A 4DCPB 2FJXA 5L39A 3L7OA 1TMMA 3EVMA 2VG7B 3FNNA 2VFSA 2QO3A 3PR4A 3G2XA 1RSCA 2BANA 2VC0A 4RUCA 4PR6A 5EUHA 2H3EB 1UA1A 1ZETA 1HMVB 6AT1B 2HHHJ 2DIVA 3HSGA 2OMOA 3T1HF 2W2QP 2HVHA 1WTBA 1P8GA 3LANA 4NOHA 3R9LA 3FBEA 3UPFA 4W90B 1UETA 3SCJE 4BDPA 4QZVB 4URQU 3FCHA 4JI8F 2BEFA 2NREA 4DS5A 1SJRA 5EHHA 4F4KA 2F5GA 2L9NA 1KN6A 1WDDA 4KSEB 3VQSA 4LF7F 2BJ7A 2OFHX 4ETZA 3JSRA 1Q78A 3Q8PB 2DHGA 5F8JA 3OTOJ 1RTDA 3KG0A 3BYPA 3NGDA 3QSYB 4DV2F 5D78A 3BO3A 3DDKA 3T5HA 3PX4A 1NMEB 2OTJS 1N54B 2BM0A 1HWLA 4FF3A 2WVDA 1KHWA 3IG1B 5M2UA 1FRHA 3PIOQ 3TVZA 4DR5J 2LEBA 1M1HA 1FKOA 3MEGA 2HSEB 2DR6A 2A3JA 2M70A 1K0VA 1FRKA 3BBCA 3H2LA 3GFYA 1RLCL 4OQJA 1VQ8S 3IM8A 5L8RC 2UP1A 2DRDA 1RACB 2CQHA 1JLEA 2KM8C 1FFGB 4JI7F 2W9CB 2LEPA 1VQYA 3HVAA 2VFRA 4J9OA 2KZMA 3FEYB 5H9EK 1VHFA 2Q6CA 1XIQA 2UXCJ 4WU3A 4NCGA 1UFKA 3TQEA 3R6GB 3FSYA 4OYAA 5AT1B 1RT2B 1D1UA 4KGKA 4UY85 2J6UA 4WFYA 2F65A 4N56A 1N32J 3AXKA 3K7RA 1FFWB 4PQUA 1O6XA 2VV5A 1SB6A 1TV6B 1RT7B 2XYHB 1KDNA 2MQQA 3J7ZT 2Y0SD 2CJAA 2CQBA 5AXNA 1YHQS 3DLEB 2OFGX 1W26A 3K5OA 1TKZA 1VQKS 4B3RF 3WIUA 4OLPA 1YIJS 2QGFB 5A8WA 3HVTA 4QR0A 3FBCA 4WKYA 1RTJA 4K2JA 3R5GA 1TUGB 2CJBA 4X65F 3SMZA 3PYFA 3KNGA 6FDRA 4DR6J 1T95A 1KTQA 3AOBA 3EGVA 1FD2A 2G2ZA 2YWKA 1SKRA 1KOOA 2KT5A 1J5EJ 1JLFA 2XWXA 4DV5F 1XMOJ 1J27A 4O4GB 2R3VA 3LGHA 1SV5A 3BO4A 3CW2C 4F04B 1EQ0A 2A6OA 1EP4B 4MIBA 4NASA 3NLCA 2OAUA 1Q7YT 3ENVA 1N34J 2YKPA 5KG5A 1VC0A 4GVLA 4USIA 4ERDA 4A48A 2UUTA 3DKDA 3UDCA 2BACA 5KFJA 3I96A 3DLLQ 2ZJQQ 1PJ6A 3DI6A 3D0IE 3CDWA 3IS9A 1VGYA 3I0RA 2HK3A 5ETTA 1G2EA 2G1DA 1HNWJ 2IYIA 2WVBA 3T5JA 4NLGA 2OELA 2YVSA 1U1PA 2WVEA 3P49B 4DR4F 3LWMA 4N77A 4Z7YA 4Z7CA 3G87A 3PJWA 2FHOB 4NZ6A 1RP5A 2R7UA 1XNQJ 4KGMA 3WQPA 2KVQE 3PM9A 2HQGA 5B09A 2AEMA 1ZZNA 3QRPA 4X62F 1S4FA 1WC1A 2XSJA 5HLFB 2UXDJ 2E5HA 4C0OC 4FYXB 4M94A 1HI0P 5T14A 2YKQA 2JC0A 5IV3A 2PA8D 2PMHA 3EUNA 5F3TA 2WB4A 1N52B 1N88A 2NPFA 4I56A 4I6AA 4TY8B 1CULB 4QWAA 2QIFA 2NZ4A 1NLKL 2LU1A 3NBPB 2J6TA 3CTRA 1DQ8A 2ALZA 4MFBA 3CJKA 2XTJP 3PKYA 4CIOA 3CCES 2HPUA 1D9DA 1S48A 2FDNA 2JEFA 1S99A 1JNRB 3HT3A 1B7YB 2I8EA 2IRUA 1NBEB 2R2UA 5CABA 3GJSB 2E5JA 2KZZA 5FDLA 5BYQA 5LM7E 1RA6A 3OPKA 2L48A 3M9OB 3KKFA 2J8SA 3PNIA 4P2SA 3V6HA 4ZLPA 1U6FA 3AD8C 2Q79A 4A4JA 1HLWA 4A46A 3BO2A 1FE4A 4ZMMA 2QLBB 4O3SA 3SQOP 1W7WA 1FI4A 4ZCMA 4UUXA 2ZVIA 2J0XA 1R8CA 1TFYA 1DQ9A 1WC4A 2MKJA 4IOAQ 5HMYA 5KFNA 1Q5VA 4DUTA 2HBYB 4O23A 1HNXF 2DCLA 4RUHA 1FRIA 2XB2D 3TEGA 4AQYJ 4JUZA 3BSCA 3OLAA 3J7YU 2KFYA 3D1HA 1UJ4A 3A8IA 1Q8BA 4ECTA 4WIIA 3NWRA 3QFWA 3DRSA 1JLCA 4LIRA 5KOWA 4RPFA 3THTA 2Q3PA 4YN3B 1E6YA 2ZHAA 5LT5A 4ZITA 3A4TA 2GW8A 3DRRB 3UVJB 4PRFA 3I0SB 4LREA 2WTFA 3DOLB 2MZSA 1FK9B 4C6AA 1Q81T 1FDBA 1ZBTA 4ELTA 1SJFA 3JSBA 5LXYA 4NA3A 1RWKB 3BB5A 2VL1A 1Q7LB 4OX7A 4U7UD 2AW0A 1O0PA 1CBKA 3X1LB 2DNLA 3BN4A 1NK8A 4C9DA 1B70B 4NPOA 2QA4G 4J9MA 4EBEA 1TL7A 4FVMA 3CJ0A 2VC1A 4DL4A 4CLTA 4YHHJ 2HMIB 2HWIA 3A3NB 5LJ3Y 2VBYA 2FD2A 2FGCA 1FERA 3QGGA 4I2QA 3W5YA 3BGUA 1BY9A 3PDNA 4B3SF 3LPEA 4AL6A 5MAOA 4MK7A 5IC4B 2DNNA 3JSYA 1HD1A 1NKBA 5KFFA 2MLZA 4ZP7A 5JVGQ 3M8WA 1HBUB 2HNZA 2ZNZA 1VIOA 5EX3A 1IKXA 1JXLA 4DV7F 3HXMA 2KM8B 1NZAA 1U6BA 2Z2ZA 3CCRS 1D9FA 3CDBA 2D69A 1FESA 3CJRA 5KFRA 3WX4A 3VAHA 3RW7A 1YJ9S 2PEBA 4PKDB 2XEXA 3IGVA 4WFZA 3GYGA 2XLJA 1UPPA 2BJ1A 3C14A 2XG8A 1X9WA 3CJTA 2J0QD 5LSOA 4K4WA 4RZRA 1MN9A 3QMQA 2ZH4A 1PILA 5CYMB 1YGYA 3A8JA 4MJKA 1QD1A 4I4BA 1T03A 3BEGB 2JOQA 2YNGB 3C6TA 3NEKA 1O51A 3E01A 5CA5A 2FZGB 1I3OB 1UVNA 4HYKA 4FF1A 2RS8A 4GRSA 2WHOA 2LMIA 4NI2B 2J7WA 4I2PB 4ZIWA 1O5JA 3D3BJ 3C6UB 1WHYA 1IBKJ 2OI2A 2RIJA 4P2FA 1WI8A 3TJ9A 3PX0A 3JXOA 4CH0S 2XBPA 2VBZA 1L3SA 1RKIA 2JFKA 1S59A 2ZFHA 4OYOA 2ZH9A 5KFUA 5F8HA 2MEWA 1NO8A 2QX0A 2KRBA 3N5FA 4X4TA 1HYSA 3R6LB 4J90A 3FMWA 5KFEA 1Q79A 2NSCA 4ZPAA 4V1Ak 2UUCF 3EZUA 4ZPDA 2B7BB 2C1EB 2IA0A 4C2MA 3KOAA 2XCAA 4I6WA 4PWWA 1QDUB 2G13A 3ZZZA 2BANB 5GAGU 2EFNA 3TR5A 2HAFA 2XMMA 3VTIA 4PYDA 1PJ5A 1Z2LA 1S7HA 3VHQA 3MMCA 2GVDA 4YR2A 3SFGA 3IGNA 2V68A 3UCGA 2O1PA 1FTCA 1U25A 4QYZJ 5EX0A 4OZ3A 2H54B 2RSQA 2ZM6F 2HS3A 2AQ4A 2NCKL 4USHA 3H2UB 2RU3A 1B7FA 3MR5A 2XMAA 2FLOA 4UQTA 1RAOA 3O5TB 3KHHA 2XS5A 4OJ3A 3D5MA 4ALZA 3Q23A 1S5ZA 1I5OB 1L3TA 4KHRA 2CZVC 5DQHA 4IG0A 1LKZA 4OJ1A 2V2KA 1WSVA 2AYGA 1KBRA 3KUHA 3GFHA 3QGHA 3ZZ0A 3UQSA 1H73A 2R7TA 3T6JA 2O5DA 3ZO7A 2DNHA 1EARA 3TA2A 2UUBJ 1JLEB 1U02A 1YI2S 3G8TA 3MM8A 2VKRA 3JQMA 1U1RA 2C22A 3IR5B 3IO1A 2HHHF 3CF5Q 1VLOA 1HFEL 1RK8A 2GVZA 4HHJA 5DDRC 4PEOA 3W66A 1XBWA 1SH0A 3D1OA 3VF0B 2YNIA 4URSA 5KFYA 4NCGB 2CNLB 3I9ZA 4IQMA 4GKKF 3PW5A 4B9LA 1FJ7A 5KG4A 5C2GA 3QIPB 1MG7A 5D15A 5F8IA 2GO8A 3RZAA 3OXGA 2BDPA 1FEHA 4N7TA 3WC0A 4WU2A 3OTOF 4OZNA 3BDPA 3E2EA 4MKBA 4PQUB 1YBTA 5A8RA 3N9UC 4ZJLA 1TQLA 3HT0A 2COLA 4QR1A 5BJRA 3F41A 5DLGA 4LBPA 4DR1J 1NEEA 4B3OB 1RT4A 1Q8KA 2KG0A 2RNEA 1SXLA 4QIVA 4DR5F 1KD1T 2BMBA 3JS9A 1R31A 5LMNJ 1TKZB 5A8WB 3HVTB 1OJ4A 1UKUA 1RTJB 2CKWA 3QPIA 3QFHA 4NLPA 1MWYA 2AU0A 4ED8A 3O1LA 3DLHA 4X4OA 4DPYA 3R3TA 1REVA 2UV8A 4D3GA 4HT5A 3HJFA 1C4AA 3OHBA 5L9NA 5J1PA 1CS4A 5A6WA 2UXCF 4CO1A 2P2CB 4YQWA 2ZOMA 3BH6B 4KJIA 1S79A 3I87A 5DRKA 2OSRA 1SCJB 1RBLA 1N32F 5HL7Q 1UVIA 3OVSA 3LAMA 4NYZA 5FIIA 3W62A 5CCMA 2AWZA 4MIWA 3ITHA 4ZVQB 1QY7A 3NCRA 3N5BA 3DI6B 4ZIVA 1RTHA 4EUVA 1LWXA 4YB1P 5DG8A 2RKIA 3T5LA 1LW2A 3G8QA 1NKCA 1ACMB 3I0RB 3KDOA 2V8DA 3ETMA 3I32A 1XJWB 2EPIA 4Q44A 1ZM4A 3I82A 3A13A 4ENOA 1M0SA 5CAAA 5HROB 1VQOS 5C2CA 4O4RA 4TQSA 3D28A 1TAQA 1NSKL 1Q82T 4I67A 3OFGA 1HWUA 3DGPA 1GNKA 2XMWA 4LF1A 4DR6F 1N33J 3O3LA 1AB8A 3W8GA 2EWHA 2MKHA 2Z2LA 5E33A 3VAFA 3V5RA 1J5EF 1T9XA 3TJAA 1XMOF 1BQXA 1TZ0A 1VISA 4CLPA 1WOOA 3LQVA 4A8OA 1RT1B 2RDDA 3BF4A 4NYOA 1KC8T 3TUZC 1YJ7A 4P7TA 1N34F 1OQ3A 2W4DA 2BRLA 4Y6IA 3FKBA 3I55S 4N41A 1BHNA 2E5GA 2E9ZA 3DC2A 3N01A 4R25A 3GU0A 1SKUB 3P96A 3KLGB 1BMQB 1OY6A 5CH7B 4DV1J 3CIZA 3P4UB 3N4WA 4KV8A 4DV4J 4G65A 5JMNA 1OMSA 1N8RT 2KXFA 4DU7A 3ZFVA 1HNWF 2AEJA 3GIRA 2I9SA 3EDQB 4RLEA 2E29A 2BR0A 3QT6A 4WP3A 1SJ1A 1HHTP 4RNOA 4HR2A 1F5BA 3MUTP 1XNQF 5K14B 4ATNA 4NWBA 3CDUA 2CIMA 1A6LA 3MPVA 2UXDF 2X3GA 3K59A 1RWMB 3S7RA 2IA6A 2LXIA 4N8NA 4I6YA 2JZ5A 2YX1A 4FDFA 2KT3A 3NS5A 5DGAA 2CYYA 1SC3B 3NMAA 5HP1A 4QOTA 4RW9A 4LF6J 1C1CA 2EKNA 1PGZA 4JI4F 1OYEA 3W1YC 3TA1A 4C8LA 4OZ2A 2AJ0A 3DRSB 5KFHA 1I6JA 1TL5A 5IT9Y 3VGVA 3N28A 5KG6A 2HZCA 4JI1J 4Q2LA 3HSDA 1LWEA 1LFPA 2KN4A 1VS3A 2CQ3A 3M6UA 1N56A 2DGXA 4H4MA 4ZVUB 1PYSB 1R43A 4ETXA 3MEDB 2B5JA 4NL5A 1VI7A 4C97A 1AROP 1D9AA 4HHUA 3G71S 1X4CA 1YJTA 2QL7B 1OS5A 3KYLA 2XZWA 2W8KA 3N6MA 4CYUA 4ED3A 3VV2B 3RUBL 5HI7A 4Y3CA 2F8HA 2RD5C 5D8HB 4RNFA 3P8BB 2V2QA 4EBDA 5KFPA 2H5EA 4RO0A 4FYVB 4K4YA 1UCNA 3CC4S 1GX5A 2POKA 4AQYF 3KK2A 4OJGA 1RA7A 3CD5A 1FE0A 1OIAA 3PYGA 4G1QA 1IKXB 2MQOA 4MH8A 3PEHA 3BGFA 2QJ3A 3H42A 2R7OA 4O3RA 3MM6B 3GB0A 4M95A 3RBEA 2RHSB 1X5OA 2F9DA 1IQTA 1X4EA 2VUGA 3FEXB 3PX6A 3V81A 4X4QA 1D0EA 2H1YA 3AY0A 1NCLA 3NNHA 4WP9A 3D6TB 2ZD1B 3GWCA 3K8VA 2DR7A 1SL2A 2JVOA 4CDIA 2EVZA 3NGSA 3THVA 1IWGA 1WELA 1K0TA 3FZ2A 2VF3A 1IR0A 4AXIA 2MXYA 1YWXA 2XI3A 3C2PA 1KQGB 1FRLA 1N0UA 2P5VA 4MKYA 2DH7A 3HFVA 3CO9A 1BGXT 2XY5A 2DO4A 1GMWD 3AJ1A 4YHHF 1T03B 3R7NB 3C6TB 1GK8A 2W9AA 5KFXA 1G1XA 3GYNA 3E01B 3KLHA 4HLBA 3FRYA 1X4HA 4B02A 2P9EA 2KFNA 1DFDA 2FTRA 2BM1A 5DDQC 2HRUA 3EX7B 4CZCA 2OLWA 2LLZA 4K4XA 4ED5A 2ZZTA 1FX4A 1U7LA 3ENWA 2QYGA 7FDRA 2ZH2A 1SKSA 2GGPA 4WFXA 3UFCX 1ZAVA 1NRKA 4CRJA 4AE5A 2HVIA 2YKNA 2WW4A 2XMTA 4P9SA 2YY3A 4IRKA 3L09A 4F25A 1CJVB 4QPXA 3CCVS 3L7UA 4ZVOB 1S97A 3OL6A 1N36J 4P2MA 3RRHA 1TFWA 1JJ2R 1CJUB 2AZ1A 4JI5J 5HAOA 2Y1LB 1HYSB 2XY7A 3GIJA 1FD8A 2K8GA 1KQFB 1XR7A 2H4YB 4RW6B 4Y2IA 3OTBA 2EBGA 1OWXA 2Y9HA 2CZ4A 2MKCA 1M1KT 3CWJA 1WOSA 1KONA 3SSRA 2Q1LA 1BWVA 3NAHA 1MSWD 2FHJA 4RWXA 3RYLA 5IT0A 2BKOA 1WD6A 5EN1A 5J2NA 3MDFA 4X4NA 4KH1B 1NSAA 2Y0BB 3MMCB 1DARA 4KO0A 2CVEA 2GVDB 2RF2A 2RT3A 2MQPA 2HZAA 5IV4A 1SVDA 2YKMA 2QG9B 1IKWB 2V8VA 1EIYB 2V6AA 2NXUA 5K8PA 2WVFA 4ECQA 3BBFA 4JI0F 2C2EA 3W61A 1HW8A 4GVBA 3K5MA 1IBKF 3KLEA 4C7QA 3KMSA 1RDRA 2JL9A 1SC1B 4IH7A 1NPKA 2DH8A 4HH0A 3K5PA 2CXEA 1VMBA 5ETMA 3HFKA 2FVCA 2NZCA 3OBIA 5K8MA 3MD3A 3MHYA 4IG0B 1PG5B 2DKOB 4M5NA 2GCFA 3F0NA 9ATCB 3ZC4A 1S9EA 4FKXA 3M8SA 4PABA 2B9EA 2J7KA 3IAM9 2P8IA 1B64A 4AFFA 3E51A 3TRGA 4WE1A 4DX6A 2O01C 4DBQA 1TKTA 2CJ9A 1FO1A 1S9GA 1JWWA 4DG1A 3HVWA 1MU2A 4BWMA 2L41A 4P7VA 2KU7A 2XI2A 2LQ8A 2WB1D 1PAEX 1TKXB 2RDIA 4QCLA 4F0KA 1UEVA 3U1NA 1X0PA 2CQ0A 2HBRB 2W2PP 5C42A 3OL8A 4C3LA 1UPMB 1ZYQA 1CPZA 1FJGJ 3D54A 1R0BG 3SQGB 4TYBA 2OPSA 2ADCA 2X51A 3BR8A 1NKEA 2X1GA 2CJQA 1DTQA 2EFOA 3ETOA 1N5YA 2QMXA 4ED2A 1EHWA 4QJVA 5GAHU 2J76E 2R2SA 1LEOA 3D2WA 3CPWR 1SL0A 4RW7A 5A8RB 4OZ5A 2HIYA 2K7KA 3G6VA 3GJQB 3OR1A 3W60A 1VQMS 4ZOSA 1RT4B 3IC1A 4B9SA 3AOCA 2C3MA 1UVMA 3POTB 3K5NA 3E8OA 3F56A 2DVIA 2UVUA 1VRTB 5E7OB 2PEHA 2PIIA 3DFEA 4RNMA 2UUBF 2KT2A 4C48A 2XMUA 2VPYB 1VQ5S 5F8GA 1H72C 1S1TA 2HQFA 2CFXA 5ETLA 1UWBA 4FXVA 2NR0A 6FD1A 3AT1B 1HWKA 2CQIA 2DTJA 2RHQB 3R8YA 3FQLA 3U27A 1HBNB 3DRPA 4P6QA 1CS4B 4CO0A 2E9RX 1F5CA 3PY8A 4J9QA 4ILMA 1PBAA 5IT9U 3PRBA 3R5AA 4MK8A 2DITA 1VDHA 2A10A 4TYAA 3VAMA 3DRXA 5GAHI 2HQDA 2PT0A 5J1EA 2FZKB 4OJHA 3M2RB 2F4VJ 4KGZB 4NLSA 2AX1A 1H2UX 4WYLA 4DR1F 5DQIA 4DI6A 5AXMA 1LW2B 1ZPWX 2R8KA 4X4RA 4JV1A 4WWSA 3ADAC 3H8YA 4LRAA 5LMNF 1FJCA 3RGIA 1JJHA 2CAJA 1FFSB 1H2VZ 3MM7B 1M5HA 2J9DA 1X7VA 4EFAC 1QLNA 2DNQA 4ZS6A 2CPJA 2GMJA 2ZUAA 1GQEA 4TU8A 3DGPB 2U2FA 3BM7A 2NUHA 2I1RA 4PXEA 1B99A 1FCAA 3AJDA 3EVWA 1F9EB 2D1CA 1ZM2A 3I5BA 1Y3JA 3CCTA 3D68A 1NJXA 3D6FB 3TW0A 4A8SA 2CA9A 1BQMA 1DURA 1HR0J 1JLGA 2X3DA 3A3PB 3HSJA 2YBVA 1UZHA 3D7SB 5T7LA 5DM7Q 3J80Y 1F0XA 1W2IA 2M8HA 4F3MA 3M1VA 3DYAB 5D4NA 3HCXA 3L9ZA 4I7FB 2Z56B 1PYOB 3LA0A 2OEJA 4AL7A 1NDKA 2GNKA 2B8PA 4B3RJ 4A8WA 4OI4A 4KV8B 2I38A 2FQQB 1IM4A 3MPYA 3EE3A 2E5IA 4FP9A 5IFMA 2W4PA 1BXNA 2K3KA 4ES3A 2UXBJ 1HNIA 2IHR1 2MQ8A 3QO9A 4K2XA 5E0OA 5I3QA 4DV5J 4HVZA 4IRDA 1N33F 2ZEJA 2ZH8A 2XHWA 2PN6A 2B6AA 2QV6A 5DETA 4KHMA 1K9MT 1VCTA 3GV7B 1REGX 5KFWA 4IR9A 3NGRA 4WCEQ 1P9QC 3LWLA 3O2IA 1HNVA 1C1CB 1NU4A 5LSLA 3LUYA 4DCOB 1JJ4A 4UQGA 4M5MA 2ZHBA 1TVRB 4YDXA 1QE1A 1KEKA 2NXCA 2E1MC 2DXEA 2AIRB 3RW6A 3KJQB 4LQ3A 1FVSA 2OP5A 2ZBRA 3MTKA 3GTYX 3UN3A 3WZ0A 3ET6A 2WBRA 2Z8QA 4XAKA 4DV1F 4CNYA 4DFKA 4OIXA 4G3IA 1T05A 2LCWA 3DHXA 1VQ6S 3HZEA 2R8HA 4DHVA 4DV4F 2MB0B 3S1TA 1R3NA 4OZ1A 2C3YA 3BQ0A 4AD6A 1OYDA 2B5JB 5HMWA 1QSLA 3B4MA 4Y2KA 2F7VA 4X62J 1BE4A 4KHPJ 1S0MA 1RHUB 4Q45A 2LQ9A 1SBRA 2HHXA 4CYUB 3J7A1 1U2RA 4KGXB 1FF2A 2BXJA 3MCSA 1NH7A 3TVYA 4R8UA 2GMLA 5IM0A 5LMUJ 3M32A 2RQMA 3UDVA 2ZKUA 2HLTA 2AD9A 5B7WA 1TK8A 1RT3A 4USJC 1U45A 4P10A 3W64A 4LR8A 3RTVA 4LF6F 3M30A 2YNHB 2BVZA 3KK2B 4RL1A 4QW9A 3L7PA 2WONB 3BGRA 2R9LA 2OPQA 3H90A 3AA8A 2K06A 2MZTA 4O0NA 1AFJA 4P52A 1R27B 2YWEA 4PXDA 1IJEB 4KFBB 2CDQA 4CO5A 2XYPB 1XC9A 1RWUA 1S6UA 3DM2A 1LW0A 5KFIA 4JI1F 5H9FJ 3FBFA 3SSQA 5JJBA 2HRYA 3MM9B 1AZSA 3OL9A 1OY9A 1FRMA 1ZZFA 4DL3A 2M8DB 1M5OC 4DCJB 1FWPA 2BUNA 1VBZA 1QUVA 1JQGA 4QIEA 3H5UA 1WEXA 3V4MA 1T9YA 3TO8A 1YJWS 1WC5A 4EGLA 1EB0A 1VIXA 3M2VB 2W4CA 2OMLA 2CPXA 2HK2A 3FBBA 4F4XA 5KFBA 4WYWA 2YWFA 3CIMA 2IAJB 4LR7A 4XDDA 1YKWA 2E7WA 2PSZA 4OFZA 3MAAB 3J81U 3MR7A 3D9BA 4LRFA 1IKVA 4K4VA 3H0PA 4MMOA 4ITSA 5FLXY 2DXDA 4OYIA 1H2TZ 3MF5A 3G82A 1S49A 5E3PA 2ZWOA 1RABB 1ZA2B 2EG1A 5B0EA 3M2UA 4B17A 2WAQD 1UFLA 3I6PA 3Q2TC 3BJYA 4QYRA 2YKNB 2XC9A 2B7CB 4RWWA 4ZHRA 4F50A 3ISND 3CMES 1VBYA 4CM2A 3QT8A 2RRAA 3IRXB 1FNMA 2HVEA 4BS2A 2ALYB 4DFMA 2OPRA 2XGQA 5HQ8A 2M0GB 2GX8A 3T1YJ 2Q6BA 1RHRB 3GPAA 2XMKA 2MMYA 3JTNA 1R0AB 2LXFA 2FHKA 2MKYA 4W4MA 4ZPVR 4YS2A 4DN0A 1WG1A 1VYAA 2JLFA 1NJZA 3LGNA 3V6DA 4X64F 3TI0A 4R0JA 1FWLA 1RU1A 4ZKAA 2FLPA 5J2NB 2AT1B 2EEYA 3NCPA 4ECZA 2I6WA 1RTIB 3RAXA 4ECSA 3D3CJ 4KO0B 4LVNP 2PC6A 2KKHA 2YKMB 3M6XA 2QLXA 2GQ2A 3R5CA 4AXJA 4QIFA 1LOUA 1TR0A 1U48A 2YX7A 2OEKA 3TX0A 4JV5J 4O44A 4OHZA 2DNKA 3DLKB 4MYTA 2OIHA 4QR2A 3DU6A 4CLSA 3IMQJ 4ZP9A 4IOCQ 3A1YG 3CO0P 3OJUA 3SV4A 5FJ4A 2GIQA 3AH6A 1N36F 1D8YA 2AX0A 8ATCB 1EZZB 4LBIA 5D77A 4JI5F 2J6SA 1YJRA 5B0FA 2HFSA 2L3MA 2C2RA 4K50A 2UU9J 1R8HA 4RKUC 4BHQA 1R7IA 2C2MB 4CO3A 1J5OB 3NXZA 4C8ZA 4S0MA 4USTA 2F40A 3PRVA 4PAAA 1KOHA 3VVTA 1A0OB 4C8OA 3Q8SB 5J2QA 4YY3J 4KQZA 2PFDA 3PR5B 1TKTB 1S10A 2FZCB 1CJTB 3CD6S 4ZVRB 1DHMA 4QU7A 1KVKA 1S9GB 4DG1B 3MCOA 2XMVA 1MU2B 3FZBA 3CJ4A 9RUBA 4NLRA 2ACYA 4U95A 1QUPA 2KYXA 3UR0A 3EGNA 4KKOB 2Z0GA 4WF9Q 5C42B 3J80U 2W2MP 4ZP6A 2AJ2A 4B9UA 4HTIA 4UOGA 1E6VA 1IBLJ 1U1QA 3ZTOA 3N6NA 4LSLA 3R5DA 1DTQB 1N5YB 4ZA1A 4KC5A 2DCUB 4LSNA 1WHXA 3LP1A 5F8LA 2H48B 1XEZA 4F8RA 4HDHA 1M5PC 3U1LA 1LQ9A 4ZP8A 2PI5A 1U1OA 3TAMA 4IRCA 1JMTA 2KXNB 4IQXA 1VJQA 1UVLA 4V19X 4RW7B 3C46A 4Q5VA 3T41A 2EFGA 3BZQA 2DGQA 1NXIA 1PO6A 3P45B 2XO7A 2K2PA 2IMOA 1A9NB 1UW4A 1UA0A 4F26A 1HI8A 2FJEB 3NL0A 4M5IA 4O3PA 4DSFA 2DGTA 3QJJA 1X5SA 2IFXA 4U96A 1RCXB 1SQEA 3Q86A 3OL7A 2XNQA 4DMZA 3KK1A 2ZJRQ 3RAMA 2G2OA 1S1TB 3J7AN 3UW1A 1QM9A 3OR2A 1UWBB 2RUGA 4DQIA 4ID5B 4Y34A 3D4JA 3THPA 2XLIA 1UJ5A 2VG5A 2PO4A 4I0WA 2XO6A 3DOKA 1F9FA 3LPYA 1KS2A 4C11B 1FJGF 5HK4A 4Q2MA 3AB2B 1QAIA 3OUYA 2O66A 5IT4A 3R5JB 2IVFB 4UTGA 5KFVA 5GAEU 3US5A 5DJBA 5CXTA 2EG2A 5KOXA 2V4JB 4PG4A 2BJEA 2HHQA 3RB3A 3MM5A 3OVBA 3LP0A 5KAKA 1YZ7A 2VU5A 1HI1A 3TZWA 2KFZA 1U1NA 1S76D 3CCQS 3K58A 2FC8A 2WRMA 2VFTA 3UD4P 3W7BA 3L95X 4UUWA 4OX6A 1LXNA 2VG6A 3CJSA 1GXUA 4OZ0A 3UCZP 4GKKJ 2QA2A 2I0XA 4RW4A 2J7UA 2XWYA 4IR1A 1RYRA 2GS8A 8AT1B 3A8KA 4R5PB 3KDNA 1FKPB 1U2CA 1X8DA 4ZPWR 1HA1A 1RI7A 3HPOA 2DPIA 4E8UA 2C2NA 2FYXA 2RRBA 1JLGB 2G4BA 2HNYA 3DXBA 3MXHP 2IC3A 1QAXA 2SXLA 1RHMB 2AGQA 2F4VF 1FWKA 4CT9A 3RG6A 3EM1A 3MFIA 2DXFA 2MLXA 2EC2A 2KRRA 1GTHA 4IFYA 2ZDOA 4JOUA 4QWCA 2A0FB 1PBUA 5EWFA 4TKTA 5A2QY 3KMQA 1S6PB 4RBVA 3SDEA 3P5TL 4L6V3 4GO7X 5L1LA 1WDTA 3F44A 4FS2A 1BD6A 1MWZA 1UW9A 4RW8A 1ZA1B 1RAIB 1YQHA 2LVWA 5C7PA 3QO9B 4RX6A 4OYBA 4Y2CA 4ZN3A 5FLXU 4XPCA 4J9RA 3MEEA 1NHVA 2JC1A 4EYHB 1X9MA 5D3GB 4JP8A 3WDOA 4DL2A 4PG5A 2NXEA 4LF8J 4XPEA 1YK9A 2BX6A 1HNVB 1YG0A 4C3KA 4LF9J 3M6VA 1JLAA 3NGUA 1HR0F 1RWWB 1YJUA 1VK3A 5B0GA 2H65B 4B9NA 4FVCA 1VBXA 4HI2A 5DO2A 3ZTRA 3KNAA 4KRWA 4JI6J 2VQEJ 3ET6B 2ADBA 1SPBP 4C3MA 4YR3A 5CYJA 4B08A 2ROGA 5H9FK 3ZZUA 4DSLA 5BR8F 1FJEB 1GXLA 1T05B 3KUGA 1RHJB 2V8PA 2DBBA 1AUDA 1NPPA 4K0KJ 1S1WA 2WOMA 2LYVA 5CYQA 2ASJA 1K8AT 4NLUA 5GMEA 4YUDA 1TL1A 2VOOA 4ZVEA 4PUOB 1P1LA 4HACB 1WEZA 3PVXA 2UXBF 2B9XA 2VG7A 2BZ2A 2KXHA 2DNRA 4ID8A 3GIKA 1V5IB 3EZ5A 4R8UB 1KHVA 4DQRA 1GAOA 1NJIT 5IM0B 1H6KX 4DN9A 3M32B 4GC6A 3M8PA 3D67A 4NXNJ 4OHXA 1HMVA 2Z2YB 5D4PA 1RT3B 1GEHA 5SUHA 5KG1A 3H5YA 3WHIA 3M30B 2ZH3A 4OX8A 1WG5A 1X31C 1T3OA 4EMDA 3BGRB 3PEJA 2HS0A 3DLGA 5HMZA 5A0YA 3ZZTA 3GJRB 1P9YA 1VK8A 2GJ2A 2LECA 3WC2A 1VQLS 3DM2B 4F0MA 4H4OA 3HDSA 3IR6B 3RR8A 1VR6A 3VGSA 4J9KA 2APOA 3HJVA 4LFAJ 4ECYA 1RB0A 1AZSB 3S6EA 2W9BA 4C8YA 2O67A 3PRDA 2HFZA 4KHPF 3LAKA 4NMLA 1R6YA 1HBOB 2V94A 3MTJA 1S1VA 1PKUA 3NRBA 2IJNA 1MROA 1RU2A 1JLQA 2R7QA 4CLLA 4FPIA 2ZE2A 2IM1A 4JI4J 2YWHA 4UZCA 5LMUF 2XGPA 2OH2A 1LWFB 2W9CA 1IKVB 2CPHA 2RUSA 1SH3A 1N5VA 4CNZA 2CNNB 1JJCB 3T3FA 2C42A 1IVZA 3G82B 1MMDA 3VQTA 1X0FA 4LBHA 3C15B 1W2BR 3GSDA 3B78A 4FYWB 1RT2A 1U24A 3TANA 5KG2A 1H0HB 1N5TA 1IBCB 3UCUP 2ATLA 2ZH5A 1F5AA 3Q8UA 2QMWA 2OPRB 1IN0A 3FCVA 2ZZMA 1RBAA 3D0GE 3TZYA 2DT9A 3ZZYA 1RT7A 3UN2A 4CH7A 3JTPA 1H74A 1R8PA 2DNMA 1VRUB 4TU9A 2QA4S 5I3UA 3DLEA 1NK7A 1U2FA 3KHGA 1FA0A 5D0EA 2W8LA 1BLUA 2F9JA 3FDSA 2AF6A 3BYRA 2F1FA 3W65A 2D3UA 3HO1A 1SI9A 3HD2A 4ANCA 1I51B 2CZ9A 1PJ7A 2PMWA 2XY6A 1NB2A 4J7CA 4WXOA 5H9EJ 4CM0A 1LFWA 3JB9k 5G4DA 4QIWD 1GXTA 1PIEA 4ECUA 2OGUA 2AEFA 3IAS9 5DM6Q 2V34A 2MGZB 1QVGR 3MECB 3Q22A 5JUMA 2HLUA 3CCUS 2KTQA 4M5DB 4Q0BA 1VQ9S 2M9KA 3HHNB 5C24B 4WFBQ 1CQMA 3TUIC 3J81j 1FNXH 2ASDA 4F36A 4J9NA 4EK2A 4N5SA 4HT7A 5KT3A 1YVFA 4BC9A 3T1YF 1RAGB 3OD2A 3PHEA 7AT1B 4F3OA 4GKJF 3NG8A 2VASA 2FGOA 4X84A 1B0TA 4I1TA 4WTYA 2HBZB 2E5LF 2DEJA 3CC2S 1M90T 3CD0A 5J2QB 2CPFA 2B9YA 5F0UA 4UOHA 4KBIA 4F4ZA 2F63A 4KH0B 3J7YI 1ROFA 5HBMA 3AA9A 3S01A 3MUVP 3H20A 1JXEA 2DD8S 1X5PA 3QRRA 3MMBB 1K1SA 4KPCA 1N5SA 3EGWB 4WFNQ 1NK4A 4C8NA 1B4SA 2YPZA 3TYTA 1E6VB 3MCNA 1VC5A 4JV5F 4J91A 3SI8A 3DNCA 4LSLB 3KWMA 4J9LA 4LSNB 2LP4A 4KB7A 3TP2A 3LP1B 2X7IA 1XMBA 1DQAA 3OFEA 5A2QU 2R7XA 4YMEA 3W8PA 4OZLA 5JVHQ 1UP1A 1RE1B 4USKA 2BJDA 3FGVA 1YBUA 3IN5A 1AFIA 4EEYA 4HI1A 2W01A 3V2UC 2RS2A 5K5MA 2VODA 5KFCA 2UU9F 4A8XA 3U1MA 2DEIA 3KK3B 2R7WA 2OPPB 5KFOA 2VJUA 4ELUA 4LF4J 1TL4A 4YY3F 5KG0A 3RR7A 4FXDA 2QSWA 5A76A 3SFUA 2ZH7A 1WNEA 2BBEA 1TK5A 4JI0J 3KJFB 4NLQA 3OR2B 5IXUA 1S9FA 2MQNA 2VG5B 3W63A 4ZVHA 3M8RA 4LVOP 4ER8A 2B8QA 3NCQA 3PYEA 4AYBD 2YNFB 4Y00A 1IBLF 1V3ZA 2C28A 1IWAA 2A6MA 2RMLA 4B9VA 3HD1A 2AJFE 4URGA 4FNHA 1AYEA 2NS1B 3OUYB 1L3KA 2FVPA 4OMFG 4F67A 3MEKA 2KO1A 3ZZOA 1OSCA 2R4FA 2Y1RI 2HFNA 1PCAA 2GAHC 2RU9A 3LP0B 3NS6A 2CWXA 2NLWA 3CMQA 3I9V9 3R7BB 3I0SA 4R0EA 3DOLA 2YXLA 2CVIA 1FK9A 3QZ7A 3VWSA 2XM3A 2XSFA 4YOEA 2MSTA 4WPAA 2GFFA 2VG6B 2RQ4A 1YJVA 3WIVA 4EO6A 1KFDA 3CMAS 1U49A 5I3PA 2ZBCA 1T3NA 2CG4A 1XNRJ 1X4FA 2V9KA 1Z1ZA 1S1UA 3IBCB 4WK3A 3GV8B 5EWGA 4KR0B 3QWUA 3CXCR 4OHYA 1Y5NB 2HFUA 5JXSA 1RTDB 1NJWA 3PO4A 2FJVA 2EW9A 4LSZB 4DF8A 2DR9A 4NA1A 2HNYB 3HULA 2MKSA 2V69A 2FY1A 1KNZA 3FK4A 2IC3B 4U9RA 2WSCC 4ICLA 4DR2J 3R7SB 2CDRB 2YH0A 2BOAA 4ED7A 1FKOB 3MEGB 1HBUA 3GMGA 3CT9A 4IFYB 5ETKA 3KG1A 2QLFB 2ZH1A 2HS4A 5T41A 3BV8A 3BH7B 4K59A 2I2YA 5IS2A 5KFSA 3GP9A 3SDEB 5GAGI 4ILLA 4TY9A 3DXSX 2Z30B 4ZVGA 3QGPA 3RU0A 2Z57B 3U7JA 2DNPA 4ZCIA 2GJFA 4RW8B 4IKAA 3M8ZA 1C2PA 3W5XA 1N48A 1QTMA 1Q8LA 1QVFR 1ZAWA 5BXIA 4J37A 2GHVC 1GT8A 2JJ4D 2BJ8A 2QFJA 1IR1A 1JLBA 1S6QA 2V8GA 5CD4A 3D66A 2HQ3A 2G2YA 1HPZA 3AAWB 1KVJA 4Q43A 1TAUA 1DTTA 2JEGA 1RAHB 2D3ZA 3VGUA 2K1RA 1TUWA 5AJ3J 3DU5A 1UEKA 2HNDA 4MYUA 3HP6A 2NXJA 2QRRA 2F8MA 1SH2A 1UJ6A 2GAGC 1ZM3A 4DR7J 3PTWA 1U4BA 4UOCA 2R7RA 2DHAA 3MI7X 3K0JA 2FB0A 3NMRA 1MW7A 4P2XA 2KHCA 3VR1A 2E1AA 4L73A 5LL6d 4EYIB 2PD1A 3MD1A 1LK7A 4NMXA 2HHVA 5CYQB 4NX9A 3TOQA 4DLGA 5LJ5Y 4E0DA 1T9UA 5E5NA 2L08A 2B51A 4EO8A 1JLFB 3QT7A 1RWNB 4MAKA 3CDEA 3I4PA 3IP0A 3W9HA 2AJ1A 1SV5B 3IWXA 4HEA9 1Y3KA 1BC6A 5ETRA 3M8PB 2BE2A 3R27A 3ILJA 3FFIA 4V19J 3DMJA 2CRLA 2CUYA 4PZVA 1U1MA 4LF8F 3BGOP 3K2YA 5K20B 1NSQA 4WZMA 5IQQA 4LF9F 3R5BA 2B4OA 3TQ1A 4CQ1A 2HHUA 2IJFA 2CJYB 1TMJA 2KB2A 1CQNA 3NOGA 4ZPTR 2H9ZA 3DLGB 5A0YB 2VBWA 1V5VA 4RU9A 3IS9B 2ZDPA 1FKAF 3QLHA 2P6TA 5L38A 4B9TA 2KJVA 2R2RA 2D9OA 4JI6F 3FRZA 4CTAA 2VQEF 4J9VA 2R7VA 2G0CA 4QWDA 4WKRA 4H4OB 2FIUA 4LRCA 5B0BA 3FVYA 4IG3A 3QIDA 4ED6A 3W2WA 2MQLA 3EMTA 1WC6A 5CZXA 1M5VC 4EI2A 5L1JA 2W9BB 2Z58B 4K0KF 4USWA 3T5KA 5D0GA 3PFEA 1R0CB 3CCLS 4FPRA 3CNQP 2JLEA 2XSJB 3B54A 1X4DA 4XIUA 1W25A 4OLOA 3TNVA 1S1VB 2DHHA 1C0TA 1MROB 4F4YA 5J2MA 1S0VA 3MR6A 5M2RA 3AJ2A 1JLQB 2J9CA 4QPTA 1NJYA 2CQGA 1SKWA 2ZE2B 3AOAA 4JV2A 2VD3A 1U26A 4NXNF 1HQEA 4MFBB 5IZHA 3CJKB 3R97A 1RWPB 3CSKA 3MZIA 2C2DA 3ILIA 3ZNJ1 2VQFF 4C98A 1TK0A 4IYQA 1P1TA 2LEAA 2Z2MA 4DV3J 2ZBPA 3FEZA 2JHEA 3C19A 3CUNA 4XDCA 5D4LA 5FDLB 3QIPA 2HHTA 1L3VA 5ETNA 3HHDA 4QWBA 3IBFB 5F41A 2MY8A 2GIFA 2YQ0A 4IUFA 1KLMA 2HURA 3H5SA 2ZOGA 2IMWP 4DXLA 4PPDA 1H98A 4LFAF 1WI6A 1XERA 3DDIA 4A8QA 3GIIA 2FC9A 3H2VE 1NK5A 1HNZJ 2ZBQA 5AE3A 2I5JA 3B6BA 2JVRA 3OJSA 2UVRA 1NHUA 4B3OA 1RT6A 2AP6A 2IDLA 3V6JA 1FDNA 3HLUA 5I3UB 2FVRA 3GCWP 2OHDA 1HKAA 2R8GA 4WP8A 2MZ1A 1DRZA 5I4MA 2ASLA 4PCQA 5CD4H 4CT8A 2F8EX 4DQSA 4NLTA 1F60B 1SC4B 4DEZA 5FD1A 3ZTSA 1Q95G 1NB7A 5ITHA 5F9NA 1JLCB 1WC3A 4O3NA 3B8HA 1UEUA 3PJ9A 1E6YB 1XR5A 3TUPA 1N6QA 2V2ZA 4HDGA 5DGBA 1U09A 5BYRA 4Q0BB 4PPZA 4X4UA 4M5GA 3O6QA 5DDPC 3BDEA 2JWNA 2XZTB 2DGOA 1QTNB 2AKWB 2CQ2A 2VDHA 1O8BA 4PWDA 1FHTA 1K47A 1NPRA 5EDWA 3DRYA 3DLBA 2BABA 2DYAA 3GLJA 4DL0C 1TL7B 3HHKA 2MTLA 3CJ2A 4NLVA 4L72B 4W92B 3FCWA 1DAXA 1QJHA 5J1NA 5HVGA 1NDPA 1WKJA 3H4BA 3Q2SC 4KY3A 2C3OA 5HROA 2BQRA 1YITS 4I2QB 5D6GA 3LO3A 4DSEA 3FSIA 5HBMB 3GZ7A
chains in the Genus database with same CATH topology
5M2PA 3KLVA 4C8OA 3Q8SB 4OJ1A 1NK0A 2V2KA 3IWNC 5J2QA 2AYGA 2R7SA 4IH6A 1MNEA 4KQZA 3PR5B 1TKTB 1S10A 4FF4A 2HNZB 1UL3A 3AQOA 2VKZG 1ZH5A 3GFHA 4HL9A 2PGCA 2NYIA 2IBOA 1X5TA 3PW2A 3CD6S 3NNAA 3QGHA 1UVKA 3TA0A 2QZ8A 3ZZ0A 2RB7A 1DHMA 3OTDA 4QU7A 1S9GB 1WF2A 3UQSA 2R7TA 2GC8A 3T6JA 4DG1B 2O5DA 2XMVA 2DNHA 3PIPQ 1MU2B 4ZCLA 1YSJA 3CJ4A 3FZBA 3TA2A 4NLRA 2ZBIA 5C25B 2ACYA 1QUPA 2J5AA 3IG1A 2HQIA 1JLEB 2KYXA 3UR0A 3EGNA 4KKOB 2Z0GA 1YI2S 3G8TA 3MM8A 5C42B 4WF9Q 2VKRA 1U1RA 1RT1A 4ZP6A 4B9UA 1V3RA 2Z4PA 4TXSA 2M3DA 5KFMA 2C22A 1T02A 3IR5B 3IO1A 4HTIA 2HHHF 1HBMB 1E6VA 3CF5Q 4CCHA 1U1QA 3HMJG 4LMZA 1HFEL 1RK8A 3KHLA 3MR2A 2HYIB 4K4UA 1LWCB 4N8OA 2HGLA 3N6NA 4LSLA 4HHJA 3R5DA 5DDRC 1R8BA 3G8SA 4NCBA 2ASYA 1DTQB 1XK8A 1N5YB 4ZA1A 1S6PA 2HHWA 4KC5A 2DCUB 4LSNA 1WHXA 1XBWA 4H4KA 1WF1A 3LP1A 4C0HA 5F8LA 1KR4A 1SH0A 3DN9A 1XEZA 3D1OA 3VF0B 2YNIA 4URSA 4F8RA 5KFYA 4HDHA 2MPUA 4OHVA 3U1LA 1LQ9A 1M5PC 4ZP8A 2PI5A 1Q1KA 1U1OA 4NCGB 1P6TA 4F3QA 3QAEA 3I9ZA 3TAMA 3KLGA 4IRCA 4IQMA 4GKKF 1JMTA 2DO0A 2KXNB 3PW5A 4B9LA 1FJ7A 3GILA 4IQXA 1WWHA 5KG4A 2AGOA 1UVLA 3QIPB 4V19X 4RW7B 5F8IA 3C46A 2C3UA 4Q5VA 2GO8A 1T94A 3IFEA 4DL6A 3RZAA 5KT4A 3OXGA 2EFGA 1PC4A 3NNCA 3KLFA 3BZQA 4YEAA 2DGUA 1ZTTA 2BDPA 1IJFB 3FMBA 1FEHA 5KG3A 2DGQA 1WEYA 3M2UB 1PO6A 3WC0A 4X2BA 4DDFA 2XO7A 2LA4A 4WU2A 2FUG9 3OTOF 2R2TA 2FJBB 2AJQA 1GX6A 2K2PA 2IMOA 4OZNA 3BDPA 4BCAA 3E2EA 1L5UA 1A9NB 2DNZA 4GC7A 4QW8A 1UW4A 1UA0A 2LQJA 4MKBA 2IYGA 3BREA 4PQUB 1JB0C 4F26A 4IO1A 1HI8A 2FJEB 3N9UC 5A8RA 1TQLA 2CQPA 5D3GA 3NL0A 2UZAA 5K8OA 2COLA 3SCLE 2HAIA 3HKWA 2J9DE 4QR1A 4TLQA 4O3PA 5BJRA 2E44A 3F41A 4ZHRB 2DGTA 1C1BB 4DSFA 1XMQF 1QSSA 2IVYA 5DLGA 3QJJA 3DCAA 3ISZA 1X5SA 4JI2F 1NEEA 2IFXA 5K14A 4ECXA 1SQEA 3BR9A 3VAIA 4B3OB 1RT4A 3UE2A 2QE5A 3OL7A 3QYYA 2KG0A 2FJAB 2RNEA 1SXLA 4DQPA 2XNQA 4QIVA 4DR5F 4QBUA 1KD1T 2KI2A 4DMZA 3UNGC 4DUZF 1QAYA 1R31A 3KK1A 2GIRA 2ZJRQ 2N4DA 3W2VB 2CQ1A 3RAMA 1TKZB 5IQ6A 4U6PA 1S1TB 1H7WA 1TV6A 3UW1A 1QM9A 5A8WB 3RB6A 2N7YA 3HVTB 3OR2A 1UWBB 1UKUA 2RUGA 1SIWB 1RTJB 1S0NA 3MFHA 5I42B 2CKWA 4DQIA 3QPIA 2ZH6A 4ID5B 4Y34A 3THPA 2LDIA 1TKDA 2B43A 2XLIA 1UJ5A 3SYZA 2VG5A 4NLPA 2RVJA 2PO4A 1UAWA 4I0WA 1MWYA 2PE8A 2AU0A 1D3WA 4ED8A 3V6DB 2VA2A 3DOKA 4ZDNA 1F9FA 3LPYA 4Q7AA 3O1LA 5A8KB 2XLKA 1KS2A 4C11B 2BOPA 3DLHA 2E1CA 1FJGF 3B4DA 2DJWA 4X4OA 4K4ZA 3R3TA 1REVA 3OHAA 2UV8A 2GA7A 4Q2MA 3CCWA 4D3GA 3AB2B 4HT5A 4CI0B 4U7CA 3MOJB 3HJFA 1CC7A 1QAIA 1C4AA 4OI3A 3OUYA 2O66A 5IT4A 3OHBA 4DS4A 5L9NA 5G0RB 5J1PA 5HN0A 5KG7A 1Y0HA 3TARA 5A6WA 2IVFB 3EYZA 2UXCF 3AQPA 1G3OA 4WXWA 2Q43A 5KFVA 2V4QA 3NWGA 5GAEU 2YWGA 4CO1A 3ZZPA 3US5A 5DJBA 5CXTA 2EG2A 5B0CA 4YQWA 4RU2A 2ZOMA 2P9CA 3EPIA 3KTQA 5KOXA 4NLXA 4PUOA 5F8NA 2V4JB 4PG4A 2BJEA 4KJIA 1S79A 3I87A 2HHQA 3ONQA 5DRKA 5H1SV 2OSRA 3RB3A 2IM2A 3MM5A 3OVBA 1N4LA 5CQGA 4AUKA 3LP0A 5KTQA 3HX9A 4ELVA 4GO5X 1JIHA 2DISA 3MEDA 5KAKA 4O44B 3RRKA 3SCIE 3X3UA 3LW5C 4LF4F 1N32F 5HL7Q 4O4GA 3OVSA 1UVIA 1HI1A 3GV5B 3LAMA 2KVIA 1M5SA 4NYZA 2ABYA 5B08A 5KFKA 2GQCA 5FIIA 2KFZA 1VQPS 1U1NA 5CCMA 1S76D 4X4PA 2AWZA 4MIWA 3ITHA 2N3LA 1YBAA 3C66A 1V6HA 1EP4A 4EU0A 3CCQS 1QY7A 3NCRA 3N5BA 1WF0A 4ZCKA 3K58A 3DI6B 2RQKA 2E1RA 2FC8A 1RTHA 2WRMA 2RDJA 4EUVA 1Y4ZB 4YB1P 2VFTA 2RKIA 5DG8A 3T5LA 3UD4P 1LW2A 3G8QA 3HHLB 1NKCA 1S1UB 2EI5A 2LXUA 3I0RB 3W7BA 2V8DA 3L95X 2HIQA 4UUWA 4OX6A 4O3OA 3G9CA 3AHPA 3I32A 1U6ZA 2FHJD 2MHNA 1LXNA 2EPIA 2VG6A 4Q44A 1ZM4A 2MSSA 1FRXA 1CLFA 1GXUA 5IWAF 4BC7A 3I82A 2MKIA 4OZ0A 2KG1A 3UCZP 4IH5A 1M0SA 1KFSA 3LOUA 3UR3C 2QA2A 2VPXB 4FN5A 4A8YA 4UW2A 5HROB 2AYMA 2I0XA 4RW4A 1VQOS 2J7UA 2XWYA 2MZJA 4O4RA 1YRTA 4TQSA 2DNOA 2HWTA 4IR1A 1RYRA 4OI0A 3D28A 1TAQA 2ZUGA 1Q82T 4PWUA 2DH9A 3CDAA 2N7CA 4I67A 4R5PB 2DGWA 4OI2A 1FKPB 3OFGA 1HWUA 1X8DA 4ZPWR 4DFPA 4U7UK 3DGPA 1HA1A 1GNKA 2XMWA 4DR6F 4HTJA 3MR3A 2M52A 3O3LA 4ICLB 1RI7A 3GE9A 2RJZA 2EWHA 2AYEA 3HPOA 2DPIA 4E8UA 3LGMA 2MKHA 2RRBA 1TP7A 2DRBA 2IM3A 4NLYA 1JLGB 2G4BA 2HNYA 2B4PA 4DWIA 2Z2LA 1URRA 4ECRA 2GV1A 2VB6A 5E33A 5AE2A 3VAFA 3V5RA 1J5EF 4F2RA 3VAKA 2MDAA 4J9SA 3DXBA 1XMOF 2IC3A 3MXHP 2ZZNA 1BQXA 1QAXA 3MM6A 5KFAA 1OQ6A 1TZ0A 2SXLA 1HD0A 3HZGA 2AGQA 2F4VF 2BQUA 3HKZD 2ZOFA 4DSKA 4CT9A 1BQNB 5HLFA 5THWA 4F4WA 3MM8B 1ZM9A 2ROPA 2FVQA 3MFIA 3KJVB 3LQVA 3H5XA 1HBOA 1RT1B 4A8OA 3CCMS 1XR6A 1ZPVA 2KRRA 1GTHA 3BF4A 4IFYA 4NYOA 1KC8T 3TUZC 2ZDOA 3MAHA 4JOUA 1VQSA 2JSXA 4P7TA 4QWCA 1N34F 1OQ3A 3QJPA 2W4DA 2CQCA 2ZD1A 2BRLA 4Y6IA 5HMXA 5EWFA 4TKTA 5A2QY 3KMQA 3I55S 1S6PB 4N41A 1J2VA 4RBVA 3PXGa 2E5GA 3SDEA 3P5TL 2E9ZA 4UY8T 3DC2A 2RILA 4L6V3 4CH1A 1FNOA 2OSQA 3N01A 4GO7X 4TY8A 4R25A 2E66A 2YNIB 4WJBA 3UI3A 5L1LA 4IO9Q 4KIAA 2CPDA 1FDDA 4H4KC 4DV0F 2CPYA 3QZ8A 3F44A 3P96A 4FS2A 1BD6A 3TAMB 1LWFA 3KLGB 4DJBA 5CH7B