1OX8A

Crystal structure of sspb
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of degradation signal recognition by SspB, a specificity-enhancing factor for the ClpXP proteolytic machine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase activator
molecule keywords Stringent starvation protein B
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ox8A00
1OX8A 2QASA 1OX9A 1ZSZB 2NYSA 1OULA 1ZSZC 2QAZA 1TWBA 1YFNA 1OU9A 1ZSZA 1OU8A
chains in the Genus database with same CATH superfamily
4PFOA 2NUTB 3TSWA 3TSZA 1LVKA 3CD6Q 4F04B 3CC2Q 4HCBA 4R55A 4IURA 5D6YA 1PD0A 2R57A 3PIOA 3QUIA 5D6XA 2RJCA 5KYUB 2EQIA 1K0XA 3FEOA 3HRUA 4OF1A 1T0HA 3CBPA 1CSKA 3QYHB 6AT1B 1IXDA 2DXCA 3MP6A 2V8KA 1VQPA 4KGXB 2L3PA 2L3QA 2LDMA 4PJOB 1QVFA 3H8ZA 3T9NA 2C0TA 2KYBA 2KR3A 1UJ0A 3EFOB 1KFZA 4KGVB 1ARKA 2NUPA 1GBRA 3PE0A 2PVGB 4RTWA 2VGNA 3I35A 3OS5A 4QVZA 4J6WA 2IIMA 4XU2A 2HKQB 2J6FA 3I5RA 1JJ2P 4OB1B 2AZVA 1BIAA 1IREB 4JRIA 1R0CB 2DILA 1ZSZA 2AK5A 2QK0A 4FU6A 5LJ3e 3CCJT 8AT1B 3M56A 4RTTA 4KUDK 1N8RR 4BY6B 1Y96A 3QJYA 2D0QB 1BIBA 2QAZA 1TXQA 3CXCA 5GAN5 1MMAA 4RUGA 4LDXA 2A37A 4KRTA 2V1RA 2YLBA 4C0ZA 1K0SA 2DIGA 1RLPC 4KUIA 5A2QE 1WPYA 2LT4A 1RI0A 2RN8A 4FCYA 2JUFA 1VA7A 2DETA 2DRMA 2X4XA 1XQHA 2Y4XA 2OAWA 2GFAA 3JB9J 3CMAA 5IAYA 1HXDA 2X35A 3DB4A 1AWXA 1Z9QA 4OMQA 1VQNA 4M7DG 3CCUT 2DZCA 5GANf 1FMKA 5FU6B 3I56T 3CXCS 4XU3A 3E19A 1F1BB 2ZAEA 1EFNA 4GY5A 2CDTA 4M7DA 1GXIE 2DTIA 2DERA 1YITA 3RUXA 3V7CA 2JNGA 5FROA 1ZSGA 3AHUA 1G5VA 1JEGA 1YHQQ 1YJNA 3VRYA 2EIFA 3M57A 3CPWS 2NLUA 2VXFA 1TTHB 1D0ZA 1IO6A 1KC8R 4C92B 2CYZB 1JU5C 2JZ2A 1I4K1 1IRXA 5CKBA 3X25B 3JCMd 1K9AA 2CZ6B 1PNJA 3QWYA 2FPDA 4PFZA 2ZCFB 2RA2A 1OU9A 2YSQA 4J8OA 2CP7A 1I5OB 3EG0A 5KYXA 3OS0A 5GAN2 3OSVA 1VQ7Q 5IHIA 4BI8B 4F16A 4ZGEB 4OGEA 2DAQA 4J9EA 5C0MA 5HY6A 4ZTJA 2J6KA 4JLIA 3JCMV 5GANg 1E6HA 3REBB 3EH1A 1TWBA 2F69A 3QIIA 3H0IA 3SWNB 2D0NA 1Q7YC 2KBTA 2OTLT 2A08A 2DTOA 2QA4Q 2YRDA 3L1AA 1JXMA 4RKUE 1R0BG 1M90R 4M75A 3L2RA 4RCBA 1M1GA 2CSIA 2RJFA 1SG5A 4NL2A 2FZCB 5CKFA 1AHJB 2V1QA 4II1A 4PJMA 3H41A 2RI3A 1GL5A 1LCKA 4M75F 1VQ4Q 1V76A 3OBYA 3LWIA 3EGUA 1X75C 4JRPA 4BE1A 3OYIA 2AT1B 3MJXA 3EGXB 3JCMQ 4KH0B 3OYCA 4M7AD 4FL6A 1WXUA 4OMLA 4BUGA 5FLXE 3OW2S 2OTJT 2QQBA 1TOVA 3JSCA 2NWMA 3FRNA 2OI3A 2LJ3A 2LVMA 4N0AA 1UDLA 3BW1A 1N8RC 5I2SA 3PNWC 1GBQA 3GBQA 3JCMb 2PTKA 3V8KA 1B7TA 4LDYA 3OYAA 4Z02A 2WACA 1I8FA 4YTLA 2XD0A 3G7ZA 5GMKh 4M77D 4OMOA 3OS1A 3CCRQ 5FU6C 5GMKl 2BE9B 1TUDA 5HKCA 4KGZB 2KT8A 2V8IA 2C06A 8ATCB 2DXUA 2EGEA 1M27C 1Y57A 2DL5A 2IG0A 3LH0A 2ZPIB 3QSUA 2XHCA 5CKHA 2JW4A 4PJLA 3L2QA 5D7UA 4WTOB 7AT1B 4C92E 4RTXA 3D7SB 4E7ZA 1VQ5A 3HSBA 3CCQQ 2KYMA 1N27A 3PFSA 1JBMA 1NLPC 3A8LB 1Y0MA 1VQOQ 1VQPT 5CKEA 1IGUA 5FRMA 2P4TA 1W2BA 4IIMA 4UC4A 2LCCA 4M78C 3BDLA 4QW2A 5LJ5g 2JN0A 1NYGA 5DM7R 1LOJA 2CP5A 2CZ1B 2DK3A 1AEYA 1WZOA 2ECZA 5CQYA 2J06A 5A0DA 3EFOA 1J3TA 1PM3A 3INZA 2DRKA 2RPNA 4GLKA 2QQAA 3CCVQ 1ZSZC 3A8HB 1X01A 1YI2T 4LXCA 5AYFA 2VC8A 2BZYA 3FJ5A 4F7UB 2W10A 1IHVA 3JCMJ 3CCLA 3PTAA 2KAFA 3PMIA 4ESRA 2O4XA 3QDFA 3PT9A 3G71A 4JRKA 1KD1C 5M9OA 3J80E 1HK9A 2AIRB 5KCHA 4OMMA 4L5GA 5L23A 1MV3A 4Z8AA 5I2MA 5I11A 3M5AA 3SWNC 1X69A 3UDCA 4D8DA 3LW5E 1W1FA 3G6EA 1IZ6A 1R77A 4OB3B 2M51A 2E3HA 2YDLA 2QGGA 1I1JA 4DEXA 2D1XA 4R56A 3RNJA 1QWFA 5EC7A 1G3WA 1VQ8A 1YJWQ 1VQLT 4FYVB 5IT9E 1VQ6A 1X43A 3EGDA 1BB9A 2M0OA 4J9DA 5CCAA 1QVGS 2X4WA 2YWWA 1N8RU 5GAMd 4FM4B 3CCUA 1Q82C 3JCMX 2AZSA 3LX7A 1JJ2A 3SHWA 3JCMW 2F5TX 1NYFA 2HDAA 2LMJA 2VWFA 3RERA 1T0JA 3JCMg 4ANJA 4QQGA 3E9FA 5HCKA 2M16A 1EX4A 1RAGB 2E5KA 2WSEE 2JM9A 3JB9G 3EG2A 1H8KA 2MYSA 4A4HA 3URGA 2SRCA 1BCOA 3OYKA 4JJNK 2H3JA 2A3LA 1NPPA 3CPWP 3CCJA 1PCXA 3G4ST 1RLQC 3LH5A 3QPHA 4C8QG 1YJ9T 2KROA 3VYGA 5KYYA 3OYLA 1Y07A 1VQMA 4ZNXA 4B9WA 1A0NB 3WVEB 3DLMA 5AT1B 3FC3A 3OYDA 3CBMA 4JUVA 5I22A 2GQVA 1G8XA 1XOVA 1PG5B 2VKNA 4B6MA 1LJOA 4QVCA 5IH2A 2XMFA 3CC2T 1PKTA 1RAAB 1YCSB 2Z0WA 2BTTA 1OZ3A 3TREA 2FG0A 1D09B 3CCMA 2BKDN 2E3IA 3FJPA 5KH6A 1YFNA 4XU1A 2EPDA 2L3RA 2RJDA 3JCMf 4BDZA 4E6RA 1UHFA 1K8AC 3MEAA 1PWTA 4IIOA 3OYYA 4C0FA 1KQ1A 5KYWB 2QASA 4PJOD 4RG2A 3KUFA 1V29B 3GPLA 3P8HA 2NUPB 2DL3A 2EGCA 5GAOl 5KCOA 1K76A 2EYXA 2RNAA 1M2VB 3OA6A 2KEAA 3EG9B 5LJ3j 2DL4A 3EG3A 2A7YA 1VQMQ 1D1CA 2RQVA 3PVLA 4PJOC 5CVIA 3FDRA 2LRQA 2RQTA 2YRCA 1K8AU 2E65A 3GIBA 3CCJQ 3A8OB 1FX7A 3CC4Q 1VQKQ 2EQJA 4ME7A 1UGQB 3CMET 1QP2A 1M1KR 2YUOA 4NOYA 2L89A 4Y91A 3VS6A 5FRNA 4A4KA 2CGHA 2ABLA 2AHJB 1FWZA 4JPBW 3V8LA 1OYXA 2XI9A 4M7DC 2P0QA 2MIOA 4C92D 1H92A 2QDLA 4M77A 4MMLA 4LNPA 5CO7A 1S72T 2DX1A 4HKEA 4E2FB 4C8QD 2H8HA 2HSEB 3C12A 3DLLA 3X20B 3OYGA 3CCUQ 5CQXA 3KFVA 1VOMA 1VQ6Q 1ZA1B 1YJWA 2F2WA 1TSFA 3TU4K 4A54A 1GFCA 2JMAA 1UHCA 4ZN3A 1AVZC 1MHNA 2JS2A 3NFCA 4EIKA 1Y71A 5LJ5j 4RMOA 1BU1A 1ACMB 3G6EQ 1YHQT 1BI3A 2JM8A 4EMKB 3M54A 4C0DB 2HBWA 1B3QA 4E7SA 3QDRB 3V8JA 2QDYB 1ZUYA 1D1BA 4C92A 3LGFA 4KBMB 3G71Q 9ATCB 3HKSA 2A0FB 3H0HA 2JMCA 2KT1A 3L2UA 2DEQA 1KHCA 4M7AB 1RI9A 1AZGB 3CCVA 1X27A 4QVDA 2X4YA 3KXTA 3BY7A 1M90U 2FPEA 2DA9A 4PKCC 4J5YA 3Q1JA 2HL3A 1YIJQ 3DB3A 4X9DA 5CAIA 4XK8E 4NL3A 2F2XA 2LTOA 4BY6C 1NJIC 2QG9B 2G3RA 4OB2B 1PSEA 2IPOB 1C1AA 3M9QA 1M8VA 4PJOA 4J9BA 1T3LA 2EYZA 4N4GA 1UB4A 3QXEB 1ZQ1A 1G83A 3UWNA 2BZ8A 1HJDA 4QT7A 4FSSA 1SPKA 5GAN3 4C8QA 2EFIA 5GAMj 3UA7A 3HFNA 2KE9A 2DF6A 3V7RA 4GBQA 2LT1A 4JS5A 1TS9A 3GLXA 3JB9H 3ZBDA 3PIPA 3CCRA 1NZ9A 2VGMA 4F7UE 4HT8A 2K3XA 4J9IA 1GCPA 1SHGA 5GAOp 2DMOA 3UATA 5GANd 2GTJA 1QCOA 3RDVA 1S1NA 4AFZC 3OMGA 1WNLA 1YWPA 4M78B 3VJPA 1SSHA 1WHLA 1MMGA 2CH4W 1WJQA 3LGLA 1UGPB 2XICA 4C8QC 1WQ7A 1G3YA 2RM4A 1Q7YR 3LYIA 1YIJA 1IHWA 2NYSA 4DBRA 2YLCA 2FZGB 1QVFS 3CCST 1MUZA 2CP6A 5KYXB 3QWXX 3H0FA 2RI2A 2LQKA 1M3AA 2AKLA 5KYYB 3H9NA 3MKDA 4EPCA 5GAMe 1M9SA 2FL7A 4A4EA 4NS5A 2DIQA 2F2VA 2C0OA 2JT4A 2DPPB 3REAB 1QVPA 3OY9A 4ZN1A 1NEGA 1K4US 4MZPA 1JB0E 4A4GA 2QEXT 1QWEA 4M77F 1RADB 4RTYA 2QA4A 1U5SA 3CCET 4RG8A 2E6NA 1C0MA 3G1JA 2I2LA 1ZBJA 3QG1A 4PL6A 2HNIA 2DJQA 1UECA 1PRLC 4BACA 1WQWA 3HHTB 2KVQG 4DOWA 4M7AF 4D6WA 1Q95G 4E7KA 2L0AA 1RL2A 2GFUA 2P84A 1FYNA 3LLRA 4ORZA 3L2VA 4BE0A 5FWBA 2OJ2A 1WJSA 1W4SA 1VQ9T 1BI2A 2MCNA 4XAXB 3CC7T 4HVWA 3J7AF 2HD0A 2VASA 1OX8A 3EGXA 2LC4A 5LJ3g 2J6OA 4A63B 3UT1A 3ULRB 1K9MC 3VS3A 1DJ7B 3OMCA 2MK5A 3QBYA 2EYYA 3QZ9B 3A8MB 2D9TA 3ZFJA 5LJ5f 2D8HA 1YJNQ 3ME9A 2M9UA 3MP1A 1VQKA 3CC4A 3CBOA 1NG2A 2LQNA 1NM7A 3C0CA 1YITQ 1KK7A 5GAN7 2GQIA 1VYVA 4HVVA 2JTEA 2GCXA 3CPWA 3U23A 1XJWB 2FRWA 4MDWA 2DD4A 1CKAA 1K8AR 1W70A 4E7HA 2HSPA 2QXFA 4B9XA 3KBGA 3O5ZA 1NPRA 4M7DB 5CK9A 4J7IA 2XK0A 3L2WA 2X4JA 1Z9ZA 4F7UF 3CD6T 4HA8A 4LD9K 3OSSC 2PQWA 3PMTA 4FYWB 3A1PA 4ZGDB 1VYUA 1G3SA 3GF5A 2K2VA 5GMKe 1TU0B 3JCMe 4JS4A 3VS2A 4M75E 2XKOC 5KE2A 1YNZA 3CCMQ 2CP2A 2QTVA 2COWA 4PJOF 3P8DA 2CS7A 2I0NA 1BBZA 4M75D 3VU3C 3H6ZA 4IKFA 4PFPA 4M75G 4M75B 4JZ3A 3VYHB 3NPFA 1K73U 1D0YA 1ABOA 1MMDA 1D3BB 4C92F 2GBQA 5GAOm 3FIFA 3CXCP 1D1AA 2F5KA 3I55T 1EIFA 3GNGA 5D6WA 2EKOA 1VUBA 5GANe 1AT1B 4C0GA 2PUKB 2HKNA 2DLPA 5LJ5e 4AG1C 4PNOA 2FPFA 2M02A 4DOVA 3JB9I 2H3EB 1VQOT 1VQPQ 1U06A 2XDDA 1NE8A 3MEWA 3OW2A 5CKDA 2LZ6B 2FZKB 4FIBA 3RIRA 5LL6S 2BUDA 2GNCA 3EH2A 3JCMh 1AOJA 4DBHA 4RTZA 2DXBA 4FT2A 3OYFA 1X6GA 3CD6A 5GAOq 4XQ3A 2PVOB 3EHQA 4M78G 1QVGP 4MDXA 5LJ3f 1B34B 5KE3A 1I5LA 1SEMA 1UGRB 3GP8A 5KYUA 1VQ8Q 4IUVA 4X34A 3RMSA 3EAEA 3C94A 2X51A 3QKJA 3M59A 2EYWA 2YT6A 4OP0A 4PLLA 3ER0A 2KRMA 2PZ1A 1UTIA 1Q81R 3A98A 3VS5A 3GOXA 3CMEQ 1IB8A 4MMKA 2KDSA 1FMWA 2FO0A 2KY9A 1HSQA 1I81A 1NJIR 5GANj 3I56Q 2E10A 1WHMA 3BDUA 1UJYA 3CCLQ 1SRLA 4X9CA 2EQUA 2X3XD 3O8VA 1C6VX 3TQ7P 5CIUA 4J9HA 1NEBA 1O9SA 1TUCA 1BKBA 5IN1A 2MI6A 2ESWA 2D8JA 4KULA 4M78F 2YXYA 4LE9A 4XTWA 4F14A 5FWCA 4DBFA 3EHRA 1M3BA 2MWPA 5GAOn 3VS0A 2E64A 3BE3A 1ZUUA 4FW1A 3VS4A 3CCQT 5L8RE 1EZZB 4XTXA 1VQOA 3OBWA 4KH1B 2EGAA 3E9GA 3CCQA 1BI0A 1G3TA 3VKIA 3F70A 2PUOB 1VQ5Q 3HRTA 4Q5WA 1WJRA 1Q86C 4XTYA 1I0CA 2DO3A 3JV3A 3G4SQ 2QEXA 3QZ5B 4DEYA 1E7OA 2O88A 1ZUKA 1AWJA 3TVTA 2MPXC 1VQ7T 1WA7A 1HD3A 1H3HA 2LQ8A 3DKMA 1Q82R 2E6ZA 2V8JA 2MMPA 3HFOA 3META 5I21A 3M0SA 4OMNA 3M4GA 5CR2A 4C5EA 2O9VA 3HTRA 2P0KA 1B07A 1JO8A 3FLGA 2E12A 2P4RA 1PD1A 3NTKA 2K5FA 4X1VA 4L6V5 2XDBA 1SKUB 4A4FA 3THKA 2YUNA 4CC7A 3TCJA 4M77G 3M53A 3R6NA 4BD3A 1M1FA 1ZHIA 4AT1B 2Y90A 4GLMA 2BIVA 1OPKA 1QQJA 1VQ4T 2KMTA 3MEUA 2KNBB 2DTHA 1MNDA 4LDWA 2KXDA 2K57A 3A5ZB 2RD1A 1K73R 3E1SA 3JB9D 2NUTA 3M0UA 1Q86U 2QQSA 4M77C 2ZPFB 1M4ZA 2K5IA 3LWHA 5J26A 3M0TA 3OQ5A 1OEBA 2RQWA 1VQ4A 2LCSA 3J81E 3NTIA 5GAOr 2VYTA 1M2VA 5GMKm 4CI0C 1U3OA 1AWOA 2HZYA 1AZEA 1WHKA 4Y28E 2RHYA 1FMVA 3M0RA 5IXBA 5IHNA 1KQSS 3V7SA 3CC4T 1H3ZA 1NJIU 3CEYA 2ZGWA 3VUBA 3SEMA 1WFWA 3I55A 4LDVA 2RMOA 1SRMA 2C0IA 2DL8A 1Q7YU 1U8RA 1ZBXA 4BI4A 5A0LA 3HP9A 4M7AE 1QKWA 2E1HA 4M77B 5GAN4 1TG0A 4JZ4A 4ZTFA 1VQ7A 3C4SA 1X6BA 3CC7A 2RB6A 4N0AC 1WHHA 2VV5A 4C5HA 1VQ9A 4TVRA 4IUPA 1KG1A 2DYIA 2KQWA 1KQSA 2DBKA 3CCVT 4V2SA 4M7DE 4M77E 4EDUA 2J7IA 3P8BB 3PVQA 1JQQA 4RTUA 4Y92A 2O4XB 1E6GA 4M4ZA 2D6FA 4CC4B 2O01E 4PJJA 4D8KA 1I07A 1WGSA 3MO8A 4M7AG 2Y4YA 3EFRA 1KSWA 1WIEA 2LJ0A 1BCMA 1M1KC 4OGCA 4AMCA 2EW3A 4RTVA 2ED1A 3WXMB 2LX9A 1W6XA 2DZ9A 4XTVA 1YHQA 3OS2A 4PJOE 5GJVB 1N9RA 3ZL7C 1KQSP 1UUEA 2V26A 4C8QB 2COZA 4C5GA 1OOTA 2KXCA 2MF2A 4EMHA 4E47A 2VXEA 1X2QA 1YJWT 5IXFA 1PC0A 3RR6A 4C8QF 2HQEA 1WYXA 2LJ1A 1IGQA 2HAXA 1ZSZB 3A8GB 2K3YA 3OB9A 1LPLA 2DEUA 3CCSA 1MV0B 1VQNQ 2RK2A 3S6WA 1TUGB 2GF7A 3CMAQ 4EMGA 1Q82U 1NBEB 4M78E 1S72A 2KGTA 3M4YA 3NHNA 2L2PA 1B34A 2EVRA 2DVEA 2XG8D 2CZ7B 1KHIA 2JOYA 1M30A 2OX7A 4AFSC 1VQLQ 2CP3A 4C92C 3UF4A 1OULA 2QI2A 2QGFB 2RHIA 3SD4A 1QKXA 2K3BA 3MPUB 4PK4A 5GAMf 2FRYA 4HCCA 1R8OB 4OMPA 1YWOA 1M5Q1 3CCRT 2M0YA 4IUTA 3QJ6A 1X6OA 3VRZA 4QQDA 2DE0X 2O31A 1RACB 2O2OA 1OI1A 2EQKA 2WSCE 3MEVA 1N5ZA 2RI5A 5FW9A 3TEEA 1QVFP 4M7AC 2L5QA 5J3BA 2CP0A 4M7AA 2E4HA 1H641 3SWNA 3CCEA 2QA4T 4VUBA 4PJOG 5FU7B 1M1KU 1ZX6A 3JB9F 1QCNA 2K9GA 4F7UG 3L42A 2K4YA 3NMZC 4JLGA 1BI1A 4R0KA 2LNVA 1CKBA 4LDUA 4O5VA 2CT3A 3RKYA 3RKXA 1RAHB 5GAMh 3JRZA 1Q81C 2JTMA 4J6YA 4FYYB 4C5IA 2QTXA 2LX7A 4J6XA 4BI3A 2KI7A 3CC2A 3E2UA 2CT4A 1GFDA 2GGRA 4Z88A 3OYEA 1V1CA 1P92A 1N9SA 2DFUA 4LUEA 1YIJT 2DJZA 1WX6A 2G6FX 1W2BS 2FVUA 3HL8A 2K5LA 2B8AA 2HBPA 5ECAA 3M0PA 3M55A 1KJWA 1JRIA 5GMKj 1SF9A 4HCKA 2RHZA 5KYWA 2ZZDA 3CCEQ 4E7LA 2EWNA 2JJ9A 2COYA 2PU9B 4IUUA 1WHJA 1KD1U 3BFMA 1AD5A 3MHXA 2HCKA 1RAIB 2F1LA 2DKGA 1UEBA 4RCCA 4L59A 1G2BA 2ENMA 2CH4A 3R6OA 1Q86R 3OW2P 2QQ9A 3S3NA 2RK1A 2XDPA 1U1TA 2DYBA 4M7DF 2VVKA 4PLIA 2CKKA 3AT1B 2CSQA 5LJ3d 1VQKT 2ZPBB 4M7DD 3EFSA 1SHFA 1YN8A 3EG1A 2R5MA 1QLYA 4ELYC 3ASKA 2YRVA 2DXTA 2CREA 1YCYA 2EKHA 3I5SA 1QVGA 1VQLA 1OU8A 2FYKA 1M90C 4CRIA 2FEIA 2DBMA 4WCIA 1WXTA 2B86A 5HK3A 4M75C 2QYZA 4ATOA 2LP5A 2FB7A 2JVVA 1JJ2S 1S72Q 4HCZA 3N5BB 4IUQA 1Y7XA 1PKSA 4XTZA 2EJGA 3CCSQ 2ZPGB 3SDZA 3OYBA 4XTUA 5KYNA 2RQUA 2KK4A 3FB9A 5DLOA 1M2OA 2BE7D 4LN2A 1XTDA 3EG9A 3WVDB 2KSSA 3RESA 2ROTA 1PSFA 2L3SA 4OB0B 1M3CA 1YI2A 2ZPHB 4C92G 2JXBA 2W0ZA 3C95A 5A0GA 1T3SA 3X26B 4CC3A 5GMKi 2OTLQ 2BZXA 1YP5A 2EAYA 4PJNA 3ZEHA 1XNIA 2MAMA 4J9CA 1K9MR 1D0XA 3OYJA 2R5AA 3OYNA 4O6JA 1KQ2A 5HK0A 3M58A 3M0QA 2KRNA 3CCMT 3HPWA 4QKUA 3VUZA 2K2MA 4Z89A 2PVDB 3QO3A 3NGPA 2CZ0B 2PNIA 4BE2A 3NTHA 2EYQA 1VQ9Q 4HVUA 1Y96B 1ABQA 3CC7Q 4F7UA 4ELZC 2WSFE 4BB7A 4P5NA 2O9SA 4KT0E 1VYTA 3SB2A 1MGQA 2OTJQ 2QQRA 3CPFA 3VS7A 1WLPB 1VQMT 3RBBB 1SSFA 1KC8C 1N6AA 2A36A 2IVWA 1YJ9A 1ZA2B 3I55Q 4QQ6A 5IHKA 2LQWA 4J83A 5GJWB 1HYOA 4EMKA 2P0PA 1RAFB 1VIEA 2E5QA 4JDSA 3L2ZA 4M78A 4A53A 1YJ9Q 4MZTA 2HMAA 1KIKA 1QW1A 5LJ5d 1RAEB 5J39A 3EGDB 1UG1A 4JRQA 3S3OA 1BYMA 2CUBA 2OTJA 2X3WD 4AFQC 1Q81U 1KC8U 2ROLA 4F17A 3UPUA 3X24B 1KD1R 4HXJA 2JS0A 3HRSA 3I9QA 3JCMc 1OPLA 2RH2A 5DLQE 2X9HA 1RUWA 2XU8A 1U1SA 2DVJA 2VUBA 2E70A 3QYGB 2A28A 4FSXA 1OV3A 2RQRA 1UGVA 5GAN6 3X28B 2RHUA 1D3BA 1VQ8T 3PGGA 2LCLA 1ZLMA 2AKKA 3GNFB 2J05A 4K11A 4C8QE 1QMCA 3RMQA 1RABB 1WDXA 3G6ET 1PRMC 2K6DA 4N4IA 2OTLA 4J9GA 2EBPA 4XU0A 5LJ3h 1O75A 2RHXA 1JXOA 2HEQA 1YI2Q 1OQKA 4JJDA 4FW2A 2HQXA 3CQTA 4BDYA 2K7AA 4CC2A 1NLOC 4LD6A 4EMKC 1LNXA 2RF0A 4MZMA 1K73C 2EJFA 2CUDA 2HL5C 4AG2C 5GANh 2E41A 1WI7A 2MWOA 5GAN8 1K9MU 2QEXQ 2XIDA 3G4SA 2EJ9A 3SFMA 2YUPA 4OMFB 4FYXB 1WHGA 3JCMP 4DA4A 3UA6A 4AFUC 3JAME 5FU7C 1UE9A 2ZPEB 3VV0A 2NUZA 5DY9A 4WF2A 1FXXA 1MNEA 1X2KA 4HT9A 4J7FA 2KRSA 1TH7A 2K79A 4ZGJB 2YUQA 3S3MA 4J9FA 1VQ5T 2L8DA 1AWWA 2YHTA 3OYHA 1QCFA 2DNUA 1M8MA 3IQLA 4FT4A 1QP3A 4LUDA 1YJNT 4DBQA 2OAUA 3MP8A 4JJBA 2VB6A 1YITT 1OX9A 2RJEA 4E7JA 4E7IA 3QHSA 5LJ5h 2DM1A 2R58A 1PHTA 1VIFA 2ATCB 2RO0A 1VQ6T 3I56A 2DD5A 3VS1A 2GTOA 4DQ2A 4N4HA 1GCQA 1WXBA 2FHDA 1UFFA 1VQNT 2ED0A 5GAMg 2M1HA 3CMAT 5C6SA 3CMEA 3MCAB 1GCQC 2JTFA 1BK2A 1GRIA 1YBYA 4C0DC 2SEMA 1W2BP 2MOXA 1OZ2A 1UGSB 4JJCA 3G71T 3OYMA 5EG2A 1MMNA 2HQHA 4OVAA 2LNHB 3CCLT 1K1ZA 4M78D 3RKWA 2EQMA 2DL7A
chains in the Genus database with same CATH topology
1OX8A 2QASA 1OX9A 1ZSZB 2NYSA 1OULA 1ZSZC 2QAZA 1TWBA 1YFNA 1OU9A 1ZSZA 1OU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX8 A;  2QAS A;  1OX9 A;  1ZSZ B;  2NYS A;  1OUL A;  1ZSZ C;  2QAZ A;  1TWB A;  1YFN A;  1OU9 A;  1ZSZ A;  1OU8 A; 
#chains in the Genus database with same CATH topology
 4PFO A;  2NUT B;  3TSW A;  3TSZ A;  1LVK A;  3CD6 Q;  4F04 B;  3CC2 Q;  4HCB A;  4R55 A;  4IUR A;  5D6Y A;  1PD0 A;  2R57 A;  3PIO A;  3QUI A;  5D6X A;  2RJC A;  5KYU B;  2EQI A;  1K0X A;  3FEO A;  3HRU A;  4OF1 A;  1T0H A;  3CBP A;  1CSK A;  3QYH B;  6AT1 B;  1IXD A;  2DXC A;  3MP6 A;  2V8K A;  1VQP A;  4KGX B;  2L3P A;  2L3Q A;  2LDM A;  4PJO B;  1QVF A;  3H8Z A;  3T9N A;  2C0T A;  2KYB A;  2KR3 A;  1UJ0 A;  3EFO B;  1KFZ A;  4KGV B;  1ARK A;  2NUP A;  1GBR A;  3PE0 A;  2PVG B;  4RTW A;  2VGN A;  3I35 A;  3OS5 A;  4QVZ A;  4J6W A;  2IIM A;  4XU2 A;  2HKQ B;  2J6F A;  3I5R A;  1JJ2 P;  4OB1 B;  2AZV A;  1BIA A;  1IRE B;  4JRI A;  1R0C B;  2DIL A;  1ZSZ A;  2AK5 A;  2QK0 A;  4FU6 A;  5LJ3 e;  3CCJ T;  8AT1 B;  3M56 A;  4RTT A;  4KUD K;  1N8R R;  4BY6 B;  1Y96 A;  3QJY A;  2D0Q B;  1BIB A;  2QAZ A;  1TXQ A;  3CXC A;  5GAN 5;  1MMA A;  4RUG A;  4LDX A;  2A37 A;  4KRT A;  2V1R A;  2YLB A;  4C0Z A;  1K0S A;  2DIG A;  1RLP C;  4KUI A;  5A2Q E;  1WPY A;  2LT4 A;  1RI0 A;  2RN8 A;  4FCY A;  2JUF A;  1VA7 A;  2DET A;  2DRM A;  2X4X A;  1XQH A;  2Y4X A;  2OAW A;  2GFA A;  3JB9 J;  3CMA A;  5IAY A;  1HXD A;  2X35 A;  3DB4 A;  1AWX A;  1Z9Q A;  4OMQ A;  1VQN A;  4M7D G;  3CCU T;  2DZC A;  5GAN f;  1FMK A;  5FU6 B;  3I56 T;  3CXC S;  4XU3 A;  3E19 A;  1F1B B;  2ZAE A;  1EFN A;  4GY5 A;  2CDT A;  4M7D A;  1GXI E;  2DTI A;  2DER A;  1YIT A;  3RUX A;  3V7C A;  2JNG A;  5FRO A;  1ZSG A;  3AHU A;  1G5V A;  1JEG A;  1YHQ Q;  1YJN A;  3VRY A;  2EIF A;  3M57 A;  3CPW S;  2NLU A;  2VXF A;  1TTH B;  1D0Z A;  1IO6 A;  1KC8 R;  4C92 B;  2CYZ B;  1JU5 C;  2JZ2 A;  1I4K 1;  1IRX A;  5CKB A;  3X25 B;  3JCM d;  1K9A A;  2CZ6 B;  1PNJ A;  3QWY A;  2FPD A;  4PFZ A;  2ZCF B;  2RA2 A;  1OU9 A;  2YSQ A;  4J8O A;  2CP7 A;  1I5O B;  3EG0 A;  5KYX A;  3OS0 A;  5GAN 2;  3OSV A;  1VQ7 Q;  5IHI A;  4BI8 B;  4F16 A;  4ZGE B;  4OGE A;  2DAQ A;  4J9E A;  5C0M A;  5HY6 A;  4ZTJ A;  2J6K A;  4JLI A;  3JCM V;  5GAN g;  1E6H A;  3REB B;  3EH1 A;  1TWB A;  2F69 A;  3QII A;  3H0I A;  3SWN B;  2D0N A;  1Q7Y C;  2KBT A;  2OTL T;  2A08 A;  2DTO A;  2QA4 Q;  2YRD A;  3L1A A;  1JXM A;  4RKU E;  1R0B G;  1M90 R;  4M75 A;  3L2R A;  4RCB A;  1M1G A;  2CSI A;  2RJF A;  1SG5 A;  4NL2 A;  2FZC B;  5CKF A;  1AHJ B;  2V1Q A;  4II1 A;  4PJM A;  3H41 A;  2RI3 A;  1GL5 A;  1LCK A;  4M75 F;  1VQ4 Q;  1V76 A;  3OBY A;  3LWI A;  3EGU A;  1X75 C;  4JRP A;  4BE1 A;  3OYI A;  2AT1 B;  3MJX A;  3EGX B;  3JCM Q;  4KH0 B;  3OYC A;  4M7A D;  4FL6 A;  1WXU A;  4OML A;  4BUG A;  5FLX E;  3OW2 S;  2OTJ T;  2QQB A;  1TOV A;  3JSC A;  2NWM A;  3FRN A;  2OI3 A;  2LJ3 A;  2LVM A;  4N0A A;  1UDL A;  3BW1 A;  1N8R C;  5I2S A;  3PNW C;  1GBQ A;  3GBQ A;  3JCM b;  2PTK A;  3V8K A;  1B7T A;  4LDY A;  3OYA A;  4Z02 A;  2WAC A;  1I8F A;  4YTL A;  2XD0 A;  3G7Z A;  5GMK h;  4M77 D;  4OMO A;  3OS1 A;  3CCR Q;  5FU6 C;  5GMK l;  2BE9 B;  1TUD A;  5HKC A;  4KGZ B;  2KT8 A;  2V8I A;  2C06 A;  8ATC B;  2DXU A;  2EGE A;  1M27 C;  1Y57 A;  2DL5 A;  2IG0 A;  3LH0 A;  2ZPI B;  3QSU A;  2XHC A;  5CKH A;  2JW4 A;  4PJL A;  3L2Q A;  5D7U A;  4WTO B;  7AT1 B;  4C92 E;  4RTX A;  3D7S B;  4E7Z A;  1VQ5 A;  3HSB A;  3CCQ Q;  2KYM A;  1N27 A;  3PFS A;  1JBM A;  1NLP C;  3A8L B;  1Y0M A;  1VQO Q;  1VQP T;  5CKE A;  1IGU A;  5FRM A;  2P4T A;  1W2B A;  4IIM A;  4UC4 A;  2LCC A;  4M78 C;  3BDL A;  4QW2 A;  5LJ5 g;  2JN0 A;  1NYG A;  5DM7 R;  1LOJ A;  2CP5 A;  2CZ1 B;  2DK3 A;  1AEY A;  1WZO A;  2ECZ A;  5CQY A;  2J06 A;  5A0D A;  3EFO A;  1J3T A;  1PM3 A;  3INZ A;  2DRK A;  2RPN A;  4GLK A;  2QQA A;  3CCV Q;  1ZSZ C;  3A8H B;  1X01 A;  1YI2 T;  4LXC A;  5AYF A;  2VC8 A;  2BZY A;  3FJ5 A;  4F7U B;  2W10 A;  1IHV A;  3JCM J;  3CCL A;  3PTA A;  2KAF A;  3PMI A;  4ESR A;  2O4X A;  3QDF A;  3PT9 A;  3G71 A;  4JRK A;  1KD1 C;  5M9O A;  3J80 E;  1HK9 A;  2AIR B;  5KCH A;  4OMM A;  4L5G A;  5L23 A;  1MV3 A;  4Z8A A;  5I2M A;  5I11 A;  3M5A A;  3SWN C;  1X69 A;  3UDC A;  4D8D A;  3LW5 E;  1W1F A;  3G6E A;  1IZ6 A;  1R77 A;  4OB3 B;  2M51 A;  2E3H A;  2YDL A;  2QGG A;  1I1J A;  4DEX A;  2D1X A;  4R56 A;  3RNJ A;  1QWF A;  5EC7 A;  1G3W A;  1VQ8 A;  1YJW Q;  1VQL T;  4FYV B;  5IT9 E;  1VQ6 A;  1X43 A;  3EGD A;  1BB9 A;  2M0O A;  4J9D A;  5CCA A;  1QVG S;  2X4W A;  2YWW A;  1N8R U;  5GAM d;  4FM4 B;  3CCU A;  1Q82 C;  3JCM X;  2AZS A;  3LX7 A;  1JJ2 A;  3SHW A;  3JCM W;  2F5T X;  1NYF A;  2HDA A;  2LMJ A;  2VWF A;  3RER A;  1T0J A;  3JCM g;  4ANJ A;  4QQG A;  3E9F A;  5HCK A;  2M16 A;  1EX4 A;  1RAG B;  2E5K A;  2WSE E;  2JM9 A;  3JB9 G;  3EG2 A;  1H8K A;  2MYS A;  4A4H A;  3URG A;  2SRC A;  1BCO A;  3OYK A;  4JJN K;  2H3J A;  2A3L A;  1NPP A;  3CPW P;  3CCJ A;  1PCX A;  3G4S T;  1RLQ C;  3LH5 A;  3QPH A;  4C8Q G;  1YJ9 T;  2KRO A;  3VYG A;  5KYY A;  3OYL A;  1Y07 A;  1VQM A;  4ZNX A;  4B9W A;  1A0N B;  3WVE B;  3DLM A;  5AT1 B;  3FC3 A;  3OYD A;  3CBM A;  4JUV A;  5I22 A;  2GQV A;  1G8X A;  1XOV A;  1PG5 B;  2VKN A;  4B6M A;  1LJO A;  4QVC A;  5IH2 A;  2XMF A;  3CC2 T;  1PKT A;  1RAA B;  1YCS B;  2Z0W A;  2BTT A;  1OZ3 A;  3TRE A;  2FG0 A;  1D09 B;  3CCM A;  2BKD N;  2E3I A;  3FJP A;  5KH6 A;  1YFN A;  4XU1 A;  2EPD A;  2L3R A;  2RJD A;  3JCM f;  4BDZ A;  4E6R A;  1UHF A;  1K8A C;  3MEA A;  1PWT A;  4IIO A;  3OYY A;  4C0F A;  1KQ1 A;  5KYW B;  2QAS A;  4PJO D;  4RG2 A;  3KUF A;  1V29 B;  3GPL A;  3P8H A;  2NUP B;  2DL3 A;  2EGC A;  5GAO l;  5KCO A;  1K76 A;  2EYX A;  2RNA A;  1M2V B;  3OA6 A;  2KEA A;  3EG9 B;  5LJ3 j;  2DL4 A;  3EG3 A;  2A7Y A;  1VQM Q;  1D1C A;  2RQV A;  3PVL A;  4PJO C;  5CVI A;  3FDR A;  2LRQ A;  2RQT A;  2YRC A;  1K8A U;  2E65 A;  3GIB A;  3CCJ Q;  3A8O B;  1FX7 A;  3CC4 Q;  1VQK Q;  2EQJ A;  4ME7 A;  1UGQ B;  3CME T;  1QP2 A;  1M1K R;  2YUO A;  4NOY A;  2L89 A;  4Y91 A;  3VS6 A;  5FRN A;  4A4K A;  2CGH A;  2ABL A;  2AHJ B;  1FWZ A;  4JPB W;  3V8L A;  1OYX A;  2XI9 A;  4M7D C;  2P0Q A;  2MIO A;  4C92 D;  1H92 A;  2QDL A;  4M77 A;  4MML A;  4LNP A;  5CO7 A;  1S72 T;  2DX1 A;  4HKE A;  4E2F B;  4C8Q D;  2H8H A;  2HSE B;  3C12 A;  3DLL A;  3X20 B;  3OYG A;  3CCU Q;  5CQX A;  3KFV A;  1VOM A;  1VQ6 Q;  1ZA1 B;  1YJW A;  2F2W A;  1TSF A;  3TU4 K;  4A54 A;  1GFC A;  2JMA A;  1UHC A;  4ZN3 A;  1AVZ C;  1MHN A;  2JS2 A;  3NFC A;  4EIK A;  1Y71 A;  5LJ5 j;  4RMO A;  1BU1 A;  1ACM B;  3G6E Q;  1YHQ T;  1BI3 A;  2JM8 A;  4EMK B;  3M54 A;  4C0D B;  2HBW A;  1B3Q A;  4E7S A;  3QDR B;  3V8J A;  2QDY B;  1ZUY A;  1D1B A;  4C92 A;  3LGF A;  4KBM B;  3G71 Q;  9ATC B;  3HKS A;  2A0F B;  3H0H A;  2JMC A;  2KT1 A;  3L2U A;  2DEQ A;  1KHC A;  4M7A B;  1RI9 A;  1AZG B;  3CCV A;  1X27 A;  4QVD A;  2X4Y A;  3KXT A;  3BY7 A;  1M90 U;  2FPE A;  2DA9 A;  4PKC C;  4J5Y A;  3Q1J A;  2HL3 A;  1YIJ Q;  3DB3 A;  4X9D A;  5CAI A;  4XK8 E;  4NL3 A;  2F2X A;  2LTO A;  4BY6 C;  1NJI C;  2QG9 B;  2G3R A;  4OB2 B;  1PSE A;  2IPO B;  1C1A A;  3M9Q A;  1M8V A;  4PJO A;  4J9B A;  1T3L A;  2EYZ A;  4N4G A;  1UB4 A;  3QXE B;  1ZQ1 A;  1G83 A;  3UWN A;  2BZ8 A;  1HJD A;  4QT7 A;  4FSS A;  1SPK A;  5GAN 3;  4C8Q A;  2EFI A;  5GAM j;  3UA7 A;  3HFN A;  2KE9 A;  2DF6 A;  3V7R A;  4GBQ A;  2LT1 A;  4JS5 A;  1TS9 A;  3GLX A;  3JB9 H;  3ZBD A;  3PIP A;  3CCR A;  1NZ9 A;  2VGM A;  4F7U E;  4HT8 A;  2K3X A;  4J9I A;  1GCP A;  1SHG A;  5GAO p;  2DMO A;  3UAT A;  5GAN d;  2GTJ A;  1QCO A;  3RDV A;  1S1N A;  4AFZ C;  3OMG A;  1WNL A;  1YWP A;  4M78 B;  3VJP A;  1SSH A;  1WHL A;  1MMG A;  2CH4 W;  1WJQ A;  3LGL A;  1UGP B;  2XIC A;  4C8Q C;  1WQ7 A;  1G3Y A;  2RM4 A;  1Q7Y R;  3LYI A;  1YIJ A;  1IHW A;  2NYS A;  4DBR A;  2YLC A;  2FZG B;  1QVF S;  3CCS T;  1MUZ A;  2CP6 A;  5KYX B;  3QWX X;  3H0F A;  2RI2 A;  2LQK A;  1M3A A;  2AKL A;  5KYY B;  3H9N A;  3MKD A;  4EPC A;  5GAM e;  1M9S A;  2FL7 A;  4A4E A;  4NS5 A;  2DIQ A;  2F2V A;  2C0O A;  2JT4 A;  2DPP B;  3REA B;  1QVP A;  3OY9 A;  4ZN1 A;  1NEG A;  1K4U S;  4MZP A;  1JB0 E;  4A4G A;  2QEX T;  1QWE A;  4M77 F;  1RAD B;  4RTY A;  2QA4 A;  1U5S A;  3CCE T;  4RG8 A;  2E6N A;  1C0M A;  3G1J A;  2I2L A;  1ZBJ A;  3QG1 A;  4PL6 A;  2HNI A;  2DJQ A;  1UEC A;  1PRL C;  4BAC A;  1WQW A;  3HHT B;  2KVQ G;  4DOW A;  4M7A F;  4D6W A;  1Q95 G;  4E7K A;  2L0A A;  1RL2 A;  2GFU A;  2P84 A;  1FYN A;  3LLR A;  4ORZ A;  3L2V A;  4BE0 A;  5FWB A;  2OJ2 A;  1WJS A;  1W4S A;  1VQ9 T;  1BI2 A;  2MCN A;  4XAX B;  3CC7 T;  4HVW A;  3J7A F;  2HD0 A;  2VAS A;  1OX8 A;  3EGX A;  2LC4 A;  5LJ3 g;  2J6O A;  4A63 B;  3UT1 A;  3ULR B;  1K9M C;  3VS3 A;  1DJ7 B;  3OMC A;  2MK5 A;  3QBY A;  2EYY A;  3QZ9 B;  3A8M B;  2D9T A;  3ZFJ A;  5LJ5 f;  2D8H A;  1YJN Q;  3ME9 A;  2M9U A;  3MP1 A;  1VQK A;  3CC4 A;  3CBO A;  1NG2 A;  2LQN A;  1NM7 A;  3C0C A;  1YIT Q;  1KK7 A;  5GAN 7;  2GQI A;  1VYV A;  4HVV A;  2JTE A;  2GCX A;  3CPW A;  3U23 A;  1XJW B;  2FRW A;  4MDW A;  2DD4 A;  1CKA A;  1K8A R;  1W70 A;  4E7H A;  2HSP A;  2QXF A;  4B9X A;  3KBG A;  3O5Z A;  1NPR A;  4M7D B;  5CK9 A;  4J7I A;  2XK0 A;  3L2W A;  2X4J A;  1Z9Z A;  4F7U F;  3CD6 T;  4HA8 A;  4LD9 K;  3OSS C;  2PQW A;  3PMT A;  4FYW B;  3A1P A;  4ZGD B;  1VYU A;  1G3S A;  3GF5 A;  2K2V A;  5GMK e;  1TU0 B;  3JCM e;  4JS4 A;  3VS2 A;  4M75 E;  2XKO C;  5KE2 A;  1YNZ A;  3CCM Q;  2CP2 A;  2QTV A;  2COW A;  4PJO F;  3P8D A;  2CS7 A;  2I0N A;  1BBZ A;  4M75 D;  3VU3 C;  3H6Z A;  4IKF A;  4PFP A;  4M75 G;  4M75 B;  4JZ3 A;  3VYH B;  3NPF A;  1K73 U;  1D0Y A;  1ABO A;  1MMD A;  1D3B B;  4C92 F;  2GBQ A;  5GAO m;  3FIF A;  3CXC P;  1D1A A;  2F5K A;  3I55 T;  1EIF A;  3GNG A;  5D6W A;  2EKO A;  1VUB A;  5GAN e;  1AT1 B;  4C0G A;  2PUK B;  2HKN A;  2DLP A;  5LJ5 e;  4AG1 C;  4PNO A;  2FPF A;  2M02 A;  4DOV A;  3JB9 I;  2H3E B;  1VQO T;  1VQP Q;  1U06 A;  2XDD A;  1NE8 A;  3MEW A;  3OW2 A;  5CKD A;  2LZ6 B;  2FZK B;  4FIB A;  3RIR A;  5LL6 S;  2BUD A;  2GNC A;  3EH2 A;  3JCM h;  1AOJ A;  4DBH A;  4RTZ A;  2DXB A;  4FT2 A;  3OYF A;  1X6G A;  3CD6 A;  5GAO q;  4XQ3 A;  2PVO B;  3EHQ A;  4M78 G;  1QVG P;  4MDX A;  5LJ3 f;  1B34 B;  5KE3 A;  1I5L A;  1SEM A;  1UGR B;  3GP8 A;  5KYU A;  1VQ8 Q;  4IUV A;  4X34 A;  3RMS A;  3EAE A;  3C94 A;  2X51 A;  3QKJ A;  3M59 A;  2EYW A;  2YT6 A;  4OP0 A;  4PLL A;  3ER0 A;  2KRM A;  2PZ1 A;  1UTI A;  1Q81 R;  3A98 A;  3VS5 A;  3GOX A;  3CME Q;  1IB8 A;  4MMK A;  2KDS A;  1FMW A;  2FO0 A;  2KY9 A;  1HSQ A;  1I81 A;  1NJI R;  5GAN j;  3I56 Q;  2E10 A;  1WHM A;  3BDU A;  1UJY A;  3CCL Q;  1SRL A;  4X9C A;  2EQU A;  2X3X D;  3O8V A;  1C6V X;  3TQ7 P;  5CIU A;  4J9H A;  1NEB A;  1O9S A;  1TUC A;  1BKB A;  5IN1 A;  2MI6 A;  2ESW A;  2D8J A;  4KUL A;  4M78 F;  2YXY A;  4LE9 A;  4XTW A;  4F14 A;  5FWC A;  4DBF A;  3EHR A;  1M3B A;  2MWP A;  5GAO n;  3VS0 A;  2E64 A;  3BE3 A;  1ZUU A;  4FW1 A;  3VS4 A;  3CCQ T;  5L8R E;  1EZZ B;  4XTX A;  1VQO A;  3OBW A;  4KH1 B;  2EGA A;  3E9G A;  3CCQ A;  1BI0 A;  1G3T A;  3VKI A;  3F70 A;  2PUO B;  1VQ5 Q;  3HRT A;  4Q5W A;  1WJR A;  1Q86 C;  4XTY A;  1I0C A;  2DO3 A;  3JV3 A;  3G4S Q;  2QEX A;  3QZ5 B;  4DEY A;  1E7O A;  2O88 A;  1ZUK A;  1AWJ A;  3TVT A;  2MPX C;  1VQ7 T;  1WA7 A;  1HD3 A;  1H3H A;  2LQ8 A;  3DKM A;  1Q82 R;  2E6Z A;  2V8J A;  2MMP A;  3HFO A;  3MET A;  5I21 A;  3M0S A;  4OMN A;  3M4G A;  5CR2 A;  4C5E A;  2O9V A;  3HTR A;  2P0K A;  1B07 A;  1JO8 A;  3FLG A;  2E12 A;  2P4R A;  1PD1 A;  3NTK A;  2K5F A;  4X1V A;  4L6V 5;  2XDB A;  1SKU B;  4A4F A;  3THK A;  2YUN A;  4CC7 A;  3TCJ A;  4M77 G;  3M53 A;  3R6N A;  4BD3 A;  1M1F A;  1ZHI A;  4AT1 B;  2Y90 A;  4GLM A;  2BIV A;  1OPK A;  1QQJ A;  1VQ4 T;  2KMT A;  3MEU A;  2KNB B;  2DTH A;  1MND A;  4LDW A;  2KXD A;  2K57 A;  3A5Z B;  2RD1 A;  1K73 R;  3E1S A;  3JB9 D;  2NUT A;  3M0U A;  1Q86 U;  2QQS A;  4M77 C;  2ZPF B;  1M4Z A;  2K5I A;  3LWH A;  5J26 A;  3M0T A;  3OQ5 A;  1OEB A;  2RQW A;  1VQ4 A;  2LCS A;  3J81 E;  3NTI A;  5GAO r;  2VYT A;  1M2V A;  5GMK m;  4CI0 C;  1U3O A;  1AWO A;  2HZY A;  1AZE A;  1WHK A;  4Y28 E;  2RHY A;  1FMV A;  3M0R A;  5IXB A;  5IHN A;  1KQS S;  3V7S A;  3CC4 T;  1H3Z A;  1NJI U;  3CEY A;  2ZGW A;  3VUB A;  3SEM A;  1WFW A;  3I55 A;  4LDV A;  2RMO A;  1SRM A;  2C0I A;  2DL8 A;  1Q7Y U;  1U8R A;  1ZBX A;  4BI4 A;  5A0L A;  3HP9 A;  4M7A E;  1QKW A;  2E1H A;  4M77 B;  5GAN 4;  1TG0 A;  4JZ4 A;  4ZTF A;  1VQ7 A;  3C4S A;  1X6B A;  3CC7 A;  2RB6 A;  4N0A C;  1WHH A;  2VV5 A;  4C5H A;  1VQ9 A;  4TVR A;  4IUP A;  1KG1 A;  2DYI A;  2KQW A;  1KQS A;  2DBK A;  3CCV T;  4V2S A;  4M7D E;  4M77 E;  4EDU A;  2J7I A;  3P8B B;  3PVQ A;  1JQQ A;  4RTU A;  4Y92 A;  2O4X B;  1E6G A;  4M4Z A;  2D6F A;  4CC4 B;  2O01 E;  4PJJ A;  4D8K A;  1I07 A;  1WGS A;  3MO8 A;  4M7A G;  2Y4Y A;  3EFR A;  1KSW A;  1WIE A;  2LJ0 A;  1BCM A;  1M1K C;  4OGC A;  4AMC A;  2EW3 A;  4RTV A;  2ED1 A;  3WXM B;  2LX9 A;  1W6X A;  2DZ9 A;  4XTV A;  1YHQ A;  3OS2 A;  4PJO E;  5GJV B;  1N9R A;  3ZL7 C;  1KQS P;  1UUE A;  2V26 A;  4C8Q B;  2COZ A;  4C5G A;  1OOT A;  2KXC A;  2MF2 A;  4EMH A;  4E47 A;  2VXE A;  1X2Q A;  1YJW T;  5IXF A;  1PC0 A;  3RR6 A;  4C8Q F;  2HQE A;  1WYX A;  2LJ1 A;  1IGQ A;  2HAX A;  1ZSZ B;  3A8G B;  2K3Y A;  3OB9 A;  1LPL A;  2DEU A;  3CCS A;  1MV0 B;  1VQN Q;  2RK2 A;  3S6W A;  1TUG B;  2GF7 A;  3CMA Q;  4EMG A;  1Q82 U;  1NBE B;  4M78 E;  1S72 A;  2KGT A;  3M4Y A;  3NHN A;  2L2P A;  1B34 A;  2EVR A;  2DVE A;  2XG8 D;  2CZ7 B;  1KHI A;  2JOY A;  1M30 A;  2OX7 A;  4AFS C;  1VQL Q;  2CP3 A;  4C92 C;  3UF4 A;  1OUL A;  2QI2 A;  2QGF B;  2RHI A;  3SD4 A;  1QKX A;  2K3B A;  3MPU B;  4PK4 A;  5GAM f;  2FRY A;  4HCC A;  1R8O B;  4OMP A;  1YWO A;  1M5Q 1;  3CCR T;  2M0Y A;  4IUT A;  3QJ6 A;  1X6O A;  3VRZ A;  4QQD A;  2DE0 X;  2O31 A;  1RAC B;  2O2O A;  1OI1 A;  2EQK A;  2WSC E;  3MEV A;  1N5Z A;  2RI5 A;  5FW9 A;  3TEE A;  1QVF P;  4M7A C;  2L5Q A;  5J3B A;  2CP0 A;  4M7A A;  2E4H A;  1H64 1;  3SWN A;  3CCE A;  2QA4 T;  4VUB A;  4PJO G;  5FU7 B;  1M1K U;  1ZX6 A;  3JB9 F;  1QCN A;  2K9G A;  4F7U G;  3L42 A;  2K4Y A;  3NMZ C;  4JLG A;  1BI1 A;  4R0K A;  2LNV A;  1CKB A;  4LDU A;  4O5V A;  2CT3 A;  3RKY A;  3RKX A;  1RAH B;  5GAM h;  3JRZ A;  1Q81 C;  2JTM A;  4J6Y A;  4FYY B;  4C5I A;  2QTX A;  2LX7 A;  4J6X A;  4BI3 A;  2KI7 A;  3CC2 A;  3E2U A;  2CT4 A;  1GFD A;  2GGR A;  4Z88 A;  3OYE A;  1V1C A;  1P92 A;  1N9S A;  2DFU A;  4LUE A;  1YIJ T;  2DJZ A;  1WX6 A;  2G6F X;  1W2B S;  2FVU A;  3HL8 A;  2K5L A;  2B8A A;  2HBP A;  5ECA A;  3M0P A;  3M55 A;  1KJW A;  1JRI A;  5GMK j;  1SF9 A;  4HCK A;  2RHZ A;  5KYW A;  2ZZD A;  3CCE Q;  4E7L A;  2EWN A;  2JJ9 A;  2COY A;  2PU9 B;  4IUU A;  1WHJ A;  1KD1 U;  3BFM A;  1AD5 A;  3MHX A;  2HCK A;  1RAI B;  2F1L A;  2DKG A;  1UEB A;  4RCC A;  4L59 A;  1G2B A;  2ENM A;  2CH4 A;  3R6O A;  1Q86 R;  3OW2 P;  2QQ9 A;  3S3N A;  2RK1 A;  2XDP A;  1U1T A;  2DYB A;  4M7D F;  2VVK A;  4PLI A;  2CKK A;  3AT1 B;  2CSQ A;  5LJ3 d;  1VQK T;  2ZPB B;  4M7D D;  3EFS A;  1SHF A;  1YN8 A;  3EG1 A;  2R5M A;  1QLY A;  4ELY C;  3ASK A;  2YRV A;  2DXT A;  2CRE A;  1YCY A;  2EKH A;  3I5S A;  1QVG A;  1VQL A;  1OU8 A;  2FYK A;  1M90 C;  4CRI A;  2FEI A;  2DBM A;  4WCI A;  1WXT A;  2B86 A;  5HK3 A;  4M75 C;  2QYZ A;  4ATO A;  2LP5 A;  2FB7 A;  2JVV A;  1JJ2 S;  1S72 Q;  4HCZ A;  3N5B B;  4IUQ A;  1Y7X A;  1PKS A;  4XTZ A;  2EJG A;  3CCS Q;  2ZPG B;  3SDZ A;  3OYB A;  4XTU A;  5KYN A;  2RQU A;  2KK4 A;  3FB9 A;  5DLO A;  1M2O A;  2BE7 D;  4LN2 A;  1XTD A;  3EG9 A;  3WVD B;  2KSS A;  3RES A;  2ROT A;  1PSF A;  2L3S A;  4OB0 B;  1M3C A;  1YI2 A;  2ZPH B;  4C92 G;  2JXB A;  2W0Z A;  3C95 A;  5A0G A;  1T3S A;  3X26 B;  4CC3 A;  5GMK i;  2OTL Q;  2BZX A;  1YP5 A;  2EAY A;  4PJN A;  3ZEH A;  1XNI A;  2MAM A;  4J9C A;  1K9M R;  1D0X A;  3OYJ A;  2R5A A;  3OYN A;  4O6J A;  1KQ2 A;  5HK0 A;  3M58 A;  3M0Q A;  2KRN A;  3CCM T;  3HPW A;  4QKU A;  3VUZ A;  2K2M A;  4Z89 A;  2PVD B;  3QO3 A;  3NGP A;  2CZ0 B;  2PNI A;  4BE2 A;  3NTH A;  2EYQ A;  1VQ9 Q;  4HVU A;  1Y96 B;  1ABQ A;  3CC7 Q;  4F7U A;  4ELZ C;  2WSF E;  4BB7 A;  4P5N A;  2O9S A;  4KT0 E;  1VYT A;  3SB2 A;  1MGQ A;  2OTJ Q;  2QQR A;  3CPF A;  3VS7 A;  1WLP B;  1VQM T;  3RBB B;  1SSF A;  1KC8 C;  1N6A A;  2A36 A;  2IVW A;  1YJ9 A;  1ZA2 B;  3I55 Q;  4QQ6 A;  5IHK A;  2LQW A;  4J83 A;  5GJW B;  1HYO A;  4EMK A;  2P0P A;  1RAF B;  1VIE A;  2E5Q A;  4JDS A;  3L2Z A;  4M78 A;  4A53 A;  1YJ9 Q;  4MZT A;  2HMA A;  1KIK A;  1QW1 A;  5LJ5 d;  1RAE B;  5J39 A;  3EGD B;  1UG1 A;  4JRQ A;  3S3O A;  1BYM A;  2CUB A;  2OTJ A;  2X3W D;  4AFQ C;  1Q81 U;  1KC8 U;  2ROL A;  4F17 A;  3UPU A;  3X24 B;  1KD1 R;  4HXJ A;  2JS0 A;  3HRS A;  3I9Q A;  3JCM c;  1OPL A;  2RH2 A;  5DLQ E;  2X9H A;  1RUW A;  2XU8 A;  1U1S A;  2DVJ A;  2VUB A;  2E70 A;  3QYG B;  2A28 A;  4FSX A;  1OV3 A;  2RQR A;  1UGV A;  5GAN 6;  3X28 B;  2RHU A;  1D3B A;  1VQ8 T;  3PGG A;  2LCL A;  1ZLM A;  2AKK A;  3GNF B;  2J05 A;  4K11 A;  4C8Q E;  1QMC A;  3RMQ A;  1RAB B;  1WDX A;  3G6E T;  1PRM C;  2K6D A;  4N4I A;  2OTL A;  4J9G A;  2EBP A;  4XU0 A;  5LJ3 h;  1O75 A;  2RHX A;  1JXO A;  2HEQ A;  1YI2 Q;  1OQK A;  4JJD A;  4FW2 A;  2HQX A;  3CQT A;  4BDY A;  2K7A A;  4CC2 A;  1NLO C;  4LD6 A;  4EMK C;  1LNX A;  2RF0 A;  4MZM A;  1K73 C;  2EJF A;  2CUD A;  2HL5 C;  4AG2 C;  5GAN h;  2E41 A;  1WI7 A;  2MWO A;  5GAN 8;  1K9M U;  2QEX Q;  2XID A;  3G4S A;  2EJ9 A;  3SFM A;  2YUP A;  4OMF B;  4FYX B;  1WHG A;  3JCM P;  4DA4 A;  3UA6 A;  4AFU C;  3JAM E;  5FU7 C;  1UE9 A;  2ZPE B;  3VV0 A;  2NUZ A;  5DY9 A;  4WF2 A;  1FXX A;  1MNE A;  1X2K A;  4HT9 A;  4J7F A;  2KRS A;  1TH7 A;  2K79 A;  4ZGJ B;  2YUQ A;  3S3M A;  4J9F A;  1VQ5 T;  2L8D A;  1AWW A;  2YHT A;  3OYH A;  1QCF A;  2DNU A;  1M8M A;  3IQL A;  4FT4 A;  1QP3 A;  4LUD A;  1YJN T;  4DBQ A;  2OAU A;  3MP8 A;  4JJB A;  2VB6 A;  1YIT T;  1OX9 A;  2RJE A;  4E7J A;  4E7I A;  3QHS A;  5LJ5 h;  2DM1 A;  2R58 A;  1PHT A;  1VIF A;  2ATC B;  2RO0 A;  1VQ6 T;  3I56 A;  2DD5 A;  3VS1 A;  2GTO A;  4DQ2 A;  4N4H A;  1GCQ A;  1WXB A;  2FHD A;  1UFF A;  1VQN T;  2ED0 A;  5GAM g;  2M1H A;  3CMA T;  5C6S A;  3CME A;  3MCA B;  1GCQ C;  2JTF A;  1BK2 A;  1GRI A;  1YBY A;  4C0D C;  2SEM A;  1W2B P;  2MOX A;  1OZ2 A;  1UGS B;  4JJC A;  3G71 T;  3OYM A;  5EG2 A;  1MMN A;  2HQH A;  4OVA A;  2LNH B;  3CCL T;  1K1Z A;  4M78 D;  3RKW A;  2EQM A;  2DL7 A; 
#chains in the Genus database with same CATH homology
 1OX8 A;  2QAS A;  1OX9 A;  1ZSZ B;  2NYS A;  1OUL A;  1ZSZ C;  2QAZ A;  1TWB A;  1YFN A;  1OU9 A;  1ZSZ A;  1OU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...