1OX8A

Crystal structure of sspb
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of degradation signal recognition by SspB, a specificity-enhancing factor for the ClpXP proteolytic machine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase activator
molecule keywords Stringent starvation protein B
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ox8A00
2QASA 1ZSZC 1OX9A 2QAZA 1OULA 1TWBA 1OX8A 1YFNA 1OU8A 1ZSZB 1ZSZA 1OU9A 2NYSA
chains in the Genus database with same CATH superfamily
3G71Q 2VWFA 2FO0A 5A2QE 3OYCA 3CCEA 1Q81U 3KUFA 2MMPA 2MWOA 3M4GA 2VVKA 2LT4A 2X51A 3CPWP 1BIBA 4IIOA 4PJNA 3CD6Q 1BI1A 3L2UA 2ECZA 4D6WA 5GAN2 4LNPA 3M5AA 2LRQA 1M1GA 3M0QA 3JB9D 1BK2A 2JTEA 3JRZA 5IHKA 3RR6A 2CP0A 4Y92A 2COWA 1N9SA 2IVWA 4MDXA 1AWJA 2QAZA 1VQ9Q 1HJDA 2EGEA 3DB4A 3PE0A 4C0FA 4FIBA 4RTUA 4C8QF 5LJ5d 3RDVA 3NGPA 1RAHB 1TUGB 1ZQ1A 4ESRA 5A0GA 1ZUKA 5KYWB 3CCVT 1NEGA 4JZ3A 5FW9A 3G71A 2XMFA 1KG1A 1PG5B 1TG0A 3QKJA 3I9QA 4J6YA 3JCMJ 1JJ2S 3OYNA 3E2UA 1YIJQ 2EW3A 2EQIA 4E47A 2DK3A 5KCOA 3QWXX 2PQWA 1YWPA 4M7DF 4J5YA 3D7SB 5GAMf 1CSKA 2LCLA 3GLXA 1ZSZB 4XTWA 1R0BG 5CIUA 2JM8A 1PKSA 4C8QG 1D1BA 3QYGB 2DILA 1UJYA 2CT3A 3JB9G 4HVVA 2RQRA 4MMKA 3CC4Q 2LQWA 2XDDA 1WI7A 1V76A 2F2XA 2VYTA 4RG2A 2GF7A 2HD0A 1YHQA 3QUIA 3OS5A 4PFOA 1MUZA 2DLPA 5LJ3f 3EGXA 4L5GA 1F1BB 1WZOA 1VQ7Q 4PK4A 2XD0A 1UUEA 3JCMh 2DETA 1VQ8A 2DL5A 2K57A 1X2QA 1VQ4Q 2CZ6B 4HXJA 2KQWA 1KFZA 1QP3A 3PFSA 3EH2A 2V26A 4CC7A 1JO8A 3LLRA 2EJ9A 1B34B 4D8DA 1VQ6T 1Y71A 3EFRA 4OF1A 2X3XD 3CCJA 2KMTA 2OTJT 3BDLA 3QZ5B 3QJYA 5IT9E 2KEAA 3OA6A 2VXFA 5GAMd 5CKFA 1GCQC 2ZZDA 4XAXB 1IGUA 4HCZA 4B9XA 3AHUA 3OS1A 2SRCA 5HK3A 2YUQA 4C8QC 3L2RA 2IIMA 2KRSA 2LTOA 2MCNA 2QEXA 4FW1A 3TU4K 1BBZA 1H8KA 2CP5A 2HKNA 2QTVA 5GAOr 3EFOA 3J7AF 1A0NB 1NLOC 2NUZA 1ZSGA 4LN2A 3JCMQ 1YITQ 4GBQA 2FVUA 4E7LA 2NUTB 1GL5A 3X20B 4N0AA 3CPFA 3PIPA 3CCRQ 1AT1B 3OYAA 2DA9A 1VQKA 4FYWB 1EZZB 3P8DA 2GNCA 2K4YA 1ZHIA 1Y0MA 3TEEA 3TCJA 4C0DC 4XK8E 1WFWA 3CC7T 4JLIA 4HVUA 3CCQQ 1LNXA 1AVZC 3RMQA 2OTLT 4OMOA 4RTYA 4BD3A 1MHNA 5L8RE 1XQHA 2PVDB 3MEWA 4ELYC 3CMET 3NTHA 1NLPC 3UF4A 4NS5A 1T3LA 4O6JA 3JCMV 3VRZA 3CCUA 5GAOq 4FSSA 1AHJB 2ZPBB 3HSBA 1EX4A 4DBQA 5KYXA 4KUDK 2MYSA 4M78G 1YBYA 5LJ5e 4HA8A 3PMIA 4ELZC 5LJ3g 3LWHA 3EG9A 1NM7A 1YCYA 1AD5A 4M7AC 1FMWA 5GAOp 2DXCA 4A54A 1VYTA 3SFMA 1FWZA 3QIIA 1YJWA 1KSWA 4M78E 4KBMB 4JRIA 2YLBA 5IXBA 5KCHA 1IO6A 4F7UB 1H3HA 5D6WA 4JUVA 1VQ6A 3OS0A 4FYVB 4M7DC 4LDVA 4WF2A 4KH0B 1MV3A 1N9RA 3QDRB 3LYIA 5FRMA 4C5EA 3M53A 4J8OA 2ZPFB 5FU7B 3JB9H 1OX9A 1R0CB 3JV3A 1P92A 5GANe 1K9AA 5I11A 1Q82C 4XTYA 4NL3A 5CQYA 4QW2A 4E7ZA 3H8ZA 3MEUA 1X43A 2HL5C 1K9MC 1M8MA 1LVKA 2YRVA 5GAMj 1TUDA 3OBYA 2PUOB 3CCMQ 2WSFE 3CCJQ 4FSXA 3G6EA 2LT1A 1X6BA 4M77B 2WACA 1X69A 5I2MA 2SEMA 2YHTA 2LJ3A 3MKDA 4QQDA 1MMNA 1OOTA 3S3OA 2EIFA 4XTUA 1X27A 1MMDA 1RL2A 2CSQA 2CH4A 4OGEA 2EKHA 3G4SQ 4M75F 3CC7Q 3P8HA 1ZBXA 3CCQT 2MIOA 3I5RA 4EDUA 3BFMA 4BY6C 4PLIA 4DOWA 2RA2A 3CCRT 1KC8U 1UB4A 2KROA 2XG8D 4MMLA 1T0HA 4AG2C 4FCYA 2V8KA 1K4US 3ZEHA 5KH6A 3JB9J 4ZN1A 9ATCB 3VYHB 4MZTA 3KBGA 1VQ7T 3DLMA 1UGPB 3M54A 2J06A 1E7OA 1WDXA 1C1AA 2DL4A 1TU0B 1VQPT 3EHRA 4EMHA 2CS7A 5GAN7 4DEXA 3EFSA 3NTIA 4GLMA 1WA7A 5LJ3e 2CUBA 1D09B 2JOYA 3BE3A 2RM4A 2DO3A 1Z9QA 3EGDA 1NJIU 2RJDA 3ZFJA 1QKXA 1VQOQ 2CT4A 3OS2A 2Y90A 4XU0A 3L42A 3LGFA 4F16A 1G3YA 2VV5A 4FM4B 2RQWA 1PWTA 1K9MR 3OYGA 1ZUUA 1UE9A 2HDAA 4J9EA 2J05A 3CC4A 1K73R 1VQ5T 5CQXA 3DKMA 2QG9B 4AT1B 1QMCA 3UPUA 1VQ9A 2KYBA 2DNUA 3I35A 1TXQA 5GAMe 3UA6A 2JXBA 3L1AA 1M9SA 3WVEB 1UGQB 2DFUA 1AWOA 3G4SA 2EQUA 1VUBA 1C0MA 3A1PA 2H3EB 1YI2T 1Z9ZA 3X25B 1E6GA 5IXFA 5DLQE 3X24B 2XDBA 2HSPA 4J9FA 2QYZA 1I8FA 2K3BA 4Z89A 5KYYA 1YJNT 4BDYA 2LJ0A 3GNGA 4C92D 5GAMh 5CAIA 3C0CA 4M7AD 1M1KC 4KULA 4ZGDB 3PGGA 4CC3A 1XOVA 1WYXA 3S3NA 4FW2A 3FC3A 3FB9A 4CI0C 1ZX6A 3M4YA 2O01E 2ED1A 3EAEA 3CMEQ 3BW1A 3CCST 2FEIA 2FZGB 4XTXA 3M55A 3I56A 4QT7A 5LJ5j 2K79A 2MPXC 4A4GA 1TSFA 5M9OA 1QQJA 2FHDA 2O2OA 1PHTA 4CC2A 2CP6A 4PJOE 2GFAA 2COYA 1VQNA 5FU6B 2HSEB 2GCXA 1W2BS 5LJ3h 1VYVA 2OX7A 4IUPA 2HKQB 1BI3A 2E41A 4C5GA 2PUKB 5CR2A 3MHXA 2DEQA 4L6V5 2RB6A 1JRIA 2R58A 3META 3DB3A 1M90U 2MI6A 3JB9F 4RTWA 1EFNA 1GBQA 3OYHA 3ER0A 4A63B 2K5LA 2O88A 4C92G 4AFUC 2QQAA 3C4SA 1KHIA 4ORZA 1RAFB 2LNHB 1N6AA 1W1FA 3EG2A 2FZKB 1AOJA 2CP7A 1SRLA 2C06A 2L3PA 3HRSA 2C0IA 1MNDA 4KH1B 1SHGA 3OQ5A 3OY9A 1SF9A 4XU3A 2QEXQ 2EFIA 4JJDA 3A8OB 2C0OA 4IUUA 4JPBW 2QA4T 4BDZA 1QP2A 3A8HB 1Y7XA 1N5ZA 1Y96A 3GF5A 2PZ1A 1G3SA 2JW4A 4C8QE 5GAN6 2EPDA 4RCCA 1Y07A 2A37A 1QCNA 2NLUA 2DL8A 4PNOA 1M1KR 1ZLMA 4RUGA 2RK1A 3OW2S 1IGQA 4M75D 1RLQC 4M78B 1G2BA 4NOYA 2FB7A 4OMPA 1JXMA 3CCRA 3VS7A 1CKAA 2DE0X 3QPHA 4J83A 2JUFA 2L89A 2K2MA 2LP5A 4M77F 2MAMA 5LJ3d 2F2WA 2DVEA 1UEBA 1WXBA 2KK4A 3NFCA 2DVJA 2YDLA 2P4TA 2PNIA 1OULA 4GLKA 1WQWA 4F7UG 1NBEB 3CXCS 3RKYA 1VQ7A 2D6FA 1S72Q 3QHSA 2L3RA 3O5ZA 2LMJA 1SRMA 4A4HA 3JSCA 2GGRA 4ZN3A 3EFOB 2A36A 4FT4A 1ZBJA 5CK9A 4ATOA 1PNJA 3FEOA 4M78A 2MWPA 4EMKC 4AG1C 4DBRA 1S72T 2DMOA 2EQJA 4LDYA 1VQMA 5J26A 3H0HA 4J6XA 1MMAA 2BIVA 3LWIA 4KGVB 4M75A 4HKEA 3ZL7C 4M75C 1TOVA 3CBMA 4J9BA 2M16A 4X1VA 1PKTA 2DTIA 3OYDA 3QJ6A 2KRNA 3CCEQ 3V7CA 4XU1A 1R77A 4Y91A 1BCOA 2LZ6B 3CBOA 3CMAQ 5GANd 5LJ5g 2CZ1B 4YTLA 1MNEA 3VYGA 2OTJQ 1VQNQ 2ATCB 5KE2A 2NUTA 3M9QA 2X9HA 4DA4A 3URGA 3MP1A 5GAN4 4X9DA 1NYGA 1Q7YC 1FX7A 2CSIA 2DXTA 5GJVB 2QDYB 1VQPA 3OMGA 5IAYA 4AFQC 4XTVA 5LJ3j 3M56A 3HFOA 1VQLQ 3QDFA 2KGTA 3INZA 4OMLA 1IHVA 1GRIA 2QQSA 1HK9A 2V8IA 4FYYB 1VQ5A 3E9GA 2L5QA 1B07A 3OYYA 2I2LA 3SHWA 1D3BA 2RI2A 4TVRA 2K3XA 3EG9B 2LNVA 1YI2A 2RHXA 1PM3A 2E65A 1KQSP 5FU7C 4C5HA 4BUGA 5KE3A 3OMCA 2F69A 2CREA 3NPFA 2X35A 4QKUA 5FWCA 3TREA 4F7UA 2AK5A 2DAQA 2FYKA 1K8AU 1M5Q1 2DYBA 2OTJA 1SG5A 4C92B 2EJGA 4HCKA 2RO0A 2D0NA 2DRKA 1BIAA 3RBBB 3UDCA 5HKCA 2BKDN 2JTFA 2O4XB 1D1CA 2XIDA 1K73C 2DL3A 3VS5A 3EHQA 2HNIA 4E7SA 1PD1A 2VC8A 3KFVA 2CZ7B 1WJRA 2JT4A 2E3HA 3EGUA 2QTXA 1G5VA 4BACA 5D6YA 3CD6A 2DXUA 3CCLT 3JAME 1ZA2B 1JJ2P 2CUDA 4LD9K 3GIBA 5FRNA 1QVFA 2QASA 5EC7A 2ZCFB 5GANj 2HQHA 1Q81C 5CO7A 5IN1A 2PVOB 3C95A 2OAUA 2BZXA 3A8GB 1M8VA 1M27C 3REAB 3EG3A 1E6HA 2YRCA 2QA4Q 3CCET 3OYJA 2MK5A 4K11A 5CKHA 4C92A 1UDLA 2HL3A 2BE9B 1OPLA 1UHCA 2KY9A 3O8VA 4DBFA 3JCMX 1JEGA 2C0TA 3LH5A 1HYOA 2QEXT 3CCMA 3V8LA 1YN8A 1U3OA 1M2VA 2A7YA 1B7TA 2R57A 3HRUA 2RK2A 1WJSA 2J7IA 2X4JA 1QVFP 3MP8A 1U1TA 1WNLA 4FL6A 2VGMA 4RKUE 3UWNA 4LDWA 2R5MA 4M78C 3CC7A 3EGDB 2RJCA 2XICA 4ZGEB 4IUQA 1RI0A 2DPPB 1H641 3EGXB 4QVDA 2LCCA 2YXYA 3S3MA 2QA4A 2RI3A 4BI4A 2OTLA 3HRTA 4C92E 2K6DA 5AT1B 1T0JA 4OMQA 3CPWS 1NYFA 2G6FX 5KYNA 2LQ8A 1GCPA 1M2VB 2E3IA 3SWNB 3QWYA 1YJNA 2K5FA 1WHJA 1X2KA 2FRYA 2KXDA 4JS5A 2K5IA 1X6GA 4XU2A 4LE9A 1VQMT 3MCAB 2QGFB 2QQ9A 1YITT 2PU9B 1YCSB 1H3ZA 1W2BP 2ZPIB 2D1XA 1YWOA 1K76A 2DJQA 2L2PA 2L0AA 2CH4W 4C0DB 4PJOD 1YJ9T 2E1HA 3OW2P 4C8QD 1YJWT 1GCQA 3A8LB 1M3BA 2M1HA 2HMAA 3PTAA 4X34A 3L2WA 4A4EA 1NJIC 2FZCB 5FU6C 2QI2A 2FL7A 1LOJA 2Y4XA 2HQEA 1Q7YR 1ARKA 2HQXA 3VS4A 4V2SA 1UGRB 1VQ4T 1V29B 2VGNA 3PIOA 4F7UE 3CCQA 4R55A 3U23A 1VQLT 1KC8R 4LDXA 2E70A 2LCSA 2KT1A 2XK0A 3EG1A 3UA7A 2D8JA 2XKOC 2VB6A 2KR3A 3RNJA 1GFDA 2RN8A 4R56A 5L23A 1NPPA 3QG1A 3JCMb 2EWNA 5CKDA 1HXDA 5GANh 3AT1B 2D0QB 4E7IA 1OZ3A 3JCMf 1AWWA 4KRTA 4XTZA 3RKWA 2CP2A 2LX7A 1M90C 1K0XA 3QBYA 1X75C 4JJBA 4M7DB 1M30A 1I1JA 2DF6A 1VYUA 2KI7A 1RAEB 2YT6A 1WHMA 4C92F 3DLLA 5FWBA 2AIRB 2ZPGB 1MV0B 4PJMA 3R6OA 2JVVA 3FJPA 1Q86C 2AZVA 3CMAA 2EVRA 2V1QA 4IURA 3OYKA 2RNAA 2JNGA 5GAOl 2XU8A 2XI9A 1SHFA 4WCIA 1N8RC 8ATCB 1K73U 2YWWA 2DIGA 4J6WA 1BI2A 2HBPA 1OU8A 1M3AA 5GAN5 1VQ4A 2FG0A 1KQ1A 1X6OA 3CC4T 3V8JA 1N27A 3I55A 1YNZA 1KJWA 1VQMQ 2JS0A 2O9SA 4E7HA 1O75A 4J9HA 1EIFA 1Y96B 3C12A 1WPYA 1OI1A 4J9GA 6AT1B 2YSQA 5AYFA 4KGZB 3CQTA 1NG2A 2QQBA 2J6OA 3G4ST 2F1LA 1W4SA 4EPCA 4O5VA 5A0LA 5C0MA 2DEUA 2JMCA 4JZ4A 3I56Q 4M7DE 1JXOA 1RAGB 2P4RA 2DD4A 2JJ9A 3ME9A 3RIRA 5KYYB 2RQUA 5EG2A 3ZBDA 3CCLQ 2AZSA 1U1SA 3HKSA 4PFPA 5GANg 4A4FA 4D8KA 3BDUA 1G3WA 1UECA 4JJNK 1BU1A 1OU9A 1YP5A 5I2SA 1RABB 4B9WA 1K1ZA 5LJ5f 1NE8A 2KYMA 2DTHA 1KD1C 5IHIA 4CRIA 5KYUB 2MF2A 3BY7A 1WHGA 3S6WA 1FXXA 5GMKi 2GQVA 2M02A 4QQ6A 2GQIA 2AT1B 3RKXA 3PMTA 1WJQA 3M0SA 5GAOn 1W6XA 4C8QA 1Q81R 3JCMg 2V8JA 1VQNT 3G6EQ 4UC4A 1PC0A 4M77D 4B6MA 3MO8A 4PJOA 4R0KA 5DY9A 2GTOA 2ESWA 4C92C 3ULRB 1HD3A 1ZSZA 1QW1A 3E1SA 4M75E 3GP8A 4ZGJB 2ROTA 3CBPA 1YIJA 2W0ZA 3G6ET 4E6RA 4KT0E 5IH2A 5KYXB 3QSUA 1KK7A 1UJ0A 3VS2A 5GMKh 2RPNA 1FMKA 2A0FB 2NUPA 1I0CA 1VIFA 1W2BA 3I55T 4NL2A 2K2VA 3H0IA 1VQOA 1B34A 4X9CA 2K3YA 3H6ZA 3JCMd 1M2OA 4LUDA 1ABOA 4LXCA 4IKFA 4N4GA 1W70A 3LGLA 4BE2A 3CCJT 1HSQA 2YRDA 1ABQA 1BKBA 1ZA1B 2XHCA 2JS2A 1OV3A 4OGCA 1KQSA 4BE1A 3JCMc 2YUNA 1D0YA 2RJFA 3F70A 1YI2Q 1YFNA 5ECAA 1NEBA 2VUBA 3OYBA 2RF0A 5GMKl 1G3TA 4J7FA 1UGVA 2P0KA 4ZNXA 3CCSA 2B8AA 2F5KA 2LQNA 2WSCE 2KE9A 3VS3A 3A98A 4C8QB 1KQSS 3SD4A 2CP3A 1LCKA 3UATA 2L3SA 2RH2A 1RUWA 3LH0A 3M0PA 4Y28E 1VQPQ 2RHZA 2QDLA 2EJFA 1D3BB 3CMAT 4FT2A 3LX7A 1VOMA 1WGSA 2HAXA 2XDPA 4OMNA 2EGAA 2AKLA 1YJWQ 3P8BB 4DBHA 4M7AA 2P0PA 4QQGA 3VRYA 2YLCA 2NYSA 1QVGP 4AMCA 1IZ6A 3EH1A 4EMKB 2RD1A 1VQ5Q 1UHFA 3VS1A 1NJIR 3CCLA 5KYWA 1VQOT 2LQKA 3SB2A 3JCMW 1PRMC 3FDRA 3HFNA 3HTRA 4WTOB 1JBMA 2O4XA 2H3JA 1AZGB 3J80E 4CC4B 4OMMA 2QGGA 2DERA 4BI3A 5GMKe 4N0AC 4M7DD 3HHTB 4JLGA 2X4XA 4E2FB 2LVMA 1PSFA 1TS9A 2EYZA 3MEAA 2DZCA 2BTTA 2RHIA 3WXMB 1M1KU 3NHNA 1SSHA 2EQMA 4M7AB 3HL8A 2J6FA 1DJ7B 3M0UA 1ACMB 3CC2T 1FYNA 4JRKA 2DIQA 1NZ9A 4IUTA 1JQQA 2QK0A 1FMVA 1SKUB 5I21A 2F2VA 1V1CA 3SWNC 2DXBA 1I5OB 2H8HA 5GJWB 4KUIA 1YJ9Q 3VS6A 4BE0A 5LL6S 3X26B 1C6VX 3QXEB 5CKBA 1I4K1 3HPWA 3H9NA 2BZ8A 1YITA 3RUXA 2IPOB 5I22A 4KGXB 2K9GA 3GNFB 3CXCA 4M75G 3VKIA 3Q1JA 4ZTJA 3EG0A 3JCMe 1WLPB 1MMGA 1WHHA 3FJ5A 4M77A 4EMGA 1H92A 4PJLA 5HK0A 3NTKA 2O9VA 4RG8A 1VIEA 3PVLA 2DZ9A 1GXIE 1PSEA 4A4KA 1SSFA 2FRWA 3OYLA 3M0RA 4HVWA 3VU3C 2D9TA 1AEYA 3N5BB 2JN0A 2P0QA 1PD0A 1GFCA 5FLXE 4HT8A 5GMKm 1YJ9A 1Q95G 4OB1B 3NMZC 2RI5A 2E6ZA 1NPRA 1RAAB 1T3SA 1M1FA 2CKKA 3PVQA 4RTTA 1U8RA 2ZAEA 1Q86U 2KT8A 1VQ8Q 2ABLA 1OX8A 1K9MU 3REBB 2DM1A 2E10A 1VQKT 1BYMA 1Q82U 2G3RA 2DBMA 4VUBA 2X4YA 4BI8B 3FLGA 1B3QA 2BE7D 2GBQA 3WVDB 3TQ7P 1WHKA 4N4HA 2KRMA 3CCVA 3H0FA 3CD6T 1UG1A 1RADB 2M9UA 1R8OB 1QVPA 3V8KA 4M7AF 3CMEA 3G71T 3L2ZA 2DYIA 4MZMA 1QWEA 1IB8A 4ME7A 1OYXA 5D7UA 1CKBA 5CCAA 1RI9A 1K8AR 1JU5C 5CKEA 3L2VA 3CCMT 3FIFA 4JRPA 5CVIA 1LPLA 3THKA 4M4ZA 5J39A 1VQ9T 2R5AA 4DOVA 5A0DA 1JB0E 1WHLA 3CCUT 1YJNQ 3R6NA 3IQLA 1OQKA 1QWFA 2RMOA 4DEYA 5GAOm 2DBKA 3OSSC 4OP0A 2RQVA 1YHQQ 4IUVA 4MDWA 4OB3B 2LC4A 4ZTFA 1N8RU 2LDMA 3RMSA 5GAMg 3G1JA 4ANJA 4BB7A 4Q5WA 1M4ZA 1I07A 4PJOB 2FPDA 3OYEA 3QYHB 2OI3A 2CGHA 1WXTA 1WX6A 3JB9I 3I56T 2HZYA 1QLYA 2JZ2A 1KQ2A 1BI0A 2M0YA 1UTIA 2KAFA 2ED0A 2PVGB 2QXFA 3PNWC 5KYUA 2VKNA 3M58A 2D8HA 2EYYA 5GANf 3SDZA 4LDUA 4LD6A 4FU6A 2DL7A 3J81E 2AKKA 3M0TA 3PT9A 2DRMA 4J9IA 1IHWA 2Z0WA 4M78F 2RJEA 2E12A 4L59A 1PCXA 2JM9A 1KC8C 1XJWB 1VA7A 1Q82R 4PL6A 3MPUB 4C0ZA 2DX1A 3SEMA 2CZ0B 1D0XA 2DTOA 1WIEA 3OYIA 1M3CA 2X3WD 4PKCC 2HBWA 3TSZA 3M59A 1MGQA 2EKOA 2VXEA 4J9CA 1LJOA 2ZPHB 3OB9A 3A5ZB 3KXTA 1JJ2A 2FPFA 4M7DG 3I5SA 1SPKA 2LJ1A 4PJJA 1VQLA 1KD1U 2KBTA 4A53A 4PJOC 1AWXA 5GAN8 4FYXB 3X28B 4OVAA 4F17A 4RTVA 4IIMA 2E64A 2EYQA 1ZSZC 2HCKA 1XNIA 2RQTA 5C6SA 4J7IA 1U06A 3I55Q 2AHJB 1K8AC 2V1RA 3VV0A 4BY6B 1QVFS 3GPLA 2JMAA 2L8DA 3MP6A 2KVQG 1D0ZA 1WXUA 2BZYA 3GOXA 1KHCA 4OMFB 2FPEA 2DD5A 3CXCP 1X01A 3OBWA 4DQ2A 2EBPA 4E7JA 3ASKA 4GY5A 4AFSC 2A08A 3CC2Q 2EGCA 4OB0B 4JDSA 1QCOA 2M0OA 2ZPEB 4QVCA 4PLLA 1KIKA 3T9NA 1N8RR 4RTXA 2ENMA 1OZ2A 5FROA 4JRQA 2ROLA 1QKWA 1QVGA 2IG0A 3G7ZA 3FRNA 2YUOA 1YHQT 1U5SA 3OSVA 2RHUA 2E6NA 3GBQA 3C94A 1S72A 5GMKj 1OPKA 3L2QA 2CYZB 3OW2A 3TSWA 1TWBA 2PTKA 1O9SA 2I0NA 4M77G 4XQ3A 5DM7R 1RLPC 4RCBA 2OAWA 4RMOA 1VQ6Q 1ZUYA 2KNBB 5HCKA 2NUPB 1VQ8T 1I5LA 4QVZA 1I81A 4C0GA 3M57A 2KXCA 1VQKQ 3OYFA 2LX9A 3VJPA 3V7RA 5GAN3 3E9FA 1WQ7A 4M77E 2J6KA 2KDSA 1XTDA 2B86A 2P84A 1UFFA 3MJXA 4AFZC 4M75B 1TH7A 4OB2B 4M78D 8AT1B 5DLOA 1M90R 3RERA 4PJOG 2RHYA 2W10A 2ZGWA 4E7KA 2EYXA 2KSSA 4F7UF 3CCVQ 2M51A 3H41A 4EIKA 2YUPA 2Y4YA 4RTZA 1KD1R 2CDTA 3QO3A 3A8MB 2COZA 2DJZA 7AT1B 1PRLC 3CC2A 2EQKA 2HEQA 1UGSB 4HT9A 4N4IA 2GFUA 4EMKA 4II1A 2JTMA 1RACB 4Z8AA 5D6XA 3MEVA 2GTJA 2MOXA 3CEYA 2E4HA 5HY6A 4C5IA 1TUCA 1YIJT 4P5NA 5LJ5h 5J3BA 4Z88A 2E5QA 2OTLQ 3V7SA 4HCBA 1AZEA 3HP9A 4Z02A 1J3TA 4JJCA 4M7DA 3VUBA 1IXDA 1S1NA 2O31A 1IREB 3UT1A 3CCUQ 4PFZA 1TTHB 1OEBA 4MZPA 4LUEA 5IHNA 4M7AE 4PJOF 3TVTA 2K7AA 3VUZA 2L3QA 4M77C 4F04B 3OYMA 2EYWA 1K0SA 1SEMA 1IRXA 3CPWA 3JCMP 2OJ2A 4F14A 3QZ9B 3CCSQ 2DKGA 2BUDA 1Q86R 2EAYA 1GBRA 1BB9A 4M7AG 3E19A 3LW5E 4HCCA 2X4WA 2VASA 2QQRA 4J9DA 1G8XA 2NWMA 2F5TX 1RAIB 4JS4A 1Q7YU 1G83A 3RESA 1D1AA 2WSEE 1BCMA 2E5KA 1QVGS 1Y57A 3SWNA 2A28A 1QCFA 3VS0A 2A3LA
chains in the Genus database with same CATH topology
2QASA 1ZSZC 1OX9A 2QAZA 1OULA 1TWBA 1OX8A 1YFNA 1OU8A 1ZSZB 1ZSZA 1OU9A 2NYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAS A;  1ZSZ C;  1OX9 A;  2QAZ A;  1OUL A;  1TWB A;  1OX8 A;  1YFN A;  1OU8 A;  1ZSZ B;  1ZSZ A;  1OU9 A;  2NYS A; 
#chains in the Genus database with same CATH topology
 3G71 Q;  2VWF A;  2FO0 A;  5A2Q E;  3OYC A;  3CCE A;  1Q81 U;  3KUF A;  2MMP A;  2MWO A;  3M4G A;  2VVK A;  2LT4 A;  2X51 A;  3CPW P;  1BIB A;  4IIO A;  4PJN A;  3CD6 Q;  1BI1 A;  3L2U A;  2ECZ A;  4D6W A;  5GAN 2;  4LNP A;  3M5A A;  2LRQ A;  1M1G A;  3M0Q A;  3JB9 D;  1BK2 A;  2JTE A;  3JRZ A;  5IHK A;  3RR6 A;  2CP0 A;  4Y92 A;  2COW A;  1N9S A;  2IVW A;  4MDX A;  1AWJ A;  2QAZ A;  1VQ9 Q;  1HJD A;  2EGE A;  3DB4 A;  3PE0 A;  4C0F A;  4FIB A;  4RTU A;  4C8Q F;  5LJ5 d;  3RDV A;  3NGP A;  1RAH B;  1TUG B;  1ZQ1 A;  4ESR A;  5A0G A;  1ZUK A;  5KYW B;  3CCV T;  1NEG A;  4JZ3 A;  5FW9 A;  3G71 A;  2XMF A;  1KG1 A;  1PG5 B;  1TG0 A;  3QKJ A;  3I9Q A;  4J6Y A;  3JCM J;  1JJ2 S;  3OYN A;  3E2U A;  1YIJ Q;  2EW3 A;  2EQI A;  4E47 A;  2DK3 A;  5KCO A;  3QWX X;  2PQW A;  1YWP A;  4M7D F;  4J5Y A;  3D7S B;  5GAM f;  1CSK A;  2LCL A;  3GLX A;  1ZSZ B;  4XTW A;  1R0B G;  5CIU A;  2JM8 A;  1PKS A;  4C8Q G;  1D1B A;  3QYG B;  2DIL A;  1UJY A;  2CT3 A;  3JB9 G;  4HVV A;  2RQR A;  4MMK A;  3CC4 Q;  2LQW A;  2XDD A;  1WI7 A;  1V76 A;  2F2X A;  2VYT A;  4RG2 A;  2GF7 A;  2HD0 A;  1YHQ A;  3QUI A;  3OS5 A;  4PFO A;  1MUZ A;  2DLP A;  5LJ3 f;  3EGX A;  4L5G A;  1F1B B;  1WZO A;  1VQ7 Q;  4PK4 A;  2XD0 A;  1UUE A;  3JCM h;  2DET A;  1VQ8 A;  2DL5 A;  2K57 A;  1X2Q A;  1VQ4 Q;  2CZ6 B;  4HXJ A;  2KQW A;  1KFZ A;  1QP3 A;  3PFS A;  3EH2 A;  2V26 A;  4CC7 A;  1JO8 A;  3LLR A;  2EJ9 A;  1B34 B;  4D8D A;  1VQ6 T;  1Y71 A;  3EFR A;  4OF1 A;  2X3X D;  3CCJ A;  2KMT A;  2OTJ T;  3BDL A;  3QZ5 B;  3QJY A;  5IT9 E;  2KEA A;  3OA6 A;  2VXF A;  5GAM d;  5CKF A;  1GCQ C;  2ZZD A;  4XAX B;  1IGU A;  4HCZ A;  4B9X A;  3AHU A;  3OS1 A;  2SRC A;  5HK3 A;  2YUQ A;  4C8Q C;  3L2R A;  2IIM A;  2KRS A;  2LTO A;  2MCN A;  2QEX A;  4FW1 A;  3TU4 K;  1BBZ A;  1H8K A;  2CP5 A;  2HKN A;  2QTV A;  5GAO r;  3EFO A;  3J7A F;  1A0N B;  1NLO C;  2NUZ A;  1ZSG A;  4LN2 A;  3JCM Q;  1YIT Q;  4GBQ A;  2FVU A;  4E7L A;  2NUT B;  1GL5 A;  3X20 B;  4N0A A;  3CPF A;  3PIP A;  3CCR Q;  1AT1 B;  3OYA A;  2DA9 A;  1VQK A;  4FYW B;  1EZZ B;  3P8D A;  2GNC A;  2K4Y A;  1ZHI A;  1Y0M A;  3TEE A;  3TCJ A;  4C0D C;  4XK8 E;  1WFW A;  3CC7 T;  4JLI A;  4HVU A;  3CCQ Q;  1LNX A;  1AVZ C;  3RMQ A;  2OTL T;  4OMO A;  4RTY A;  4BD3 A;  1MHN A;  5L8R E;  1XQH A;  2PVD B;  3MEW A;  4ELY C;  3CME T;  3NTH A;  1NLP C;  3UF4 A;  4NS5 A;  1T3L A;  4O6J A;  3JCM V;  3VRZ A;  3CCU A;  5GAO q;  4FSS A;  1AHJ B;  2ZPB B;  3HSB A;  1EX4 A;  4DBQ A;  5KYX A;  4KUD K;  2MYS A;  4M78 G;  1YBY A;  5LJ5 e;  4HA8 A;  3PMI A;  4ELZ C;  5LJ3 g;  3LWH A;  3EG9 A;  1NM7 A;  1YCY A;  1AD5 A;  4M7A C;  1FMW A;  5GAO p;  2DXC A;  4A54 A;  1VYT A;  3SFM A;  1FWZ A;  3QII A;  1YJW A;  1KSW A;  4M78 E;  4KBM B;  4JRI A;  2YLB A;  5IXB A;  5KCH A;  1IO6 A;  4F7U B;  1H3H A;  5D6W A;  4JUV A;  1VQ6 A;  3OS0 A;  4FYV B;  4M7D C;  4LDV A;  4WF2 A;  4KH0 B;  1MV3 A;  1N9R A;  3QDR B;  3LYI A;  5FRM A;  4C5E A;  3M53 A;  4J8O A;  2ZPF B;  5FU7 B;  3JB9 H;  1OX9 A;  1R0C B;  3JV3 A;  1P92 A;  5GAN e;  1K9A A;  5I11 A;  1Q82 C;  4XTY A;  4NL3 A;  5CQY A;  4QW2 A;  4E7Z A;  3H8Z A;  3MEU A;  1X43 A;  2HL5 C;  1K9M C;  1M8M A;  1LVK A;  2YRV A;  5GAM j;  1TUD A;  3OBY A;  2PUO B;  3CCM Q;  2WSF E;  3CCJ Q;  4FSX A;  3G6E A;  2LT1 A;  1X6B A;  4M77 B;  2WAC A;  1X69 A;  5I2M A;  2SEM A;  2YHT A;  2LJ3 A;  3MKD A;  4QQD A;  1MMN A;  1OOT A;  3S3O A;  2EIF A;  4XTU A;  1X27 A;  1MMD A;  1RL2 A;  2CSQ A;  2CH4 A;  4OGE A;  2EKH A;  3G4S Q;  4M75 F;  3CC7 Q;  3P8H A;  1ZBX A;  3CCQ T;  2MIO A;  3I5R A;  4EDU A;  3BFM A;  4BY6 C;  4PLI A;  4DOW A;  2RA2 A;  3CCR T;  1KC8 U;  1UB4 A;  2KRO A;  2XG8 D;  4MML A;  1T0H A;  4AG2 C;  4FCY A;  2V8K A;  1K4U S;  3ZEH A;  5KH6 A;  3JB9 J;  4ZN1 A;  9ATC B;  3VYH B;  4MZT A;  3KBG A;  1VQ7 T;  3DLM A;  1UGP B;  3M54 A;  2J06 A;  1E7O A;  1WDX A;  1C1A A;  2DL4 A;  1TU0 B;  1VQP T;  3EHR A;  4EMH A;  2CS7 A;  5GAN 7;  4DEX A;  3EFS A;  3NTI A;  4GLM A;  1WA7 A;  5LJ3 e;  2CUB A;  1D09 B;  2JOY A;  3BE3 A;  2RM4 A;  2DO3 A;  1Z9Q A;  3EGD A;  1NJI U;  2RJD A;  3ZFJ A;  1QKX A;  1VQO Q;  2CT4 A;  3OS2 A;  2Y90 A;  4XU0 A;  3L42 A;  3LGF A;  4F16 A;  1G3Y A;  2VV5 A;  4FM4 B;  2RQW A;  1PWT A;  1K9M R;  3OYG A;  1ZUU A;  1UE9 A;  2HDA A;  4J9E A;  2J05 A;  3CC4 A;  1K73 R;  1VQ5 T;  5CQX A;  3DKM A;  2QG9 B;  4AT1 B;  1QMC A;  3UPU A;  1VQ9 A;  2KYB A;  2DNU A;  3I35 A;  1TXQ A;  5GAM e;  3UA6 A;  2JXB A;  3L1A A;  1M9S A;  3WVE B;  1UGQ B;  2DFU A;  1AWO A;  3G4S A;  2EQU A;  1VUB A;  1C0M A;  3A1P A;  2H3E B;  1YI2 T;  1Z9Z A;  3X25 B;  1E6G A;  5IXF A;  5DLQ E;  3X24 B;  2XDB A;  2HSP A;  4J9F A;  2QYZ A;  1I8F A;  2K3B A;  4Z89 A;  5KYY A;  1YJN T;  4BDY A;  2LJ0 A;  3GNG A;  4C92 D;  5GAM h;  5CAI A;  3C0C A;  4M7A D;  1M1K C;  4KUL A;  4ZGD B;  3PGG A;  4CC3 A;  1XOV A;  1WYX A;  3S3N A;  4FW2 A;  3FC3 A;  3FB9 A;  4CI0 C;  1ZX6 A;  3M4Y A;  2O01 E;  2ED1 A;  3EAE A;  3CME Q;  3BW1 A;  3CCS T;  2FEI A;  2FZG B;  4XTX A;  3M55 A;  3I56 A;  4QT7 A;  5LJ5 j;  2K79 A;  2MPX C;  4A4G A;  1TSF A;  5M9O A;  1QQJ A;  2FHD A;  2O2O A;  1PHT A;  4CC2 A;  2CP6 A;  4PJO E;  2GFA A;  2COY A;  1VQN A;  5FU6 B;  2HSE B;  2GCX A;  1W2B S;  5LJ3 h;  1VYV A;  2OX7 A;  4IUP A;  2HKQ B;  1BI3 A;  2E41 A;  4C5G A;  2PUK B;  5CR2 A;  3MHX A;  2DEQ A;  4L6V 5;  2RB6 A;  1JRI A;  2R58 A;  3MET A;  3DB3 A;  1M90 U;  2MI6 A;  3JB9 F;  4RTW A;  1EFN A;  1GBQ A;  3OYH A;  3ER0 A;  4A63 B;  2K5L A;  2O88 A;  4C92 G;  4AFU C;  2QQA A;  3C4S A;  1KHI A;  4ORZ A;  1RAF B;  2LNH B;  1N6A A;  1W1F A;  3EG2 A;  2FZK B;  1AOJ A;  2CP7 A;  1SRL A;  2C06 A;  2L3P A;  3HRS A;  2C0I A;  1MND A;  4KH1 B;  1SHG A;  3OQ5 A;  3OY9 A;  1SF9 A;  4XU3 A;  2QEX Q;  2EFI A;  4JJD A;  3A8O B;  2C0O A;  4IUU A;  4JPB W;  2QA4 T;  4BDZ A;  1QP2 A;  3A8H B;  1Y7X A;  1N5Z A;  1Y96 A;  3GF5 A;  2PZ1 A;  1G3S A;  2JW4 A;  4C8Q E;  5GAN 6;  2EPD A;  4RCC A;  1Y07 A;  2A37 A;  1QCN A;  2NLU A;  2DL8 A;  4PNO A;  1M1K R;  1ZLM A;  4RUG A;  2RK1 A;  3OW2 S;  1IGQ A;  4M75 D;  1RLQ C;  4M78 B;  1G2B A;  4NOY A;  2FB7 A;  4OMP A;  1JXM A;  3CCR A;  3VS7 A;  1CKA A;  2DE0 X;  3QPH A;  4J83 A;  2JUF A;  2L89 A;  2K2M A;  2LP5 A;  4M77 F;  2MAM A;  5LJ3 d;  2F2W A;  2DVE A;  1UEB A;  1WXB A;  2KK4 A;  3NFC A;  2DVJ A;  2YDL A;  2P4T A;  2PNI A;  1OUL A;  4GLK A;  1WQW A;  4F7U G;  1NBE B;  3CXC S;  3RKY A;  1VQ7 A;  2D6F A;  1S72 Q;  3QHS A;  2L3R A;  3O5Z A;  2LMJ A;  1SRM A;  4A4H A;  3JSC A;  2GGR A;  4ZN3 A;  3EFO B;  2A36 A;  4FT4 A;  1ZBJ A;  5CK9 A;  4ATO A;  1PNJ A;  3FEO A;  4M78 A;  2MWP A;  4EMK C;  4AG1 C;  4DBR A;  1S72 T;  2DMO A;  2EQJ A;  4LDY A;  1VQM A;  5J26 A;  3H0H A;  4J6X A;  1MMA A;  2BIV A;  3LWI A;  4KGV B;  4M75 A;  4HKE A;  3ZL7 C;  4M75 C;  1TOV A;  3CBM A;  4J9B A;  2M16 A;  4X1V A;  1PKT A;  2DTI A;  3OYD A;  3QJ6 A;  2KRN A;  3CCE Q;  3V7C A;  4XU1 A;  1R77 A;  4Y91 A;  1BCO A;  2LZ6 B;  3CBO A;  3CMA Q;  5GAN d;  5LJ5 g;  2CZ1 B;  4YTL A;  1MNE A;  3VYG A;  2OTJ Q;  1VQN Q;  2ATC B;  5KE2 A;  2NUT A;  3M9Q A;  2X9H A;  4DA4 A;  3URG A;  3MP1 A;  5GAN 4;  4X9D A;  1NYG A;  1Q7Y C;  1FX7 A;  2CSI A;  2DXT A;  5GJV B;  2QDY B;  1VQP A;  3OMG A;  5IAY A;  4AFQ C;  4XTV A;  5LJ3 j;  3M56 A;  3HFO A;  1VQL Q;  3QDF A;  2KGT A;  3INZ A;  4OML A;  1IHV A;  1GRI A;  2QQS A;  1HK9 A;  2V8I A;  4FYY B;  1VQ5 A;  3E9G A;  2L5Q A;  1B07 A;  3OYY A;  2I2L A;  3SHW A;  1D3B A;  2RI2 A;  4TVR A;  2K3X A;  3EG9 B;  2LNV A;  1YI2 A;  2RHX A;  1PM3 A;  2E65 A;  1KQS P;  5FU7 C;  4C5H A;  4BUG A;  5KE3 A;  3OMC A;  2F69 A;  2CRE A;  3NPF A;  2X35 A;  4QKU A;  5FWC A;  3TRE A;  4F7U A;  2AK5 A;  2DAQ A;  2FYK A;  1K8A U;  1M5Q 1;  2DYB A;  2OTJ A;  1SG5 A;  4C92 B;  2EJG A;  4HCK A;  2RO0 A;  2D0N A;  2DRK A;  1BIA A;  3RBB B;  3UDC A;  5HKC A;  2BKD N;  2JTF A;  2O4X B;  1D1C A;  2XID A;  1K73 C;  2DL3 A;  3VS5 A;  3EHQ A;  2HNI A;  4E7S A;  1PD1 A;  2VC8 A;  3KFV A;  2CZ7 B;  1WJR A;  2JT4 A;  2E3H A;  3EGU A;  2QTX A;  1G5V A;  4BAC A;  5D6Y A;  3CD6 A;  2DXU A;  3CCL T;  3JAM E;  1ZA2 B;  1JJ2 P;  2CUD A;  4LD9 K;  3GIB A;  5FRN A;  1QVF A;  2QAS A;  5EC7 A;  2ZCF B;  5GAN j;  2HQH A;  1Q81 C;  5CO7 A;  5IN1 A;  2PVO B;  3C95 A;  2OAU A;  2BZX A;  3A8G B;  1M8V A;  1M27 C;  3REA B;  3EG3 A;  1E6H A;  2YRC A;  2QA4 Q;  3CCE T;  3OYJ A;  2MK5 A;  4K11 A;  5CKH A;  4C92 A;  1UDL A;  2HL3 A;  2BE9 B;  1OPL A;  1UHC A;  2KY9 A;  3O8V A;  4DBF A;  3JCM X;  1JEG A;  2C0T A;  3LH5 A;  1HYO A;  2QEX T;  3CCM A;  3V8L A;  1YN8 A;  1U3O A;  1M2V A;  2A7Y A;  1B7T A;  2R57 A;  3HRU A;  2RK2 A;  1WJS A;  2J7I A;  2X4J A;  1QVF P;  3MP8 A;  1U1T A;  1WNL A;  4FL6 A;  2VGM A;  4RKU E;  3UWN A;  4LDW A;  2R5M A;  4M78 C;  3CC7 A;  3EGD B;  2RJC A;  2XIC A;  4ZGE B;  4IUQ A;  1RI0 A;  2DPP B;  1H64 1;  3EGX B;  4QVD A;  2LCC A;  2YXY A;  3S3M A;  2QA4 A;  2RI3 A;  4BI4 A;  2OTL A;  3HRT A;  4C92 E;  2K6D A;  5AT1 B;  1T0J A;  4OMQ A;  3CPW S;  1NYF A;  2G6F X;  5KYN A;  2LQ8 A;  1GCP A;  1M2V B;  2E3I A;  3SWN B;  3QWY A;  1YJN A;  2K5F A;  1WHJ A;  1X2K A;  2FRY A;  2KXD A;  4JS5 A;  2K5I A;  1X6G A;  4XU2 A;  4LE9 A;  1VQM T;  3MCA B;  2QGF B;  2QQ9 A;  1YIT T;  2PU9 B;  1YCS B;  1H3Z A;  1W2B P;  2ZPI B;  2D1X A;  1YWO A;  1K76 A;  2DJQ A;  2L2P A;  2L0A A;  2CH4 W;  4C0D B;  4PJO D;  1YJ9 T;  2E1H A;  3OW2 P;  4C8Q D;  1YJW T;  1GCQ A;  3A8L B;  1M3B A;  2M1H A;  2HMA A;  3PTA A;  4X34 A;  3L2W A;  4A4E A;  1NJI C;  2FZC B;  5FU6 C;  2QI2 A;  2FL7 A;  1LOJ A;  2Y4X A;  2HQE A;  1Q7Y R;  1ARK A;  2HQX A;  3VS4 A;  4V2S A;  1UGR B;  1VQ4 T;  1V29 B;  2VGN A;  3PIO A;  4F7U E;  3CCQ A;  4R55 A;  3U23 A;  1VQL T;  1KC8 R;  4LDX A;  2E70 A;  2LCS A;  2KT1 A;  2XK0 A;  3EG1 A;  3UA7 A;  2D8J A;  2XKO C;  2VB6 A;  2KR3 A;  3RNJ A;  1GFD A;  2RN8 A;  4R56 A;  5L23 A;  1NPP A;  3QG1 A;  3JCM b;  2EWN A;  5CKD A;  1HXD A;  5GAN h;  3AT1 B;  2D0Q B;  4E7I A;  1OZ3 A;  3JCM f;  1AWW A;  4KRT A;  4XTZ A;  3RKW A;  2CP2 A;  2LX7 A;  1M90 C;  1K0X A;  3QBY A;  1X75 C;  4JJB A;  4M7D B;  1M30 A;  1I1J A;  2DF6 A;  1VYU A;  2KI7 A;  1RAE B;  2YT6 A;  1WHM A;  4C92 F;  3DLL A;  5FWB A;  2AIR B;  2ZPG B;  1MV0 B;  4PJM A;  3R6O A;  2JVV A;  3FJP A;  1Q86 C;  2AZV A;  3CMA A;  2EVR A;  2V1Q A;  4IUR A;  3OYK A;  2RNA A;  2JNG A;  5GAO l;  2XU8 A;  2XI9 A;  1SHF A;  4WCI A;  1N8R C;  8ATC B;  1K73 U;  2YWW A;  2DIG A;  4J6W A;  1BI2 A;  2HBP A;  1OU8 A;  1M3A A;  5GAN 5;  1VQ4 A;  2FG0 A;  1KQ1 A;  1X6O A;  3CC4 T;  3V8J A;  1N27 A;  3I55 A;  1YNZ A;  1KJW A;  1VQM Q;  2JS0 A;  2O9S A;  4E7H A;  1O75 A;  4J9H A;  1EIF A;  1Y96 B;  3C12 A;  1WPY A;  1OI1 A;  4J9G A;  6AT1 B;  2YSQ A;  5AYF A;  4KGZ B;  3CQT A;  1NG2 A;  2QQB A;  2J6O A;  3G4S T;  2F1L A;  1W4S A;  4EPC A;  4O5V A;  5A0L A;  5C0M A;  2DEU A;  2JMC A;  4JZ4 A;  3I56 Q;  4M7D E;  1JXO A;  1RAG B;  2P4R A;  2DD4 A;  2JJ9 A;  3ME9 A;  3RIR A;  5KYY B;  2RQU A;  5EG2 A;  3ZBD A;  3CCL Q;  2AZS A;  1U1S A;  3HKS A;  4PFP A;  5GAN g;  4A4F A;  4D8K A;  3BDU A;  1G3W A;  1UEC A;  4JJN K;  1BU1 A;  1OU9 A;  1YP5 A;  5I2S A;  1RAB B;  4B9W A;  1K1Z A;  5LJ5 f;  1NE8 A;  2KYM A;  2DTH A;  1KD1 C;  5IHI A;  4CRI A;  5KYU B;  2MF2 A;  3BY7 A;  1WHG A;  3S6W A;  1FXX A;  5GMK i;  2GQV A;  2M02 A;  4QQ6 A;  2GQI A;  2AT1 B;  3RKX A;  3PMT A;  1WJQ A;  3M0S A;  5GAO n;  1W6X A;  4C8Q A;  1Q81 R;  3JCM g;  2V8J A;  1VQN T;  3G6E Q;  4UC4 A;  1PC0 A;  4M77 D;  4B6M A;  3MO8 A;  4PJO A;  4R0K A;  5DY9 A;  2GTO A;  2ESW A;  4C92 C;  3ULR B;  1HD3 A;  1ZSZ A;  1QW1 A;  3E1S A;  4M75 E;  3GP8 A;  4ZGJ B;  2ROT A;  3CBP A;  1YIJ A;  2W0Z A;  3G6E T;  4E6R A;  4KT0 E;  5IH2 A;  5KYX B;  3QSU A;  1KK7 A;  1UJ0 A;  3VS2 A;  5GMK h;  2RPN A;  1FMK A;  2A0F B;  2NUP A;  1I0C A;  1VIF A;  1W2B A;  3I55 T;  4NL2 A;  2K2V A;  3H0I A;  1VQO A;  1B34 A;  4X9C A;  2K3Y A;  3H6Z A;  3JCM d;  1M2O A;  4LUD A;  1ABO A;  4LXC A;  4IKF A;  4N4G A;  1W70 A;  3LGL A;  4BE2 A;  3CCJ T;  1HSQ A;  2YRD A;  1ABQ A;  1BKB A;  1ZA1 B;  2XHC A;  2JS2 A;  1OV3 A;  4OGC A;  1KQS A;  4BE1 A;  3JCM c;  2YUN A;  1D0Y A;  2RJF A;  3F70 A;  1YI2 Q;  1YFN A;  5ECA A;  1NEB A;  2VUB A;  3OYB A;  2RF0 A;  5GMK l;  1G3T A;  4J7F A;  1UGV A;  2P0K A;  4ZNX A;  3CCS A;  2B8A A;  2F5K A;  2LQN A;  2WSC E;  2KE9 A;  3VS3 A;  3A98 A;  4C8Q B;  1KQS S;  3SD4 A;  2CP3 A;  1LCK A;  3UAT A;  2L3S A;  2RH2 A;  1RUW A;  3LH0 A;  3M0P A;  4Y28 E;  1VQP Q;  2RHZ A;  2QDL A;  2EJF A;  1D3B B;  3CMA T;  4FT2 A;  3LX7 A;  1VOM A;  1WGS A;  2HAX A;  2XDP A;  4OMN A;  2EGA A;  2AKL A;  1YJW Q;  3P8B B;  4DBH A;  4M7A A;  2P0P A;  4QQG A;  3VRY A;  2YLC A;  2NYS A;  1QVG P;  4AMC A;  1IZ6 A;  3EH1 A;  4EMK B;  2RD1 A;  1VQ5 Q;  1UHF A;  3VS1 A;  1NJI R;  3CCL A;  5KYW A;  1VQO T;  2LQK A;  3SB2 A;  3JCM W;  1PRM C;  3FDR A;  3HFN A;  3HTR A;  4WTO B;  1JBM A;  2O4X A;  2H3J A;  1AZG B;  3J80 E;  4CC4 B;  4OMM A;  2QGG A;  2DER A;  4BI3 A;  5GMK e;  4N0A C;  4M7D D;  3HHT B;  4JLG A;  2X4X A;  4E2F B;  2LVM A;  1PSF A;  1TS9 A;  2EYZ A;  3MEA A;  2DZC A;  2BTT A;  2RHI A;  3WXM B;  1M1K U;  3NHN A;  1SSH A;  2EQM A;  4M7A B;  3HL8 A;  2J6F A;  1DJ7 B;  3M0U A;  1ACM B;  3CC2 T;  1FYN A;  4JRK A;  2DIQ A;  1NZ9 A;  4IUT A;  1JQQ A;  2QK0 A;  1FMV A;  1SKU B;  5I21 A;  2F2V A;  1V1C A;  3SWN C;  2DXB A;  1I5O B;  2H8H A;  5GJW B;  4KUI A;  1YJ9 Q;  3VS6 A;  4BE0 A;  5LL6 S;  3X26 B;  1C6V X;  3QXE B;  5CKB A;  1I4K 1;  3HPW A;  3H9N A;  2BZ8 A;  1YIT A;  3RUX A;  2IPO B;  5I22 A;  4KGX B;  2K9G A;  3GNF B;  3CXC A;  4M75 G;  3VKI A;  3Q1J A;  4ZTJ A;  3EG0 A;  3JCM e;  1WLP B;  1MMG A;  1WHH A;  3FJ5 A;  4M77 A;  4EMG A;  1H92 A;  4PJL A;  5HK0 A;  3NTK A;  2O9V A;  4RG8 A;  1VIE A;  3PVL A;  2DZ9 A;  1GXI E;  1PSE A;  4A4K A;  1SSF A;  2FRW A;  3OYL A;  3M0R A;  4HVW A;  3VU3 C;  2D9T A;  1AEY A;  3N5B B;  2JN0 A;  2P0Q A;  1PD0 A;  1GFC A;  5FLX E;  4HT8 A;  5GMK m;  1YJ9 A;  1Q95 G;  4OB1 B;  3NMZ C;  2RI5 A;  2E6Z A;  1NPR A;  1RAA B;  1T3S A;  1M1F A;  2CKK A;  3PVQ A;  4RTT A;  1U8R A;  2ZAE A;  1Q86 U;  2KT8 A;  1VQ8 Q;  2ABL A;  1OX8 A;  1K9M U;  3REB B;  2DM1 A;  2E10 A;  1VQK T;  1BYM A;  1Q82 U;  2G3R A;  2DBM A;  4VUB A;  2X4Y A;  4BI8 B;  3FLG A;  1B3Q A;  2BE7 D;  2GBQ A;  3WVD B;  3TQ7 P;  1WHK A;  4N4H A;  2KRM A;  3CCV A;  3H0F A;  3CD6 T;  1UG1 A;  1RAD B;  2M9U A;  1R8O B;  1QVP A;  3V8K A;  4M7A F;  3CME A;  3G71 T;  3L2Z A;  2DYI A;  4MZM A;  1QWE A;  1IB8 A;  4ME7 A;  1OYX A;  5D7U A;  1CKB A;  5CCA A;  1RI9 A;  1K8A R;  1JU5 C;  5CKE A;  3L2V A;  3CCM T;  3FIF A;  4JRP A;  5CVI A;  1LPL A;  3THK A;  4M4Z A;  5J39 A;  1VQ9 T;  2R5A A;  4DOV A;  5A0D A;  1JB0 E;  1WHL A;  3CCU T;  1YJN Q;  3R6N A;  3IQL A;  1OQK A;  1QWF A;  2RMO A;  4DEY A;  5GAO m;  2DBK A;  3OSS C;  4OP0 A;  2RQV A;  1YHQ Q;  4IUV A;  4MDW A;  4OB3 B;  2LC4 A;  4ZTF A;  1N8R U;  2LDM A;  3RMS A;  5GAM g;  3G1J A;  4ANJ A;  4BB7 A;  4Q5W A;  1M4Z A;  1I07 A;  4PJO B;  2FPD A;  3OYE A;  3QYH B;  2OI3 A;  2CGH A;  1WXT A;  1WX6 A;  3JB9 I;  3I56 T;  2HZY A;  1QLY A;  2JZ2 A;  1KQ2 A;  1BI0 A;  2M0Y A;  1UTI A;  2KAF A;  2ED0 A;  2PVG B;  2QXF A;  3PNW C;  5KYU A;  2VKN A;  3M58 A;  2D8H A;  2EYY A;  5GAN f;  3SDZ A;  4LDU A;  4LD6 A;  4FU6 A;  2DL7 A;  3J81 E;  2AKK A;  3M0T A;  3PT9 A;  2DRM A;  4J9I A;  1IHW A;  2Z0W A;  4M78 F;  2RJE A;  2E12 A;  4L59 A;  1PCX A;  2JM9 A;  1KC8 C;  1XJW B;  1VA7 A;  1Q82 R;  4PL6 A;  3MPU B;  4C0Z A;  2DX1 A;  3SEM A;  2CZ0 B;  1D0X A;  2DTO A;  1WIE A;  3OYI A;  1M3C A;  2X3W D;  4PKC C;  2HBW A;  3TSZ A;  3M59 A;  1MGQ A;  2EKO A;  2VXE A;  4J9C A;  1LJO A;  2ZPH B;  3OB9 A;  3A5Z B;  3KXT A;  1JJ2 A;  2FPF A;  4M7D G;  3I5S A;  1SPK A;  2LJ1 A;  4PJJ A;  1VQL A;  1KD1 U;  2KBT A;  4A53 A;  4PJO C;  1AWX A;  5GAN 8;  4FYX B;  3X28 B;  4OVA A;  4F17 A;  4RTV A;  4IIM A;  2E64 A;  2EYQ A;  1ZSZ C;  2HCK A;  1XNI A;  2RQT A;  5C6S A;  4J7I A;  1U06 A;  3I55 Q;  2AHJ B;  1K8A C;  2V1R A;  3VV0 A;  4BY6 B;  1QVF S;  3GPL A;  2JMA A;  2L8D A;  3MP6 A;  2KVQ G;  1D0Z A;  1WXU A;  2BZY A;  3GOX A;  1KHC A;  4OMF B;  2FPE A;  2DD5 A;  3CXC P;  1X01 A;  3OBW A;  4DQ2 A;  2EBP A;  4E7J A;  3ASK A;  4GY5 A;  4AFS C;  2A08 A;  3CC2 Q;  2EGC A;  4OB0 B;  4JDS A;  1QCO A;  2M0O A;  2ZPE B;  4QVC A;  4PLL A;  1KIK A;  3T9N A;  1N8R R;  4RTX A;  2ENM A;  1OZ2 A;  5FRO A;  4JRQ A;  2ROL A;  1QKW A;  1QVG A;  2IG0 A;  3G7Z A;  3FRN A;  2YUO A;  1YHQ T;  1U5S A;  3OSV A;  2RHU A;  2E6N A;  3GBQ A;  3C94 A;  1S72 A;  5GMK j;  1OPK A;  3L2Q A;  2CYZ B;  3OW2 A;  3TSW A;  1TWB A;  2PTK A;  1O9S A;  2I0N A;  4M77 G;  4XQ3 A;  5DM7 R;  1RLP C;  4RCB A;  2OAW A;  4RMO A;  1VQ6 Q;  1ZUY A;  2KNB B;  5HCK A;  2NUP B;  1VQ8 T;  1I5L A;  4QVZ A;  1I81 A;  4C0G A;  3M57 A;  2KXC A;  1VQK Q;  3OYF A;  2LX9 A;  3VJP A;  3V7R A;  5GAN 3;  3E9F A;  1WQ7 A;  4M77 E;  2J6K A;  2KDS A;  1XTD A;  2B86 A;  2P84 A;  1UFF A;  3MJX A;  4AFZ C;  4M75 B;  1TH7 A;  4OB2 B;  4M78 D;  8AT1 B;  5DLO A;  1M90 R;  3RER A;  4PJO G;  2RHY A;  2W10 A;  2ZGW A;  4E7K A;  2EYX A;  2KSS A;  4F7U F;  3CCV Q;  2M51 A;  3H41 A;  4EIK A;  2YUP A;  2Y4Y A;  4RTZ A;  1KD1 R;  2CDT A;  3QO3 A;  3A8M B;  2COZ A;  2DJZ A;  7AT1 B;  1PRL C;  3CC2 A;  2EQK A;  2HEQ A;  1UGS B;  4HT9 A;  4N4I A;  2GFU A;  4EMK A;  4II1 A;  2JTM A;  1RAC B;  4Z8A A;  5D6X A;  3MEV A;  2GTJ A;  2MOX A;  3CEY A;  2E4H A;  5HY6 A;  4C5I A;  1TUC A;  1YIJ T;  4P5N A;  5LJ5 h;  5J3B A;  4Z88 A;  2E5Q A;  2OTL Q;  3V7S A;  4HCB A;  1AZE A;  3HP9 A;  4Z02 A;  1J3T A;  4JJC A;  4M7D A;  3VUB A;  1IXD A;  1S1N A;  2O31 A;  1IRE B;  3UT1 A;  3CCU Q;  4PFZ A;  1TTH B;  1OEB A;  4MZP A;  4LUE A;  5IHN A;  4M7A E;  4PJO F;  3TVT A;  2K7A A;  3VUZ A;  2L3Q A;  4M77 C;  4F04 B;  3OYM A;  2EYW A;  1K0S A;  1SEM A;  1IRX A;  3CPW A;  3JCM P;  2OJ2 A;  4F14 A;  3QZ9 B;  3CCS Q;  2DKG A;  2BUD A;  1Q86 R;  2EAY A;  1GBR A;  1BB9 A;  4M7A G;  3E19 A;  3LW5 E;  4HCC A;  2X4W A;  2VAS A;  2QQR A;  4J9D A;  1G8X A;  2NWM A;  2F5T X;  1RAI B;  4JS4 A;  1Q7Y U;  1G83 A;  3RES A;  1D1A A;  2WSE E;  1BCM A;  2E5K A;  1QVG S;  1Y57 A;  3SWN A;  2A28 A;  1QCF A;  3VS0 A;  2A3L A; 
#chains in the Genus database with same CATH homology
 2QAS A;  1ZSZ C;  1OX9 A;  2QAZ A;  1OUL A;  1TWB A;  1OX8 A;  1YFN A;  1OU8 A;  1ZSZ B;  1ZSZ A;  1OU9 A;  2NYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...