1OX8A

Crystal structure of sspb
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
b'QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B
publication title Structural basis of degradation signal recognition by SspB, a specificity-enhancing factor for the ClpXP proteolytic machine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase activator
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ox8A00
1OU8A 1YFNA 2QAZA 1ZSZC 2QASA 1OX8A 1ZSZA 1OULA 1ZSZB 2NYSA 1TWBA 1OU9A 1OX9A
chains in the Genus database with same CATH superfamily
3JCMW 4RTWA 4DBHA 1BI1A 6AT1B 2A08A 5KYUB 5GMKm 2OJ2A 3G4SQ 4C0FA 3GIBA 4C8QE 4XU1A 2A37A 1T0HA 2R57A 1ZSZC 1YJWT 3PTAA 2KRNA 4EMKB 3CPFA 3I55A 1BIBA 1UGQB 3GOXA 2CZ7B 2RQTA 2YXYA 1C6VX 5FLXE 2PNIA 1XOVA 2KMTA 3OYGA 1RI0A 4L59A 5KE2A 4ZN1A 3THKA 2J06A 3I55T 4OMFB 4FW2A 2LT1A 1QQJA 3GNFB 1X6BA 3M55A 1WQWA 2DETA 1K73U 2RB6A 2J05A 5CQXA 1KD1R 2LX7A 5GAN8 4FYYB 1TXQA 2M0YA 2XKOC 4JS4A 1KSWA 5LJ5g 1JB0E 1FMKA 1K8AC 2FPDA 2Y90A 1GCQC 2PTKA 4PJJA 4PJOG 4PJMA 2P0PA 2XIDA 3VYHB 1VA7A 4HKEA 1M2VA 2G3RA 2MMPA 5IN1A 2CP6A 5A0DA 4XTZA 2KNBB 5I2MA 3UA7A 4DEYA 2DA9A 3CBOA 1QMCA 3CCEQ 4OMOA 4FYWB 3OBWA 1YJWQ 4LDVA 2K5IA 3QWYA 3KBGA 1PG5B 2DL3A 4C8QD 1ARKA 3REAB 3NMZC 4PKCC 1U06A 3QSUA 2RI2A 4QKUA 1TWBA 2AKLA 4E7IA 1K8AR 1BKBA 4MZTA 2JMCA 2VB6A 1I5LA 4OP0A 2NUPB 1SSHA 2EFIA 2JNGA 2ZPGB 3I55Q 5GANh 4E7JA 2CT4A 1M3BA 3T9NA 1E6HA 3M54A 1AEYA 5CQYA 3CXCP 2DD5A 5FWBA 4M75G 4F7UE 2BZ8A 2GNCA 4N4GA 3JB9D 2C06A 4C92F 2CP2A 4KGVB 3DB3A 5GAOp 1RACB 2RD1A 3LGLA 1TSFA 2EYYA 3C94A 3RDVA 1KQSA 4Z02A 1PKSA 1JXMA 1WJQA 3VYGA 3M0PA 3TVTA 5I2SA 2F5TX 1E6GA 3OSSC 1LPLA 4M7AA 3P8DA 2J6FA 3OQ5A 1QP2A 1T3SA 1SHFA 1YFNA 2F2WA 1ZLMA 1JBMA 4R55A 2LX9A 2CGHA 4F17A 1VQ8A 4FW1A 4ZGEB 2DKGA 4IUPA 1TUGB 4C0DC 2QA4A 1D0XA 2EJ9A 2JT4A 4J9FA 1VQMA 3EFSA 1I8FA 5CKBA 2R58A 5KYYA 2RI3A 2ROLA 1QKWA 4CC4B 1VQ8T 2OTJT 5D6XA 2WSCE 3URGA 5DY9A 1TUDA 4MZPA 2QA4T 2V1QA 5LJ5h 1VQMT 2EKHA 3MO8A 2HZYA 4XTXA 1OYXA 2LCCA 2EQUA 1QWFA 1GBQA 3MEAA 2IPOB 2R5AA 2ZPHB 2LMJA 3I35A 4N0AA 4D8DA 2DEQA 2EJFA 3DKMA 2RHZA 1YITA 1O75A 2DNUA 5HY6A 2QEXQ 4JRKA 4JJBA 4DBRA 4PLIA 4HVVA 3EFOA 4LD6A 1YITT 3CD6Q 5KYYB 2EYQA 2V1RA 2SEMA 1U1TA 1JJ2A 4IUVA 5FU7C 1WXTA 3REBB 2H3EB 4M77B 3TREA 1T3LA 2JTEA 1M8MA 3MP1A 2MAMA 5LJ3g 1NYFA 3HRTA 3VUZA 3NTIA 4JUVA 1PRLC 3SFMA 3SD4A 1VQ8Q 2PVGB 4OMNA 2JW4A 1E7OA 3V8LA 1KK7A 2QA4Q 1D1AA 4RG2A 2GQVA 1VQMQ 1Q86U 3EFOB 1JRIA 3O5ZA 2YDLA 3UPUA 3TQ7P 2K5LA 3D7SB 4BI8B 3H0IA 4RCCA 3A8LB 2CP5A 5FRNA 1B34B 4F14A 3CC2A 2HL3A 2EYZA 5J26A 1VYUA 3LGFA 3I9QA 2ZGWA 1IREB 2WSFE 3HTRA 3CXCS 2L3RA 4KUIA 4M77D 3INZA 4ORZA 3CC2T 2DIQA 4MMLA 5GAMg 4FYXB 2ENMA 2MK5A 5M9OA 2M16A 5GAOm 3JCMb 2DF6A 1GFCA 1NJIR 4M78F 2HNIA 4A54A 2DRKA 4XTYA 3HL8A 1RAEB 2L5QA 3FJ5A 4R56A 1SSFA 2DTHA 2FHDA 2NUZA 4ZTJA 3NHNA 1K9MU 3AHUA 1Q7YC 1KC8R 4E7LA 2OI3A 5IHKA 2XD0A 4PJOC 5GMKl 4C92A 3X28B 2DPPB 3L2RA 4EMHA 1AOJA 3TEEA 2H8HA 4JLIA 4E7SA 5CIUA 2FPEA 1RAIB 4J9GA 3CBPA 2RNAA 4RUGA 4MMKA 2DL4A 2LVMA 5GAMe 1IB8A 4UC4A 3PFSA 4MDXA 4PJOE 3VS0A 3L2UA 2VXEA 1D09B 2YRCA 4Z8AA 3MEUA 2QDLA 1OZ2A 2XMFA 1V76A 1WLPB 3PMTA 3GP8A 1AWWA 3LYIA 1W70A 2K79A 3CCMA 1Q7YR 4LE9A 2WSEE 2M02A 3H9NA 2V8JA 3CC2Q 2E64A 2VXFA 2XG8D 3KUFA 4O6JA 3PIOA 1BI0A 4M75C 1QW1A 5GMKh 4XQ3A 2CH4W 4AG2C 2EQMA 2FZGB 5J39A 1WHMA 1I0CA 2P4TA 2CP0A 5A0GA 1FMWA 3OMCA 5KCOA 2DFUA 4KH0B 2A0FB 1SRLA 3S6WA 4M7AG 2PUKB 5CCAA 2LP5A 4RTTA 3ZFJA 4C5GA 4M75E 4AG1C 2X35A 1RL2A 3RIRA 1AZEA 3RBBB 1UGRB 1T0JA 2ZPIB 4E2FB 2KSSA 3L1AA 4ZGDB 4M7DA 1HYOA 4GLMA 3VS3A 4D6WA 3JRZA 4LDWA 4RMOA 3RUXA 2LNVA 3RKWA 3MHXA 1X27A 5KE3A 3OYAA 2LCSA 1UHCA 3EGXA 4CRIA 4M75B 3U23A 3QPHA 4M77G 1PSFA 3BY7A 5KYWA 5EC7A 4LDYA 3QO3A 3JCMc 4Y28E 5CK9A 3M0RA 3V8KA 3OS2A 4ELYC 1IGUA 2AT1B 2LJ3A 4BDYA 1BYMA 1KIKA 5D6YA 3LH0A 5AT1B 4F7UF 1K0SA 4M4ZA 3CCMQ 1MNDA 1YJ9A 2LRQA 1X2QA 2OAUA 2QXFA 5FU6B 4NL2A 4E7HA 1UECA 2HBPA 1B07A 2CZ1B 1BU1A 4PFOA 1OQKA 1YI2A 2DEUA 1WGSA 1YJ9T 1Y71A 3JSCA 3META 2GBQA 4J9HA 2EKOA 2LQWA 1UEBA 1PSEA 1N8RU 4PL6A 1YIJQ 1AWOA 3BDUA 3M0SA 1YI2T 4M75D 4AFUC 3GLXA 2QQRA 2LT4A 1C0MA 2O4XA 4KGXB 3JB9J 2E12A 1JXOA 2K7AA 2ZZDA 3GNGA 4OGEA 2CSIA 1W2BA 3R6NA 1VQ7A 1ZUKA 4M78A 4IUUA 5GANg 1PCXA 3EAEA 3L2QA 2V8KA 3DB4A 4J8OA 2E3HA 5IHNA 1IHVA 1QCOA 2RF0A 4VUBA 4LXCA 1ACMB 3OS5A 3PE0A 1W4SA 2R5MA 3RMQA 1BB9A 3M59A 1D3BB 3TSZA 3CCET 2KEAA 3EG9A 1UG1A 2X4WA 1ZHIA 2SRCA 1WPYA 2ZPBB 4CC3A 2KQWA 1GL5A 1G3TA 4II1A 1UGSB 4K11A 3LW5E 1UDLA 3A8HB 5CKDA 2MI6A 3HFNA 3JCMd 4OF1A 2JTFA 3VS5A 2KYMA 1VQLQ 3CCLA 1C1AA 2XDBA 3MJXA 2HSPA 2EGCA 2DBMA 4FSSA 4AFSC 2YRVA 4HA8A 5GANe 4HVUA 1VQ4A 1YJ9Q 4BB7A 1G3YA 2LCLA 2HDAA 1ZSZA 2O9SA 1IHWA 1NG2A 8AT1B 3MCAB 2GTJA 4PK4A 4EDUA 1YI2Q 1G83A 2MIOA 3EGDA 1VQ4T 4KH1B 3HKSA 1Z9QA 3CC7A 2QGFB 2QG9B 4C92G 1X2KA 1PNJA 1GXIE 1D0YA 2KGTA 3FB9A 4E7ZA 2L3QA 4OMPA 1D1BA 2BUDA 3OB9A 2WACA 2FPFA 4YTLA 1IRXA 1NBEB 3QYGB 2D0QB 3OYMA 1MGQA 4A53A 1WIEA 4RTUA 4A4FA 3UT1A 1VQ7Q 4B9XA 2KDSA 4LUDA 2DYIA 2BZXA 4OVAA 2MOXA 1UE9A 2LC4A 4L6V5 1W1FA 1GRIA 4IIMA 5GJVB 1KFZA 3PIPA 2FYKA 2CP3A 2EGAA 3PNWC 4J6WA 4JS5A 2DJZA 3FC3A 3EGDB 1M27C 1SF9A 3JCMf 2E6ZA 2XK0A 5LJ5e 2HAXA 2OTLQ 3V7CA 4GY5A 5GAOr 5CKFA 1MV3A 2K2VA 5I22A 4J5YA 1KHIA 2CUBA 2QEXA 4FL6A 2ZAEA 1RLQC 3CCLQ 1M2VB 1S1NA 1RAGB 3CD6A 1MUZA 1R8OB 1Q86C 3PGGA 2LJ0A 1VQ4Q 3LH5A 2QEXT 1TS9A 4F7UA 3TCJA 1FX7A 1FYNA 3I5RA 2JZ2A 3P8BB 4M7AC 4FM4B 2LDMA 2HCKA 1FMVA 3CD6T 4GBQA 2G6FX 2RQWA 3QXEB 3L2VA 3CC7Q 4HCCA 5GAMj 3CMAQ 1K4US 3QJ6A 3BE3A 4A4KA 1AZGB 2AK5A 3OYKA 3OYLA 5CO7A 1KD1U 1M1KU 9ATCB 2JXBA 5A0LA 3WVDB 3C12A 1M4ZA 4HT9A 1OZ3A 1H3ZA 1MMGA 1WHGA 3LLRA 4BD3A 2VGMA 2BE7D 1G5VA 1Q86R 2P0KA 5IT9E 1VQOA 2DXBA 3UF4A 3EH2A 3S3NA 2HKQB 1K9MC 3OW2P 4M77C 3MPUB 2BE9B 3O8VA 3SEMA 3UATA 1WX6A 2F2VA 1VQOT 2VYTA 5GAOn 5HCKA 1WDXA 1ABQA 1X6GA 3OY9A 3LWHA 4X1VA 1ZA2B 4M7AB 2DX1A 2ABLA 3JB9I 4BI4A 2MWPA 2NYSA 1WI7A 2FRYA 3QYHB 4AMCA 3S3MA 1LOJA 1D0ZA 4M77E 3HPWA 2KT8A 4BI3A 4OB0B 2QQSA 3M4GA 3S3OA 3UDCA 3QG1A 1OOTA 2P84A 3I56A 1UJYA 2M1HA 4IIOA 3HSBA 4M7DF 1K9MR 1VQ9A 4KULA 2E6NA 2L2PA 1I07A 2V26A 4M78G 2QYZA 4LD9K 3I56T 1BI3A 1XJWB 2FVUA 4OB2B 4DEXA 3RNJA 4FSXA 2LQ8A 2MPXC 3RR6A 1VQ9T 3OSVA 3V7SA 1RI9A 3M0QA 1H8KA 4M7AD 4XAXB 2FEIA 1TTHB 3TSWA 4HXJA 1JO8A 2E10A 2K5FA 2EQJA 1UB4A 2L3SA 3MKDA 1ZUYA 2JM8A 2PU9B 4NOYA 1VOMA 5LJ5f 2DXUA 2JM9A 1NJIC 2KRMA 3CC4Q 2AZVA 1VQOQ 1A0NB 3RMSA 1EZZB 1M5Q1 1YBYA 2NUTA 1KQ2A 1KC8C 1QCFA 2EYXA 2M51A 1K1ZA 2QASA 2D1XA 3PT9A 1M90U 1NEGA 3G6EA 3CPWP 1KHCA 1R77A 4QW2A 4J6YA 1HK9A 4JLGA 1IXDA 5L23A 3FLGA 4PJLA 4OMMA 2VGNA 3CMEA 2DTOA 5LJ3e 3X24B 4MZMA 3G6ET 5GMKe 3JCMP 2EAYA 2FL7A 3HRUA 2RI5A 2DZCA 3C4SA 2D9TA 1FWZA 2CSQA 3G71A 3PVLA 4Y92A 4LUEA 3QKJA 1JU5C 1X75C 4RTVA 3I56Q 3CMET 3VUBA 2X3WD 2X3XD 5IXFA 4PLLA 2V8IA 1PC0A 4RKUE 1VQ9Q 2JVVA 2GQIA 1CSKA 2NUTB 2RH2A 2HMAA 1AT1B 3G71T 1KQ1A 4P5NA 2HKNA 2RQUA 2DL5A 4PFPA 4JJDA 1UGVA 5HKCA 3F70A 2A7YA 2EJGA 1DJ7B 4KRTA 4X9DA 2J6OA 4C8QF 1K0XA 2GFAA 1SHGA 3QUIA 2VVKA 3BW1A 3EFRA 3P8HA 1G2BA 1B3QA 1WXBA 3OW2S 5GAN7 4OMLA 3OMGA 2CS7A 1VQNA 1NZ9A 4PJOA 3QDRB 2IIMA 2JS2A 1AVZC 2E3IA 3G1JA 4J9IA 2ESWA 3FRNA 1Q81U 1YNZA 1G3SA 1SEMA 3H8ZA 2XICA 1AHJB 1BCOA 1HD3A 3QWXX 4C92B 4ANJA 3CXCA 3JB9F 5DLQE 2RPNA 2L0AA 3EHRA 3G6EQ 3CCMT 4F7UG 3CQTA 2A3LA 3CBMA 2KR3A 1Y96A 2XHCA 1Q82U 4ELZC 3OYJA 1YIJA 1N8RR 3CMEQ 1NEBA 3M9QA 4PJNA 3LX7A 2MF2A 3QDFA 2YRDA 1SRMA 3HRSA 2JTMA 4O5VA 2RQVA 4EIKA 3G71Q 1YIJT 5FU6C 5GAN5 2COZA 1HJDA 1OULA 1U3OA 2L3PA 2EW3A 1WJRA 4J9BA 2ED0A 2B8AA 1G8XA 2DK3A 1XNIA 4XU0A 2P4RA 5GAMd 5GAN2 3UWNA 3MP6A 1WQ7A 3OS0A 1K73C 2VUBA 1M1FA 3BFMA 3A1PA 5GAN3 4C92D 4AT1B 1KQSP 1VYTA 2GCXA 3L2ZA 4QT7A 5LJ5j 3A8OB 2OAWA 2I0NA 4A4GA 3VS1A 4RTZA 1WYXA 3SWNA 2W10A 2EPDA 4PNOA 1OPLA 1RUWA 2M0OA 4XK8E 2W0ZA 4WTOB 2DERA 1PWTA 1I1JA 2BZYA 2AZSA 1MNEA 2QTXA 1JEGA 1VQNQ 2KI7A 1BK2A 3WXMB 1VQLA 5LJ3f 5GAOq 2HSEB 4JZ4A 2K9GA 2DJQA 3CPWS 4FCYA 1LNXA 2KK4A 4DOVA 2MYSA 2RJEA 3RKYA 5J3BA 3HP9A 2RJFA 1WXUA 4FIBA 1K73R 1VQLT 2BKDN 4M7DB 1UGPB 2RM4A 3VS4A 1FXXA 4A4EA 5FWCA 4HCKA 2A36A 3JCMJ 3LWIA 4PFZA 1BBZA 2HQXA 2ZCFB 3EGXB 2YUOA 4M78C 3FIFA 5KYNA 3E1SA 4J9CA 2DVJA 2X4JA 1D1CA 5KYWB 4RCBA 4D8KA 1WHLA 5GAMf 2E5QA 1OI1A 2DE0X 3EG0A 1N27A 1WFWA 1VQ5A 1HSQA 3I5SA 4EMKA 2XDPA 4LDXA 2DIGA 4CC2A 1N5ZA 3QIIA 5FRMA 2RQRA 2C0OA 1NLOC 2DTIA 4N4HA 4KGZB 2EIFA 3OS1A 1JJ2P 1IO6A 3EGUA 1VQ7T 4M7DD 3DLLA 4KUDK 5KCHA 3VRZA 3ME9A 1VQ5T 1SPKA 2EQKA 3E2UA 1QCNA 2VWFA 3PMIA 2CUDA 3C95A 1MHNA 2K2MA 2OTLA 2O9VA 2QQBA 3X26B 4NL3A 3A8GB 3M4YA 1NE8A 4C8QA 4XU2A 1M1KC 5CAIA 1VUBA 4RTYA 3JCMV 2DD4A 2O4XB 3CPWA 2LNHB 2YSQA 2O88A 5CKHA 2OTLT 3GBQA 3VJPA 4M78B 3CCVA 2QK0A 2ZPFB 1IZ6A 3CCLT 1QVGP 5CKEA 2J7IA 2K3YA 1ZX6A 2RN8A 4ZN3A 2IVWA 1BIAA 1YCYA 1NPRA 3CCVT 3JB9H 4DQ2A 4XU3A 3JCMh 1VQ6A 3CMAA 3EG9B 2LQKA 2D0NA 2HEQA 1RABB 1CKAA 3ZL7C 1AWJA 1M1KR 1CKBA 4Q5WA 4C8QB 2K4YA 1NLPC 3CC7T 1VQ6T 3CMAT 5GJWB 2X51A 4B9WA 3A98A 1KQSS 2D8JA 2VC8A 4BY6B 3ZBDA 3VS2A 3G7ZA 2AHJB 2RJDA 2NUPA 2QDYB 3E19A 4M78D 1VQ5Q 2DO3A 5GMKi 2E65A 2EBPA 1SKUB 4EMGA 2DBKA 5DLOA 2LQNA 1RLPC 3IQLA 1UFFA 3M57A 3CCRA 4HCBA 1ZSZB 2QI2A 1GCQA 3RKXA 1TG0A 3SDZA 1MV0B 5LJ3j 5GAOl 2FZKB 3CEYA 2DXCA 4MDWA 5EG2A 5GMKj 1VQPA 5GANd 4OGCA 4BDZA 4HT8A 3M5AA 5IH2A 1QWEA 3BDLA 3CCRT 1YCSB 2YHTA 2KAFA 1H92A 2EYWA 4QVDA 4BE0A 2KRSA 2DL7A 3J81E 2RHYA 4IUQA 1ABOA 1VQPT 2COWA 1K9AA 1PM3A 2KROA 3VRYA 2O31A 4GLKA 2FZCB 4C5EA 3OYBA 3CCVQ 2GGRA 3ER0A 2CDTA 1MMNA 4JRIA 1QLYA 3H0FA 1VYVA 4KT0E 3JCMQ 3GF5A 5DM7R 4JDSA 3ZEHA 2QQAA 2L8DA 1N6AA 4R0KA 2CKKA 1PD0A 4WF2A 1X43A 1M90C 1TH7A 2RA2A 5L8RE 1VQ6Q 4OMQA 3X20B 2YUNA 5IHIA 4M7DG 2KXCA 1VIEA 1G3WA 3OYFA 2YWWA 4L5GA 2DMOA 4CI0C 1I5OB 2VV5A 2DAQA 1YJNA 2OX7A 3OBYA 2VASA 2JS0A 4PJOF 4M7AE 3M0TA 1JJ2S 1RAAB 3OYCA 2HQEA 1OX9A 1H3HA 2QAZA 3CC4A 1WHHA 4DBQA 4CC7A 4DA4A 2EVRA 4V2SA 1YJNT 3OYDA 1Z9ZA 5LJ5d 4JZ3A 2O2OA 3A5ZB 2CREA 1EIFA 1M3CA 4A63B 4F7UB 2JJ9A 4JJNK 2OTJA 2NWMA 5GANf 3CC4T 2DRMA 3CCRQ 4N0AC 1PKTA 1M90R 3MP8A 1YP5A 1M8VA 1R0BG 3EG1A 3CCQA 2ECZA 4B6MA 1QP3A 1UJ0A 5GAN6 1VQPQ 3M58A 3NPFA 1H641 2XU8A 4BUGA 1X6OA 4HCZA 1OX8A 2KBTA 3R6OA 4FT4A 1P92A 2H3JA 1Y0MA 1M9SA 2GTOA 1AD5A 3AT1B 2VKNA 1QVGS 1UTIA 2XDDA 4J83A 1M2OA 3CCQT 2DXTA 1ZBXA 4M77A 5KYXA 1KG1A 2K57A 5C0MA 3OYYA 2MCNA 1ZA1B 1K8AU 4M75F 3M56A 7AT1B 2AIRB 1J3TA 4X9CA 2AKKA 2LTOA 2COYA 2F69A 3QJYA 3VKIA 1YWOA 2F2XA 1VIFA 2DVEA 5IXBA 1WZOA 1V29B 1Q81C 4FYVB 1GCPA 2FRWA 3NGPA 4LNPA 5A2QE 1N9RA 4Z88A 3NTKA 2YUQA 4C0ZA 2CZ6B 4ZGJB 1B34A 1Q82C 1Y07A 4C0DB 1N9SA 2GF7A 1WA7A 1QKXA 1SG5A 4C5HA 4IKFA 5AYFA 1YJNQ 2D6FA 1RADB 1WJSA 2CT3A 2DILA 1I81A 1OU9A 1ZQ1A 5KYXB 2EQIA 1W2BP 2YLBA 3E9FA 4C8QG 3CCJA 2F5KA 1U1SA 5D6WA 2HL5C 2CYZB 3M0UA 1WHJA 1Q81R 3WVEB 5D7UA 2OTJQ 3HHTB 1QVFP 2DLPA 1WHKA 5FW9A 4JRPA 3CCJT 2IG0A 1ZSGA 1QVPA 2PUOB 1TOVA 2RHIA 2PZ1A 3CCQQ 2E70A 1Q82R 4ATOA 2YLCA 4Z89A 2KXDA 2L89A 2P0QA 5KH6A 3C0CA 3VU3C 4C5IA 2D8HA 2FB7A 1QVGA 3ULRB 3KXTA 3JB9G 1TU0B 1NM7A 1ZBJA 1NPPA 2YT6A 2HQHA 3KFVA 4BE1A 4C0GA 1JQQA 3EG2A 5I21A 1GFDA 2BTTA 4C92C 1KJWA 1YITQ 1NYGA 2HBWA 5FU7B 2JUFA 2RK2A 3NFCA 3FJPA 2QTVA 4Y91A 1UHFA 1LCKA 1U8RA 1IGQA 2DL8A 2XI9A 3UA6A 2Y4XA 2LJ1A 4C92E 3A8MB 1OPKA 2FO0A 2RO0A 1N8RC 3FEOA 1LVKA 2FG0A 2PVOB 1TUCA 2JN0A 2KT1A 4OB1B 1F1BB 2BIVA 1XQHA 2JOYA 1PHTA 3CCSA 5GANj 3ASKA 4RTXA 1OV3A 2X4YA 1M30A 3CCJQ 4F04B 4QQ6A 4QQDA 5C6SA 1I4K1 3VS7A 1O9SA 4RG8A 2ZPEB 3CCST 1VQNT 3GPLA 2JMAA 5LJ3d 1K76A 5CVIA 3H6ZA 4J7FA 1BI2A 2RHXA 2K6DA 3PVQA 2X9HA 4ME7A 3L42A 1M1GA 4LN2A 3X25B 4DOWA 4ESRA 8ATCB 2RHUA 1EX4A 3CCUA 1X69A 2CZ0B 1YHQA 3QBYA 3JCMX 2KYBA 1VQKA 4XTWA 4WCIA 2B86A 2EWNA 3J7AF 3V7RA 3MEWA 4AFZC 1YN8A 1YWPA 5HK0A 1OU8A 1MMAA 5ECAA 5GAN4 2RJCA 5LJ3h 3CCUT 3JAME 5I11A 1YHQT 1WNLA 1VQKT 2I2LA 4PJOB 1PD1A 2ROTA 5CR2A 2RMOA 3EG3A 5LL6S 4M7DC 4HVWA 2E1HA 4E47A 3SHWA 4M75A 4J9DA 2EGEA 1U5SA 2Z0WA 3E9GA 2C0TA 3FDRA 3EH1A 3QZ9B 3OYHA 4J9EA 4KBMB 1NJIU 1UUEA 3QHSA 4QVCA 3SWNC 2O01E 3MEVA 5FROA 2CH4A 4QVZA 4XTVA 2A28A 1X01A 5IAYA 1S72A 1W2BS 1Y96B 4FU6A 4M7DE 5HK3A 2M9UA 2X4XA 1KC8U 2RK1A 4IURA 3OW2A 4J7IA 1Q95G 3JCMg 4XTUA 4E7KA 3VS6A 2J6KA 5GAMh 3CCSQ 1QVFS 2QQ9A 3HFOA 1S72T 4TVRA 4OB3B 1BCMA 2F1LA 3G4SA 2NLUA 4PJOD 1R0CB 4JJCA 1Y7XA 2ATCB 1AWXA 2YUPA 4IUTA 1W6XA 2MWOA 4X34A 2E5KA 4ZNXA 3VV0A 4ZTFA 3QZ5B 3L2WA 3N5BB 4BACA 3G4ST 3Q1JA 2DZ9A 1M3AA 1PRMC 1RAFB 1XTDA 1Y57A 1RAHB 3JV3A 1V1CA 4N4IA 4A4HA 3CCUQ 1GBRA 3OYNA 2ED1A 1YHQQ 1Q7YU 3SWNB 4LDUA 1VQKQ 4BE2A 1MMDA 1EFNA 4EPCA 2PQWA 3J80E 2KE9A 3NTHA 3DLMA 3JCMe 4M7AF 2LZ6B 1D3BA 4JPBW 5KYUA 4E6RA 3H0HA 4EMKC 2HD0A 4DBFA 1OEBA 4NS5A 2DYBA 3EHQA 2QGGA 3OYEA 2GFUA 3H41A 3RERA 3RESA 4AFQC 3M53A 1LJOA 4JRQA 3V8JA 4M78E 4J6XA 4F16A 2E4HA 3OYIA 3TU4K 2Y4YA 4C8QC 4FT2A 1S72Q 3SB2A 2KVQG 2E41A 3CCEA 2K3BA 1ZUUA 4QQGA 2K3XA 1B7TA 2DM1A 2KY9A 2CP7A 1QVFA 4BY6C 2C0IA 2PVDB 1HXDA 1YJWA 1KD1C 4M77F 3OA6A
chains in the Genus database with same CATH topology
1OU8A 1YFNA 2QAZA 1ZSZC 2QASA 1OX8A 1ZSZA 1OULA 1ZSZB 2NYSA 1TWBA 1OU9A 1OX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OU8 A;  1YFN A;  2QAZ A;  1ZSZ C;  2QAS A;  1OX8 A;  1ZSZ A;  1OUL A;  1ZSZ B;  2NYS A;  1TWB A;  1OU9 A;  1OX9 A; 
#chains in the Genus database with same CATH topology
 3JCM W;  4RTW A;  4DBH A;  1BI1 A;  6AT1 B;  2A08 A;  5KYU B;  5GMK m;  2OJ2 A;  3G4S Q;  4C0F A;  3GIB A;  4C8Q E;  4XU1 A;  2A37 A;  1T0H A;  2R57 A;  1ZSZ C;  1YJW T;  3PTA A;  2KRN A;  4EMK B;  3CPF A;  3I55 A;  1BIB A;  1UGQ B;  3GOX A;  2CZ7 B;  2RQT A;  2YXY A;  1C6V X;  5FLX E;  2PNI A;  1XOV A;  2KMT A;  3OYG A;  1RI0 A;  4L59 A;  5KE2 A;  4ZN1 A;  3THK A;  2J06 A;  3I55 T;  4OMF B;  4FW2 A;  2LT1 A;  1QQJ A;  3GNF B;  1X6B A;  3M55 A;  1WQW A;  2DET A;  1K73 U;  2RB6 A;  2J05 A;  5CQX A;  1KD1 R;  2LX7 A;  5GAN 8;  4FYY B;  1TXQ A;  2M0Y A;  2XKO C;  4JS4 A;  1KSW A;  5LJ5 g;  1JB0 E;  1FMK A;  1K8A C;  2FPD A;  2Y90 A;  1GCQ C;  2PTK A;  4PJJ A;  4PJO G;  4PJM A;  2P0P A;  2XID A;  3VYH B;  1VA7 A;  4HKE A;  1M2V A;  2G3R A;  2MMP A;  5IN1 A;  2CP6 A;  5A0D A;  4XTZ A;  2KNB B;  5I2M A;  3UA7 A;  4DEY A;  2DA9 A;  3CBO A;  1QMC A;  3CCE Q;  4OMO A;  4FYW B;  3OBW A;  1YJW Q;  4LDV A;  2K5I A;  3QWY A;  3KBG A;  1PG5 B;  2DL3 A;  4C8Q D;  1ARK A;  3REA B;  3NMZ C;  4PKC C;  1U06 A;  3QSU A;  2RI2 A;  4QKU A;  1TWB A;  2AKL A;  4E7I A;  1K8A R;  1BKB A;  4MZT A;  2JMC A;  2VB6 A;  1I5L A;  4OP0 A;  2NUP B;  1SSH A;  2EFI A;  2JNG A;  2ZPG B;  3I55 Q;  5GAN h;  4E7J A;  2CT4 A;  1M3B A;  3T9N A;  1E6H A;  3M54 A;  1AEY A;  5CQY A;  3CXC P;  2DD5 A;  5FWB A;  4M75 G;  4F7U E;  2BZ8 A;  2GNC A;  4N4G A;  3JB9 D;  2C06 A;  4C92 F;  2CP2 A;  4KGV B;  3DB3 A;  5GAO p;  1RAC B;  2RD1 A;  3LGL A;  1TSF A;  2EYY A;  3C94 A;  3RDV A;  1KQS A;  4Z02 A;  1PKS A;  1JXM A;  1WJQ A;  3VYG A;  3M0P A;  3TVT A;  5I2S A;  2F5T X;  1E6G A;  3OSS C;  1LPL A;  4M7A A;  3P8D A;  2J6F A;  3OQ5 A;  1QP2 A;  1T3S A;  1SHF A;  1YFN A;  2F2W A;  1ZLM A;  1JBM A;  4R55 A;  2LX9 A;  2CGH A;  4F17 A;  1VQ8 A;  4FW1 A;  4ZGE B;  2DKG A;  4IUP A;  1TUG B;  4C0D C;  2QA4 A;  1D0X A;  2EJ9 A;  2JT4 A;  4J9F A;  1VQM A;  3EFS A;  1I8F A;  5CKB A;  2R58 A;  5KYY A;  2RI3 A;  2ROL A;  1QKW A;  4CC4 B;  1VQ8 T;  2OTJ T;  5D6X A;  2WSC E;  3URG A;  5DY9 A;  1TUD A;  4MZP A;  2QA4 T;  2V1Q A;  5LJ5 h;  1VQM T;  2EKH A;  3MO8 A;  2HZY A;  4XTX A;  1OYX A;  2LCC A;  2EQU A;  1QWF A;  1GBQ A;  3MEA A;  2IPO B;  2R5A A;  2ZPH B;  2LMJ A;  3I35 A;  4N0A A;  4D8D A;  2DEQ A;  2EJF A;  3DKM A;  2RHZ A;  1YIT A;  1O75 A;  2DNU A;  5HY6 A;  2QEX Q;  4JRK A;  4JJB A;  4DBR A;  4PLI A;  4HVV A;  3EFO A;  4LD6 A;  1YIT T;  3CD6 Q;  5KYY B;  2EYQ A;  2V1R A;  2SEM A;  1U1T A;  1JJ2 A;  4IUV A;  5FU7 C;  1WXT A;  3REB B;  2H3E B;  4M77 B;  3TRE A;  1T3L A;  2JTE A;  1M8M A;  3MP1 A;  2MAM A;  5LJ3 g;  1NYF A;  3HRT A;  3VUZ A;  3NTI A;  4JUV A;  1PRL C;  3SFM A;  3SD4 A;  1VQ8 Q;  2PVG B;  4OMN A;  2JW4 A;  1E7O A;  3V8L A;  1KK7 A;  2QA4 Q;  1D1A A;  4RG2 A;  2GQV A;  1VQM Q;  1Q86 U;  3EFO B;  1JRI A;  3O5Z A;  2YDL A;  3UPU A;  3TQ7 P;  2K5L A;  3D7S B;  4BI8 B;  3H0I A;  4RCC A;  3A8L B;  2CP5 A;  5FRN A;  1B34 B;  4F14 A;  3CC2 A;  2HL3 A;  2EYZ A;  5J26 A;  1VYU A;  3LGF A;  3I9Q A;  2ZGW A;  1IRE B;  2WSF E;  3HTR A;  3CXC S;  2L3R A;  4KUI A;  4M77 D;  3INZ A;  4ORZ A;  3CC2 T;  2DIQ A;  4MML A;  5GAM g;  4FYX B;  2ENM A;  2MK5 A;  5M9O A;  2M16 A;  5GAO m;  3JCM b;  2DF6 A;  1GFC A;  1NJI R;  4M78 F;  2HNI A;  4A54 A;  2DRK A;  4XTY A;  3HL8 A;  1RAE B;  2L5Q A;  3FJ5 A;  4R56 A;  1SSF A;  2DTH A;  2FHD A;  2NUZ A;  4ZTJ A;  3NHN A;  1K9M U;  3AHU A;  1Q7Y C;  1KC8 R;  4E7L A;  2OI3 A;  5IHK A;  2XD0 A;  4PJO C;  5GMK l;  4C92 A;  3X28 B;  2DPP B;  3L2R A;  4EMH A;  1AOJ A;  3TEE A;  2H8H A;  4JLI A;  4E7S A;  5CIU A;  2FPE A;  1RAI B;  4J9G A;  3CBP A;  2RNA A;  4RUG A;  4MMK A;  2DL4 A;  2LVM A;  5GAM e;  1IB8 A;  4UC4 A;  3PFS A;  4MDX A;  4PJO E;  3VS0 A;  3L2U A;  2VXE A;  1D09 B;  2YRC A;  4Z8A A;  3MEU A;  2QDL A;  1OZ2 A;  2XMF A;  1V76 A;  1WLP B;  3PMT A;  3GP8 A;  1AWW A;  3LYI A;  1W70 A;  2K79 A;  3CCM A;  1Q7Y R;  4LE9 A;  2WSE E;  2M02 A;  3H9N A;  2V8J A;  3CC2 Q;  2E64 A;  2VXF A;  2XG8 D;  3KUF A;  4O6J A;  3PIO A;  1BI0 A;  4M75 C;  1QW1 A;  5GMK h;  4XQ3 A;  2CH4 W;  4AG2 C;  2EQM A;  2FZG B;  5J39 A;  1WHM A;  1I0C A;  2P4T A;  2CP0 A;  5A0G A;  1FMW A;  3OMC A;  5KCO A;  2DFU A;  4KH0 B;  2A0F B;  1SRL A;  3S6W A;  4M7A G;  2PUK B;  5CCA A;  2LP5 A;  4RTT A;  3ZFJ A;  4C5G A;  4M75 E;  4AG1 C;  2X35 A;  1RL2 A;  3RIR A;  1AZE A;  3RBB B;  1UGR B;  1T0J A;  2ZPI B;  4E2F B;  2KSS A;  3L1A A;  4ZGD B;  4M7D A;  1HYO A;  4GLM A;  3VS3 A;  4D6W A;  3JRZ A;  4LDW A;  4RMO A;  3RUX A;  2LNV A;  3RKW A;  3MHX A;  1X27 A;  5KE3 A;  3OYA A;  2LCS A;  1UHC A;  3EGX A;  4CRI A;  4M75 B;  3U23 A;  3QPH A;  4M77 G;  1PSF A;  3BY7 A;  5KYW A;  5EC7 A;  4LDY A;  3QO3 A;  3JCM c;  4Y28 E;  5CK9 A;  3M0R A;  3V8K A;  3OS2 A;  4ELY C;  1IGU A;  2AT1 B;  2LJ3 A;  4BDY A;  1BYM A;  1KIK A;  5D6Y A;  3LH0 A;  5AT1 B;  4F7U F;  1K0S A;  4M4Z A;  3CCM Q;  1MND A;  1YJ9 A;  2LRQ A;  1X2Q A;  2OAU A;  2QXF A;  5FU6 B;  4NL2 A;  4E7H A;  1UEC A;  2HBP A;  1B07 A;  2CZ1 B;  1BU1 A;  4PFO A;  1OQK A;  1YI2 A;  2DEU A;  1WGS A;  1YJ9 T;  1Y71 A;  3JSC A;  3MET A;  2GBQ A;  4J9H A;  2EKO A;  2LQW A;  1UEB A;  1PSE A;  1N8R U;  4PL6 A;  1YIJ Q;  1AWO A;  3BDU A;  3M0S A;  1YI2 T;  4M75 D;  4AFU C;  3GLX A;  2QQR A;  2LT4 A;  1C0M A;  2O4X A;  4KGX B;  3JB9 J;  2E12 A;  1JXO A;  2K7A A;  2ZZD A;  3GNG A;  4OGE A;  2CSI A;  1W2B A;  3R6N A;  1VQ7 A;  1ZUK A;  4M78 A;  4IUU A;  5GAN g;  1PCX A;  3EAE A;  3L2Q A;  2V8K A;  3DB4 A;  4J8O A;  2E3H A;  5IHN A;  1IHV A;  1QCO A;  2RF0 A;  4VUB A;  4LXC A;  1ACM B;  3OS5 A;  3PE0 A;  1W4S A;  2R5M A;  3RMQ A;  1BB9 A;  3M59 A;  1D3B B;  3TSZ A;  3CCE T;  2KEA A;  3EG9 A;  1UG1 A;  2X4W A;  1ZHI A;  2SRC A;  1WPY A;  2ZPB B;  4CC3 A;  2KQW A;  1GL5 A;  1G3T A;  4II1 A;  1UGS B;  4K11 A;  3LW5 E;  1UDL A;  3A8H B;  5CKD A;  2MI6 A;  3HFN A;  3JCM d;  4OF1 A;  2JTF A;  3VS5 A;  2KYM A;  1VQL Q;  3CCL A;  1C1A A;  2XDB A;  3MJX A;  2HSP A;  2EGC A;  2DBM A;  4FSS A;  4AFS C;  2YRV A;  4HA8 A;  5GAN e;  4HVU A;  1VQ4 A;  1YJ9 Q;  4BB7 A;  1G3Y A;  2LCL A;  2HDA A;  1ZSZ A;  2O9S A;  1IHW A;  1NG2 A;  8AT1 B;  3MCA B;  2GTJ A;  4PK4 A;  4EDU A;  1YI2 Q;  1G83 A;  2MIO A;  3EGD A;  1VQ4 T;  4KH1 B;  3HKS A;  1Z9Q A;  3CC7 A;  2QGF B;  2QG9 B;  4C92 G;  1X2K A;  1PNJ A;  1GXI E;  1D0Y A;  2KGT A;  3FB9 A;  4E7Z A;  2L3Q A;  4OMP A;  1D1B A;  2BUD A;  3OB9 A;  2WAC A;  2FPF A;  4YTL A;  1IRX A;  1NBE B;  3QYG B;  2D0Q B;  3OYM A;  1MGQ A;  4A53 A;  1WIE A;  4RTU A;  4A4F A;  3UT1 A;  1VQ7 Q;  4B9X A;  2KDS A;  4LUD A;  2DYI A;  2BZX A;  4OVA A;  2MOX A;  1UE9 A;  2LC4 A;  4L6V 5;  1W1F A;  1GRI A;  4IIM A;  5GJV B;  1KFZ A;  3PIP A;  2FYK A;  2CP3 A;  2EGA A;  3PNW C;  4J6W A;  4JS5 A;  2DJZ A;  3FC3 A;  3EGD B;  1M27 C;  1SF9 A;  3JCM f;  2E6Z A;  2XK0 A;  5LJ5 e;  2HAX A;  2OTL Q;  3V7C A;  4GY5 A;  5GAO r;  5CKF A;  1MV3 A;  2K2V A;  5I22 A;  4J5Y A;  1KHI A;  2CUB A;  2QEX A;  4FL6 A;  2ZAE A;  1RLQ C;  3CCL Q;  1M2V B;  1S1N A;  1RAG B;  3CD6 A;  1MUZ A;  1R8O B;  1Q86 C;  3PGG A;  2LJ0 A;  1VQ4 Q;  3LH5 A;  2QEX T;  1TS9 A;  4F7U A;  3TCJ A;  1FX7 A;  1FYN A;  3I5R A;  2JZ2 A;  3P8B B;  4M7A C;  4FM4 B;  2LDM A;  2HCK A;  1FMV A;  3CD6 T;  4GBQ A;  2G6F X;  2RQW A;  3QXE B;  3L2V A;  3CC7 Q;  4HCC A;  5GAM j;  3CMA Q;  1K4U S;  3QJ6 A;  3BE3 A;  4A4K A;  1AZG B;  2AK5 A;  3OYK A;  3OYL A;  5CO7 A;  1KD1 U;  1M1K U;  9ATC B;  2JXB A;  5A0L A;  3WVD B;  3C12 A;  1M4Z A;  4HT9 A;  1OZ3 A;  1H3Z A;  1MMG A;  1WHG A;  3LLR A;  4BD3 A;  2VGM A;  2BE7 D;  1G5V A;  1Q86 R;  2P0K A;  5IT9 E;  1VQO A;  2DXB A;  3UF4 A;  3EH2 A;  3S3N A;  2HKQ B;  1K9M C;  3OW2 P;  4M77 C;  3MPU B;  2BE9 B;  3O8V A;  3SEM A;  3UAT A;  1WX6 A;  2F2V A;  1VQO T;  2VYT A;  5GAO n;  5HCK A;  1WDX A;  1ABQ A;  1X6G A;  3OY9 A;  3LWH A;  4X1V A;  1ZA2 B;  4M7A B;  2DX1 A;  2ABL A;  3JB9 I;  4BI4 A;  2MWP A;  2NYS A;  1WI7 A;  2FRY A;  3QYH B;  4AMC A;  3S3M A;  1LOJ A;  1D0Z A;  4M77 E;  3HPW A;  2KT8 A;  4BI3 A;  4OB0 B;  2QQS A;  3M4G A;  3S3O A;  3UDC A;  3QG1 A;  1OOT A;  2P84 A;  3I56 A;  1UJY A;  2M1H A;  4IIO A;  3HSB A;  4M7D F;  1K9M R;  1VQ9 A;  4KUL A;  2E6N A;  2L2P A;  1I07 A;  2V26 A;  4M78 G;  2QYZ A;  4LD9 K;  3I56 T;  1BI3 A;  1XJW B;  2FVU A;  4OB2 B;  4DEX A;  3RNJ A;  4FSX A;  2LQ8 A;  2MPX C;  3RR6 A;  1VQ9 T;  3OSV A;  3V7S A;  1RI9 A;  3M0Q A;  1H8K A;  4M7A D;  4XAX B;  2FEI A;  1TTH B;  3TSW A;  4HXJ A;  1JO8 A;  2E10 A;  2K5F A;  2EQJ A;  1UB4 A;  2L3S A;  3MKD A;  1ZUY A;  2JM8 A;  2PU9 B;  4NOY A;  1VOM A;  5LJ5 f;  2DXU A;  2JM9 A;  1NJI C;  2KRM A;  3CC4 Q;  2AZV A;  1VQO Q;  1A0N B;  3RMS A;  1EZZ B;  1M5Q 1;  1YBY A;  2NUT A;  1KQ2 A;  1KC8 C;  1QCF A;  2EYX A;  2M51 A;  1K1Z A;  2QAS A;  2D1X A;  3PT9 A;  1M90 U;  1NEG A;  3G6E A;  3CPW P;  1KHC A;  1R77 A;  4QW2 A;  4J6Y A;  1HK9 A;  4JLG A;  1IXD A;  5L23 A;  3FLG A;  4PJL A;  4OMM A;  2VGN A;  3CME A;  2DTO A;  5LJ3 e;  3X24 B;  4MZM A;  3G6E T;  5GMK e;  3JCM P;  2EAY A;  2FL7 A;  3HRU A;  2RI5 A;  2DZC A;  3C4S A;  2D9T A;  1FWZ A;  2CSQ A;  3G71 A;  3PVL A;  4Y92 A;  4LUE A;  3QKJ A;  1JU5 C;  1X75 C;  4RTV A;  3I56 Q;  3CME T;  3VUB A;  2X3W D;  2X3X D;  5IXF A;  4PLL A;  2V8I A;  1PC0 A;  4RKU E;  1VQ9 Q;  2JVV A;  2GQI A;  1CSK A;  2NUT B;  2RH2 A;  2HMA A;  1AT1 B;  3G71 T;  1KQ1 A;  4P5N A;  2HKN A;  2RQU A;  2DL5 A;  4PFP A;  4JJD A;  1UGV A;  5HKC A;  3F70 A;  2A7Y A;  2EJG A;  1DJ7 B;  4KRT A;  4X9D A;  2J6O A;  4C8Q F;  1K0X A;  2GFA A;  1SHG A;  3QUI A;  2VVK A;  3BW1 A;  3EFR A;  3P8H A;  1G2B A;  1B3Q A;  1WXB A;  3OW2 S;  5GAN 7;  4OML A;  3OMG A;  2CS7 A;  1VQN A;  1NZ9 A;  4PJO A;  3QDR B;  2IIM A;  2JS2 A;  1AVZ C;  2E3I A;  3G1J A;  4J9I A;  2ESW A;  3FRN A;  1Q81 U;  1YNZ A;  1G3S A;  1SEM A;  3H8Z A;  2XIC A;  1AHJ B;  1BCO A;  1HD3 A;  3QWX X;  4C92 B;  4ANJ A;  3CXC A;  3JB9 F;  5DLQ E;  2RPN A;  2L0A A;  3EHR A;  3G6E Q;  3CCM T;  4F7U G;  3CQT A;  2A3L A;  3CBM A;  2KR3 A;  1Y96 A;  2XHC A;  1Q82 U;  4ELZ C;  3OYJ A;  1YIJ A;  1N8R R;  3CME Q;  1NEB A;  3M9Q A;  4PJN A;  3LX7 A;  2MF2 A;  3QDF A;  2YRD A;  1SRM A;  3HRS A;  2JTM A;  4O5V A;  2RQV A;  4EIK A;  3G71 Q;  1YIJ T;  5FU6 C;  5GAN 5;  2COZ A;  1HJD A;  1OUL A;  1U3O A;  2L3P A;  2EW3 A;  1WJR A;  4J9B A;  2ED0 A;  2B8A A;  1G8X A;  2DK3 A;  1XNI A;  4XU0 A;  2P4R A;  5GAM d;  5GAN 2;  3UWN A;  3MP6 A;  1WQ7 A;  3OS0 A;  1K73 C;  2VUB A;  1M1F A;  3BFM A;  3A1P A;  5GAN 3;  4C92 D;  4AT1 B;  1KQS P;  1VYT A;  2GCX A;  3L2Z A;  4QT7 A;  5LJ5 j;  3A8O B;  2OAW A;  2I0N A;  4A4G A;  3VS1 A;  4RTZ A;  1WYX A;  3SWN A;  2W10 A;  2EPD A;  4PNO A;  1OPL A;  1RUW A;  2M0O A;  4XK8 E;  2W0Z A;  4WTO B;  2DER A;  1PWT A;  1I1J A;  2BZY A;  2AZS A;  1MNE A;  2QTX A;  1JEG A;  1VQN Q;  2KI7 A;  1BK2 A;  3WXM B;  1VQL A;  5LJ3 f;  5GAO q;  2HSE B;  4JZ4 A;  2K9G A;  2DJQ A;  3CPW S;  4FCY A;  1LNX A;  2KK4 A;  4DOV A;  2MYS A;  2RJE A;  3RKY A;  5J3B A;  3HP9 A;  2RJF A;  1WXU A;  4FIB A;  1K73 R;  1VQL T;  2BKD N;  4M7D B;  1UGP B;  2RM4 A;  3VS4 A;  1FXX A;  4A4E A;  5FWC A;  4HCK A;  2A36 A;  3JCM J;  3LWI A;  4PFZ A;  1BBZ A;  2HQX A;  2ZCF B;  3EGX B;  2YUO A;  4M78 C;  3FIF A;  5KYN A;  3E1S A;  4J9C A;  2DVJ A;  2X4J A;  1D1C A;  5KYW B;  4RCB A;  4D8K A;  1WHL A;  5GAM f;  2E5Q A;  1OI1 A;  2DE0 X;  3EG0 A;  1N27 A;  1WFW A;  1VQ5 A;  1HSQ A;  3I5S A;  4EMK A;  2XDP A;  4LDX A;  2DIG A;  4CC2 A;  1N5Z A;  3QII A;  5FRM A;  2RQR A;  2C0O A;  1NLO C;  2DTI A;  4N4H A;  4KGZ B;  2EIF A;  3OS1 A;  1JJ2 P;  1IO6 A;  3EGU A;  1VQ7 T;  4M7D D;  3DLL A;  4KUD K;  5KCH A;  3VRZ A;  3ME9 A;  1VQ5 T;  1SPK A;  2EQK A;  3E2U A;  1QCN A;  2VWF A;  3PMI A;  2CUD A;  3C95 A;  1MHN A;  2K2M A;  2OTL A;  2O9V A;  2QQB A;  3X26 B;  4NL3 A;  3A8G B;  3M4Y A;  1NE8 A;  4C8Q A;  4XU2 A;  1M1K C;  5CAI A;  1VUB A;  4RTY A;  3JCM V;  2DD4 A;  2O4X B;  3CPW A;  2LNH B;  2YSQ A;  2O88 A;  5CKH A;  2OTL T;  3GBQ A;  3VJP A;  4M78 B;  3CCV A;  2QK0 A;  2ZPF B;  1IZ6 A;  3CCL T;  1QVG P;  5CKE A;  2J7I A;  2K3Y A;  1ZX6 A;  2RN8 A;  4ZN3 A;  2IVW A;  1BIA A;  1YCY A;  1NPR A;  3CCV T;  3JB9 H;  4DQ2 A;  4XU3 A;  3JCM h;  1VQ6 A;  3CMA A;  3EG9 B;  2LQK A;  2D0N A;  2HEQ A;  1RAB B;  1CKA A;  3ZL7 C;  1AWJ A;  1M1K R;  1CKB A;  4Q5W A;  4C8Q B;  2K4Y A;  1NLP C;  3CC7 T;  1VQ6 T;  3CMA T;  5GJW B;  2X51 A;  4B9W A;  3A98 A;  1KQS S;  2D8J A;  2VC8 A;  4BY6 B;  3ZBD A;  3VS2 A;  3G7Z A;  2AHJ B;  2RJD A;  2NUP A;  2QDY B;  3E19 A;  4M78 D;  1VQ5 Q;  2DO3 A;  5GMK i;  2E65 A;  2EBP A;  1SKU B;  4EMG A;  2DBK A;  5DLO A;  2LQN A;  1RLP C;  3IQL A;  1UFF A;  3M57 A;  3CCR A;  4HCB A;  1ZSZ B;  2QI2 A;  1GCQ A;  3RKX A;  1TG0 A;  3SDZ A;  1MV0 B;  5LJ3 j;  5GAO l;  2FZK B;  3CEY A;  2DXC A;  4MDW A;  5EG2 A;  5GMK j;  1VQP A;  5GAN d;  4OGC A;  4BDZ A;  4HT8 A;  3M5A A;  5IH2 A;  1QWE A;  3BDL A;  3CCR T;  1YCS B;  2YHT A;  2KAF A;  1H92 A;  2EYW A;  4QVD A;  4BE0 A;  2KRS A;  2DL7 A;  3J81 E;  2RHY A;  4IUQ A;  1ABO A;  1VQP T;  2COW A;  1K9A A;  1PM3 A;  2KRO A;  3VRY A;  2O31 A;  4GLK A;  2FZC B;  4C5E A;  3OYB A;  3CCV Q;  2GGR A;  3ER0 A;  2CDT A;  1MMN A;  4JRI A;  1QLY A;  3H0F A;  1VYV A;  4KT0 E;  3JCM Q;  3GF5 A;  5DM7 R;  4JDS A;  3ZEH A;  2QQA A;  2L8D A;  1N6A A;  4R0K A;  2CKK A;  1PD0 A;  4WF2 A;  1X43 A;  1M90 C;  1TH7 A;  2RA2 A;  5L8R E;  1VQ6 Q;  4OMQ A;  3X20 B;  2YUN A;  5IHI A;  4M7D G;  2KXC A;  1VIE A;  1G3W A;  3OYF A;  2YWW A;  4L5G A;  2DMO A;  4CI0 C;  1I5O B;  2VV5 A;  2DAQ A;  1YJN A;  2OX7 A;  3OBY A;  2VAS A;  2JS0 A;  4PJO F;  4M7A E;  3M0T A;  1JJ2 S;  1RAA B;  3OYC A;  2HQE A;  1OX9 A;  1H3H A;  2QAZ A;  3CC4 A;  1WHH A;  4DBQ A;  4CC7 A;  4DA4 A;  2EVR A;  4V2S A;  1YJN T;  3OYD A;  1Z9Z A;  5LJ5 d;  4JZ3 A;  2O2O A;  3A5Z B;  2CRE A;  1EIF A;  1M3C A;  4A63 B;  4F7U B;  2JJ9 A;  4JJN K;  2OTJ A;  2NWM A;  5GAN f;  3CC4 T;  2DRM A;  3CCR Q;  4N0A C;  1PKT A;  1M90 R;  3MP8 A;  1YP5 A;  1M8V A;  1R0B G;  3EG1 A;  3CCQ A;  2ECZ A;  4B6M A;  1QP3 A;  1UJ0 A;  5GAN 6;  1VQP Q;  3M58 A;  3NPF A;  1H64 1;  2XU8 A;  4BUG A;  1X6O A;  4HCZ A;  1OX8 A;  2KBT A;  3R6O A;  4FT4 A;  1P92 A;  2H3J A;  1Y0M A;  1M9S A;  2GTO A;  1AD5 A;  3AT1 B;  2VKN A;  1QVG S;  1UTI A;  2XDD A;  4J83 A;  1M2O A;  3CCQ T;  2DXT A;  1ZBX A;  4M77 A;  5KYX A;  1KG1 A;  2K57 A;  5C0M A;  3OYY A;  2MCN A;  1ZA1 B;  1K8A U;  4M75 F;  3M56 A;  7AT1 B;  2AIR B;  1J3T A;  4X9C A;  2AKK A;  2LTO A;  2COY A;  2F69 A;  3QJY A;  3VKI A;  1YWO A;  2F2X A;  1VIF A;  2DVE A;  5IXB A;  1WZO A;  1V29 B;  1Q81 C;  4FYV B;  1GCP A;  2FRW A;  3NGP A;  4LNP A;  5A2Q E;  1N9R A;  4Z88 A;  3NTK A;  2YUQ A;  4C0Z A;  2CZ6 B;  4ZGJ B;  1B34 A;  1Q82 C;  1Y07 A;  4C0D B;  1N9S A;  2GF7 A;  1WA7 A;  1QKX A;  1SG5 A;  4C5H A;  4IKF A;  5AYF A;  1YJN Q;  2D6F A;  1RAD B;  1WJS A;  2CT3 A;  2DIL A;  1I81 A;  1OU9 A;  1ZQ1 A;  5KYX B;  2EQI A;  1W2B P;  2YLB A;  3E9F A;  4C8Q G;  3CCJ A;  2F5K A;  1U1S A;  5D6W A;  2HL5 C;  2CYZ B;  3M0U A;  1WHJ A;  1Q81 R;  3WVE B;  5D7U A;  2OTJ Q;  3HHT B;  1QVF P;  2DLP A;  1WHK A;  5FW9 A;  4JRP A;  3CCJ T;  2IG0 A;  1ZSG A;  1QVP A;  2PUO B;  1TOV A;  2RHI A;  2PZ1 A;  3CCQ Q;  2E70 A;  1Q82 R;  4ATO A;  2YLC A;  4Z89 A;  2KXD A;  2L89 A;  2P0Q A;  5KH6 A;  3C0C A;  3VU3 C;  4C5I A;  2D8H A;  2FB7 A;  1QVG A;  3ULR B;  3KXT A;  3JB9 G;  1TU0 B;  1NM7 A;  1ZBJ A;  1NPP A;  2YT6 A;  2HQH A;  3KFV A;  4BE1 A;  4C0G A;  1JQQ A;  3EG2 A;  5I21 A;  1GFD A;  2BTT A;  4C92 C;  1KJW A;  1YIT Q;  1NYG A;  2HBW A;  5FU7 B;  2JUF A;  2RK2 A;  3NFC A;  3FJP A;  2QTV A;  4Y91 A;  1UHF A;  1LCK A;  1U8R A;  1IGQ A;  2DL8 A;  2XI9 A;  3UA6 A;  2Y4X A;  2LJ1 A;  4C92 E;  3A8M B;  1OPK A;  2FO0 A;  2RO0 A;  1N8R C;  3FEO A;  1LVK A;  2FG0 A;  2PVO B;  1TUC A;  2JN0 A;  2KT1 A;  4OB1 B;  1F1B B;  2BIV A;  1XQH A;  2JOY A;  1PHT A;  3CCS A;  5GAN j;  3ASK A;  4RTX A;  1OV3 A;  2X4Y A;  1M30 A;  3CCJ Q;  4F04 B;  4QQ6 A;  4QQD A;  5C6S A;  1I4K 1;  3VS7 A;  1O9S A;  4RG8 A;  2ZPE B;  3CCS T;  1VQN T;  3GPL A;  2JMA A;  5LJ3 d;  1K76 A;  5CVI A;  3H6Z A;  4J7F A;  1BI2 A;  2RHX A;  2K6D A;  3PVQ A;  2X9H A;  4ME7 A;  3L42 A;  1M1G A;  4LN2 A;  3X25 B;  4DOW A;  4ESR A;  8ATC B;  2RHU A;  1EX4 A;  3CCU A;  1X69 A;  2CZ0 B;  1YHQ A;  3QBY A;  3JCM X;  2KYB A;  1VQK A;  4XTW A;  4WCI A;  2B86 A;  2EWN A;  3J7A F;  3V7R A;  3MEW A;  4AFZ C;  1YN8 A;  1YWP A;  5HK0 A;  1OU8 A;  1MMA A;  5ECA A;  5GAN 4;  2RJC A;  5LJ3 h;  3CCU T;  3JAM E;  5I11 A;  1YHQ T;  1WNL A;  1VQK T;  2I2L A;  4PJO B;  1PD1 A;  2ROT A;  5CR2 A;  2RMO A;  3EG3 A;  5LL6 S;  4M7D C;  4HVW A;  2E1H A;  4E47 A;  3SHW A;  4M75 A;  4J9D A;  2EGE A;  1U5S A;  2Z0W A;  3E9G A;  2C0T A;  3FDR A;  3EH1 A;  3QZ9 B;  3OYH A;  4J9E A;  4KBM B;  1NJI U;  1UUE A;  3QHS A;  4QVC A;  3SWN C;  2O01 E;  3MEV A;  5FRO A;  2CH4 A;  4QVZ A;  4XTV A;  2A28 A;  1X01 A;  5IAY A;  1S72 A;  1W2B S;  1Y96 B;  4FU6 A;  4M7D E;  5HK3 A;  2M9U A;  2X4X A;  1KC8 U;  2RK1 A;  4IUR A;  3OW2 A;  4J7I A;  1Q95 G;  3JCM g;  4XTU A;  4E7K A;  3VS6 A;  2J6K A;  5GAM h;  3CCS Q;  1QVF S;  2QQ9 A;  3HFO A;  1S72 T;  4TVR A;  4OB3 B;  1BCM A;  2F1L A;  3G4S A;  2NLU A;  4PJO D;  1R0C B;  4JJC A;  1Y7X A;  2ATC B;  1AWX A;  2YUP A;  4IUT A;  1W6X A;  2MWO A;  4X34 A;  2E5K A;  4ZNX A;  3VV0 A;  4ZTF A;  3QZ5 B;  3L2W A;  3N5B B;  4BAC A;  3G4S T;  3Q1J A;  2DZ9 A;  1M3A A;  1PRM C;  1RAF B;  1XTD A;  1Y57 A;  1RAH B;  3JV3 A;  1V1C A;  4N4I A;  4A4H A;  3CCU Q;  1GBR A;  3OYN A;  2ED1 A;  1YHQ Q;  1Q7Y U;  3SWN B;  4LDU A;  1VQK Q;  4BE2 A;  1MMD A;  1EFN A;  4EPC A;  2PQW A;  3J80 E;  2KE9 A;  3NTH A;  3DLM A;  3JCM e;  4M7A F;  2LZ6 B;  1D3B A;  4JPB W;  5KYU A;  4E6R A;  3H0H A;  4EMK C;  2HD0 A;  4DBF A;  1OEB A;  4NS5 A;  2DYB A;  3EHQ A;  2QGG A;  3OYE A;  2GFU A;  3H41 A;  3RER A;  3RES A;  4AFQ C;  3M53 A;  1LJO A;  4JRQ A;  3V8J A;  4M78 E;  4J6X A;  4F16 A;  2E4H A;  3OYI A;  3TU4 K;  2Y4Y A;  4C8Q C;  4FT2 A;  1S72 Q;  3SB2 A;  2KVQ G;  2E41 A;  3CCE A;  2K3B A;  1ZUU A;  4QQG A;  2K3X A;  1B7T A;  2DM1 A;  2KY9 A;  2CP7 A;  1QVF A;  4BY6 C;  2C0I A;  2PVD B;  1HXD A;  1YJW A;  1KD1 C;  4M77 F;  3OA6 A; 
#chains in the Genus database with same CATH homology
 1OU8 A;  1YFN A;  2QAZ A;  1ZSZ C;  2QAS A;  1OX8 A;  1ZSZ A;  1OUL A;  1ZSZ B;  2NYS A;  1TWB A;  1OU9 A;  1OX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...