1OXBA

Complex between ypd1 and sln1 response regulator domain in space group p2(1)2(1)2(1)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
166
structure length
166
Chain Sequence
STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ypd1p
publication title The yeast YPD1/SLN1 complex: insights into molecular recognition in two-component signaling systems.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 66
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2003-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1oxbA00
3KYIA 2R25A 1C02A 1SR2A 1I5NA 3MYFA 1FR0A 4G78A 1TQGA 1WN0A 1YVIA 3IQTA 2A0BA 4PACA 1BDJB 2LP4A 2Q4FA 3U3BA 2OOCA 1QSPA 1C03A 1OXKA 3KYJA 3US6A 1A0BA 2LD6A 4EUKB 2LCHA 1OXBA 1Y6DA
chains in the Genus database with same CATH superfamily
1K05A 3V7OA 2ZXPA 3PMRA 4YT4A 1JR8A 1MQVA 4AL1A 1NG1A 1TFKB 1RMVA 2PFDA 1D0XA 2MWQA 2KSFA 1JPNA 1ST6A 1SF8A 3GANA 4E7SA 3FOOA 3DJNB 2KC3A 4XPWA 2PX0A 3TK0A 4KNWA 5K0IA 1ZU5A 3RQFA 2H7OA 3HLZA 3R7CA 2R7WA 2R7SA 2R7XA 1M6TA 1S7ZA 3JRTA 3NKDA 5B1AC 4K0DA 3W2WA 1RXQA 2KQ9A 3H2VA 4U5CE 2X0CA 1LKXA 1QPUA 5E33A 1FAPB 4D4XA 4OD4A 1BR1A 4WABA 1Y6DA 1MNDA 2JPUA 3O10A 4M63A 4BEMJ 3NYMA 3KYIA 5KYYA 1C02A 2PX3A 1BBHA 4NC3A 1OCRC 3EG9B 2LQGA 1EI7A 1M2VB 2AWYA 2IXPA 4HFFB 4Q5SF 1YDIA 2YLDA 3K1IC 1I5NA 4PJLA 3H2UA 1PD1A 1LS4A 1OKKD 3ZG1A 1MMNA 2FFHA 3L8IA 4DRIB 3FVYA 4YT8A 4BJ5A 4G7OF 3ZC4A 2FGYA 3LEVA 1G5ZA 2PBEA 4JCZA 5DS4A 1YA9A 1YZCA 1A41A 4EWCA 2KW3C 2XXAA 1CGME 2OOCA 3MYIA 3O6XA 3IQ6A 2ETSA 2H7VC 4FX5A 4J32B 4MTFA 4U9DA 2PP4A 5L0FA 1TWCA 1RJ9B 3OA1A 1OXKA 3FHDA 3QTHA 3SP1A 1AEPA 1LVKA 4HEAJ 2LCHA 1XZPA 1HY5A 1GQAA 3DMDA 1TKNA 2AWCA 1OW6A 4IAOA 2WL8A 3NDBB 1M2OA 5AC4A 2NUTB 4YT5A 4JRZA 4XLPF 4WGZA 2IM8A 5L3QA 1YZAA 1K04A 3L8JA 5B1BC 2M4EA 4J7TA 1H9TA 5A6BA 1IZMA 3CAXA 4KC9A 3ZSUA 2W4MA 4W8KA 1CPQA 2R7RA 2R7UA 1LPEA 3RKOF 2EPMX 1SYQA 2EIJC 3E9VA 3HNKA 4MVQA 1OR2A 1E83A 1OW7A 3B9QA 1CGOA 3F46A 2XS1A 1IW7F 5JLIA 2IXMA 3FAPB 1O5HA 1M56C 3LJBA 4LLCA 1C03A 3O39A 3GWNA 4CJGA 4DRJB 2CW0F 2Q9AA 4PJJA 2YRFA 1Z23A 1A7DA 1WGWA 1ZYRF 3EGDB 3WG7C 3V5ZA 1TWAA 4OIPF 2DI3A 1PD0A 2XLHA 2QY9A 1AUEA 3AG4C 3CZ6A 3W2VA 2WZGA 5L0JA 3ZIBA 1YARO 2LK4A 2NG1A 2XL4A 3GEIA 3ZQVA 4C7OB 1KTMA 2J0WA 1BR2A 1H6GA 2WVOA 2GDCA 3E70C 3LEOA 4RDAA 4A2NB 3JCUQ 3S0XA 4D4NA 2XLOA 1XZQA 4MVOA 4U5DE 2XLEA 5FZTA 4YN0B 2Y3HA 3VM6A 1PV3A 2KJGA 3HNIA 4O79A 3SXZA 3VRCA 2R7TA 5BQGA 4CDVA 2CCYA 1Q0GA 3U3BA 3AG3C 1LE2A 3SNHA 2XM0A 3B29A 4LDRA 1D1AA 3AGTA 4JURI 3ZDLA 2HSBA 4BJ1A 2CYDA 1YA7O 2CNWD 2J46A 2G3VA 4XPXA 2D4UA 2TMVP 3NKEA 1EA8A 4LDQA 4YL3A 3WODF 1E2XA 3U0CA 3VF0A 2IBFA 4F4BA 3KPHA 1D1CA 1V74B 4U5HA 3L34A 5CI9A 2J0XA 4YJWA 5COMA 4AE4B 5KYYB 3AG1C 3U5SA 4YL1A 4BJ5C 4EBJA 3TOMA 1RCPA 4C3EA 3NMKA 4IB4A 2YLGA 1Z7Qc 3TJ5A 1FNTc 1FR0A 3T6BA 2DYSC 2O9XA 1ZHZA 256BA 4DVZA 2AU5A 4FWVA 4CDAA 1U0BB 2R02A 2LP4A 2J7PA 1C17M 2C04A 4U5BE 4YWQA 5HV9A 4XPYA 1MMDA 4C3BA 3M15A 1R4TA 1S05A 2DGJA 1WASA 1Q0MA 3Q7LA 2OQMA 4RD9A 4G7HF 4MVRA 3EHNA 3U2MA 2XXAB 2HS5A 3C8GD 3GM1A 3QVYA 2UUHA 1Q0KA 2IYLD 2PF4E 1ZW3A 3LNRA 3DM5A 2RSEB 3B0VC 1ZVZA 1YYXA 3ZVRA 1QQ3A 1SR2A 4PJMA 4PFPA 3G4ZA 4AX2A 2B0HA 1HMDA 2VC9A 5DVWA 2X51A 3JYYA 2ZXOA 3K66A 3U3FA 4MVMA 2EPOA 3T6JA 1TQGA 1YVIA 3DE8A 1VYKA 1NBBA 1WWPA 4NQFA 1BDJB 5HSWA 2WVNA 2QLAA 2R7VA 1SMYF 2CDQA 4UDVA 4WJ0A 2VCAA 3POVA 3CSKA 1ZU4A 3WHNA 5A6AA 3KYJA 4FESA 5DQZA 2A1DD 2I8BA 5EK0A 2G3KA 1A7VA 3KKBA 1ZHYA 1GM5A 2R05A 1OCOC 5F28E 4KI2A 4BG0A 1SZIA 3CEXA 2XRHA 3L1MA 4E7ZA 3G4XA 3UMHA 4CS9A 3EZIA 2WVQA 4ZLCA 4DBRA 2XL6A 3AQBA 1ORJA 3DZAA 3O55A 5F5HA 2I15A 2OG2A 2XL8A 2AVKA 4I1MA 4LACB 4XEKA 4DRHB 2NUPB 1BZ4A 1TWGA 1WN0A 3IQTA 2YL3A 4WGYA 5B3SC 3S90A 3M1CB 2H7BA 2OEXA 3EFOA 1ZW2A 1T6IA 4ULWA 1V54C 2L9JA 4GEHA 1V4AA 4R32A 3KL4A 2W9YA 1MNEA 2LSEA 3A11A 4DJ9A 4G7ZF 4CSAA 3C8GB 4N6CA 3FAJA 4K7BA 4N4WA 2VB6A 2A6EF 4MVSA 1EKYA 3L0IA 2Q9CA 2QE9A 3A9CA 4CSAC 4E0HA 2P7VA 1Z63A 1ORSC 1V55C 2IXOA 3EH1A 4I3MA 4JKVA 2OU6A 2QTVA 1NU9C 3DD7A 4MTGA 4O7GA 4P9TA 1OCZC 5L0IA 1E85A 2QUPA 2XSEA 1DOWA 3BRJA 3MFNA 1KU2A 2YWAA 2Y3DA 5DQTA 4MVZA 1NFNA 1U6HA 1ZHTA 1Y4CA 3T6GB 3LNMB 1JPJA 2NSGA 1OR3A 3G50A 4PACA 2Q4FA 1M57C 1XWJA 2FAPB 2VCCA 4JW1A 3K7DA 1G4US 2YHSA 5A69A 2A6HF 1VTMP 3SXYA 4PR9A 2Y3GA 3GEEA 4P6IC 4U5GA 3U9JA 5L0GA 3RVZA 3M79A 2HMQA 2A69F 2Y3BA 3DAFA 3JT1A 5JSLA 3ABLC 4CBEA 5DLJA 4DVYP 5DS6A 4JJGA 2IOQA 2XM4A 5E3CA 2R25A 2WZLA 1D0YA 3U2LA 2YL0A 3VAYA 3K1HA 3IHUA 2EPNA 3PCVA 5KYNA 2L6HA 3DAGA 1VLTA 2OKUA 3JYHA 4ONSA 3DM9B 4LERA 4NTBA 4BJTA 1I4YA 4YK5A 3HNLA 3QVZA 4JZAA 5JVEA 4MTOA 3RQGA 1GS9A 3RH3A 4J7YA 1T5OA 4U5FE 3B0UX 4HFKB 4ULVA 3SXMA 5AC5A 3UMKA 4JTAB 2A68F 2L6FA 4FAPB 1J8YF 4CIPA 5A6BD 2HJ3A 5KYWA 2Q9BA 2HMZA 2P0NA 4IJJA 3EG9A 1M2VA 1FFTC 1LS1A 3EHMA 3FOPA 3NRHA 3NG1A 2YEVA 3NYLA 3IPMO 4CS9C 1HE9A 2ASRA 3FMSA 2OEVA 4P9FA 2HZ8A 1I4ZA 2J8WA 1APCA 3AGUA 3ATPA 5TJ5E 3ZTZA 3PHF2 3IEEA 3K33A 4XEFA 3ZTMA 3GWLA 3RFYA 3LS0A 1MMAA 4ER9A 4JVSA 3W4YA 3KH2A 3NYJA 3ECSA 1O87A 2BE5F 1NFOA 2XLWA 4O6NA 4G0HA 3AJMA 4CX9A 3I5PA 2ICWG 2CGEA 1JAFA 1WTYA 3T9OA 1N1CA 1QKRA 2MYSA 3OWTA 1AVOB 4H54A 3V5YA 1OCCC 4E0IA 5EHHA 3TQOA 4O6MA 4CS7A 4QI2A 1HW2A 1RKEA 1R5ID 2OJED 3I5QA 4EKWA 2NUTA 3EFOB 2B0JA 2J9WA 2L6GA 1A0BA 2E87A 2ZXRA 4HE8D 2NSFA 4BJ6A 1OQCA 4OIOF 3GORA 1UG7A 3EQLF 3MBGA 1FMWA 3EPVA 4Q7CA 2IXNA 1Z5ZA 1A7EA 2WB7A 3LAYA 1U89A 5COGA 3RIPA 3S9OA 1E86A 4K1OA 2J45A 2BC5A 4JEAA 1QZXA 3DJUB 4BPMA 1ZHWA 3TJ6A 2KGOA 4MNDA 1ZHXA 1WOLA 3M4BA 5GPGB 5JUAA 1MMGA 5E2QA 3J06A 2XLDA 3DKAA 5L0CA 3NMIA 4IAQA 4PJNA 3F47A 3LS1A 3W8HA 1CPRA 2HJMA 2WZFA 3S29A 3K6BA 4CS8A 1O3UA 3EGDA 4XWJA 2GA0A 3C7JA 1QSPA 2VASA 1QVXA 4W8PA 4I44A 4AK9A 2XLVA 3EJNA 4XEVA 3BEHA 4C7OA 3RYLA 4JTCB 5KYXA 3UR3C 5BUOA 5T3TA 2Y69C 2J7PD 3VYWA 4JTDB 1OKKA 1LE4A 3U8VA 2YL1A 3UNGC 2Q3TA 3Q7GA 4IWBA 4E17A 1JOGA 1EQ1A 1L3PA 3DI5A 4GYTA 4L6RA 1L7CA 1TWHA 4JJFA 2Q7RA 2ZPAA 5L0DA 1YYJA 2P1AA 2R7QA 5D91A 2LFDA 1UFBA 4O6YA 2QNLA 3TULA 4EHPA 4JIOA 2R03A 2F22A 3ITFA 1RKCA 4G78A 3DWWA 4C3DA 1HE1A 3W8IA 1NSGB 3U9MA 4JC7A 3ZQYA 2VCBA 4Q4ZF 4PK4A 3HTKC 2J9UA 4N06A 3S28A 5A6KA 3Q6NA 4OIRF 4LDKA 4IGGA 3JTLO 4I1OB 4AE4A 2LIGA 4MQ9F 2EIKC 5KYWB 3SYNA 1E84A 2EIMC 4ANJA 1CGNA 1G4WR 4QI0A 2HUJA 2ZXWC 3R2PA 4NTAA 4CDYA 1B68A 2GFHA 3X2QC 1NU7D 3LLKA 4Z9IA 1OW8A 4NY3A 1NLXA 4DXWA 2A0UA 4Z9JA 2D5RB 3MLGA 3SEOA 2XLMA 2M64A 3V5XA 5A6JA 3ASNC 2A0BA 3IQ5A 5AGFA 3LESA 5KYUA 3LUTB 4BEJA 4OD5A 3FDQA 1BR4A 2P61A 3EGXA 4J30B 3B71A 4U5EE 3JSZA 5IY5C 3X1OA 1T01A 4BJ6C 2YKZA 4IRUA 3AQCA 4RBNA 3JRMO 2KNHA 5JT4A 4EBBA 1K40A 3ABMC 4H4KC 3JSEO 1VYIA 1RKEB 3HNJA 1LI7A 3QW1A 3RW0A 3TD7A 3S84A 4EIYA 2J9BA 3N2ZB 1HW1A 4JEBA 5T3WA 2R7OA 1TR2A 3QW0A 4N6HA 2XS8A 4CJOA 4IARA 1DOVA 1LIHA 1Z3IX 2GWWA 1H9GA 1TFOB 3AOUA 1FMVA 3QZCA 4CS8C 2EINC 2CNWA 2EPLX 5DS5A 2L81A 2LFFA 2UUIA 5JP7A 4LLEA 3HKKA 3MX3A 4OIQF 2H8AA 4MW3A 1Q0DA 4XTKA 2JX0A 2Q00A 1FTSA 4KBLA 4XLNF 4AL0A 3M4CA 1G8XA 4DOZA 2YZSA 2G62A 1VB5A 4CIHA 3EZHA 3SXKA 1VOMA 3UGPA 3T4RA 2EILC 1PCXA 3I4UA 3ZWIA 4B6IA 1Z6AA 3DXJF 3Q6MA 3CQZA 4JCHA 4YT2A 2NUPA 3UGOA 5KYXB 2MHRA 3GM2A 3NMJA 3C63A 1ZZPA 2ZD9A 1LM3B 2NPUA 2YLIA 4MW8A 5EGYA 5L3VA 2C03A 2V3CC 3K1IA 2YQYA 4E18A 2V26A 5COFA 4A4AA 3MYFA 5BQIA 2HFIA 1VK5A 3C8GA 3DE9A 3IQCA 1RJ9A 2YL7A 1Q0FA 2J9VA 3EH2A 1VLSA 4KNVA 5E3AA 3PDMP 5T1DB 1YLMA 2KYHA 2W45A 3AG2C 1JMWA 3GODA 1HMOA 3ASOC 2P6VA 1D0ZA 4MS2A 5BQHA 2LD6A 4EUKB 3SZRA 1J8MF 3H65A 3RQEA 5CIVA 2KK1A 5JS5A 1OXBA 1KNYA 2HSQA 3RVYA 2HV7A 5FCLA 3UMIA 3GEHA 1WATA 2BL2A 1YJGA 1FFHA 1NZEA 4JE9A 1D1BA 3C8ZA 4YL0A 1LI5A 3C62A 5JRAA 2DB4A 3GM3A 2Z15A 3JZ0A 4DBQA 5F5FA 3N24A 4U9EA 2L7AA 2OCCC 4NCQA 4QDLA 3RF3A 2AP3A 2W4BA 4Z9HA 2YVKA 5D92A 2DYRC 2VH3A 3HJCA 1F1MA 1GGQA 4EBKA 1T6QA 5B3IA 2Y39A 4X0RA 3QMKA 1W2WA 4NTFA 4PFOA 3WAQA 1ORYA 1T9KA 2RD9A 4GQHA 1QLEC 1T6UA 3B0PA 2JD3A 3FXHA 3KMIA 3N0TA 4MVUA 3S27A 3U8PA 4XQ1A 2HKVA 1H7IA 3ABKC 2HV6A 2PNOA 3LLIA 5CI8A 3OEOA 4OINF 3TOLA 3US6A 3EGXB 5L0HA 5KYUB 4ZLDA 1YAUO 2GAQA 1VMAA 2R9RB 2EPKX 3C18A 2OJQA 1JRAA
chains in the Genus database with same CATH topology
3KYIA 2R25A 1C02A 1SR2A 1I5NA 3MYFA 1FR0A 4G78A 1TQGA 1WN0A 1YVIA 3IQTA 2A0BA 4PACA 1BDJB 2LP4A 2Q4FA 3U3BA 2OOCA 1QSPA 1C03A 1OXKA 3KYJA 3US6A 1A0BA 2LD6A 4EUKB 2LCHA 1OXBA 1Y6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYI A;  2R25 A;  1C02 A;  1SR2 A;  1I5N A;  3MYF A;  1FR0 A;  4G78 A;  1TQG A;  1WN0 A;  1YVI A;  3IQT A;  2A0B A;  4PAC A;  1BDJ B;  2LP4 A;  2Q4F A;  3U3B A;  2OOC A;  1QSP A;  1C03 A;  1OXK A;  3KYJ A;  3US6 A;  1A0B A;  2LD6 A;  4EUK B;  2LCH A;  1OXB A;  1Y6D A; 
#chains in the Genus database with same CATH topology
 1K05 A;  3V7O A;  2ZXP A;  3PMR A;  4YT4 A;  1JR8 A;  1MQV A;  4AL1 A;  1NG1 A;  1TFK B;  1RMV A;  2PFD A;  1D0X A;  2MWQ A;  2KSF A;  1JPN A;  1ST6 A;  1SF8 A;  3GAN A;  4E7S A;  3FOO A;  3DJN B;  2KC3 A;  4XPW A;  2PX0 A;  3TK0 A;  4KNW A;  5K0I A;  1ZU5 A;  3RQF A;  2H7O A;  3HLZ A;  3R7C A;  2R7W A;  2R7S A;  2R7X A;  1M6T A;  1S7Z A;  3JRT A;  3NKD A;  5B1A C;  4K0D A;  3W2W A;  1RXQ A;  2KQ9 A;  3H2V A;  4U5C E;  2X0C A;  1LKX A;  1QPU A;  5E33 A;  1FAP B;  4D4X A;  4OD4 A;  1BR1 A;  4WAB A;  1Y6D A;  1MND A;  2JPU A;  3O10 A;  4M63 A;  4BEM J;  3NYM A;  3KYI A;  5KYY A;  1C02 A;  2PX3 A;  1BBH A;  4NC3 A;  1OCR C;  3EG9 B;  2LQG A;  1EI7 A;  1M2V B;  2AWY A;  2IXP A;  4HFF B;  4Q5S F;  1YDI A;  2YLD A;  3K1I C;  1I5N A;  4PJL A;  3H2U A;  1PD1 A;  1LS4 A;  1OKK D;  3ZG1 A;  1MMN A;  2FFH A;  3L8I A;  4DRI B;  3FVY A;  4YT8 A;  4BJ5 A;  4G7O F;  3ZC4 A;  2FGY A;  3LEV A;  1G5Z A;  2PBE A;  4JCZ A;  5DS4 A;  1YA9 A;  1YZC A;  1A41 A;  4EWC A;  2KW3 C;  2XXA A;  1CGM E;  2OOC A;  3MYI A;  3O6X A;  3IQ6 A;  2ETS A;  2H7V C;  4FX5 A;  4J32 B;  4MTF A;  4U9D A;  2PP4 A;  5L0F A;  1TWC A;  1RJ9 B;  3OA1 A;  1OXK A;  3FHD A;  3QTH A;  3SP1 A;  1AEP A;  1LVK A;  4HEA J;  2LCH A;  1XZP A;  1HY5 A;  1GQA A;  3DMD A;  1TKN A;  2AWC A;  1OW6 A;  4IAO A;  2WL8 A;  3NDB B;  1M2O A;  5AC4 A;  2NUT B;  4YT5 A;  4JRZ A;  4XLP F;  4WGZ A;  2IM8 A;  5L3Q A;  1YZA A;  1K04 A;  3L8J A;  5B1B C;  2M4E A;  4J7T A;  1H9T A;  5A6B A;  1IZM A;  3CAX A;  4KC9 A;  3ZSU A;  2W4M A;  4W8K A;  1CPQ A;  2R7R A;  2R7U A;  1LPE A;  3RKO F;  2EPM X;  1SYQ A;  2EIJ C;  3E9V A;  3HNK A;  4MVQ A;  1OR2 A;  1E83 A;  1OW7 A;  3B9Q A;  1CGO A;  3F46 A;  2XS1 A;  1IW7 F;  5JLI A;  2IXM A;  3FAP B;  1O5H A;  1M56 C;  3LJB A;  4LLC A;  1C03 A;  3O39 A;  3GWN A;  4CJG A;  4DRJ B;  2CW0 F;  2Q9A A;  4PJJ A;  2YRF A;  1Z23 A;  1A7D A;  1WGW A;  1ZYR F;  3EGD B;  3WG7 C;  3V5Z A;  1TWA A;  4OIP F;  2DI3 A;  1PD0 A;  2XLH A;  2QY9 A;  1AUE A;  3AG4 C;  3CZ6 A;  3W2V A;  2WZG A;  5L0J A;  3ZIB A;  1YAR O;  2LK4 A;  2NG1 A;  2XL4 A;  3GEI A;  3ZQV A;  4C7O B;  1KTM A;  2J0W A;  1BR2 A;  1H6G A;  2WVO A;  2GDC A;  3E70 C;  3LEO A;  4RDA A;  4A2N B;  3JCU Q;  3S0X A;  4D4N A;  2XLO A;  1XZQ A;  4MVO A;  4U5D E;  2XLE A;  5FZT A;  4YN0 B;  2Y3H A;  3VM6 A;  1PV3 A;  2KJG A;  3HNI A;  4O79 A;  3SXZ A;  3VRC A;  2R7T A;  5BQG A;  4CDV A;  2CCY A;  1Q0G A;  3U3B A;  3AG3 C;  1LE2 A;  3SNH A;  2XM0 A;  3B29 A;  4LDR A;  1D1A A;  3AGT A;  4JUR I;  3ZDL A;  2HSB A;  4BJ1 A;  2CYD A;  1YA7 O;  2CNW D;  2J46 A;  2G3V A;  4XPX A;  2D4U A;  2TMV P;  3NKE A;  1EA8 A;  4LDQ A;  4YL3 A;  3WOD F;  1E2X A;  3U0C A;  3VF0 A;  2IBF A;  4F4B A;  3KPH A;  1D1C A;  1V74 B;  4U5H A;  3L34 A;  5CI9 A;  2J0X A;  4YJW A;  5COM A;  4AE4 B;  5KYY B;  3AG1 C;  3U5S A;  4YL1 A;  4BJ5 C;  4EBJ A;  3TOM A;  1RCP A;  4C3E A;  3NMK A;  4IB4 A;  2YLG A;  1Z7Q c;  3TJ5 A;  1FNT c;  1FR0 A;  3T6B A;  2DYS C;  2O9X A;  1ZHZ A;  256B A;  4DVZ A;  2AU5 A;  4FWV A;  4CDA A;  1U0B B;  2R02 A;  2LP4 A;  2J7P A;  1C17 M;  2C04 A;  4U5B E;  4YWQ A;  5HV9 A;  4XPY A;  1MMD A;  4C3B A;  3M15 A;  1R4T A;  1S05 A;  2DGJ A;  1WAS A;  1Q0M A;  3Q7L A;  2OQM A;  4RD9 A;  4G7H F;  4MVR A;  3EHN A;  3U2M A;  2XXA B;  2HS5 A;  3C8G D;  3GM1 A;  3QVY A;  2UUH A;  1Q0K A;  2IYL D;  2PF4 E;  1ZW3 A;  3LNR A;  3DM5 A;  2RSE B;  3B0V C;  1ZVZ A;  1YYX A;  3ZVR A;  1QQ3 A;  1SR2 A;  4PJM A;  4PFP A;  3G4Z A;  4AX2 A;  2B0H A;  1HMD A;  2VC9 A;  5DVW A;  2X51 A;  3JYY A;  2ZXO A;  3K66 A;  3U3F A;  4MVM A;  2EPO A;  3T6J A;  1TQG A;  1YVI A;  3DE8 A;  1VYK A;  1NBB A;  1WWP A;  4NQF A;  1BDJ B;  5HSW A;  2WVN A;  2QLA A;  2R7V A;  1SMY F;  2CDQ A;  4UDV A;  4WJ0 A;  2VCA A;  3POV A;  3CSK A;  1ZU4 A;  3WHN A;  5A6A A;  3KYJ A;  4FES A;  5DQZ A;  2A1D D;  2I8B A;  5EK0 A;  2G3K A;  1A7V A;  3KKB A;  1ZHY A;  1GM5 A;  2R05 A;  1OCO C;  5F28 E;  4KI2 A;  4BG0 A;  1SZI A;  3CEX A;  2XRH A;  3L1M A;  4E7Z A;  3G4X A;  3UMH A;  4CS9 A;  3EZI A;  2WVQ A;  4ZLC A;  4DBR A;  2XL6 A;  3AQB A;  1ORJ A;  3DZA A;  3O55 A;  5F5H A;  2I15 A;  2OG2 A;  2XL8 A;  2AVK A;  4I1M A;  4LAC B;  4XEK A;  4DRH B;  2NUP B;  1BZ4 A;  1TWG A;  1WN0 A;  3IQT A;  2YL3 A;  4WGY A;  5B3S C;  3S90 A;  3M1C B;  2H7B A;  2OEX A;  3EFO A;  1ZW2 A;  1T6I A;  4ULW A;  1V54 C;  2L9J A;  4GEH A;  1V4A A;  4R32 A;  3KL4 A;  2W9Y A;  1MNE A;  2LSE A;  3A11 A;  4DJ9 A;  4G7Z F;  4CSA A;  3C8G B;  4N6C A;  3FAJ A;  4K7B A;  4N4W A;  2VB6 A;  2A6E F;  4MVS A;  1EKY A;  3L0I A;  2Q9C A;  2QE9 A;  3A9C A;  4CSA C;  4E0H A;  2P7V A;  1Z63 A;  1ORS C;  1V55 C;  2IXO A;  3EH1 A;  4I3M A;  4JKV A;  2OU6 A;  2QTV A;  1NU9 C;  3DD7 A;  4MTG A;  4O7G A;  4P9T A;  1OCZ C;  5L0I A;  1E85 A;  2QUP A;  2XSE A;  1DOW A;  3BRJ A;  3MFN A;  1KU2 A;  2YWA A;  2Y3D A;  5DQT A;  4MVZ A;  1NFN A;  1U6H A;  1ZHT A;  1Y4C A;  3T6G B;  3LNM B;  1JPJ A;  2NSG A;  1OR3 A;  3G50 A;  4PAC A;  2Q4F A;  1M57 C;  1XWJ A;  2FAP B;  2VCC A;  4JW1 A;  3K7D A;  1G4U S;  2YHS A;  5A69 A;  2A6H F;  1VTM P;  3SXY A;  4PR9 A;  2Y3G A;  3GEE A;  4P6I C;  4U5G A;  3U9J A;  5L0G A;  3RVZ A;  3M79 A;  2HMQ A;  2A69 F;  2Y3B A;  3DAF A;  3JT1 A;  5JSL A;  3ABL C;  4CBE A;  5DLJ A;  4DVY P;  5DS6 A;  4JJG A;  2IOQ A;  2XM4 A;  5E3C A;  2R25 A;  2WZL A;  1D0Y A;  3U2L A;  2YL0 A;  3VAY A;  3K1H A;  3IHU A;  2EPN A;  3PCV A;  5KYN A;  2L6H A;  3DAG A;  1VLT A;  2OKU A;  3JYH A;  4ONS A;  3DM9 B;  4LER A;  4NTB A;  4BJT A;  1I4Y A;  4YK5 A;  3HNL A;  3QVZ A;  4JZA A;  5JVE A;  4MTO A;  3RQG A;  1GS9 A;  3RH3 A;  4J7Y A;  1T5O A;  4U5F E;  3B0U X;  4HFK B;  4ULV A;  3SXM A;  5AC5 A;  3UMK A;  4JTA B;  2A68 F;  2L6F A;  4FAP B;  1J8Y F;  4CIP A;  5A6B D;  2HJ3 A;  5KYW A;  2Q9B A;  2HMZ A;  2P0N A;  4IJJ A;  3EG9 A;  1M2V A;  1FFT C;  1LS1 A;  3EHM A;  3FOP A;  3NRH A;  3NG1 A;  2YEV A;  3NYL A;  3IPM O;  4CS9 C;  1HE9 A;  2ASR A;  3FMS A;  2OEV A;  4P9F A;  2HZ8 A;  1I4Z A;  2J8W A;  1APC A;  3AGU A;  3ATP A;  5TJ5 E;  3ZTZ A;  3PHF 2;  3IEE A;  3K33 A;  4XEF A;  3ZTM A;  3GWL A;  3RFY A;  3LS0 A;  1MMA A;  4ER9 A;  4JVS A;  3W4Y A;  3KH2 A;  3NYJ A;  3ECS A;  1O87 A;  2BE5 F;  1NFO A;  2XLW A;  4O6N A;  4G0H A;  3AJM A;  4CX9 A;  3I5P A;  2ICW G;  2CGE A;  1JAF A;  1WTY A;  3T9O A;  1N1C A;  1QKR A;  2MYS A;  3OWT A;  1AVO B;  4H54 A;  3V5Y A;  1OCC C;  4E0I A;  5EHH A;  3TQO A;  4O6M A;  4CS7 A;  4QI2 A;  1HW2 A;  1RKE A;  1R5I D;  2OJE D;  3I5Q A;  4EKW A;  2NUT A;  3EFO B;  2B0J A;  2J9W A;  2L6G A;  1A0B A;  2E87 A;  2ZXR A;  4HE8 D;  2NSF A;  4BJ6 A;  1OQC A;  4OIO F;  3GOR A;  1UG7 A;  3EQL F;  3MBG A;  1FMW A;  3EPV A;  4Q7C A;  2IXN A;  1Z5Z A;  1A7E A;  2WB7 A;  3LAY A;  1U89 A;  5COG A;  3RIP A;  3S9O A;  1E86 A;  4K1O A;  2J45 A;  2BC5 A;  4JEA A;  1QZX A;  3DJU B;  4BPM A;  1ZHW A;  3TJ6 A;  2KGO A;  4MND A;  1ZHX A;  1WOL A;  3M4B A;  5GPG B;  5JUA A;  1MMG A;  5E2Q A;  3J06 A;  2XLD A;  3DKA A;  5L0C A;  3NMI A;  4IAQ A;  4PJN A;  3F47 A;  3LS1 A;  3W8H A;  1CPR A;  2HJM A;  2WZF A;  3S29 A;  3K6B A;  4CS8 A;  1O3U A;  3EGD A;  4XWJ A;  2GA0 A;  3C7J A;  1QSP A;  2VAS A;  1QVX A;  4W8P A;  4I44 A;  4AK9 A;  2XLV A;  3EJN A;  4XEV A;  3BEH A;  4C7O A;  3RYL A;  4JTC B;  5KYX A;  3UR3 C;  5BUO A;  5T3T A;  2Y69 C;  2J7P D;  3VYW A;  4JTD B;  1OKK A;  1LE4 A;  3U8V A;  2YL1 A;  3UNG C;  2Q3T A;  3Q7G A;  4IWB A;  4E17 A;  1JOG A;  1EQ1 A;  1L3P A;  3DI5 A;  4GYT A;  4L6R A;  1L7C A;  1TWH A;  4JJF A;  2Q7R A;  2ZPA A;  5L0D A;  1YYJ A;  2P1A A;  2R7Q A;  5D91 A;  2LFD A;  1UFB A;  4O6Y A;  2QNL A;  3TUL A;  4EHP A;  4JIO A;  2R03 A;  2F22 A;  3ITF A;  1RKC A;  4G78 A;  3DWW A;  4C3D A;  1HE1 A;  3W8I A;  1NSG B;  3U9M A;  4JC7 A;  3ZQY A;  2VCB A;  4Q4Z F;  4PK4 A;  3HTK C;  2J9U A;  4N06 A;  3S28 A;  5A6K A;  3Q6N A;  4OIR F;  4LDK A;  4IGG A;  3JTL O;  4I1O B;  4AE4 A;  2LIG A;  4MQ9 F;  2EIK C;  5KYW B;  3SYN A;  1E84 A;  2EIM C;  4ANJ A;  1CGN A;  1G4W R;  4QI0 A;  2HUJ A;  2ZXW C;  3R2P A;  4NTA A;  4CDY A;  1B68 A;  2GFH A;  3X2Q C;  1NU7 D;  3LLK A;  4Z9I A;  1OW8 A;  4NY3 A;  1NLX A;  4DXW A;  2A0U A;  4Z9J A;  2D5R B;  3MLG A;  3SEO A;  2XLM A;  2M64 A;  3V5X A;  5A6J A;  3ASN C;  2A0B A;  3IQ5 A;  5AGF A;  3LES A;  5KYU A;  3LUT B;  4BEJ A;  4OD5 A;  3FDQ A;  1BR4 A;  2P61 A;  3EGX A;  4J30 B;  3B71 A;  4U5E E;  3JSZ A;  5IY5 C;  3X1O A;  1T01 A;  4BJ6 C;  2YKZ A;  4IRU A;  3AQC A;  4RBN A;  3JRM O;  2KNH A;  5JT4 A;  4EBB A;  1K40 A;  3ABM C;  4H4K C;  3JSE O;  1VYI A;  1RKE B;  3HNJ A;  1LI7 A;  3QW1 A;  3RW0 A;  3TD7 A;  3S84 A;  4EIY A;  2J9B A;  3N2Z B;  1HW1 A;  4JEB A;  5T3W A;  2R7O A;  1TR2 A;  3QW0 A;  4N6H A;  2XS8 A;  4CJO A;  4IAR A;  1DOV A;  1LIH A;  1Z3I X;  2GWW A;  1H9G A;  1TFO B;  3AOU A;  1FMV A;  3QZC A;  4CS8 C;  2EIN C;  2CNW A;  2EPL X;  5DS5 A;  2L81 A;  2LFF A;  2UUI A;  5JP7 A;  4LLE A;  3HKK A;  3MX3 A;  4OIQ F;  2H8A A;  4MW3 A;  1Q0D A;  4XTK A;  2JX0 A;  2Q00 A;  1FTS A;  4KBL A;  4XLN F;  4AL0 A;  3M4C A;  1G8X A;  4DOZ A;  2YZS A;  2G62 A;  1VB5 A;  4CIH A;  3EZH A;  3SXK A;  1VOM A;  3UGP A;  3T4R A;  2EIL C;  1PCX A;  3I4U A;  3ZWI A;  4B6I A;  1Z6A A;  3DXJ F;  3Q6M A;  3CQZ A;  4JCH A;  4YT2 A;  2NUP A;  3UGO A;  5KYX B;  2MHR A;  3GM2 A;  3NMJ A;  3C63 A;  1ZZP A;  2ZD9 A;  1LM3 B;  2NPU A;  2YLI A;  4MW8 A;  5EGY A;  5L3V A;  2C03 A;  2V3C C;  3K1I A;  2YQY A;  4E18 A;  2V26 A;  5COF A;  4A4A A;  3MYF A;  5BQI A;  2HFI A;  1VK5 A;  3C8G A;  3DE9 A;  3IQC A;  1RJ9 A;  2YL7 A;  1Q0F A;  2J9V A;  3EH2 A;  1VLS A;  4KNV A;  5E3A A;  3PDM P;  5T1D B;  1YLM A;  2KYH A;  2W45 A;  3AG2 C;  1JMW A;  3GOD A;  1HMO A;  3ASO C;  2P6V A;  1D0Z A;  4MS2 A;  5BQH A;  2LD6 A;  4EUK B;  3SZR A;  1J8M F;  3H65 A;  3RQE A;  5CIV A;  2KK1 A;  5JS5 A;  1OXB A;  1KNY A;  2HSQ A;  3RVY A;  2HV7 A;  5FCL A;  3UMI A;  3GEH A;  1WAT A;  2BL2 A;  1YJG A;  1FFH A;  1NZE A;  4JE9 A;  1D1B A;  3C8Z A;  4YL0 A;  1LI5 A;  3C62 A;  5JRA A;  2DB4 A;  3GM3 A;  2Z15 A;  3JZ0 A;  4DBQ A;  5F5F A;  3N24 A;  4U9E A;  2L7A A;  2OCC C;  4NCQ A;  4QDL A;  3RF3 A;  2AP3 A;  2W4B A;  4Z9H A;  2YVK A;  5D92 A;  2DYR C;  2VH3 A;  3HJC A;  1F1M A;  1GGQ A;  4EBK A;  1T6Q A;  5B3I A;  2Y39 A;  4X0R A;  3QMK A;  1W2W A;  4NTF A;  4PFO A;  3WAQ A;  1ORY A;  1T9K A;  2RD9 A;  4GQH A;  1QLE C;  1T6U A;  3B0P A;  2JD3 A;  3FXH A;  3KMI A;  3N0T A;  4MVU A;  3S27 A;  3U8P A;  4XQ1 A;  2HKV A;  1H7I A;  3ABK C;  2HV6 A;  2PNO A;  3LLI A;  5CI8 A;  3OEO A;  4OIN F;  3TOL A;  3US6 A;  3EGX B;  5L0H A;  5KYU B;  4ZLD A;  1YAU O;  2GAQ A;  1VMA A;  2R9R B;  2EPK X;  3C18 A;  2OJQ A;  1JRA A; 
#chains in the Genus database with same CATH homology
 3KYI A;  2R25 A;  1C02 A;  1SR2 A;  1I5N A;  3MYF A;  1FR0 A;  4G78 A;  1TQG A;  1WN0 A;  1YVI A;  3IQT A;  2A0B A;  4PAC A;  1BDJ B;  2LP4 A;  2Q4F A;  3U3B A;  2OOC A;  1QSP A;  1C03 A;  1OXK A;  3KYJ A;  3US6 A;  1A0B A;  2LD6 A;  4EUK B;  2LCH A;  1OXB A;  1Y6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...