1OXBA

Complex between ypd1 and sln1 response regulator domain in space group p2(1)2(1)2(1)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
166
structure length
166
Chain Sequence
STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ypd1p
publication title The yeast YPD1/SLN1 complex: insights into molecular recognition in two-component signaling systems.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 66
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2003-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1oxbA00
1I5NA 4G78A 1YVIA 4EUKB 1OXBA 2R25A 3MYFA 1WN0A 3KYJA 1TQGA 3KYIA 2Q4FA 2LCHA 2OOCA 2LD6A 1C02A 1FR0A 2LP4A 1C03A 1A0BA 1OXKA 1Y6DA 3IQTA 4PACA 1BDJB 3US6A 3U3BA 1QSPA 2A0BA 1SR2A
chains in the Genus database with same CATH superfamily
3EG9B 3W8IA 3K1HA 1TWAA 4CX9A 4YT5A 3AJMA 3ABLC 1RJ9B 2ICWG 3DXJF 5KYYB 1VK5A 3N24A 5TJ5E 4DXWA 4MVZA 3IQ6A 2XRHA 1SF8A 2Y3GA 3ATPA 3OWTA 4OIPF 4M63A 2MHRA 2AWCA 1BR4A 2XM4A 4NCQA 2LD6A 1FMVA 2YLGA 4O6YA 4OIRF 4I1MA 5A69A 2FGYA 1ORYA 2HS5A 2QTVA 1MNEA 2KGOA 2BL2A 1KNYA 3C62A 1A41A 1D0ZA 2CW0F 3GEEA 3ITFA 1BDJB 2EIMC 2YLIA 3L34A 1Q0KA 3O55A 4J30B 3W4YA 3LEVA 4JZAA 4WJ0A 1BBHA 4OINF 1GGQA 1V74B 2XLVA 3N2ZB 4U5DE 1VMAA 2HSBA 4ZLDA 4WGYA 5B3IA 1EQ1A 1OCCC 2JD3A 1YLMA 3SZRA 5JP7A 2YHSA 5CI9A 4KI2A 4U5FE 4Q5SF 3IPMO 1M2OA 4BJTA 5E3AA 1QPUA 2Q7RA 5FZTA 2YRFA 3AG4C 2GDCA 1V54C 3CZ6A 5KYXA 1QLEC 2X0CA 3B0UX 5T3WA 4JC7A 4E0HA 3C8ZA 5AC4A 3NG1A 1OW8A 2CNWA 3ZC4A 3QVYA 3C63A 3JTLO 4MW8A 3SNHA 3JSZA 2CNWD 4EHPA 2Q00A 1PCXA 5F5FA 1NFOA 3ASOC 2YL3A 1Z63A 1JMWA 2ZD9A 1NU9C 3NRHA 3FDQA 3KKBA 2NUPA 4Z9IA 4MTGA 3WODF 4JIOA 4CDAA 2LSEA 4K1OA 3TJ6A 4DRHB 5IY5C 1D1CA 4K0DA 1SZIA 4MVQA 3SXZA 4E0IA 2EINC 2Y3BA 2NSGA 4JEBA 4DRIB 1JPJA 3IEEA 2D5RB 1YAUO 3ZIBA 4O6NA 1QQ3A 2Q9AA 3EFOB 3KYJA 3VF0A 3X1OA 2ZXRA 4YWQA 3LEOA 4W8PA 4MNDA 3JZ0A 3QMKA 2Q3TA 3O6XA 1O3UA 2XLWA 2RSEB 5BQIA 1D1AA 4KC9A 5L3QA 4P9TA 4RBNA 3U8PA 2WZLA 3IQTA 3T6JA 3U9MA 3ZG1A 1LS1A 1H7IA 1G4WR 2O9XA 1LI7A 4IWBA 2ASRA 4U5GA 2X51A 3KH2A 4N6HA 3DJNB 2EIKC 4YJWA 3LS0A 2B0HA 4JW1A 1OKKD 4XPWA 3TOLA 4AL0A 5D91A 3S27A 3RQFA 3VAYA 1MMGA 1T6UA 1OR2A 3EJNA 4KBLA 2R7VA 4G7ZF 5JRAA 4IGGA 5JLIA 4AX2A 3EZHA 3I5PA 2YL7A 3MYFA 4U5CE 2I8BA 2YVKA 4EBKA 5A6BA 3QTHA 3TD7A 5EGYA 4RDAA 1A7VA 1L7CA 2IXMA 4MVOA 4QI2A 1WASA 2J0WA 4H4KC 3ZDLA 2OKUA 4LDQA 4DVZA 2R7TA 3F47A 4J32B 2W4BA 4W8KA 1QVXA 3T6GB 2R7QA 1Y6DA 2CCYA 3G4XA 3GORA 4CS9A 4DJ9A 1MMNA 1T5OA 5COGA 1VB5A 3DE8A 5FCLA 5JUAA 4BJ5C 3LLKA 1AVOB 1LM3B 4F4BA 5KYUA 2PNOA 2EPNA 2EPLX 3F46A 1ZU5A 4JCZA 2J46A 4C3BA 2J0XA 2H7BA 4HE8D 3E9VA 1I5NA 1M6TA 2W4MA 1LE4A 2D4UA 3FOOA 3U9JA 3HNJA 4U5HA 3C8GA 3C7JA 3HJCA 3HTKC 2CYDA 1JRAA 3JT1A 1CGNA 2CDQA 1ZVZA 2HJMA 2L9JA 3C8GB 4MQ9F 2JPUA 2PX0A 4BEMJ 1T01A 3HNKA 4NTAA 2LCHA 2FAPB 4E7SA 2QNLA 3AQBA 5COFA 3VYWA 2DI3A 4BPMA 1VOMA 4IAOA 1LKXA 4XEKA 3S29A 2XL6A 3QVZA 4LLEA 2XS8A 3V7OA 1N1CA 5EK0A 3JCUQ 2GAQA 4O6MA 3SYNA 4E17A 4BJ6C 1WWPA 4Q7CA 1C17M 3K6BA 1V55C 2R9RB 4HFKB 1OR3A 1RJ9A 5L0DA 3K7DA 4U5BE 4OIOF 2ZXPA 2AVKA 2I15A 4PJJA 3EHMA 4Z9HA 1UG7A 1BR2A 1I4ZA 2A0UA 4CS7A 1Z6AA 2HJ3A 1OCZC 3NYJA 2G3VA 2ZXWC 4U5EE 4OD5A 3SXYA 3VRCA 2AP3A 4CIPA 2Z15A 1M2VA 3HNLA 2A68F 2IXPA 1HW1A 1A0BA 2WL8A 3B71A 3S28A 2Q9CA 1NZEA 1M2VB 4IARA 2R02A 4FAPB 2NPUA 1ORJA 1PD1A 3DE9A 5BQGA 3IHUA 1LIHA 4YL1A 2HMZA 3DWWA 4IB4A 3TJ5A 1HW2A 1MQVA 2R7RA 3DZAA 5AC5A 2XLOA 3K66A 1Z5ZA 3I4UA 3GEHA 4YL3A 1H9TA 4P9FA 4YT2A 1YA9A 3E70C 4X0RA 1YYJA 1E86A 3TULA 4CSAC 4JKVA 3ZTZA 2NG1A 3BEHA 5DQZA 256BA 1TFKB 1JOGA 2NSFA 3CSKA 3ZWIA 3AG1C 1UFBA 5L0FA 4UDVA 1JAFA 3C18A 3U2MA 2KW3C 2J7PA 4GYTA 1LS4A 2OOCA 1J8MF 2YWAA 3GANA 3RVZA 2R05A 2L81A 2L6HA 1TWCA 3X2QC 3CAXA 3NKEA 3EQLF 4AE4A 3H2VA 1QSPA 1AEPA 4JCHA 2IOQA 5JT4A 2NUTB 1RKEB 3RW0A 4AE4B 4DRJB 5KYNA 1Z7Qc 3NMKA 1JPNA 1MMAA 3ZQYA 4MVSA 5A6AA 3G50A 1S7ZA 2F22A 3UMIA 2V26A 3EFOA 4XPYA 3LJBA 3NDBB 3DM5A 3LLIA 3WG7C 3K1IC 4MS2A 4R32A 1SYQA 1TQGA 4PFPA 2OJQA 3J06A 4BEJA 3KPHA 2VC9A 1FMWA 3FMSA 3AG2C 4MVUA 2EPOA 5A6KA 2J9WA 4YN0B 4BG0A 3FAPB 1GS9A 1HE9A 1K40A 1HMOA 3A9CA 3KL4A 3MYIA 1SMYF 2JX0A 4PJMA 4U9EA 4Z9JA 3RIPA 2P1AA 2VCBA 3LNRA 4MTFA 4QDLA 4DOZA 1TR2A 3IQ5A 1D0YA 2BE5F 4AL1A 3AOUA 5DS5A 3WAQA 3EGDA 4JE9A 4GEHA 3EGXB 1LI5A 2XL8A 1ZZPA 1OCRC 3LUTB 3ZSUA 3S9OA 3EGDB 3TK0A 5L0HA 4BJ5A 2R7WA 2VASA 5B3SC 4N6CA 1CGME 4N06A 5JVEA 2UUIA 1EI7A 2HV7A 2LK4A 3EPVA 4ULVA 5JSLA 2IBFA 4IJJA 4KNVA 4XWJA 4Q4ZF 4CDVA 5E3CA 5BUOA 2EPMX 2WZGA 3ABKC 2C04A 4LLCA 5A6BD 3N0TA 1YDIA 1C02A 1VLTA 1Q0MA 1BR1A 2PP4A 1JR8A 2KYHA 2RD9A 3EH2A 3M4BA 4D4XA 5L0JA 3S0XA 2IXOA 3V5XA 3FXHA 1HY5A 1KTMA 2H7OA 4A2NB 1CPRA 4O7GA 5KYWA 1Q0FA 2OCCC 2QLAA 3RH3A 1NG1A 1APCA 1R4TA 1SR2A 2PFDA 4CS8A 2VCCA 5L0IA 3S90A 3GEIA 1VYKA 4PJNA 4G7OF 5KYWB 4NY3A 4PK4A 2B0JA 5E33A 1Z3IX 4NTBA 4WABA 3RQGA 1T6QA 5A6JA 4ONSA 4D4NA 4BJ6A 1FAPB 4YT8A 3L0IA 2R7OA 4MW3A 1M57C 2DB4A 1E83A 3C8GD 3RFYA 2XXAB 2Y39A 3U3FA 1QKRA 1K04A 4MVMA 1LPEA 1U89A 3RF3A 3W2VA 4E7ZA 3U8VA 4MVRA 3PHF2 2YQYA 1I4YA 4L6RA 1YA7O 1OW6A 4EIYA 1RKCA 2R03A 1ORSC 1XZPA 1NFNA 2HV6A 1H9GA 2QY9A 3BRJA 2J9BA 3JRMO 1DOWA 4CJGA 1VLSA 4PFOA 4PACA 2H7VC 3EH1A 3MFNA 1L3PA 3ZVRA 4C3EA 2LFDA 3B0PA 2J9UA 2XLHA 3U3BA 2L6FA 4LDRA 4G7HF 2HFIA 3UNGC 3UMKA 1T6IA 1FNTc 2MWQA 4BJ1A 1XZQA 2KQ9A 4G0HA 1O87A 3GWLA 2W45A 3A11A 5CI8A 3DI5A 2QE9A 3SXMA 2YL0A 3CEXA 4FWVA 2Q9BA 2QUPA 1TWGA 4H54A 3ABMC 5F28E 1CPQA 2AU5A 4JJFA 4CS9C 3WHNA 4C7OA 3IQCA 3JSEO 2XS1A 4PR9A 2H8AA 2GA0A 2KJGA 1T9KA 4C7OB 1TFOB 4CSAA 2KK1A 4N4WA 5GPGB 4J7TA 5JS5A 1C03A 1OXKA 2YL1A 3O39A 2HSQA 2LIGA 3V5YA 1YJGA 4CIHA 2V3CC 4IRUA 3FOPA 2WVNA 2TMVP 2GWWA 5T1DB 4XLNF 1ZHYA 3PCVA 1Y4CA 2FFHA 3DAFA 2VH3A 4ANJA 4JRZA 1S05A 4XEVA 3K33A 4PJLA 2P6VA 3Q7GA 4YT4A 1EA8A 3U2LA 2OG2A 3NMIA 4XTKA 4EWCA 5COMA 5BQHA 3L8IA 2R25A 3MBGA 4FX5A 5CIVA 1OQCA 1WATA 2ZPAA 1O5HA 1NLXA 1W2WA 2AWYA 2DGJA 2L7AA 3NYLA 4MTOA 4QI0A 3ASNC 2KNHA 1U6HA 3SXKA 3EZIA 2J7PD 1NU7D 2LP4A 3DD7A 3K1IA 4LDKA 4DBQA 1HE1A 3VM6A 2GFHA 2XLEA 4LACB 3T6BA 1MMDA 4A4AA 2HUJA 3UGOA 2R7SA 4J7YA 3OEOA 2PF4E 3QW1A 3LNMB 2Y69C 2PX3A 1V4AA 1RKEA 2XL4A 2MYSA 4OD4A 4U9DA 2XLDA 2NUTA 1NSGB 5EHHA 4GQHA 4B6IA 3M15A 3EHNA 5L3VA 3H2UA 2DYRC 2HZ8A 3T9OA 3DAGA 3M79A 3RQEA 2IM8A 1PD0A 1GQAA 2XSEA 1LE2A 4WGZA 2PBEA 1G8XA 2E87A 2P61A 3JYYA 3SEOA 3OA1A 1E84A 3S84A 3CQZA 5HV9A 2G3KA 1H6GA 4ULWA 2A6HF 1AUEA 2OEVA 3UGPA 3TQOA 3NYMA 2EILC 1J8YF 2Q4FA 5L0GA 2HKVA 4JVSA 2KSFA 3LAYA 4NTFA 4LERA 3NKDA 5KYXB 3HKKA 3H65A 2XM0A 3NMJA 3T4RA 3JYHA 2R7XA 3GM2A 2A69F 1ZW3A 1Q0DA 3US6A 3ECSA 3UR3C 4CJOA 3EGXA 1D0XA 5E2QA 2XLMA 3SP1A 4C3DA 1WGWA 2VB6A 2YKZA 3I5QA 2P0NA 3B29A 3DKAA 2LQGA 3GM1A 4IAQA 5DVWA 5B1BC 3PMRA 1PV3A 2J45A 5T3TA 2NUPB 5D92A 1TWHA 1BZ4A 2M64A 4EKWA 4KNWA 3Q6NA 3M1CB 4JURI 1ZHTA 2A6EF 3B9QA 1DOVA 4FESA 3POVA 1FFHA 3R2PA 4HFFB 3M4CA 4ER9A 1RMVA 1A7EA 2CGEA 2W9YA 3GM3A 3Q7LA 4JTDB 1Q0GA 1YARO 3Q6MA 3RVYA 3KYIA 2BC5A 3RKOF 3TOMA 5DQTA 5DS4A 4DBRA 3UMHA 3QZCA 1YYXA 3LESA 5K0IA 1VTMP 2OEXA 4JTCB 4CBEA 2IXNA 1OKKA 2WZFA 3MLGA 1MNDA 2VCAA 1ZHWA 1ST6A 3U0CA 2WVQA 4HEAJ 3AQCA 1KU2A 4I44A 4XQ1A 4JJGA 4JEAA 2LFFA 3FVYA 1E2XA 3L8JA 4I3MA 3GWNA 2YLDA 1D1BA 4EBJA 3B0VC 1CGOA 2ZXOA 1G5ZA 1YVIA 1R5ID 4YL0A 4EUKB 1OXBA 2XXAA 3AGTA 2J8WA 3QW0A 1GM5A 1WN0A 1QZXA 2G62A 3W2WA 5L0CA 3HNIA 2HMQA 1ZYRF 2J9VA 1B68A 2KC3A 2L6GA 1M56C 1IW7F 1A7DA 1LVKA 3AGUA 3PDMP 2YZSA 4CDYA 2YEVA 1EKYA 2OU6A 1HMDA 4NC3A 4EBBA 1ZHXA 3JRTA 1E85A 5F5HA 1FR0A 2C03A 3ZQVA 1G4US 2WVOA 1IZMA 1TKNA 3MX3A 2A0BA 5DLJA 1Z23A 1YZCA 2ETSA 3FHDA 2OJED 1OW7A 5AGFA 1WTYA 1YZAA 4RD9A 3L1MA 2Y3HA 3R7CA 4E18A 4ZLCA 4O79A 4XEFA 5KYUB 1U0BB 2IYLD 2P7VA 5DS6A 4I1OB 1FFTC 4G78A 2Y3DA 2WB7A 4NQFA 1ZW2A 4DVYP 4XLPF 3DJUB 1ZU4A 3KMIA 3DMDA 3AG3C 1VYIA 3G4ZA 3HLZA 1ZHZA 3RYLA 3GODA 1K05A 3O10A 2DYSC 2UUHA 1RCPA 1FTSA 2R7UA 2M4EA 2A1DD 1F1MA 1OCOC 3ZTMA 4CS8C 1NBBA 4OIQF 5B1AC 4JTAB 4YK5A 2EIJC 2EPKX 1WOLA 3DM9B 4XPXA 3LS1A 3EG9A 1XWJA 4K7BA 4P6IC 3U5SA 3V5ZA 3FAJA 4AK9A 5HSWA 1RXQA 2OQMA 5KYYA 3W8HA
chains in the Genus database with same CATH topology
1I5NA 4G78A 1YVIA 4EUKB 1OXBA 2R25A 3MYFA 1WN0A 3KYJA 1TQGA 3KYIA 2Q4FA 2LCHA 2OOCA 2LD6A 1C02A 1FR0A 2LP4A 1C03A 1A0BA 1OXKA 1Y6DA 3IQTA 4PACA 1BDJB 3US6A 3U3BA 1QSPA 2A0BA 1SR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5N A;  4G78 A;  1YVI A;  4EUK B;  1OXB A;  2R25 A;  3MYF A;  1WN0 A;  3KYJ A;  1TQG A;  3KYI A;  2Q4F A;  2LCH A;  2OOC A;  2LD6 A;  1C02 A;  1FR0 A;  2LP4 A;  1C03 A;  1A0B A;  1OXK A;  1Y6D A;  3IQT A;  4PAC A;  1BDJ B;  3US6 A;  3U3B A;  1QSP A;  2A0B A;  1SR2 A; 
#chains in the Genus database with same CATH topology
 3EG9 B;  3W8I A;  3K1H A;  1TWA A;  4CX9 A;  4YT5 A;  3AJM A;  3ABL C;  1RJ9 B;  2ICW G;  3DXJ F;  5KYY B;  1VK5 A;  3N24 A;  5TJ5 E;  4DXW A;  4MVZ A;  3IQ6 A;  2XRH A;  1SF8 A;  2Y3G A;  3ATP A;  3OWT A;  4OIP F;  4M63 A;  2MHR A;  2AWC A;  1BR4 A;  2XM4 A;  4NCQ A;  2LD6 A;  1FMV A;  2YLG A;  4O6Y A;  4OIR F;  4I1M A;  5A69 A;  2FGY A;  1ORY A;  2HS5 A;  2QTV A;  1MNE A;  2KGO A;  2BL2 A;  1KNY A;  3C62 A;  1A41 A;  1D0Z A;  2CW0 F;  3GEE A;  3ITF A;  1BDJ B;  2EIM C;  2YLI A;  3L34 A;  1Q0K A;  3O55 A;  4J30 B;  3W4Y A;  3LEV A;  4JZA A;  4WJ0 A;  1BBH A;  4OIN F;  1GGQ A;  1V74 B;  2XLV A;  3N2Z B;  4U5D E;  1VMA A;  2HSB A;  4ZLD A;  4WGY A;  5B3I A;  1EQ1 A;  1OCC C;  2JD3 A;  1YLM A;  3SZR A;  5JP7 A;  2YHS A;  5CI9 A;  4KI2 A;  4U5F E;  4Q5S F;  3IPM O;  1M2O A;  4BJT A;  5E3A A;  1QPU A;  2Q7R A;  5FZT A;  2YRF A;  3AG4 C;  2GDC A;  1V54 C;  3CZ6 A;  5KYX A;  1QLE C;  2X0C A;  3B0U X;  5T3W A;  4JC7 A;  4E0H A;  3C8Z A;  5AC4 A;  3NG1 A;  1OW8 A;  2CNW A;  3ZC4 A;  3QVY A;  3C63 A;  3JTL O;  4MW8 A;  3SNH A;  3JSZ A;  2CNW D;  4EHP A;  2Q00 A;  1PCX A;  5F5F A;  1NFO A;  3ASO C;  2YL3 A;  1Z63 A;  1JMW A;  2ZD9 A;  1NU9 C;  3NRH A;  3FDQ A;  3KKB A;  2NUP A;  4Z9I A;  4MTG A;  3WOD F;  4JIO A;  4CDA A;  2LSE A;  4K1O A;  3TJ6 A;  4DRH B;  5IY5 C;  1D1C A;  4K0D A;  1SZI A;  4MVQ A;  3SXZ A;  4E0I A;  2EIN C;  2Y3B A;  2NSG A;  4JEB A;  4DRI B;  1JPJ A;  3IEE A;  2D5R B;  1YAU O;  3ZIB A;  4O6N A;  1QQ3 A;  2Q9A A;  3EFO B;  3KYJ A;  3VF0 A;  3X1O A;  2ZXR A;  4YWQ A;  3LEO A;  4W8P A;  4MND A;  3JZ0 A;  3QMK A;  2Q3T A;  3O6X A;  1O3U A;  2XLW A;  2RSE B;  5BQI A;  1D1A A;  4KC9 A;  5L3Q A;  4P9T A;  4RBN A;  3U8P A;  2WZL A;  3IQT A;  3T6J A;  3U9M A;  3ZG1 A;  1LS1 A;  1H7I A;  1G4W R;  2O9X A;  1LI7 A;  4IWB A;  2ASR A;  4U5G A;  2X51 A;  3KH2 A;  4N6H A;  3DJN B;  2EIK C;  4YJW A;  3LS0 A;  2B0H A;  4JW1 A;  1OKK D;  4XPW A;  3TOL A;  4AL0 A;  5D91 A;  3S27 A;  3RQF A;  3VAY A;  1MMG A;  1T6U A;  1OR2 A;  3EJN A;  4KBL A;  2R7V A;  4G7Z F;  5JRA A;  4IGG A;  5JLI A;  4AX2 A;  3EZH A;  3I5P A;  2YL7 A;  3MYF A;  4U5C E;  2I8B A;  2YVK A;  4EBK A;  5A6B A;  3QTH A;  3TD7 A;  5EGY A;  4RDA A;  1A7V A;  1L7C A;  2IXM A;  4MVO A;  4QI2 A;  1WAS A;  2J0W A;  4H4K C;  3ZDL A;  2OKU A;  4LDQ A;  4DVZ A;  2R7T A;  3F47 A;  4J32 B;  2W4B A;  4W8K A;  1QVX A;  3T6G B;  2R7Q A;  1Y6D A;  2CCY A;  3G4X A;  3GOR A;  4CS9 A;  4DJ9 A;  1MMN A;  1T5O A;  5COG A;  1VB5 A;  3DE8 A;  5FCL A;  5JUA A;  4BJ5 C;  3LLK A;  1AVO B;  1LM3 B;  4F4B A;  5KYU A;  2PNO A;  2EPN A;  2EPL X;  3F46 A;  1ZU5 A;  4JCZ A;  2J46 A;  4C3B A;  2J0X A;  2H7B A;  4HE8 D;  3E9V A;  1I5N A;  1M6T A;  2W4M A;  1LE4 A;  2D4U A;  3FOO A;  3U9J A;  3HNJ A;  4U5H A;  3C8G A;  3C7J A;  3HJC A;  3HTK C;  2CYD A;  1JRA A;  3JT1 A;  1CGN A;  2CDQ A;  1ZVZ A;  2HJM A;  2L9J A;  3C8G B;  4MQ9 F;  2JPU A;  2PX0 A;  4BEM J;  1T01 A;  3HNK A;  4NTA A;  2LCH A;  2FAP B;  4E7S A;  2QNL A;  3AQB A;  5COF A;  3VYW A;  2DI3 A;  4BPM A;  1VOM A;  4IAO A;  1LKX A;  4XEK A;  3S29 A;  2XL6 A;  3QVZ A;  4LLE A;  2XS8 A;  3V7O A;  1N1C A;  5EK0 A;  3JCU Q;  2GAQ A;  4O6M A;  3SYN A;  4E17 A;  4BJ6 C;  1WWP A;  4Q7C A;  1C17 M;  3K6B A;  1V55 C;  2R9R B;  4HFK B;  1OR3 A;  1RJ9 A;  5L0D A;  3K7D A;  4U5B E;  4OIO F;  2ZXP A;  2AVK A;  2I15 A;  4PJJ A;  3EHM A;  4Z9H A;  1UG7 A;  1BR2 A;  1I4Z A;  2A0U A;  4CS7 A;  1Z6A A;  2HJ3 A;  1OCZ C;  3NYJ A;  2G3V A;  2ZXW C;  4U5E E;  4OD5 A;  3SXY A;  3VRC A;  2AP3 A;  4CIP A;  2Z15 A;  1M2V A;  3HNL A;  2A68 F;  2IXP A;  1HW1 A;  1A0B A;  2WL8 A;  3B71 A;  3S28 A;  2Q9C A;  1NZE A;  1M2V B;  4IAR A;  2R02 A;  4FAP B;  2NPU A;  1ORJ A;  1PD1 A;  3DE9 A;  5BQG A;  3IHU A;  1LIH A;  4YL1 A;  2HMZ A;  3DWW A;  4IB4 A;  3TJ5 A;  1HW2 A;  1MQV A;  2R7R A;  3DZA A;  5AC5 A;  2XLO A;  3K66 A;  1Z5Z A;  3I4U A;  3GEH A;  4YL3 A;  1H9T A;  4P9F A;  4YT2 A;  1YA9 A;  3E70 C;  4X0R A;  1YYJ A;  1E86 A;  3TUL A;  4CSA C;  4JKV A;  3ZTZ A;  2NG1 A;  3BEH A;  5DQZ A;  256B A;  1TFK B;  1JOG A;  2NSF A;  3CSK A;  3ZWI A;  3AG1 C;  1UFB A;  5L0F A;  4UDV A;  1JAF A;  3C18 A;  3U2M A;  2KW3 C;  2J7P A;  4GYT A;  1LS4 A;  2OOC A;  1J8M F;  2YWA A;  3GAN A;  3RVZ A;  2R05 A;  2L81 A;  2L6H A;  1TWC A;  3X2Q C;  3CAX A;  3NKE A;  3EQL F;  4AE4 A;  3H2V A;  1QSP A;  1AEP A;  4JCH A;  2IOQ A;  5JT4 A;  2NUT B;  1RKE B;  3RW0 A;  4AE4 B;  4DRJ B;  5KYN A;  1Z7Q c;  3NMK A;  1JPN A;  1MMA A;  3ZQY A;  4MVS A;  5A6A A;  3G50 A;  1S7Z A;  2F22 A;  3UMI A;  2V26 A;  3EFO A;  4XPY A;  3LJB A;  3NDB B;  3DM5 A;  3LLI A;  3WG7 C;  3K1I C;  4MS2 A;  4R32 A;  1SYQ A;  1TQG A;  4PFP A;  2OJQ A;  3J06 A;  4BEJ A;  3KPH A;  2VC9 A;  1FMW A;  3FMS A;  3AG2 C;  4MVU A;  2EPO A;  5A6K A;  2J9W A;  4YN0 B;  4BG0 A;  3FAP B;  1GS9 A;  1HE9 A;  1K40 A;  1HMO A;  3A9C A;  3KL4 A;  3MYI A;  1SMY F;  2JX0 A;  4PJM A;  4U9E A;  4Z9J A;  3RIP A;  2P1A A;  2VCB A;  3LNR A;  4MTF A;  4QDL A;  4DOZ A;  1TR2 A;  3IQ5 A;  1D0Y A;  2BE5 F;  4AL1 A;  3AOU A;  5DS5 A;  3WAQ A;  3EGD A;  4JE9 A;  4GEH A;  3EGX B;  1LI5 A;  2XL8 A;  1ZZP A;  1OCR C;  3LUT B;  3ZSU A;  3S9O A;  3EGD B;  3TK0 A;  5L0H A;  4BJ5 A;  2R7W A;  2VAS A;  5B3S C;  4N6C A;  1CGM E;  4N06 A;  5JVE A;  2UUI A;  1EI7 A;  2HV7 A;  2LK4 A;  3EPV A;  4ULV A;  5JSL A;  2IBF A;  4IJJ A;  4KNV A;  4XWJ A;  4Q4Z F;  4CDV A;  5E3C A;  5BUO A;  2EPM X;  2WZG A;  3ABK C;  2C04 A;  4LLC A;  5A6B D;  3N0T A;  1YDI A;  1C02 A;  1VLT A;  1Q0M A;  1BR1 A;  2PP4 A;  1JR8 A;  2KYH A;  2RD9 A;  3EH2 A;  3M4B A;  4D4X A;  5L0J A;  3S0X A;  2IXO A;  3V5X A;  3FXH A;  1HY5 A;  1KTM A;  2H7O A;  4A2N B;  1CPR A;  4O7G A;  5KYW A;  1Q0F A;  2OCC C;  2QLA A;  3RH3 A;  1NG1 A;  1APC A;  1R4T A;  1SR2 A;  2PFD A;  4CS8 A;  2VCC A;  5L0I A;  3S90 A;  3GEI A;  1VYK A;  4PJN A;  4G7O F;  5KYW B;  4NY3 A;  4PK4 A;  2B0J A;  5E33 A;  1Z3I X;  4NTB A;  4WAB A;  3RQG A;  1T6Q A;  5A6J A;  4ONS A;  4D4N A;  4BJ6 A;  1FAP B;  4YT8 A;  3L0I A;  2R7O A;  4MW3 A;  1M57 C;  2DB4 A;  1E83 A;  3C8G D;  3RFY A;  2XXA B;  2Y39 A;  3U3F A;  1QKR A;  1K04 A;  4MVM A;  1LPE A;  1U89 A;  3RF3 A;  3W2V A;  4E7Z A;  3U8V A;  4MVR A;  3PHF 2;  2YQY A;  1I4Y A;  4L6R A;  1YA7 O;  1OW6 A;  4EIY A;  1RKC A;  2R03 A;  1ORS C;  1XZP A;  1NFN A;  2HV6 A;  1H9G A;  2QY9 A;  3BRJ A;  2J9B A;  3JRM O;  1DOW A;  4CJG A;  1VLS A;  4PFO A;  4PAC A;  2H7V C;  3EH1 A;  3MFN A;  1L3P A;  3ZVR A;  4C3E A;  2LFD A;  3B0P A;  2J9U A;  2XLH A;  3U3B A;  2L6F A;  4LDR A;  4G7H F;  2HFI A;  3UNG C;  3UMK A;  1T6I A;  1FNT c;  2MWQ A;  4BJ1 A;  1XZQ A;  2KQ9 A;  4G0H A;  1O87 A;  3GWL A;  2W45 A;  3A11 A;  5CI8 A;  3DI5 A;  2QE9 A;  3SXM A;  2YL0 A;  3CEX A;  4FWV A;  2Q9B A;  2QUP A;  1TWG A;  4H54 A;  3ABM C;  5F28 E;  1CPQ A;  2AU5 A;  4JJF A;  4CS9 C;  3WHN A;  4C7O A;  3IQC A;  3JSE O;  2XS1 A;  4PR9 A;  2H8A A;  2GA0 A;  2KJG A;  1T9K A;  4C7O B;  1TFO B;  4CSA A;  2KK1 A;  4N4W A;  5GPG B;  4J7T A;  5JS5 A;  1C03 A;  1OXK A;  2YL1 A;  3O39 A;  2HSQ A;  2LIG A;  3V5Y A;  1YJG A;  4CIH A;  2V3C C;  4IRU A;  3FOP A;  2WVN A;  2TMV P;  2GWW A;  5T1D B;  4XLN F;  1ZHY A;  3PCV A;  1Y4C A;  2FFH A;  3DAF A;  2VH3 A;  4ANJ A;  4JRZ A;  1S05 A;  4XEV A;  3K33 A;  4PJL A;  2P6V A;  3Q7G A;  4YT4 A;  1EA8 A;  3U2L A;  2OG2 A;  3NMI A;  4XTK A;  4EWC A;  5COM A;  5BQH A;  3L8I A;  2R25 A;  3MBG A;  4FX5 A;  5CIV A;  1OQC A;  1WAT A;  2ZPA A;  1O5H A;  1NLX A;  1W2W A;  2AWY A;  2DGJ A;  2L7A A;  3NYL A;  4MTO A;  4QI0 A;  3ASN C;  2KNH A;  1U6H A;  3SXK A;  3EZI A;  2J7P D;  1NU7 D;  2LP4 A;  3DD7 A;  3K1I A;  4LDK A;  4DBQ A;  1HE1 A;  3VM6 A;  2GFH A;  2XLE A;  4LAC B;  3T6B A;  1MMD A;  4A4A A;  2HUJ A;  3UGO A;  2R7S A;  4J7Y A;  3OEO A;  2PF4 E;  3QW1 A;  3LNM B;  2Y69 C;  2PX3 A;  1V4A A;  1RKE A;  2XL4 A;  2MYS A;  4OD4 A;  4U9D A;  2XLD A;  2NUT A;  1NSG B;  5EHH A;  4GQH A;  4B6I A;  3M15 A;  3EHN A;  5L3V A;  3H2U A;  2DYR C;  2HZ8 A;  3T9O A;  3DAG A;  3M79 A;  3RQE A;  2IM8 A;  1PD0 A;  1GQA A;  2XSE A;  1LE2 A;  4WGZ A;  2PBE A;  1G8X A;  2E87 A;  2P61 A;  3JYY A;  3SEO A;  3OA1 A;  1E84 A;  3S84 A;  3CQZ A;  5HV9 A;  2G3K A;  1H6G A;  4ULW A;  2A6H F;  1AUE A;  2OEV A;  3UGP A;  3TQO A;  3NYM A;  2EIL C;  1J8Y F;  2Q4F A;  5L0G A;  2HKV A;  4JVS A;  2KSF A;  3LAY A;  4NTF A;  4LER A;  3NKD A;  5KYX B;  3HKK A;  3H65 A;  2XM0 A;  3NMJ A;  3T4R A;  3JYH A;  2R7X A;  3GM2 A;  2A69 F;  1ZW3 A;  1Q0D A;  3US6 A;  3ECS A;  3UR3 C;  4CJO A;  3EGX A;  1D0X A;  5E2Q A;  2XLM A;  3SP1 A;  4C3D A;  1WGW A;  2VB6 A;  2YKZ A;  3I5Q A;  2P0N A;  3B29 A;  3DKA A;  2LQG A;  3GM1 A;  4IAQ A;  5DVW A;  5B1B C;  3PMR A;  1PV3 A;  2J45 A;  5T3T A;  2NUP B;  5D92 A;  1TWH A;  1BZ4 A;  2M64 A;  4EKW A;  4KNW A;  3Q6N A;  3M1C B;  4JUR I;  1ZHT A;  2A6E F;  3B9Q A;  1DOV A;  4FES A;  3POV A;  1FFH A;  3R2P A;  4HFF B;  3M4C A;  4ER9 A;  1RMV A;  1A7E A;  2CGE A;  2W9Y A;  3GM3 A;  3Q7L A;  4JTD B;  1Q0G A;  1YAR O;  3Q6M A;  3RVY A;  3KYI A;  2BC5 A;  3RKO F;  3TOM A;  5DQT A;  5DS4 A;  4DBR A;  3UMH A;  3QZC A;  1YYX A;  3LES A;  5K0I A;  1VTM P;  2OEX A;  4JTC B;  4CBE A;  2IXN A;  1OKK A;  2WZF A;  3MLG A;  1MND A;  2VCA A;  1ZHW A;  1ST6 A;  3U0C A;  2WVQ A;  4HEA J;  3AQC A;  1KU2 A;  4I44 A;  4XQ1 A;  4JJG A;  4JEA A;  2LFF A;  3FVY A;  1E2X A;  3L8J A;  4I3M A;  3GWN A;  2YLD A;  1D1B A;  4EBJ A;  3B0V C;  1CGO A;  2ZXO A;  1G5Z A;  1YVI A;  1R5I D;  4YL0 A;  4EUK B;  1OXB A;  2XXA A;  3AGT A;  2J8W A;  3QW0 A;  1GM5 A;  1WN0 A;  1QZX A;  2G62 A;  3W2W A;  5L0C A;  3HNI A;  2HMQ A;  1ZYR F;  2J9V A;  1B68 A;  2KC3 A;  2L6G A;  1M56 C;  1IW7 F;  1A7D A;  1LVK A;  3AGU A;  3PDM P;  2YZS A;  4CDY A;  2YEV A;  1EKY A;  2OU6 A;  1HMD A;  4NC3 A;  4EBB A;  1ZHX A;  3JRT A;  1E85 A;  5F5H A;  1FR0 A;  2C03 A;  3ZQV A;  1G4U S;  2WVO A;  1IZM A;  1TKN A;  3MX3 A;  2A0B A;  5DLJ A;  1Z23 A;  1YZC A;  2ETS A;  3FHD A;  2OJE D;  1OW7 A;  5AGF A;  1WTY A;  1YZA A;  4RD9 A;  3L1M A;  2Y3H A;  3R7C A;  4E18 A;  4ZLC A;  4O79 A;  4XEF A;  5KYU B;  1U0B B;  2IYL D;  2P7V A;  5DS6 A;  4I1O B;  1FFT C;  4G78 A;  2Y3D A;  2WB7 A;  4NQF A;  1ZW2 A;  4DVY P;  4XLP F;  3DJU B;  1ZU4 A;  3KMI A;  3DMD A;  3AG3 C;  1VYI A;  3G4Z A;  3HLZ A;  1ZHZ A;  3RYL A;  3GOD A;  1K05 A;  3O10 A;  2DYS C;  2UUH A;  1RCP A;  1FTS A;  2R7U A;  2M4E A;  2A1D D;  1F1M A;  1OCO C;  3ZTM A;  4CS8 C;  1NBB A;  4OIQ F;  5B1A C;  4JTA B;  4YK5 A;  2EIJ C;  2EPK X;  1WOL A;  3DM9 B;  4XPX A;  3LS1 A;  3EG9 A;  1XWJ A;  4K7B A;  4P6I C;  3U5S A;  3V5Z A;  3FAJ A;  4AK9 A;  5HSW A;  1RXQ A;  2OQM A;  5KYY A;  3W8H A; 
#chains in the Genus database with same CATH homology
 1I5N A;  4G78 A;  1YVI A;  4EUK B;  1OXB A;  2R25 A;  3MYF A;  1WN0 A;  3KYJ A;  1TQG A;  3KYI A;  2Q4F A;  2LCH A;  2OOC A;  2LD6 A;  1C02 A;  1FR0 A;  2LP4 A;  1C03 A;  1A0B A;  1OXK A;  1Y6D A;  3IQT A;  4PAC A;  1BDJ B;  3US6 A;  3U3B A;  1QSP A;  2A0B A;  1SR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...