1OXBA

Complex between ypd1 and sln1 response regulator domain in space group p2(1)2(1)2(1)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
166
structure length
166
Chain Sequence
b'STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ypd1p
publication title The yeast YPD1/SLN1 complex: insights into molecular recognition in two-component signaling systems.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 66
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2003-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1oxbA00
1SR2A 2Q4FA 2OOCA 3US6A 1BDJB 1C03A 3U3BA 1WN0A 2R25A 1Y6DA 2A0BA 3MYFA 1OXKA 1TQGA 4PACA 3KYJA 1FR0A 3KYIA 4G78A 2LP4A 3IQTA 4EUKB 1C02A 1OXBA 1A0BA 1YVIA 2LD6A 1I5NA 1QSPA 2LCHA
chains in the Genus database with same CATH superfamily
3X2QC 3GWNA 4CDAA 3FAJA 3J06A 3PMRA 4U5CE 1ZHYA 3FMSA 1A41A 1TWCA 3SP1A 1WGWA 1GM5A 1C17M 4HEAJ 4O6YA 1NBBA 3V5ZA 2WL8A 3O55A 1JOGA 1VLSA 4CIPA 1TR2A 4EBJA 5KYXB 2XXAB 1R5ID 2ETSA 4BG0A 5L0HA 2R7VA 1FNTc 3EJNA 3FXHA 1GS9A 4RD9A 3TJ5A 2CYDA 1EI7A 4CS9C 4IARA 1HE9A 1CPRA 1FMVA 4JTDB 5FCLA 1C02A 2XLWA 3GEHA 2LFDA 2XL6A 3F46A 3MX3A 2DI3A 2EPLX 4U5HA 2YL3A 1Z5ZA 2NSGA 2HV6A 4JRZA 2QTVA 4XLNF 1LVKA 1YDIA 4E7ZA 2H7VC 2J7PA 4AE4B 3DKAA 3FOPA 2ASRA 4O7GA 1D1BA 1M57C 3N24A 2XRHA 3W8HA 1BDJB 2OCCC 2R7XA 3NKDA 2XLDA 2YQYA 3A11A 3DAFA 1OR2A 1A7DA 5D91A 2R25A 5EK0A 3AGUA 2EIKC 3NYJA 4CDYA 2D5RB 5BQHA 3WAQA 3IEEA 4BJ6A 3RQGA 3GEIA 1K04A 5AC5A 3UGOA 2ICWG 3IQTA 1YAUO 1E2XA 3K1IA 4PJLA 3K6BA 1G4WR 4H4KC 3KKBA 1OXBA 4DBRA 5HSWA 1LE2A 1A0BA 1MMGA 3W8IA 3T6JA 2CNWD 1VYIA 4WJ0A 5KYYA 2KYHA 1O3UA 1ZHTA 4NCQA 4XTKA 3S27A 4EKWA 3HNKA 1ZVZA 5A69A 3EFOA 1V4AA 2YL7A 4JE9A 2XLVA 3C62A 5K0IA 2AVKA 1N1CA 4EBKA 3S9OA 2Y69C 2MWQA 4DBQA 4LERA 3RW0A 2XXAA 1BR2A 5KYXA 2P6VA 2IXNA 3FAPB 1HW2A 4XEFA 4EBBA 4MVRA 2R7UA 2XLHA 3KYJA 2NPUA 3UNGC 3ZTMA 3FDQA 5B3SC 5DS6A 1VLTA 2WZLA 2J9UA 4G78A 4CIHA 1ZW3A 2QE9A 3TQOA 5L0GA 4AX2A 4XEKA 1ST6A 4BEJA 1ORYA 2EIMC 1RKCA 2UUHA 1CGME 1YVIA 2A0UA 4J7YA 2ZD9A 1H6GA 3JT1A 3M79A 4MVUA 2GFHA 4W8KA 4HE8D 2PFDA 3M15A 4JC7A 4LDQA 4YL0A 1TWHA 5TJ5E 3S28A 2J0WA 2Z15A 2PNOA 1V74B 2W9YA 1MNEA 1QKRA 2IXPA 2Y39A 3NMIA 3EQLF 4RDAA 2L81A 4NQFA 2H8AA 3KH2A 4C7OB 3N0TA 4YWQA 4JCHA 1QZXA 4U9DA 1LM3B 3ZTZA 1NZEA 2D4UA 4JVSA 4JEBA 2R03A 4IAQA 4R32A 1BR4A 1NFOA 2J8WA 4A4AA 4CJOA 4DVZA 4EWCA 1JAFA 3MYFA 2Q7RA 3U0CA 2Y3DA 2AWYA 1OCCC 3ABMC 3LEOA 4D4NA 4QDLA 1OQCA 4DOZA 2X51A 3DJNB 2OKUA 1HW1A 5CI8A 3POVA 1MNDA 1EKYA 3DM9B 4N06A 3SXZA 1T6QA 3WG7C 4BJ5A 5DQTA 3RVZA 1L7CA 3HNJA 1D0XA 1WWPA 1YYJA 2JPUA 2Q00A 3U9JA 5JUAA 4P9FA 1A7EA 3UR3C 2A68F 4BJ6C 1MQVA 1S7ZA 4LLCA 2EPNA 4YT4A 1T9KA 3QW0A 3WODF 1OW7A 1Q0FA 4NC3A 1PD0A 3K1IC 5F28E 4DXWA 3V5XA 3ASNC 5IY5C 1FFHA 2J7PD 2YL0A 3UMKA 3V5YA 1O87A 3G4ZA 3HJCA 3B71A 3C63A 3JRMO 3NDBB 1WASA 4IB4A 2KK1A 4I1MA 1T5OA 1ZHZA 3SNHA 4CX9A 5L0JA 1CGOA 4HFFB 3MFNA 2AP3A 2YHSA 5AGFA 4DRIB 2QUPA 3ABLC 3ZG1A 4BJ1A 4EIYA 4MVMA 1JPJA 1R4TA 2WVQA 5T3TA 2VASA 4FX5A 3AJMA 4XPXA 3M4BA 4GYTA 4H54A 4AL0A 1PCXA 2VCCA 2BL2A 2IM8A 2LCHA 2NG1A 1HMDA 2L6HA 1D1AA 2XLMA 5KYYB 3HTKC 4NTAA 1RJ9A 1UG7A 3QVZA 5F5HA 2CCYA 3EFOB 4OD4A 4U5FE 1FAPB 3UGPA 4P9TA 3ECSA 3O10A 3ZSUA 2PBEA 2YLDA 3L0IA 4PR9A 4PJNA 3ZVRA 2Q9BA 3B0PA 5A6JA 4Q4ZF 1Z6AA 3HNIA 1YJGA 3B0VC 3UMIA 1QLEC 4CJGA 2WB7A 5D92A 1OKKA 3GM2A 1TWAA 3V7OA 4BEMJ 3S90A 3EGXB 3DMDA 1VB5A 1IW7F 1D0YA 3TK0A 4YL3A 2V3CC 4CSAA 2CW0F 4U5GA 3AOUA 1CGNA 2IBFA 5DLJA 2J46A 1JPNA 1I5NA 3C7JA 3GORA 4G0HA 5L0IA 3DXJF 3U8PA 1Z63A 3Q7LA 4ANJA 2KW3C 3ZQYA 4AK9A 1IZMA 4YK5A 3VF0A 5DS5A 3NMKA 1MMDA 5A6BA 3IQCA 2HMZA 4OIOF 2HMQA 5KYUA 4BJ5C 4D4XA 3EG9A 2XM4A 2J9BA 1LE4A 1WOLA 4FESA 3U3BA 2R7SA 3L8IA 3IHUA 3W2VA 1FMWA 5KYWA 5COGA 1U6HA 2HSBA 1ORJA 3G50A 2OG2A 1E84A 4OIQF 4LACB 5JT4A 2W4BA 4MVQA 3VAYA 3ZWIA 2VCAA 3W4YA 1MMNA 4BJTA 1G5ZA 1LPEA 3SZRA 1TKNA 1ORSC 1SF8A 2L9JA 4F4BA 5E2QA 1Q0GA 3RVYA 4E0IA 2EPKX 1H9TA 2LIGA 3C8ZA 1T6UA 1YLMA 2LD6A 2CDQA 2LSEA 5AC4A 4MW8A 4O6NA 3HNLA 3NMJA 3EGDA 2R02A 3U3FA 3DM5A 1I4ZA 5JLIA 1E86A 4LLEA 3QW1A 1Q0DA 2UUIA 5B3IA 1D1CA 3US6A 4JJFA 2E87A 2C03A 5JP7A 1M6TA 4AL1A 2H7OA 2JX0A 1M56C 4YT2A 2QLAA 3NYMA 1RKEA 2Y3HA 4GEHA 1M2VB 2A6EF 2XL4A 4MVOA 3EGXA 1TWGA 4K0DA 4G7HF 4PFOA 4N6HA 1YARO 3CQZA 3RFYA 4I1OB 1Z7Qc 2ZXWC 3CAXA 3O6XA 1PV3A 2Q3TA 1A7VA 2J9VA 1V54C 1OW6A 4PJMA 5EGYA 2HKVA 4JEAA 1CPQA 1B68A 1NSGB 3LS1A 2MYSA 3B29A 3E70C 4FWVA 5A6KA 3ABKC 2OU6A 4U9EA 3RF3A 3AGTA 3H2UA 1Y4CA 4IAOA 3PHF2 2XLOA 5L3VA 4E17A 2Y3GA 2FFHA 2EPOA 3TD7A 3H2VA 2OOCA 4EHPA 2OEXA 4CSAC 3FOOA 4IWBA 3T6BA 3QTHA 1OW8A 4DRJB 1RJ9B 2P7VA 3ZDLA 4MNDA 2CGEA 2NSFA 3I5PA 4IJJA 4PJJA 5EHHA 1JRAA 2PX0A 5F5FA 3NRHA 1V55C 3I5QA 3O39A 4X0RA 1OCOC 4E18A 1VTMP 3MYIA 1KTMA 1O5HA 3JCUQ 1T01A 4JW1A 2P1AA 2IXMA 3R7CA 2OEVA 3EH1A 4JIOA 1U0BB 2XS8A 1OKKD 1VMAA 2O9XA 2DGJA 1XWJA 3VYWA 3IQ6A 2YLGA 4J7TA 4MQ9F 3B0UX 3LNMB 3DJUB 3EHMA 5CIVA 2BC5A 4MTFA 2L7AA 4N6CA 2DYRC 3OA1A 2FAPB 3EHNA 4UDVA 2HJMA 2Q4FA 3T6GB 4E0HA 3LESA 2KNHA 2V26A 1ZW2A 1YZAA 1L3PA 1M2VA 2R7RA 3EH2A 5JSLA 2Q9CA 4OIPF 5KYUB 5A6BD 3EG9B 3RIPA 3ITFA 1TQGA 3PDMP 3CSKA 2IXOA 1VK5A 4XEVA 5KYWB 3KPHA 4OINF 5BQIA 3LEVA 3NYLA 4YL1A 2HUJA 2ZPAA 3MLGA 3L8JA 4K7BA 1OR3A 3QMKA 2A69F 3R2PA 3DI5A 5E3CA 2I15A 1VOMA 2PX3A 3U8VA 4C3BA 1E85A 3OEOA 4ULWA 1HY5A 3U9MA 5DS4A 2WZGA 4YN0B 2YWAA 3M1CB 3FVYA 1RXQA 4IRUA 3QVYA 3VRCA 4IGGA 4MTOA 1PD1A 3IQ5A 3JRTA 4QI0A 2J45A 1LI5A 2OJED 4Q5SF 1EQ1A 4ZLDA 3EGDB 1SZIA 4PFPA 4I3MA 1QPUA 3M4CA 2FGYA 5T1DB 2BE5F 1Z23A 3I4UA 5L3QA 4NTFA 3HLZA 4DRHB 1WN0A 4Z9IA 2Y3BA 5DQZA 4XWJA 2LQGA 3NKEA 4U5DE 1YA7O 4WABA 2OJQA 4CS7A 5JS5A 5L0FA 5GPGB 2A0BA 5B1BC 5COMA 4CBEA 3KL4A 3LNRA 1KU2A 1RKEB 4RBNA 1YYXA 3CZ6A 5CI9A 1E83A 1DOWA 1JMWA 1ZHXA 3SXYA 2LK4A 3CEXA 4KC9A 3DZAA 1NU7D 2OQMA 1UFBA 2AWCA 2VCBA 1J8MF 3DE9A 1KNYA 4JZAA 3DE8A 1LIHA 3EZIA 3N2ZB 5DVWA 3DD7A 3GANA 1J8YF 2P0NA 2VC9A 4OD5A 3K66A 2KSFA 4LDKA 1SR2A 3SEOA 2EILC 2ZXOA 2HS5A 2YVKA 5JVEA 4XLPF 2TMVP 256BA 1U89A 3JYYA 3G4XA 1AUEA 3IPMO 4L6RA 4LDRA 2HV7A 4K1OA 2F22A 5T3WA 3LLIA 2W4MA 1WATA 1H9GA 3UMHA 4PACA 3L34A 4NTBA 1BR1A 1SMYF 2YLIA 4ZLCA 2J0XA 2M4EA 2VH3A 3C18A 3GWLA 1GQAA 1LS4A 3LLKA 4JTCB 4P6IC 1LI7A 3ZQVA 3RH3A 3DAGA 3SXKA 5JRAA 1I4YA 1D0ZA 2EINC 3HKKA 2H7BA 3ASOC 4XPYA 2G62A 3S0XA 3RQFA 1ZZPA 3K7DA 4B6IA 2HFIA 5KYNA 2RSEB 3OWTA 3SYNA 1ZHWA 5COFA 4Z9JA 5E3AA 3U2MA 1YZCA 2XS1A 2A6HF 3RQEA 1W2WA 3AQBA 1XZQA 4Q7CA 2P61A 1K05A 2KGOA 1BBHA 3KMIA 1C03A 3JYHA 1Q0MA 4J32B 4G7OF 4YJWA 1APCA 2A1DD 1RMVA 2NUPB 4BPMA 4CS8A 2L6GA 1ZYRF 1ZU4A 4W8PA 1OXKA 3C8GA 2IYLD 5E33A 3VM6A 1FR0A 3KYIA 2LP4A 3S29A 4ONSA 1SYQA 1TFKB 3SXMA 1G8XA 2JD3A 2R05A 3AQCA 3ZC4A 2G3VA 4XPWA 2R9RB 3A9CA 2ZXRA 4DVYP 2KQ9A 3AG2C 1HE1A 2HSQA 4MTGA 4YT5A 3B9QA 4JJGA 3U5SA 3T4RA 1QQ3A 2R7QA 1EA8A 1LKXA 3L1MA 4KBLA 3PCVA 2C04A 4C3DA 1AEPA 2GDCA 2XLEA 4YT8A 1QVXA 2HZ8A 4WGZA 3TJ6A 5B1AC 3LJBA 2B0HA 1H7IA 2KC3A 3ZIBA 4U5EE 2L6FA 1YA9A 2W45A 3AG4C 4MVSA 3W2WA 4OIRF 5L0DA 3S84A 3MBGA 3Q7GA 3AG3C 2QY9A 3BEHA 3GEEA 4MVZA 1OCRC 4C3EA 2MHRA 3EZHA 2M64A 1JR8A 3H65A 3JTLO 4JURI 2WVOA 4O6MA 3BRJA 2NUTB 3NG1A 2DB4A 2XSEA 3K1HA 4AE4A 4FAPB 1VYKA 4MW3A 3DWWA 4J30B 5FZTA 3RYLA 2R7WA 1MMAA 3Q6MA 2GA0A 4JTAB 4U5BE 3GODA 2XL8A 4JCZA 4CS9A 2GAQA 2AU5A 3K33A 2QNLA 2NUPA 3EPVA 3AG1C 3U2LA 3RKOF 5HV9A 4KI2A 3TOMA 4Z9HA 4I44A 4A2NB 2KJGA 2YRFA 4E7SA 1BZ4A 1M2OA 2WVNA 3WHNA 4QI2A 4O79A 1G4US 2CNWA 1DOVA 4EUKB 2R7TA 4HFKB 4XQ1A 4N4WA 2YL1A 2X0CA 4CDVA 4ER9A 2G3KA 1LS1A 4CS8C 2YEVA 1NLXA 1T6IA 1Z3IX 2B0JA 4KNVA 1XZPA 2HJ3A 3JSEO 2VB6A 5BUOA 1FTSA 2PF4E 5BQGA 4M63A 2I8BA 4MS2A 4KNWA 2GWWA 2R7OA 1AVOB 1S05A 3LUTB 1Q0KA 2YZSA 3X1OA 1NFNA 2XM0A 3LS0A 4GQHA 3JZ0A 1Y6DA 1GGQA 2IOQA 2J9WA 2YKZA 4WGYA 3FHDA 4ULVA 3TOLA 3T9OA 3E9VA 2PP4A 2EPMX 3JSZA 3LAYA 1TFOB 1RCPA 1OCZC 2DYSC 2ZXPA 1F1MA 3C8GB 3GM3A 2NUTA 2WZFA 4JKVA 1HMOA 4NY3A 3C8GD 1FFTC 3QZCA 3TULA 4DJ9A 1K40A 1ZU5A 5A6AA 1NU9C 2Q9AA 1WTYA 4G7ZF 2RD9A 1QSPA 3GM1A 3Q6NA 5L0CA 2LFFA 1NG1A 4PK4A 3F47A 4C7OA 2EIJC 3ATPA
chains in the Genus database with same CATH topology
1SR2A 2Q4FA 2OOCA 3US6A 1BDJB 1C03A 3U3BA 1WN0A 2R25A 1Y6DA 2A0BA 3MYFA 1OXKA 1TQGA 4PACA 3KYJA 1FR0A 3KYIA 4G78A 2LP4A 3IQTA 4EUKB 1C02A 1OXBA 1A0BA 1YVIA 2LD6A 1I5NA 1QSPA 2LCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SR2 A;  2Q4F A;  2OOC A;  3US6 A;  1BDJ B;  1C03 A;  3U3B A;  1WN0 A;  2R25 A;  1Y6D A;  2A0B A;  3MYF A;  1OXK A;  1TQG A;  4PAC A;  3KYJ A;  1FR0 A;  3KYI A;  4G78 A;  2LP4 A;  3IQT A;  4EUK B;  1C02 A;  1OXB A;  1A0B A;  1YVI A;  2LD6 A;  1I5N A;  1QSP A;  2LCH A; 
#chains in the Genus database with same CATH topology
 3X2Q C;  3GWN A;  4CDA A;  3FAJ A;  3J06 A;  3PMR A;  4U5C E;  1ZHY A;  3FMS A;  1A41 A;  1TWC A;  3SP1 A;  1WGW A;  1GM5 A;  1C17 M;  4HEA J;  4O6Y A;  1NBB A;  3V5Z A;  2WL8 A;  3O55 A;  1JOG A;  1VLS A;  4CIP A;  1TR2 A;  4EBJ A;  5KYX B;  2XXA B;  1R5I D;  2ETS A;  4BG0 A;  5L0H A;  2R7V A;  1FNT c;  3EJN A;  3FXH A;  1GS9 A;  4RD9 A;  3TJ5 A;  2CYD A;  1EI7 A;  4CS9 C;  4IAR A;  1HE9 A;  1CPR A;  1FMV A;  4JTD B;  5FCL A;  1C02 A;  2XLW A;  3GEH A;  2LFD A;  2XL6 A;  3F46 A;  3MX3 A;  2DI3 A;  2EPL X;  4U5H A;  2YL3 A;  1Z5Z A;  2NSG A;  2HV6 A;  4JRZ A;  2QTV A;  4XLN F;  1LVK A;  1YDI A;  4E7Z A;  2H7V C;  2J7P A;  4AE4 B;  3DKA A;  3FOP A;  2ASR A;  4O7G A;  1D1B A;  1M57 C;  3N24 A;  2XRH A;  3W8H A;  1BDJ B;  2OCC C;  2R7X A;  3NKD A;  2XLD A;  2YQY A;  3A11 A;  3DAF A;  1OR2 A;  1A7D A;  5D91 A;  2R25 A;  5EK0 A;  3AGU A;  2EIK C;  3NYJ A;  4CDY A;  2D5R B;  5BQH A;  3WAQ A;  3IEE A;  4BJ6 A;  3RQG A;  3GEI A;  1K04 A;  5AC5 A;  3UGO A;  2ICW G;  3IQT A;  1YAU O;  1E2X A;  3K1I A;  4PJL A;  3K6B A;  1G4W R;  4H4K C;  3KKB A;  1OXB A;  4DBR A;  5HSW A;  1LE2 A;  1A0B A;  1MMG A;  3W8I A;  3T6J A;  2CNW D;  1VYI A;  4WJ0 A;  5KYY A;  2KYH A;  1O3U A;  1ZHT A;  4NCQ A;  4XTK A;  3S27 A;  4EKW A;  3HNK A;  1ZVZ A;  5A69 A;  3EFO A;  1V4A A;  2YL7 A;  4JE9 A;  2XLV A;  3C62 A;  5K0I A;  2AVK A;  1N1C A;  4EBK A;  3S9O A;  2Y69 C;  2MWQ A;  4DBQ A;  4LER A;  3RW0 A;  2XXA A;  1BR2 A;  5KYX A;  2P6V A;  2IXN A;  3FAP B;  1HW2 A;  4XEF A;  4EBB A;  4MVR A;  2R7U A;  2XLH A;  3KYJ A;  2NPU A;  3UNG C;  3ZTM A;  3FDQ A;  5B3S C;  5DS6 A;  1VLT A;  2WZL A;  2J9U A;  4G78 A;  4CIH A;  1ZW3 A;  2QE9 A;  3TQO A;  5L0G A;  4AX2 A;  4XEK A;  1ST6 A;  4BEJ A;  1ORY A;  2EIM C;  1RKC A;  2UUH A;  1CGM E;  1YVI A;  2A0U A;  4J7Y A;  2ZD9 A;  1H6G A;  3JT1 A;  3M79 A;  4MVU A;  2GFH A;  4W8K A;  4HE8 D;  2PFD A;  3M15 A;  4JC7 A;  4LDQ A;  4YL0 A;  1TWH A;  5TJ5 E;  3S28 A;  2J0W A;  2Z15 A;  2PNO A;  1V74 B;  2W9Y A;  1MNE A;  1QKR A;  2IXP A;  2Y39 A;  3NMI A;  3EQL F;  4RDA A;  2L81 A;  4NQF A;  2H8A A;  3KH2 A;  4C7O B;  3N0T A;  4YWQ A;  4JCH A;  1QZX A;  4U9D A;  1LM3 B;  3ZTZ A;  1NZE A;  2D4U A;  4JVS A;  4JEB A;  2R03 A;  4IAQ A;  4R32 A;  1BR4 A;  1NFO A;  2J8W A;  4A4A A;  4CJO A;  4DVZ A;  4EWC A;  1JAF A;  3MYF A;  2Q7R A;  3U0C A;  2Y3D A;  2AWY A;  1OCC C;  3ABM C;  3LEO A;  4D4N A;  4QDL A;  1OQC A;  4DOZ A;  2X51 A;  3DJN B;  2OKU A;  1HW1 A;  5CI8 A;  3POV A;  1MND A;  1EKY A;  3DM9 B;  4N06 A;  3SXZ A;  1T6Q A;  3WG7 C;  4BJ5 A;  5DQT A;  3RVZ A;  1L7C A;  3HNJ A;  1D0X A;  1WWP A;  1YYJ A;  2JPU A;  2Q00 A;  3U9J A;  5JUA A;  4P9F A;  1A7E A;  3UR3 C;  2A68 F;  4BJ6 C;  1MQV A;  1S7Z A;  4LLC A;  2EPN A;  4YT4 A;  1T9K A;  3QW0 A;  3WOD F;  1OW7 A;  1Q0F A;  4NC3 A;  1PD0 A;  3K1I C;  5F28 E;  4DXW A;  3V5X A;  3ASN C;  5IY5 C;  1FFH A;  2J7P D;  2YL0 A;  3UMK A;  3V5Y A;  1O87 A;  3G4Z A;  3HJC A;  3B71 A;  3C63 A;  3JRM O;  3NDB B;  1WAS A;  4IB4 A;  2KK1 A;  4I1M A;  1T5O A;  1ZHZ A;  3SNH A;  4CX9 A;  5L0J A;  1CGO A;  4HFF B;  3MFN A;  2AP3 A;  2YHS A;  5AGF A;  4DRI B;  2QUP A;  3ABL C;  3ZG1 A;  4BJ1 A;  4EIY A;  4MVM A;  1JPJ A;  1R4T A;  2WVQ A;  5T3T A;  2VAS A;  4FX5 A;  3AJM A;  4XPX A;  3M4B A;  4GYT A;  4H54 A;  4AL0 A;  1PCX A;  2VCC A;  2BL2 A;  2IM8 A;  2LCH A;  2NG1 A;  1HMD A;  2L6H A;  1D1A A;  2XLM A;  5KYY B;  3HTK C;  4NTA A;  1RJ9 A;  1UG7 A;  3QVZ A;  5F5H A;  2CCY A;  3EFO B;  4OD4 A;  4U5F E;  1FAP B;  3UGP A;  4P9T A;  3ECS A;  3O10 A;  3ZSU A;  2PBE A;  2YLD A;  3L0I A;  4PR9 A;  4PJN A;  3ZVR A;  2Q9B A;  3B0P A;  5A6J A;  4Q4Z F;  1Z6A A;  3HNI A;  1YJG A;  3B0V C;  3UMI A;  1QLE C;  4CJG A;  2WB7 A;  5D92 A;  1OKK A;  3GM2 A;  1TWA A;  3V7O A;  4BEM J;  3S90 A;  3EGX B;  3DMD A;  1VB5 A;  1IW7 F;  1D0Y A;  3TK0 A;  4YL3 A;  2V3C C;  4CSA A;  2CW0 F;  4U5G A;  3AOU A;  1CGN A;  2IBF A;  5DLJ A;  2J46 A;  1JPN A;  1I5N A;  3C7J A;  3GOR A;  4G0H A;  5L0I A;  3DXJ F;  3U8P A;  1Z63 A;  3Q7L A;  4ANJ A;  2KW3 C;  3ZQY A;  4AK9 A;  1IZM A;  4YK5 A;  3VF0 A;  5DS5 A;  3NMK A;  1MMD A;  5A6B A;  3IQC A;  2HMZ A;  4OIO F;  2HMQ A;  5KYU A;  4BJ5 C;  4D4X A;  3EG9 A;  2XM4 A;  2J9B A;  1LE4 A;  1WOL A;  4FES A;  3U3B A;  2R7S A;  3L8I A;  3IHU A;  3W2V A;  1FMW A;  5KYW A;  5COG A;  1U6H A;  2HSB A;  1ORJ A;  3G50 A;  2OG2 A;  1E84 A;  4OIQ F;  4LAC B;  5JT4 A;  2W4B A;  4MVQ A;  3VAY A;  3ZWI A;  2VCA A;  3W4Y A;  1MMN A;  4BJT A;  1G5Z A;  1LPE A;  3SZR A;  1TKN A;  1ORS C;  1SF8 A;  2L9J A;  4F4B A;  5E2Q A;  1Q0G A;  3RVY A;  4E0I A;  2EPK X;  1H9T A;  2LIG A;  3C8Z A;  1T6U A;  1YLM A;  2LD6 A;  2CDQ A;  2LSE A;  5AC4 A;  4MW8 A;  4O6N A;  3HNL A;  3NMJ A;  3EGD A;  2R02 A;  3U3F A;  3DM5 A;  1I4Z A;  5JLI A;  1E86 A;  4LLE A;  3QW1 A;  1Q0D A;  2UUI A;  5B3I A;  1D1C A;  3US6 A;  4JJF A;  2E87 A;  2C03 A;  5JP7 A;  1M6T A;  4AL1 A;  2H7O A;  2JX0 A;  1M56 C;  4YT2 A;  2QLA A;  3NYM A;  1RKE A;  2Y3H A;  4GEH A;  1M2V B;  2A6E F;  2XL4 A;  4MVO A;  3EGX A;  1TWG A;  4K0D A;  4G7H F;  4PFO A;  4N6H A;  1YAR O;  3CQZ A;  3RFY A;  4I1O B;  1Z7Q c;  2ZXW C;  3CAX A;  3O6X A;  1PV3 A;  2Q3T A;  1A7V A;  2J9V A;  1V54 C;  1OW6 A;  4PJM A;  5EGY A;  2HKV A;  4JEA A;  1CPQ A;  1B68 A;  1NSG B;  3LS1 A;  2MYS A;  3B29 A;  3E70 C;  4FWV A;  5A6K A;  3ABK C;  2OU6 A;  4U9E A;  3RF3 A;  3AGT A;  3H2U A;  1Y4C A;  4IAO A;  3PHF 2;  2XLO A;  5L3V A;  4E17 A;  2Y3G A;  2FFH A;  2EPO A;  3TD7 A;  3H2V A;  2OOC A;  4EHP A;  2OEX A;  4CSA C;  3FOO A;  4IWB A;  3T6B A;  3QTH A;  1OW8 A;  4DRJ B;  1RJ9 B;  2P7V A;  3ZDL A;  4MND A;  2CGE A;  2NSF A;  3I5P A;  4IJJ A;  4PJJ A;  5EHH A;  1JRA A;  2PX0 A;  5F5F A;  3NRH A;  1V55 C;  3I5Q A;  3O39 A;  4X0R A;  1OCO C;  4E18 A;  1VTM P;  3MYI A;  1KTM A;  1O5H A;  3JCU Q;  1T01 A;  4JW1 A;  2P1A A;  2IXM A;  3R7C A;  2OEV A;  3EH1 A;  4JIO A;  1U0B B;  2XS8 A;  1OKK D;  1VMA A;  2O9X A;  2DGJ A;  1XWJ A;  3VYW A;  3IQ6 A;  2YLG A;  4J7T A;  4MQ9 F;  3B0U X;  3LNM B;  3DJU B;  3EHM A;  5CIV A;  2BC5 A;  4MTF A;  2L7A A;  4N6C A;  2DYR C;  3OA1 A;  2FAP B;  3EHN A;  4UDV A;  2HJM A;  2Q4F A;  3T6G B;  4E0H A;  3LES A;  2KNH A;  2V26 A;  1ZW2 A;  1YZA A;  1L3P A;  1M2V A;  2R7R A;  3EH2 A;  5JSL A;  2Q9C A;  4OIP F;  5KYU B;  5A6B D;  3EG9 B;  3RIP A;  3ITF A;  1TQG A;  3PDM P;  3CSK A;  2IXO A;  1VK5 A;  4XEV A;  5KYW B;  3KPH A;  4OIN F;  5BQI A;  3LEV A;  3NYL A;  4YL1 A;  2HUJ A;  2ZPA A;  3MLG A;  3L8J A;  4K7B A;  1OR3 A;  3QMK A;  2A69 F;  3R2P A;  3DI5 A;  5E3C A;  2I15 A;  1VOM A;  2PX3 A;  3U8V A;  4C3B A;  1E85 A;  3OEO A;  4ULW A;  1HY5 A;  3U9M A;  5DS4 A;  2WZG A;  4YN0 B;  2YWA A;  3M1C B;  3FVY A;  1RXQ A;  4IRU A;  3QVY A;  3VRC A;  4IGG A;  4MTO A;  1PD1 A;  3IQ5 A;  3JRT A;  4QI0 A;  2J45 A;  1LI5 A;  2OJE D;  4Q5S F;  1EQ1 A;  4ZLD A;  3EGD B;  1SZI A;  4PFP A;  4I3M A;  1QPU A;  3M4C A;  2FGY A;  5T1D B;  2BE5 F;  1Z23 A;  3I4U A;  5L3Q A;  4NTF A;  3HLZ A;  4DRH B;  1WN0 A;  4Z9I A;  2Y3B A;  5DQZ A;  4XWJ A;  2LQG A;  3NKE A;  4U5D E;  1YA7 O;  4WAB A;  2OJQ A;  4CS7 A;  5JS5 A;  5L0F A;  5GPG B;  2A0B A;  5B1B C;  5COM A;  4CBE A;  3KL4 A;  3LNR A;  1KU2 A;  1RKE B;  4RBN A;  1YYX A;  3CZ6 A;  5CI9 A;  1E83 A;  1DOW A;  1JMW A;  1ZHX A;  3SXY A;  2LK4 A;  3CEX A;  4KC9 A;  3DZA A;  1NU7 D;  2OQM A;  1UFB A;  2AWC A;  2VCB A;  1J8M F;  3DE9 A;  1KNY A;  4JZA A;  3DE8 A;  1LIH A;  3EZI A;  3N2Z B;  5DVW A;  3DD7 A;  3GAN A;  1J8Y F;  2P0N A;  2VC9 A;  4OD5 A;  3K66 A;  2KSF A;  4LDK A;  1SR2 A;  3SEO A;  2EIL C;  2ZXO A;  2HS5 A;  2YVK A;  5JVE A;  4XLP F;  2TMV P;  256B A;  1U89 A;  3JYY A;  3G4X A;  1AUE A;  3IPM O;  4L6R A;  4LDR A;  2HV7 A;  4K1O A;  2F22 A;  5T3W A;  3LLI A;  2W4M A;  1WAT A;  1H9G A;  3UMH A;  4PAC A;  3L34 A;  4NTB A;  1BR1 A;  1SMY F;  2YLI A;  4ZLC A;  2J0X A;  2M4E A;  2VH3 A;  3C18 A;  3GWL A;  1GQA A;  1LS4 A;  3LLK A;  4JTC B;  4P6I C;  1LI7 A;  3ZQV A;  3RH3 A;  3DAG A;  3SXK A;  5JRA A;  1I4Y A;  1D0Z A;  2EIN C;  3HKK A;  2H7B A;  3ASO C;  4XPY A;  2G62 A;  3S0X A;  3RQF A;  1ZZP A;  3K7D A;  4B6I A;  2HFI A;  5KYN A;  2RSE B;  3OWT A;  3SYN A;  1ZHW A;  5COF A;  4Z9J A;  5E3A A;  3U2M A;  1YZC A;  2XS1 A;  2A6H F;  3RQE A;  1W2W A;  3AQB A;  1XZQ A;  4Q7C A;  2P61 A;  1K05 A;  2KGO A;  1BBH A;  3KMI A;  1C03 A;  3JYH A;  1Q0M A;  4J32 B;  4G7O F;  4YJW A;  1APC A;  2A1D D;  1RMV A;  2NUP B;  4BPM A;  4CS8 A;  2L6G A;  1ZYR F;  1ZU4 A;  4W8P A;  1OXK A;  3C8G A;  2IYL D;  5E33 A;  3VM6 A;  1FR0 A;  3KYI A;  2LP4 A;  3S29 A;  4ONS A;  1SYQ A;  1TFK B;  3SXM A;  1G8X A;  2JD3 A;  2R05 A;  3AQC A;  3ZC4 A;  2G3V A;  4XPW A;  2R9R B;  3A9C A;  2ZXR A;  4DVY P;  2KQ9 A;  3AG2 C;  1HE1 A;  2HSQ A;  4MTG A;  4YT5 A;  3B9Q A;  4JJG A;  3U5S A;  3T4R A;  1QQ3 A;  2R7Q A;  1EA8 A;  1LKX A;  3L1M A;  4KBL A;  3PCV A;  2C04 A;  4C3D A;  1AEP A;  2GDC A;  2XLE A;  4YT8 A;  1QVX A;  2HZ8 A;  4WGZ A;  3TJ6 A;  5B1A C;  3LJB A;  2B0H A;  1H7I A;  2KC3 A;  3ZIB A;  4U5E E;  2L6F A;  1YA9 A;  2W45 A;  3AG4 C;  4MVS A;  3W2W A;  4OIR F;  5L0D A;  3S84 A;  3MBG A;  3Q7G A;  3AG3 C;  2QY9 A;  3BEH A;  3GEE A;  4MVZ A;  1OCR C;  4C3E A;  2MHR A;  3EZH A;  2M64 A;  1JR8 A;  3H65 A;  3JTL O;  4JUR I;  2WVO A;  4O6M A;  3BRJ A;  2NUT B;  3NG1 A;  2DB4 A;  2XSE A;  3K1H A;  4AE4 A;  4FAP B;  1VYK A;  4MW3 A;  3DWW A;  4J30 B;  5FZT A;  3RYL A;  2R7W A;  1MMA A;  3Q6M A;  2GA0 A;  4JTA B;  4U5B E;  3GOD A;  2XL8 A;  4JCZ A;  4CS9 A;  2GAQ A;  2AU5 A;  3K33 A;  2QNL A;  2NUP A;  3EPV A;  3AG1 C;  3U2L A;  3RKO F;  5HV9 A;  4KI2 A;  3TOM A;  4Z9H A;  4I44 A;  4A2N B;  2KJG A;  2YRF A;  4E7S A;  1BZ4 A;  1M2O A;  2WVN A;  3WHN A;  4QI2 A;  4O79 A;  1G4U S;  2CNW A;  1DOV A;  4EUK B;  2R7T A;  4HFK B;  4XQ1 A;  4N4W A;  2YL1 A;  2X0C A;  4CDV A;  4ER9 A;  2G3K A;  1LS1 A;  4CS8 C;  2YEV A;  1NLX A;  1T6I A;  1Z3I X;  2B0J A;  4KNV A;  1XZP A;  2HJ3 A;  3JSE O;  2VB6 A;  5BUO A;  1FTS A;  2PF4 E;  5BQG A;  4M63 A;  2I8B A;  4MS2 A;  4KNW A;  2GWW A;  2R7O A;  1AVO B;  1S05 A;  3LUT B;  1Q0K A;  2YZS A;  3X1O A;  1NFN A;  2XM0 A;  3LS0 A;  4GQH A;  3JZ0 A;  1Y6D A;  1GGQ A;  2IOQ A;  2J9W A;  2YKZ A;  4WGY A;  3FHD A;  4ULV A;  3TOL A;  3T9O A;  3E9V A;  2PP4 A;  2EPM X;  3JSZ A;  3LAY A;  1TFO B;  1RCP A;  1OCZ C;  2DYS C;  2ZXP A;  1F1M A;  3C8G B;  3GM3 A;  2NUT A;  2WZF A;  4JKV A;  1HMO A;  4NY3 A;  3C8G D;  1FFT C;  3QZC A;  3TUL A;  4DJ9 A;  1K40 A;  1ZU5 A;  5A6A A;  1NU9 C;  2Q9A A;  1WTY A;  4G7Z F;  2RD9 A;  1QSP A;  3GM1 A;  3Q6N A;  5L0C A;  2LFF A;  1NG1 A;  4PK4 A;  3F47 A;  4C7O A;  2EIJ C;  3ATP A; 
#chains in the Genus database with same CATH homology
 1SR2 A;  2Q4F A;  2OOC A;  3US6 A;  1BDJ B;  1C03 A;  3U3B A;  1WN0 A;  2R25 A;  1Y6D A;  2A0B A;  3MYF A;  1OXK A;  1TQG A;  4PAC A;  3KYJ A;  1FR0 A;  3KYI A;  4G78 A;  2LP4 A;  3IQT A;  4EUK B;  1C02 A;  1OXB A;  1A0B A;  1YVI A;  2LD6 A;  1I5N A;  1QSP A;  2LCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...