1OXCA

Lecb (pa-lii) in complex with fucose
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Carbohydrate Recognition by the Lectin LecB from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords hypothetical protein LecB
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1oxcA00
5A70A 1OVPA 1W8FA 1OUXA 2WR9A 5A6YA 2BV4A 2JDKA 1OXCA 1OURA 2JDMA 2VNVA 2JDHA 2JDNA 5D2AA 4AOCA 1UZVA 4CE8A 2JDUA 5HCHA 2BOJA 4UT5A 1W8HA 1GZTA 5A6QA 2JDPA 3DCQA 2CHHA 2VUCA 1OUSA 2BP6A 3ZDVA 1UQXA 2XR4A 5A6XA 2WRAA 2VUDA 1OVSA 5A6ZA 2BOIA 5A3OA 2JDYA
chains in the Genus database with same CATH superfamily
4QX3A 1V6IA 1HB4A 2WFF3 4NRQA 2CDPA 3IDBB 4IEYA 4YG0A 1NE4A 4E4ZA 3O1TA 2RS52 5HCBA 5FBJA 3VBFC 4YVWA 5FXXA 1HN1A 3T4VA 1K3IA 1V6MA 2R072 1UMIA 3NSTA 3WQBA 2Q0AA 4H55A 4A7KA 3VHRA 2RV9A 3ZLIA 1W06A 4CCEA 1XYNA 1GOFA 1XNBA 3ACFA 1S0DA 2WNUB 3I2FA 3KV5A 4LBNA 4Y5Z0 5BNNB 1LESA 1YFYA 5BNOC 1JBCA 2VG9A 4BPZA 3SKJE 2YUEA 5DUWA 3LDRA 1QMJA 4KGGA 2C26A 4WZFA 3AKPA 3VZKA 3LPGA 3WF3A 4N9IA 2YBPA 2LRPA 4YM0A 3BIEA 5FK7A 1VAKA 2R30A 2Q8OA 3LA7A 2X5IB 5A7SA 1LGCA 1PO11 2EIEA 3N7JA 4QPIB 4ZZ5A 2KA3A 5A7WB 3BB6A 5A3UA 4XUQA 3WDXA 1OH3A 1W6OA 2Y38A 4GQ7A 4XJUA 2PHDA 3ZSKA 2XR4A 2XQXA 5ABJA 1UD1A 5A3PA 1H8TA 5F1RA 3BYWA 4KG8A 2WABA 2AC1A 2YU2A 5J37A 3M2MA 3TRSB 1FX5A 4BWOA 5FZ1A 3KD4A 4YRDA 1N47A 1HRV1 2E7AA 3KCYA 4KWJA 1A8MA 3LGRA 2PLV1 3I2IA 5LEKA 2WWUA 1UYPA 5C5UA 1U0AA 1AL21 2JDMA 1ENQA 1O5UA 1SEFA 1CD3G 1VBD2 2VMDA 1PX4A 3M3EA 4LKEA 2YC4A 4AHXA 2DV9A 2R1DA 3AYDA 2PLV2 3A0KA 2GC3A 1DGWA 1WW4A 2OQ7A 4QPGA 3S30A 4DS0A 2RS31 5CBLA 4NWWA 4K40A 3TEWA 5IK7A 2XKPA 1W04A 1DGWX 5FY1A 1AZDA 1RUF1 4PBPA 4BH9A 1FV2A 2CY6A 5BNOA 2FQPA 5A3OA 2P37A 1H4HA 1YCIA 3O1OA 4BDVB 4CP9B 4EV0A 1CAXA 1JODA 1GBGA 3WDVA 1MR5A 1TEIA 3K4AA 5K0UC 2Q8CA 1QJZA 1L7QA 1VB2A 5JMCA 1UZ0A 3NJXA 2A75A 5CG9A 3DYPA 2W2IA 3ZXLA 1DQ4A 1JYIA 1V00A 4XFFA 1X7NA 3LDBA 4P9WA 4N53B 5FZ9A 5FWJA 1XNAA 4ARXA 4GMP3 3VUOA 4N8MA 4UF0B 3DXTA 5ABJB 1QWRA 1RYYA 1UU5A 1AR62 1XRUA 3HIFA 3TN92 3VD3A 3MFCA 4O9EA 1DGRA 1QEXA 2D6KA 2GMEA 1W6OB 2V4AA 2W68A 3HNBM 5FY5A 1DCSA 2K0GA 3ILRA 4QD2A 3X29B 1ASJ1 3J8F2 1KXGA 1B35B 3ZIWA 2Y6FA 2BUKA 1YI7A 1YQ5A 4YFWA 4MGTA 4F83A 4Q2FA 2UWCA 5CU1A 5FKCA 1CZSA 2C0ZA 2QQOA 1KDKA 5FUNA 1I5PA 1VBC1 2RG4A 3D6EA 5EV7A 4AQSA 5HXVA 5BNNC 1JZ6A 5BNOB 1RUD2 4FI9A 1UN1A 3LEGA 1CAVA 1WLCA 1EAH2 1C8M1 3K75B 5FZ0A 2Y6GA 2DUOA 3UK9A 1NQDA 2VZVA 3MI8A 5CKNA 3MLKA 4JX0A 4N43C 4UFLA 2L9LA 5BNNA 5IJRA 5IATA 5CEHA 1AR91 2EAAA 2R042 4MGZE 3AVRA 3ES4A 1E5SA 3MV11 4A6OA 1GICA 3IKWA 3N7MA 4QB1A 1PIV2 1DQ0A 2XONA 4NPLA 4UW5A 4XTMA 3O5SA 3T2OA 3PJQA 3WG3A 3BUCA 1OXCA 4RSUA 1MZEA 1J84A 2OIIA 1CZVA 2VW1A 3ETPA 3DKQA 4CE8A 1O91A 5CIRA 3URFA 4R8HA 1TME1 1RUF3 1VIWB 5I8SA 1HIXA 3WNKA 1UL9A 2A1XA 2RMU3 3OOXA 4GALA 4V2VA 3CZJA 2QVSB 3OBAA 3WUDA 4OULA 5A3LA 5FUIA 2W91A 2RE9A 4MVTA 3V65A 3VBHA 2W52A 4CDWC 3OBTA 3IM0A 4GB33 5FY0A 5F5IA 1O3QA 2VY0A 2PLV3 5AFBA 1UPIA 1MS8A 1SLBA 2X05A 2FZ2A 3AK0A 3B94A 2AACA 4SBVA 4A45A 2WNVA 1IKPA 1NLRA 4QWNA 2QDNA 1W6QB 3HN1A 5BY5A 1AXYA 5FXZA 4LUMA 3I4IA 4COWA 4MG2A 2BFUL 2JX9A 3H1MA 1QDOA 2PXJA 3M7AA 2GNTA 1AR61 2VW0A 1W6NB 4W8JA 5C3PA 1X9TA 1Y9MA 3AMNA 1RUD1 1K45A 2XWJB 3WDUA 1LGBA 1QJFA 2HWE3 4N90A 4I01A 1WLTA 2VZUA 4OHXA 2Z5WA 1YQCA 1ND2A 5FLIA 3VBOB 4EYUA 3KF3A 2X5IC 5D21A 5KC5A 5A6ZA 3V0AA 2PHRA 2A7AA 3LEKA 1ENXA 1GV9A 4XFHA 1D4VB 2JIJA 4LO6B 2BJSA 1XNCA 4AVVA 1L3JA 2QKDA 3CNAA 3WNXA 3KT4A 3UKVA 4C1XA 5LZ6A 3TYJA 4BQ2A 3PU8A 2HEVF 5F5QA 4QX2A 3POSA 4QKFA 2GAUA 3I3QA 4OQ9A 1Q8QA 4IE5A 2YYOA 2RDQA 3TEYA 5FMOL 1SMVA 5AC92 5A6QA 3NL1A 5BNPB 4ZZ8A 1EP0A 5FZFA 4B1MA 1AR71 4MZUA 5GZEA 4ES8A 3KV6A 3UT0A 4QXHA 2VUCA 4OZOA 4Q4V1 2IVIB 1KFUL 3RZJA 1Q8SA 3VBUB 4EJRA 5KR7A 1FXZA 1VBE3 3KHBA 1SLIA 4CDQC 3WW2A 4C1WA 2UYBA 2DF7A 2VL4A 1W0NA 5DZFA 1VBB3 3I97A 5B2GB 1H6YA 5C4WC 2D3SA 2JIGA 1Q8OA 2JD4A 2RS53 3HWJA 1QQP2 3WZ1A 5HXMA 4FPOB 2PQSA 4LORA 1UZVA 2AGSA 3IIIA 1J83A 3NKTA 4MLOA 5LASA 1QXPA 4EZHA 2WA3A 3OUIA 2VNGA 5HCHA 1BLZA 1W05A 2J1TA 2VOVA 2EIBA 5EJ3A 3ACIA 4Y5SA 2RR13 2XHNA 4CXXA 2XUEA 5GLWA 3B69A 1LB2A 5FYCA 2ARBA 4E8CA 1RUJ2 4YZ4A 3NVCA 3WD5A 2QTWB 2Z79A 3FX3A 4UI9L 4DOUA 4FP2A 4W65A 3RGBA 1AX1A 1MQTB 3IDCB 3H50A 3I2OA 4MGSA 2VR4A 4Y1VA 2DVDA 2X09A 3HR9A 1HRV2 1XSRA 3OD4A 2WR9A 3WG2A 4GAZA 3ZPYA 4AK3A 4BYYA 5FY9A 4K9SA 3Q8EA 4EN8B 5IHRA 4R9BA 1JOPA 4RGAA 5T3NA 1TME3 4DEQA 3LEIA 2PAEA 3H8RA 3C7FA 1RJ7A 1RUH3 4HLTA 4QDRA 2XHKA 1ULEA 1DP0A 3D8CA 3OBZA 4XC9A 1PVC3 1JYXA 4BMEA 4DUWA 5JXJA 2QQUA 3IPVA 4DUVA 4ES9A 1GP6A 4XFAA 2FD8A 1R092 2RVAA 1HRI1 1XNDA 2BERA 3UKNA 2Q1MA 5CFCC 3J7MA 3V0BA 4N9HA 1WKYA 3C7OA 3OYWB 1S4CA 3ITQA 1VRH1 1Z7S2 2R071 2Z42A 2ZGPA 1W3XA 1MS0A 2VCAA 4JV4A 4QPWA 2VQ0A 4N7UA 2RDRA 2O1QA 2NMOA 1BEV1 4W4ZA 1ZA4A 3AKQA 4UXAA 3I3BA 3FHAA 1X8MA 3MBWA 2FCVA 4FPEA 5FPVA 3B00A 4CCNA 1JW6A 1V0AA 3POFA 4QQPA 4JTOA 1QJY1 3H1YA 5F6KA 1MEC2 3NNFA 4YGDA 3WDWA 3RVHA 1DYPA 1SCRA 3AL6A 2WWSA 2IWGB 1HV0A 2ZAAA 3AYCA 3VBOC 2XG3A 1H9WA 4DRRA 3WW1A 4D94A 2ERFA 3BOPA 2E32A 3S5AA 1DDLA 1VPHA 4OHVA 5G05L 3R6SA 1OPMA 2W39A 2VBBA 3NQHA 4QHBA 3TN91 5I0DA 2WZR1 2JG9A 3FUQA 2ZZJA 1S0IA 5LRRA 2DU1A 1N1SA 2DCKA 2WN3A 4PQQA 2QQWA 3MF6A 3IMMA 4B4PA 2NQYA 4UFKA 2GH2A 1CPNA 1NKGA 1LOFC 1DYKA 2SBAA 4HONA 1IPSA 3DN7A 1GOHA 4O9GA 3RJRA 1KJLA 1YJLA 4JC1A 3ZYGA 1V9U3 3CJIC 3ON7A 5FCCA 4P5YA 3ZXFA 5AVAA 4L8QA 4ATFA 1Q5OA 2G9ZA 2YZ4A 1AJOA 3DL3A 4AFBA 4AVBA 1C8NA 4FPJA 4DXZA 2VC9A 1YEWA 3JXSA 3THTA 3NV3A 4MADA 2PTMA 2WLPA 5K7PA 2W5FA 1O3RA 4QPYA 2E31A 5HPOA 2P17A 2ZKLA 2WRAA 4CTEA 1PO21 3RMYA 1OPOA 1HQWA 4GB31 1OLMA 1W99A 2OA2A 3ZXKA 4XPVA 3T1LA 3AZYA 4CU8A 3PVEA 1F8VA 4OI2A 3AKRA 2R0FA 3ZVXA 1NT0A 2RS32 4AHZA 4BIFA 1M06G 1OLQA 4M00A 2WN2A 1DQ2A 3ZKUA 5LRSA 3I49A 3JD71 1WA4A 4WVVA 4AOCA 1KRIA 4F8AA 4UW3A 2VVDA 4Q0QA 1MACA 4QDQA 1JZ2A 3VHNA 4BISA 2WLQA 3H8OA 2D3PA 2ZHMA 3AMHA 5A7NA 3H3LA 1W9SA 4IV1B 4FQZA 1QJY2 1QY4A 1RJ8A 1NXD1 1PK6C 3GGLA 3OGRA 2V5DA 1ZNPA 4MYEA 3LEMA 1ZRFA 1GZCA 1CN1A 4YVSB 1NLQA 1CAUB 5JR2A 1JU3A 4CRQA 4C0BA 2DFBA 4XF3A 5DUVA 1RINA 1O4TA 1HB3A 5DDJ1 4D7SA 1XE8A 4QHOA 5A32B 4PLOA 4QX0A 1Z78A 1BYHA 5L36A 5SV8A 1W9FA 2D5HA 1PVC1 2YFUA 4I09A 4KH9A 5D8AC 1T6GC 5HCAA 3WG1A 1LOFA 4AVCA 1STMA 4NRPA 1OF3A 2JG8A 2R061 4XBLA 2G19A 1PZ7A 5FZ4A 3M3QA 4JDNA 4RR3A 4UFIA 3BI3A 2XDVA 5GZFA 4P9XA 2ZGSA 2ZGNA 2ZOEB 3NKGA 4AHYA 4AEDA 4CUAA 2YPJA 5JI9A 2MEV2 1O4ZA 2R062 1C1FA 5JUVA 4OI0A 1LHOA 3R4SA 2QBXA 4LHLA 4GJYA 2ATFA 4YG6A 4XJWA 3VZMA 5BYNA 5CFCB 4IE4A 5IVCA 1KQRA 4ISRA 4XILA 1SCSA 1G9CA 5F5AA 1X8EA 1BKZA 3I7DA 1C8M2 2AUYA 4CUCA 2Y6JA 4XIKA 4GMP0 2GNBA 1GFF2 4URAA 2P34A 4H14A 4EN7B 4MGYE 2AH2A 2B9UA 4IEZA 4NROA 4XE9A 1K12A 1W6MA 5GLUA 3T3YA 1U12A 2GN3A 4BLJA 4Z1VA 3CEWA 3KCXA 5FV3A 5IAVA 1GZTA 2VMGA 4FCAA 4DUXA 2A3XA 4JHZA 4LBQA 3WF1A 1TMF2 1VP6A 3I59B 2JE9A 3EB7A 3Q8BA 1R091 1C8M3 2QJVA 3KT1A 4J1WA 4ZONA 2GC2A 5T52A 4BLIA 2OW4A 1OT5A 2ZZQA 3AKSA 5DAVA 2OQ6A 4AI3A 4DXTA 2ZHLA 4NHXA 3WNLA 2CU5A 4CU6A 1N3PA 2VECA 4PDWC 5JSRA 1IS5A 2VUJA 3NNLA 1J3PA 3ZYIB 1VAMA 2RS33 1BCXA 4CEWC 4XXPA 5IVBA 1U5ZA 1QHDA 4LO4B 5JMOA 1J3QA 2W1WA 4B7KA 2WAOA 1H2LA 2Y0OA 2DFCA 3P3NA 3LA3A 3HD8B 1YXWA 2ZA9A 4RGGA 5KHIA 3KV4A 5A33A 4I3GA 5I8YA 3OY8B 5A7OA 1A3KA 2F4PA 5FQ0A 4ZXKA 2J1VA 2K2SA 1ZM1A 5GM0A 1QDCA 3WP3A 2FDKA 1VRH3 1NZCA 3MIDA 2Q30A 4LT5A 2XGXA 5FZ7A 4XUPA 1Y7BA 3VGIA 1G7YA 2VPVA 1OA4A 1DQ5A 2JXAA 1W2NA 2CAUA 4FXKB 4A6SA 5BNPC 2J1UA 2VCMA 4L9BA 5FYIA 4CEYA 5GZCA 1SLAA 2WYFA 3N9OA 3I2JA 3ZN6B 4OHYA 1UCXA 5T5JA 4LK6A 3PUHA 2PHFA 3U11A 5FZOA 4YWAA 2B42B 1SBEA 2YROA 4Q4Y1 4XETA 1UIKA 2OVUA 3UGFA 1W8HA 2C9KA 4HKWA 5DAPA 5HI0A 5FYMA 3BALA 4EE2A 3CBNA 4QDSA 5CVRA 2EXJA 1UU6A 1ZYBA 3J8F1 1RUG2 1MPXA 2JB8A 4FQ4A 4NN0A 3WINE 1REDA 2VUDA 3KS7A 1VRH2 1POV3 1Z7S1 1E5RA 4HZFA 4JHTA 4XIOA 5FMDA 4E2GA 5K4LA 5K0UB 1JYNA 2OZJA 3T2TA 1O8PA 4GD4A 1BMV2 1RIRA 1E5HA 1ODNA 4Q4V2 1HB1A 5JOXA 4Q8KA 4L99A 4Q4W1 4YW5A 1J3RA 2DU0A 3ZXDA 3HJRA 1V9U1 4PI2A 1OMIA 1RTVA 4S2DA 5FFOC 1OHFA 3PTYA 4D6SA 1FNZA 1C5HA 2A73B 2UY8A 2NLRA 1XE7A 3HAGA 2ZCWA 4M0NA 5FZCA 4P9JA 2D6MA 2VTXA 2YDEA 3P3PA 3B93A 2J42A 1PIV3 2MPFA 1YFWA 3ACGA 4LOTA 2DVFA 1IKQA 5E6HA 2YG0A 1B35A 4M3CF 3RG0A 3H8XA 3WW4A 1CZTA 2DWRA 5C8CC 2C9AA 3OG2A 4B4RA 1CWPA 1SLTA 5JDBA 2I74A 2WL1A 4UF0A 1EAH3 1CESA 3IMNA 4AYUA 3BODA 5T5PA 5FZDA 3OTFA 1GWLA 3U75A 3ZXEA 4Q4Y2 3N3HA 1OA3A 1D0GA 3CO2A 1O8SA 4XW3A 1FOD3 2FDFA 2XJQA 3NMBA 1GSLA 5C5TA 4DMIA 1X36A 3FN9A 3AMPA 5C9AB 2VE1A 5A3NA 4BB3A 1E5IA 2WDBA 3PL0A 4BIOA 5BNQA 4YPJA 1XE0A 4ISQA 2WO1A 5FYHA 4JTNA 1ND3A 5DPNA 4XDPA 1R1ZA 2A3WA 2MEV1 2QQMA 4UFJA 1S0BA 5EQUA 3S7EA 3MDPA 4X8PA 3TNQA 1UZZA 2WJSA 2A6ZA 2HYXA 1UXXX 1OBNA 2PMWB 3D5OA 4I0WB 3DF0A 4QGMA 4LEJA 3ZPOA 1W8NA 1YWKA 2J1RA 3MUZ1 4LHSA 1PK6B 1VAVA 3POYA 3MIEA 3SC7X 2WNUA 3FUOA 3ST7A 1RUH1 5F2SA 2BW8A 4BK4A 4P00B 4RHV3 2QQLA 4XQDA 1W8TA 4C90A 2WYSA 4GWNA 5A80A 3SISA 3VDDB 4B7EA 1ZZ9A 3H8UA 2VMHA 5KWRA 2WO7A 1OFNA 5EJ1B 2CL2A 4RYDA 4ZS3A 3LFIA 1LHVA 4ZXEA 1J1TA 1O4YA 5IAXA 1OH4A 4Q4W3 3KB5A 2DBNA 3GYDA 4AFDA 5A70A 5DABA 3VZJA 5BUVA 1AR73 2ZTNA 4QX1A 1ZRRA 5FZOB 1YQ2A 2WNOA 4RR3C 4OI1A 4B1LA 3OEBA 4KNCA 3WVJA 4P9YA 3AJYA 4ET7A 2RMU1 5C7GA 1JN2P 4AQ6A 3T2PA 4R9DA 1AR83 3MIHA 1WBLA 3AVSA 5JOZA 1Y3TA 2ILMA 2RS51 4KGQA 2YXSA 3UYJA 1OQ1A 4IV3C 1T2XA 3E6CC 4IGOA 4AI8A 5C8WA 1LAJA 1VBB1 4LULA 4W50A 3GM8A 4QQHA 4E4SA 1PGW2 4XDOA 1UO9A 1LTEA 1YNAA 1OC1A 4GWJA 2EF6A 5E1RA 1DG6A 2HYKA 3AP4A 4IV3A 1DQ6A 2D93A 4XBNA 2IXHA 5GZDA 4WM7B 4QT6A 2GNDA 2RS11 2XBO1 4QX8A 3VZOA 3J7HA 2QQNA 4Q0UA 2IVJA 4FPLA 3LAGA 3WNOA 1PNFA 4IXLA 2JG8B 1JI6A 1VRBA 2C24A 3POBA 4XZPA 5T5OA 2G4IA 2NPIA 1O59A 2LROA 4GB32 3GHMA 2R6QA 2DBIA 2D7FA 2UWBA 5A32A 2VMCA 4JQTA 1JYCA 1PO12 5SV5A 5FOJB 2VBDA 2EXIA 3POIA 4YVWB 1UMZA 2ORZA 5C4WB 3VZNA 4COUA 3ATGA 2FCUA 3DYOA 4LIUA 4Z2AA 4YW6A 5JIUA 2CDOA 3S57A 1BK0A 4AQTA 4HKOA 3LWCA 2CNAA 4URTA 1VMHA 3PURA 3SCFA 4ORFA 3GHNA 5C3QA 1LRHA 1ZZ7A 5JOWA 4QKNA 1UYZA 3DXUA 4CDWB 1OSGA 3NW4A 4U36A 2RMU2 4XAAA 3B9CA 3L2YA 3AP7A 5F3CA 3Q8CA 4GXLA 1ZRCA 1NLSA 5LA2A 1JHNA 1NA1A 1LEMA 4M0HA 2D44A 5A1FA 1F5FA 3WNMA 3BOWA 1URXA 2ZJCA 4K8RB 4WVMB 3C7EA 4IUGA 2XH6A 2ID4A 2Y60A 5A3WA 4HFSA 4NAOA 1W0PA 3KT7A 4BZ4A 4HVQA 3TN93 2P1BA 5ACA1 3B3QE 3SCGA 3PUAA 3T09A 3IAPA 4HSLA 3LOBA 1AUYA 5J7MA 2ZGKA 1AX0A 3NV4A 4JGYB 3MW2A 2WQ8A 5E16A 4LKSA 2WFF1 1XSQA 5M0TA 1JYTA 1FT9A 1UMHA 2E53A 4IEVA 1S1AA 4D6QA 3N7LA 2VVFA 1UY1A 1LOGA 3RWNA 5JPNB 5FDBA 1WCKA 3VBSA 5LBCA 1I9RA 3M4FA 3SQOA 3MHZA 4M01A 4HT1T 4EWAA 2R043 3O1UA 4ASMB 4IV1A 1HLCA 5L7OC 2RR12 1DZQA 1GP5A 1SFNA 4Y20B 1EAH1 1S0CA 3FWEA 4XJAA 1S0FA 4FXGB 2HEYF 3PIGA 3O1PA 1L7LA 5C9AA 4V2WA 1VBD1 3VV1A 1JTZX 4CDQB 4EN9B 1ALYA 1NCRA 3CZUA 4FT8A 3FLTA 2VNRA 4C0HA 3GZAA 1FOD1 2TUNA 5FAXA 4YW1A 3CLPA 5C3SA 3KLSA 5J3UA 2O14A 4R9AA 5CADA 2BVBA 1QJU2 1NCQA 2V5YA 1FMD2 3ZYPA 1JS9A 1WUVA 2W47A 1RHI2 4MX3A 1VLNA 3LE0A 3U14A 3KGLA 5A6YA 3F95A 3M8LA 4AFMA 5I93A 2J1AA 3VBFA 5C70A 1J1LA 1D7PM 4OUEA 4CP9A 2HWF2 2EVXA 1W9TA 1IPKA 2BEOA 2FDJA 2WT0A 3JB4C 5EYXA 3RZHA 2H6BA 1OKOA 1QXJA 5H9SA 1PGW1 3OJBA 2HWC3 1UQXA 2VCCA 2WQ4A 3HQRA 4BE3A 2W0XA 5DG1A 1ZBA2 1J58A 3FZ3A 4AAPA 2XWBB 2XPJA 1NX9A 4UBHA 1WCQA 2DURA 5LB6A 3AYEA 4XJ8A 4IV1C 1CIYA 2E9QA 1UY3A 2VZTA 3D0JA 4Q4X1 3D4KA 1YIFA 4UW6A 1KEXA 2O8OA 3WCRA 3HNMA 3VN4A 1C4RA 1W8OA 5DAQA 4CPBA 3S7IA 4CCOA 3E6BA 3T30A 5IYYA 4I2OA 4CDQA 5E89A 1UOFA 3QCWA 4HN0A 4NHMA 1HKDA 3OBRA 3OUJA 4BQXA 5C8CB 3V0BB 4KL1A 2PELA 1H8TB 1YYNA 1GKBA 1H9PA 5KHJA 2JJ6A 4XZUG 3B5LB 2B4KA 1HX6A 5DXDA 4XMAA 2BNMA 3ES1A 3WR0A 5FMCA 5BNPA 4C8DA 5FP3A 1C3HA 3BVCA 4E4HA 1I6XA 1QH7A 5FO9B 4P5HA 2GSYA 1IPJA 2WA4A 3LB9A 2W1SA 1ODMA 4L0PA 2XMLA 5JXIA 1V9U2 1C57A 4GA9A 4AEKA 3FFQA 3I2KA 1GQGA 4PLNA 5FQ0B 3TWIA 3ROUA 4MXWB 1QH6A 3SCHA 4XHXA 1QJU1 2OUJA 3QBQA 3WQ0A 3ENRA 4RL7A 4YM2A 3MF9A 1RXFA 3OPWA 4ZS2A 2JENA 3DV8A 5I91A 2BPA2 4Z07A 3PUSA 1LKNA 2ZGUA 4M4RA 5C3RA 3U37A 1GLHA 1W6PA 1F35A 3K2OA 3KQRA 2C4XA 2R0HA 3H7YA 1Q8VA 3P5BA 3ZDSA 4Y1ZA 5T5LA 1RMU1 2ET7A 4YYOA 4S2HA 3AB0A 3WW3A 4DQAA 1D4M3 4LBOA 2YC0A 2JWPA 4OLLA 5FXWA 1H2MA 1DF0A 4FPYA 1VBA1 1QOSA 1PNGA 4IEPA 3AM2A 1DLCA 5FJHA 4CDWA 3B01A 1PO22 5EWSA 5IK4A 1WGPA 2D98A 4IETA 3SKVA 3S5QA 1WLDA 5FXVA 1RUD3 4KBBA 4ASLA 3N9LA 1W6MB 1PHMA 4XOGA 5FYYA 4IE7A 4QM9A 5LCWL 4C91A 1RUI2 3ZO0B 1AYN1 1US2A 1TQ5A 2AEZA 5L9BA 1S0EA 3FLRA 4RHV2 2DCZA 5FZKA 4AI0A 3LFMA 3G6JB 3VD5A 5FKBA 1RUH2 5CA6A 3OCPA 3GBGA 5FYBA 3LA2A 2RM22 1WW7A 2IZWA 2H0BA 2WUHA 2JD9A 2IXKA 2QZ2A 1V6NA 3HVDA 1HXS2 2O0OA 3DEMA 5FJKA 4NHYA 5B4XA 5FPUA 5I0SA 5L7OB 2LS6A 4H7LA 1CAUA 1IG0A 2VAUA 4OHWA 4Q4V3 3DYMA 4Y1YA 3B7MA 2JG8C 4AQ2A 3MLJA 2ZPXA 2XVGA 1AJKA 2VGDA 1Q8PA 2P4EA 2XJPA 4LMFA 2UY9A 2Q5TA 4BK5A 3HT1A 2VNOA 2AYHA 4KWLA 1J59A 2XKOA 1RVF2 1R1A3 3POGA 1JZ8A 5JXGA 3WUCA 1GQPA 1RUG3 2R7EB 1YIPA 2KM2A 4LOSA 4OFGA 4DY3A 4MHUA 1KITA 4YVSA 1TZOA 1VBD3 3RFRA 5C8CA 3LZZA 3VHOA 1CX1A 1VBA2 2VM9A 3SEPA 2ZABA 1IG3A 3OGSA 3GZEA 3JBG2 2ZGQA 4RGKA 5FIXA 4TZDA 5CKQA 2AR6A 3TNPB 5FZ8A 3ZXJA 4RN5A 4YG3A 3DPRB 4RQPC 2I07B 3SNMA 3N4MA 2Y0IA 1W2AX 3RJ2X 3JD73 2AEYA 5LY1A 2GC0A 3MW3A 4L11A 4FFIA 1RUOA 2QDRA 1OVPA 5EFUA 4QXBA 3H9AA 1DQ1A 1YUDA 1GNYA 2Y6LA 3AZXA 2E51A 1XU2A 2OZ6A 3D82A 3SH3A 3A22A 2WNVC 2WWJA 1IHMA 3P6BA 2VZRA 4A7ZA 4Z82A 5T54A 2CTVA 1ULGA 2ZMNA 3NAPB 3M70A 2JKXA 4Y33A 1HXS1 2VOXA 1DIWA 2YMZA 2D6LX 4XJZA 4RHV1 4IGPA 2AENA 4FPGA 2W3JA 1TMF1 5J1XA 5FP7A 4CCLA 4CSWA 1CVNA 4CP0A 1FATA 1G9BA 5KC6A 3RZLA 2VO5A 4Q8LA 4UWDA 4M4PA 1WCDJ 4WVZA 5K8SA 1GZ9A 2A6XA 2XJVA 1X9PA 1NOVA 2D5FA 2Y26A 3KQ4B 1PX3A 3DGTA 2A6YA 3ZSEA 5A7PA 2B9VA 5C3OA 3BTAA 1VBE1 5DN2A 1CPMA 3CMGA 1U5IA 3JD72 3M3IA 3RMXA 1L7RA 2ZACA 1OI6A 3K3NA 1YJKA 2XLGA 4HXCA 3IN9A 5FYTA 4HN1A 1HDKA 3N9PA 4XQWA 3KSCA 1SLLA 4H7MA 4XEZA 3CIHA 1RVF1 3JBG1 3U07A 1R1A1 2VMEA 1UZWA 3IB3A 3W21A 2BU9A 5FLHA 3KM5A 1DZTA 4ZPIA 1K42A 2BFUS 2XUMA 2ARCA 3JBG3 3WY6A 1AL23 3PDQA 1R083 1LULA 3APBA 4JCKA 3TB0A 4ZU4A 4JVAA 2WFF2 4UAPA 5IVJA 1ENRA 2QQKA 4J6GA 3VBSB 4IERA 1CQ9A 5KHGA 4CU9A 4QPIA 3WNNA 1TNRA 3WLUA 2XQRA 2W9XA 5DDJ2 1HB2A 3HT2A 1COV3 4NPMA 3VBRB 4BJ0A 3PNAA 4NOTA 3O0VA 2E26A 4A44A 2EAKA 2ES3A 4CCKA 1QXRA 3MFAA 2BGOA 3AL5A 1JZ4A 1DGRN 2WO2A 1BBT3 4XMIA 3E1F1 5E88A 4B3NA 5IVFA 3BTYA 4BQ4A 2YY1A 3CJXA 3MPPG 2B8MA 2PQQA 1V6JA 1GUIA 3MEPA 3W5NA 4IEWA 5FMOS 5GLTA 4XF9A 2P6CA 2VU9A 2FDHA 3USUA 4AL9A 3O1MA 1UY0A 4FVVA 3BTXA 5JZGB 4CUGA 3GDBA 3RYPA 1FPN3 5IK8A 2BNNA 2P6HA 5T55A 3POWA 4ITCA 5GKAC 1EV11 4AAXA 3E5UA 1IS6A 2H6CA 1LJ7A 2GC1A 4YGCA 1YLLA 3FMGA 4XYXA 3WP5A 4ATEA 4NWVA 3OUHA 4YLZA 3U4XA 1WLWA 2VTXJ 4Y5TA 5FPAA 3RI8A 1CGPA 4O61A 1YQ6A 4F7ZA 4EWEA 3ILNA 4QU2A 1AL0G 2D6NA 2YGLA 3FE5A 1JUIA 1TVGA 3IIAA 2CHHA 3W5MA 3DPRA 2BNOA 2ENRA 2ZGOA 2BP6A 3JB8A 1PGL2 4NIIA 1WWYA 1COV2 5JSOA 3CU7A 4JZRA 1KJRA 2PHXA 4HPKA 3NJZA 1IZ3A 3WDTA 3DPRC 3A21A 5A7WA 2WC2A 2VZOA 3SH4A 1RUC2 3OPTA 2X5IA 3G7DA 2Y34A 1XXNA 2WINB 4XVHA 3I2HA 3O1RA 2OYZA 2VQUA 2XJSA 4LKDA 3ZXAC 4MGKE 4W6WA 1SPPB 2A5ZA 5HCFA 1W90A 2BTVC 3K3OA 2X53S 4OZXA 5CNAA 2LM3A 3I3EA 2ETEA 3KV9A 4BQ3A 4KWKA 4RR3B 2GP5A 1FAYA 3AZWA 3OGGA 3VBOA 1ZZBA 2FMDA 4I30A 3ZM8A 4FSJA 4FPCA 2VZPA 1MZFA 4Q1RA 2RJLA 4GH4C 4TLFA 4HG6B 4P14A 1VMFA 3GJBA 1POQA 3QH6A 2HWD2 2FDGA 4WV8A 3WF2A 4AI1A 4LA3A 4FBFA 5GALA 2JE7A 1SDDB 1GP4A 1RUG1 2ZEZA 2VOTA 4HVRA 2YV8A 3H7JA 4K1YA 5FLJA 1LOCA 3HNYM 3I59A 4H3WA 1YC61 3GBFA 4GKYA 1BHGA 5IVVA 2GMPA 1GMMA 2ZGRA 4Y3OA 1RVF3 4B8EA 5A1AA 4XACA 3U78A 3WSOA 5FK8A 2IXIA 4AEDC 3OSDA 4QKBA 2HWF3 3H3ZA 4LJHA 4AE2A 1NXMA 5JOYA 3KZ4C 2PFWA 1ULDA 1HRI2 1XYOA 3ECQA 3ZDVA 2DYCA 2D40A 1JH5A 1S2BA 3AFGA 3JUUA 2CGNA 4FO9A 2WNVB 3O0XA 4Y24A 2QCSB 1MS4A 3LQCA 1LGNA 2HEWF 1H8VA 4LE3A 2QQVA 1DFQA 1NY71 2NP0A 1ZRDA 2LW8A 3PUIA 2VCBA 5ANQA 4P9GA 4CCJA 2XJUA 5JWPA 3IDEA 4OHZA 2VTFA 3QD6A 1UYXA 5IVYA 5EPAA 2VMFA 1MZ5A 4JRLA 3USUB 2ARAA 1RUF2 4BQWA 1W6PB 1GOGA 3ORJA 4MO3M 1WZXA 1PK6A 1HXS3 1Z0HA 2WT1A 2RJKA 3VD4A 5ISLA 2DVGA 2V72A 1N1YA 4NVPA 3RYKA 4PT6A 1XU1A 3C7HA 5FP4A 2BOIA 4PDWA 4BHPA 1LODA 1ZBE1 1ND3B 2GNMA 5H9RA 3ZFGA 3J7LA 2ZHKA 4P9LA 4TYSA 3BIWE 2FZ1A 2FMYA 4NRMA 4P02B 4AF9A 4BA6A 1SQ4A 5DQ0A 3NAPC 1XPWA 2VQTA 4MSVA 5APAA 4XCBA 4XBQA 1Y43B 3JCIA 1UX7A 1UOBA 3DECA 1JOBA 5FWEA 1OD3A 4LO8A 2ET1A 4IDZA 4M3CE 5D8AA 4CDXA 4L92A 4LITA 2EXKA 4R52A 2WS91 5A1LA 2J7MA 3FL7A 2EXHA 2OT7A 1YRZA 5LBEA 2JDAA 5E8AA 1C1LA 4JRAA 1F31A 4AI9A 4RS5C 5A6XA 3VKNA 4JDOA 4XTPA 4KBZA 4QQOA 5IT6A 3EXUA 4YM3A 1CJDA 3HEIA 1AYM2 3GALA 3RRDA 1K5MB 4DXSA 1K5JA 3THPA 3TEXA 1EPZA 4HVOA 4KWUA 4Y26A 2DCTA 1W0OA 3OYWA 3CJIB 3GZTB 4HBNA 4BQYA 1GWKA 2WZR3 4HKLA 4N53A 4XCAA 4FP3A 4OUSA 5F3GA 1R082 3K4DA 3K4ZA 1UF2C 3Q9OA 2FBEA 4G3YC 2W87A 4NMIA 1CX4A 1DU3D 1H4GA 1W9YA 5FZGA 4CYDA 4AEMA 5CISA 1MQTC 2RS13 2XBO3 2XLFA 3AFKA 5D8AB 4COVA 5B4NA 1QGLA 4XABA 1JZ5A 3CKHA 3LSEA 5IWFA 4Q4Y3 3ETQA 1T6BX 2Q1FA 3OF1A 4S2GA 5FR3A 4Y22A 2IFRA 2YBSA 3H3UA 2WFPA 3WP6A 2W1UA 3TBDA 4IEXA 4AVTA 4BU2A 5DG2A 3VKOA 2GZWA 2HWE2 1O3SA 1IOAA 2CGPA 5F9TA 1QQP3 3EMRA 2HBUA 3W9AA 1MS1A 2FCTA 2I2SA 3U0ZA 2YB7A 3CF6E 4CP2A 1C5IA 2OX0A 2E7TA 2HWC1 4WVMA 1G9FA 3WOGA 1ZA7A 4YW2A 1YFXA 3T1MA 5JXHA 5FZ3A 1BQPA 5IVEA 3D3AA 4DZGA 1ZBE2 1ZBE3 4PIZA 4W6XA 1JYVA 2HWC2 3BU7A 3CJIA 3RPQA 4E2SA 4D69A 1UIJA 5AFEA 3QACA 4HANA 2HWD1 3RSJA 4CPBD 5FUPA 5AC93 2PAMA 1K5MA 4NAMA 2VXJA 4NUBA 4BOWA 3RS6A 3PUQA 3TEZA 1NAEA 3H0OA 3FBMA 4LLOA 3WP4A 3ZYJB 2QNKA 5FY7A 2VJXA 3S0MA 1Y9GA 5J09A 3M3CA 2FDIA 3N9QA 5EP9A 3I2GA 3N7KA 4LBQD 3IPVB 2DDUA 1I3HA 2X8KA 3BGAA 5FZMA 2IC1A 1D2QA 1YI9A 2D43A 5TSWA 2NZ9A 1UAIA 4AGGA 4FAGA 1PMHX 1ND3C 4D8MA 1KFXL 1F4HA 3IWZA 1UXZA 2TNFA 2DUQA 1H2NA 4TXWA 4QGNA 1NY72 3PIJA 3C2UA 3VHPA 2HWE1 4ONUA 2ZGMA 1ZVFA 1IS3A 2ORXA 1CR7A 2WSVA 3WCSA 1LCLA 1XBFA 4Z8BA 3ZFFA 4Q29A 2JB4A 5DZGA 3WDYA 4N43B 1IQDC 1AR81 1LU1A 3ABZA 5G04L 4OQ8A 2Z2SB 3PVOA 3MZHA 1QIQA 3P1IA 2ADDA 3WHTA 5KHHA 2UU8A 1C28A 1OUSA 2AZ5A 3ASIA 4CDUC 4A42A 4RFRB 2CWSA 3KWVA 1B35C 1QQP1 3T08A 3ZMNA 3R4UA 2RHPA 2DCJA 5L9RA 2DTWA 5HBAA 3QOPA 2B5HA 5FY8A 1WMDA 1XC6A 3E5QA 1OQEA 4HPKB 2VW2A 1PZ8A 1AX2A 1R093 1UY2A 1QJU3 4AEDB 1UYYA 4JKMA 3OEAA 1FI2A 1ZX5A 2TBVA 3PJYA 3PLQA 4AFCA 1SBDA 1VR3A 2WIIB 2Y6HA 3ZYRA 3BCWA 1QJEA 2VOKA 4K8FA 1LENA 1AYN3 1XOYA 3MIBA 3JZVA 4IEUA 2W1QA 5JSPA 1D0HA 1BBT1 1Y4WA 3E6DA 3ZYBA 1HQLA 2LALA 2ZGTA 5C4WA 2DCYA 5DDJ3 1OF4A 1REEA 3SMHA 2EA7A 2DVAA 3BKZA 3MGUA 4UFHA 4CA9A 3OGJA 4U2AA 3NRUA 5EXOA 5LATA 2NN8A 1FOD2 4YSFA 1QOOA 3J4UH 4QB2A 3FHQA 4RA0A 1QJX1 1D4M2 1GWMA 1W03A 1OURA 3EBRA 3O12A 4Q27A 3LIHA 5LBFA 2F6BA 4A3ZA 2WAAA 1MEC1 3PU3A 4AW7A 3HBKA 3N9MA 2NM1A 4CEWA 2ZEXA 4SLIA 4J1XA 1KS5A 3E5XA 5HV0A 2BGPA 5JIAA 4DNYA 4LQRA 4Z92B 2XL7A 2VD7A 3VBRA 3IAQA 1S55A 2P3JA 4EROA 2Y6KA 1LECA 5D1IA 1N3OA 2YC2A 4ASKA 2YGMA 5LA1A 2O8QA 3MW4A 5FZ6A 2GH8A 3F2ZA 2EICA 5DAWA 3T2QA 4COZA 1XJAA 4LNVA 1SFPA 4IW3A 4COYA 5IK5A 1DBNA 2D97A 1U5XA 3WT3A 1VALA 4MUVA 4Y1UA 3ZSJA 5ACA2 5JAXA 2OXBA 2QFEA 3VD9A 4QXCA 4YGBA 1OLRA 1RUI1 2JDPA 1GNZA 3DCQA 1LHWA 2DTYA 3ILFA 2OKXA 3RI9A 1CIWA 4CZSA 4G4FA 4IL7A 1SLCA 2BWAA 1UWWA 5DMYA 3FLPA 1AYM1 1XQNA 3ELNA 4PF5A 3UL2A 1ST8A 3I3DA 5J98B 4A41A 5JZGA 1RUJ1 2WBKA 4YW4A 1WMFA 1W9WA 3WG4A 4LO5B 5FY4A 5I8TA 1PM7A 4CCCA 2BBVA 3AKTA 3U10A 5L73A 2PHWA 3HQXA 2D6OX 4OUMA 3USSA 3ZFEC 1ZZ6A 4FOVA 4QGLA 2WNUC 1UZYA 2ADEA 1CAVB 2BYVE 4LR4A 3VKMA 1WBFA 2JDUA 2OPKA 3KMHA 2OS2A 5FPBA 5LBBA 1QJX2 3RZGA 1N1TA 1O7FA 1WCSA 2OUHA 3NNMA 5FPXA 5J48A 1EUUA 1XYPA 1NZIA 4BMBA 1GYKA 2R1BA 3AP9A 4D7TA 5JI7A 2HJIA 3MO4A 1H0BA 2WQZC 2HH9A 3POEA 5CZKA 3VBSC 5EHDA 4X8NA 3T0BA 5I0UA 1W28A 3VBRC 4XF4A 1D4M1 1ULFA 5F3IA 4M3CB 2W08A 1BZWA 4BCUA 4LBJA 2GN7A 1BEV2 2I45A 4IEQA 3AMMA 1AR72 1RUC3 2WNEA 4W6YA 3H1WA 1MS9A 1W39A 4Z2WA 1WW6A 2B7YA 4YZ3A 3NJYA 4UFMA 2QZ3A 1IQAA 2ARXA 4H2AA 3ZN6A 1V6KA 4AZZA 4LBKA 2ZX4A 3GF6A 5JCTA 3AMQA 2WZR2 1H2KA 3O1SA 1OKQA 1H30A 2KD7A 1NCQC 1TMF3 2Q4SA 5H9PA 3HQUA 1JZ3A 2MNGA 4HMZA 4EZ4A 4PJYA 3SITA 3KHCA 4XFCA 1FNYA 2EIDA 4GWIA 5BXXA 2VZSA 2ZHNA 2RS12 2XBO2 1MS3A 1BVP1 1UOJA 4I02A 5EZWA 3ZOIA 3ZSMA 5F2WA 3MUY1 2FHRA 4PI0A 1PVC2 1O5LA 2UYAA 2JDYA 5CB7A 2VOWA 3UKTA 1WMEA 1AHSA 2W46A 1SBFA 5C33A 4AGRA 4R9CA 2GALA 5FZEA 3JQXA 1ND2C 3AX4A 4Q4X3 5KHKA 3ZX7A 1RUI3 4UBGA 1RMU2 1JU4A 1ZREA 2E7QA 4D0QA 1RGSA 1EY2A 4OMDA 3O0WA 5K9YA 3ZYFA 1APNA 2YU1A 1AF9A 4YFZA 1JZ7A 3DKWA 3ALQA 3GJAA 5K0UA 4OYUA 1TE1B 1VB4A 1XB9A 1RUJ3 1BBT2 1XNKA 2XL9A 3R0RA 4IV3B 1CONA 4LUKA 4WVWA 1D2SA 4K6BA 3OB8A 4WZCA 4Q0VA 2D6PA 4P9IA 4XFGA 4E9KA 2ZGLA 3Q8AA 4IESA 4QAWA 4YVSC 2R49A 4LBQB 4TN7A 3ZFFC 3HBZA 4NJ4A 4S2FA 1OUXA 2RR11 4EWDA 1AVBA 2B45X 3S6PA 2QQJA 2ZEYA 2RM21 3QLQA 3ZMOA 2IXLA 2JDHA 4X6RB 2BQPA 2ZX3A 3UGHA 1RHI1 5ABJC 3RZMA 3J26N 4MH0E 5C9AC 4LBMA 3VDBA 4ZY9A 1BEV3 2E6VA 3ZSLA 1UKRA 4TTGA 2MEV3 3THCA 2ZBJA 2X29A 3PMEA 2Y64A 4CP1A 1KGYA 2OPWA 3V56A 3JQWA 1SDWA 5FO8B 2XJRA 4MXVA 5A33B 1CAWB 5LA9A 1PGL1 3I2DA 4XUTA 4YGEA 1N3QA 4DIQA 5LA0A 3C7GA 2VXRA 4N43A 1HRI3 3VDCA 3ZFFB 3IDAA 2JDKA 4YW3A 3U1XA 1LU2A 5LK5A 2LTNA 1O6UA 2ZMLA 1TG7A 3UJOA 1PMJX 2DVBA 3ZFEB 1GNHA 4GIQA 4YZ5A 3BPSA 4BQ5A 3I8TA 1W2UA 3NV1A 4WM7A 5EYYA 3RNSA 4DRVA 4FPHA 4MXWA 4R4ZA 5F37A 2ZKNA 2XLAA 2W94A 1REFA 1KS4A 4PBOA 5CFDA 4CCMA 4FAHA 1UOGA 3WEZA 1HV1A 5F32A 1KD7A 1S0JA 2W95A 5C6CA 3A0NA 2HWD3 4N7IA 2PA7A 4ARYA 5FREA 5FP8A 1WCUA 3T0AA 4FPKA 1RL3A 2V4VA 2WKKA 4JQRA 5C71A 4RS5A 2BWCA 5KXDA 4FPFA 4IE0A 4B29A 3Q8FA 1UNBA 4CXWA 4UW4A 3WV6A 4JGZA 1B09A 3VZLA 5KXCA 1BMV1 4CDUB 1LOEA 4JAAA 5FZAA 2RJ2A 1FMD3 2GDFA 3MYXA 1PM4A 2KR2A 2ZAHA 4IEOA 5IFPA 5LWBA 1LOAA 1YO8A 4I0BA 4X6QB 4K1ZA 4RFT0 2WZ8A 3RDIA 4DEVA 1IS4A 1RUE1 1R081 4IQPA 3K48A 4L97A 5ACA3 2R073 3FFZA 3K51A 1VBA3 5FTTC 2PHTA 4D3WA 2RM23 2A6WA 4BXSV 1UPSA 5AVPA 1COV1 1UX6A 2GMMA 4CXYA 2BGCA 4FTEA 4L2NA 3KGZA 2DUPA 2WZPP 1XNTA 5FZIA 3THDA 3AZZA 2CYFA 3WXPA 4UYBA 3B02A 1JUHA 2VZ1A 3SHRA 4E27A 1POV1 4OCTA 4KMQA 4QKDA 4QB6A 3AJZA 3NJVA 4LHKA 3EO6A 1NG0A 4QQLA 5LEJA 3SXWA 1X50A 3MICA 1R64A 4WM8B 2VVEA 4Q5OA 4FOQA 1NYWA 1V6OA 3CHXA 1WD3A 1QNWA 1DZRA 1ZRIA 3EQEA 4EQVA 1GZWA 2WSUA 2HWB3 1H6XA 1F4AA 1FPN1 1PZ9A 2ZS6B 4IGQA 3VL8A 3W58A 1RUNA 2K9ZA 4R4XA 2GU9A 3A4UA 4Q0PA 4BXFA 1G6NA 1HN0A 3IT8A 4YARA 5JVVA 3TOJA 3ZN4A 4GMP1 5FOBB 4D6RA 5FMBA 4LXLA 3T0DA 5FPLA 2JDZA 4YM1A 4NE9A 4A3XA 4KI5M 4AVAA 5D2AA 3DUIA 1ULOA 1Q43A 4XJ9A 4AEJA 5KBFA 4CCDA 1YFUA 2ZX2A 4QX7A 4QMAA 3VBHC 4OMCA 5LK7B 1YHFA 1W8ZA 1OFSA 4HOOA 4META 5DUUA 3VKFC 1KDMA 4I0AA 4QU1A 1HRV3 1GR3A 2JICA 4ZU5A 4LBLA 2PYTA 1OLME 4LE4A 3RZZA 3WF0A 4MGIE 2ZX1A 1G9AA 2RDNA 1H1MA 4GH4A 3AYAA 4MGQA 4BM8A 4E2QA 3OY8A 1E57A 5T50A 3AXDA 5BPXA 4LLFA 1DHKB 1ZZ8A 3KCCA 5FO7B 1WW5A 2CAVA 2JEMA 1X82A 2F4LA 3HMYA 4E4DX 2Q8EA 5CG8A 2PAKA 2LUWA 1RC6A 4QPGC 4CDXB 4YZ2A 1SACA 2WS93 4GJZA 2HWB2 4AXOA 3LSDA 3ZYHA 1GZWB 4JGYC 4LIVA 3BTZA 5ANNA 4K3UA 2PHLA 3CDZB 1GANA 1AL22 1NE6A 3AP5A 2HLEA 3FJSA 4WM8A 4K21A 3ZFGB 1F5JA 1Q56A 3T4HB 1VBB2 4UOJA 2CSGA 3RWKX 4Y4RA 1RITA 4K20A 1AXZA 1ZZCA 3K46A 4EN6B 3C3VA 2H0VA 3N9NA 2UURA 4PQ9A 1VBE2 3BN6A 4OVEA 4HETA 2IXJA 3C8XA 5L9VA 1H1AA 3L9JT 1H8TC 1RXGA 2MHFA 2SLIA 3A23A 3MIFA 4PIXA 4AR2A 4DPNA 2YFZA 1OOPA 2KXLA 1PMIA 4CDUA 5CKMA 5F8PA 1JMUB 4NPRA 4BQ1A 1G8WA 2HWF1 2P2KA 1F9KA 4NHLA 1BK1A 3WF4A 4CEYB 2BZDA 2XVKA 4RS5B 2WZEA 3LCPA 5FZBA 2B46X 4CU7A 4GWMA 1F2NA 2A70A 3KVAA 1QJY3 4O65A 4AVSA 5CFCA 5LY2A 2EALA 2A3YA 5CFDB 4QXKA 5FZHA 2J1SA 1BJQA 1HJFA 1MVQA 2J1EA 4PIYA 1VE0A 2VQAA 4AG4A 2P3KA 3HOBA 4F3JA 4ZU7A 2Y33A 4RQPA 1I1EA 1OQDA 2G1MA 3MPBA 3L2HA 1EPWA 3UNPA 4EN0A 3ZFEA 3IBMA 5FRAA 4B4QA 4XURA 1NUKA 4FTSA 1VBC2 1VBC3 3PMSA 4XFBA 5JR7B 3VB9A 4XFIA 5KXBA 3OGVA 3RYRA 5F6LB 4K7JA 4QQ2A 2JECA 4KQ7A 1EUTA 1LNSA 4JGYA 4LKFA 4NIHA 2K46A 4FFFA 4NHKA 2VUAA 4E8DA 2BVVA 2HWB1 3NNGA 2B39A 3SLIA 5FYVA 4XUOA 1S0GA 3V0AB 1W8WA 2V09A 3INAA 4YZ1A 3OD0A 1DYOA 4XQ4A 1SHWB 2XB6C 1ND2B 1WA6X 2BDRA 3QH7A 1G9DA 2JG9C 2E33A 2P3IA 2XJTA 3N35A 4ZKTB 1MEC3 4HL0A 4P08A 5CFDC 5KXEA 5J36A 3H42B 4V1PA 3HN3A 1CAWA 5HV4A 1SPPA 1US3A 5JLVA 1BXHA 1NA1B 4GZ9A 4WM7C 1FV3A 3UESA 3ZN5A 1JXNA 1RUC1 1TME2 3J9SA 1X33A 2CWMA 4NR1A 4DY5A 1Z7S3 3LD8A 1K5MC 3GBWA 2Q8DA 1QF3A 2BOJA 2QQIA 2Z4FA 3KVBA 3U4SA 3LDKA 3AC0A 3UGGA 4KG0A 2PHUA 5F7UA 2J22A 2P5BA 5H9QA 2VBPA 1IGOA 3IZOA 1RUE3 4FTBA 1EV13 4KU7A 3VBHB 5BV6A 3VBUA 3EJKA 3HPNA 4RD7A 2G9GA 1EYBA 2VMIA 4PLMA 1A78A 1A34A 4JGZC 2E63A 2D3RA 1FPN2 3LIGA 1JYWA 5A3MA 1OD5A 2ZXQA 5FYUA 4QX5A 2VZ3A 4LK7A 1LHNA 3VBUC 1DLLA 3GCXA 1U5YA 4QHZA 4ZHNA 3ZIXA 1GQHA 1JHJA 2VULA 2C5DA 2WS92 2Y8KA 1AR63 1UW8A 5DZEA 3VDDC 1AYM3 4A7YA 4JDMA 4LTAA 3UV9A 3RQ0A 2QE3A 4FOWA 2X10A 1W8UA 3LKJA 4XF0A 5F5CA 3VDAA 3UETA 5GZGA 1PGSA 3J8F3 1NQJA 2ZEWA 1EV12 1ASJ2 4O7XA 1RUE2 4GKXA 4PHZA 4XDQA 3PTRB 3VBFB 1SFYA 2NYYA 2R063 5JPMB 1RMU3 1F15A 4NIDA 2P3YA 4G9SB 5I0TA 1FYUA 2W92A 3O7OA 3POJA 1QNYA 1POV0 4FOYA 1LEDA 1OA2A 2ZX0A 4RQPB 4NIAA 1UU4A 3WQ7A 2JE8A 1V70A 1W8FA 2A6VA 4J25A 2HKXA 1ULCA 1W6QA 4GH4B 4LHNA 4CUBA 4OI4A 2A71A 4A2UA 3BU0A 4CVUA 2VNVA 5J96B 4LO7A 3VD7A 2UWAA 5EJZB 3ZR6A 1AR92 2R041 3N36A 3D0SA 1HJGA 1JOJA 1QKQA 2NMNA 4M3CA 2IUWA 3VKLA 1NCRB 1S2EA 3A7QA 4Y1XA 1PIV1 4AI2A 5AC91 4KU8A 3LF7A 4FFHA 1M4WA 1A8DA 4PF1A 4AGVA 1SZBA 3E97A 5F3EA 5IW0A 4XF1A 4QM8A 5CAZA 1OOPB 2BBAA 1QJX3 5A7QA 3O14A 4YNIA 1W3VA 3AXEA 3ME2A 3R05A 5CYYA 3BPZA 3NO8A 2JKBA 5IUQA 3UJQA 3O1VA 3MIGA 3PVNA 1ZBA3 1UKGA 3MV01 4TLGA 3J7NA 3ZKYA 3B9IA 5L19A 3VDDA 1CAXB 1ACCA 2GP3A 4MHRA 3RZKA 4Y22B 1ZBA1 1DGLA 4XXAA 5FPZA 3OPZA 2JG9B 2EIGA 3AP6A 5GLVA 3WHUA 3AZVA 4PDWB 1MS5A 3ACLA 3EHKA 4TSVA 3LPFA 3PHMA 1OVSA 3FHIB 2PN5A 3SEEA 2G9FA 2AREA 3GXUA 1HQNA 2N7GA 3MLLA 3PVBB 4QPGB 5FP9A 5DAXA 4CDXC 1NCQB 1W2OA 2C1FA 3GZUC 3NAPA 1OOPC 4WM8C 4XHBA 2RDSA 1ONAA 1VMJA 2YPDA 1VJ2A 1ULPA 5I0RA 2IXCA 2C6SA 2F17A 3M1HA 4LA2A 3W20A 4AWDA 4AFAA 2ZMKA 4UT5A 1HW5A 1FMD1 1H1IA 2WT2A 4Q4W2 1UY4A 2CGOA 1PO13 3EYPA 4QPIC 2R16A 2YBKA 3CL1A 4A4AA 2R32A 5EIYB 2VZQA 4MV2A 4TWTA 4JGZB 4INDA 4WBBA 5ERLA 3VL9A 4Y20A 1AXKA 1RHI3 2BRTA 1AR82 4HSJA 1YQ8A 2TEPA 1S2KA 4FFGA 1MVEA 4Q26A 1A6CA 4Q1PA 4XAEA 4DXRA 1ASJ3 4N53C 1R1A2 4CEYC 1I5ZA 4D7YA 2BV4A 2QUOA 4YVWC 3WX5A 5JZGC 2YHJA 2JDNA 1V6LA 1O3TA 5FBZA 5GJ6A 3JU9A 2Z69A 2QQPA 5A3TA 3W59A 2VH9A 3FBYA 3GCWA 4GULA 3WQ1A 4MOAA 1W2TA 1BVVA 2Q1ZB 1MQTA 4JKKA 4CEWB 4NIGA 4JKLA 1TNFA 2XOMA 1RB8G 1LOBA 3LOIA 3R4DB 4Q4X2 1WMXA 3I54A 1LR5A 3VLBB 3ZXGA 2IFWA 3CQOA 3NNJA 1MZ6A 1AR93 1LHUA 4NO4A 4YW7A 5FYZA 5L7OA 3TAYA 4DB5A 1QOTA 4I3PA 4PCRA 5F39A 5GLZA 1W6NA 4HK8A 4IE6A 1G86A 2CV6A 2V73A 4HK9A 4XUNA 3ZFGC 3GNEA 5FYSA 5FZLA 1P8JA 3FC0A 1N1VA 4LPLA 1CJPA 1QU0A 3I3MA 4DFSA 1Y9QA 1NCRC 4Q0SA 1WD4A 2WO3A 3K77A 3M3OA 5IFTA 2XVLA 1AYN2 1ENSA 1PO23 3NV2A 5LW9A 4DO0A 3ACHA 3V64A 1SG3A 3WNPA 4Y4YA 2XXZA 5DUXA 4AHWA 3SH5A 3ZR5A 4DINB 3NWKA 2HBTA 1NA1C 1PVXA 1Q3EA 1GU3A 3KF5A
chains in the Genus database with same CATH topology
5A70A 1OVPA 1W8FA 1OUXA 2WR9A 5A6YA 2BV4A 2JDKA 1OXCA 1OURA 2JDMA 2VNVA 2JDHA 2JDNA 5D2AA 4AOCA 1UZVA 4CE8A 2JDUA 5HCHA 2BOJA 4UT5A 1W8HA 1GZTA 5A6QA 2JDPA 3DCQA 2CHHA 2VUCA 1OUSA 2BP6A 3ZDVA 1UQXA 2XR4A 5A6XA 2WRAA 2VUDA 1OVSA 5A6ZA 2BOIA 5A3OA 2JDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A70 A;  1OVP A;  1W8F A;  1OUX A;  2WR9 A;  5A6Y A;  2BV4 A;  2JDK A;  1OXC A;  1OUR A;  2JDM A;  2VNV A;  2JDH A;  2JDN A;  5D2A A;  4AOC A;  1UZV A;  4CE8 A;  2JDU A;  5HCH A;  2BOJ A;  4UT5 A;  1W8H A;  1GZT A;  5A6Q A;  2JDP A;  3DCQ A;  2CHH A;  2VUC A;  1OUS A;  2BP6 A;  3ZDV A;  1UQX A;  2XR4 A;  5A6X A;  2WRA A;  2VUD A;  1OVS A;  5A6Z A;  2BOI A;  5A3O A;  2JDY A; 
#chains in the Genus database with same CATH topology
 4QX3 A;  1V6I A;  1HB4 A;  2WFF 3;  4NRQ A;  2CDP A;  3IDB B;  4IEY A;  4YG0 A;  1NE4 A;  4E4Z A;  3O1T A;  2RS5 2;  5HCB A;  5FBJ A;  3VBF C;  4YVW A;  5FXX A;  1HN1 A;  3T4V A;  1K3I A;  1V6M A;  2R07 2;  1UMI A;  3NST A;  3WQB A;  2Q0A A;  4H55 A;  4A7K A;  3VHR A;  2RV9 A;  3ZLI A;  1W06 A;  4CCE A;  1XYN A;  1GOF A;  1XNB A;  3ACF A;  1S0D A;  2WNU B;  3I2F A;  3KV5 A;  4LBN A;  4Y5Z 0;  5BNN B;  1LES A;  1YFY A;  5BNO C;  1JBC A;  2VG9 A;  4BPZ A;  3SKJ E;  2YUE A;  5DUW A;  3LDR A;  1QMJ A;  4KGG A;  2C26 A;  4WZF A;  3AKP A;  3VZK A;  3LPG A;  3WF3 A;  4N9I A;  2YBP A;  2LRP A;  4YM0 A;  3BIE A;  5FK7 A;  1VAK A;  2R30 A;  2Q8O A;  3LA7 A;  2X5I B;  5A7S A;  1LGC A;  1PO1 1;  2EIE A;  3N7J A;  4QPI B;  4ZZ5 A;  2KA3 A;  5A7W B;  3BB6 A;  5A3U A;  4XUQ A;  3WDX A;  1OH3 A;  1W6O A;  2Y38 A;  4GQ7 A;  4XJU A;  2PHD A;  3ZSK A;  2XR4 A;  2XQX A;  5ABJ A;  1UD1 A;  5A3P A;  1H8T A;  5F1R A;  3BYW A;  4KG8 A;  2WAB A;  2AC1 A;  2YU2 A;  5J37 A;  3M2M A;  3TRS B;  1FX5 A;  4BWO A;  5FZ1 A;  3KD4 A;  4YRD A;  1N47 A;  1HRV 1;  2E7A A;  3KCY A;  4KWJ A;  1A8M A;  3LGR A;  2PLV 1;  3I2I A;  5LEK A;  2WWU A;  1UYP A;  5C5U A;  1U0A A;  1AL2 1;  2JDM A;  1ENQ A;  1O5U A;  1SEF A;  1CD3 G;  1VBD 2;  2VMD A;  1PX4 A;  3M3E A;  4LKE A;  2YC4 A;  4AHX A;  2DV9 A;  2R1D A;  3AYD A;  2PLV 2;  3A0K A;  2GC3 A;  1DGW A;  1WW4 A;  2OQ7 A;  4QPG A;  3S30 A;  4DS0 A;  2RS3 1;  5CBL A;  4NWW A;  4K40 A;  3TEW A;  5IK7 A;  2XKP A;  1W04 A;  1DGW X;  5FY1 A;  1AZD A;  1RUF 1;  4PBP A;  4BH9 A;  1FV2 A;  2CY6 A;  5BNO A;  2FQP A;  5A3O A;  2P37 A;  1H4H A;  1YCI A;  3O1O A;  4BDV B;  4CP9 B;  4EV0 A;  1CAX A;  1JOD A;  1GBG A;  3WDV A;  1MR5 A;  1TEI A;  3K4A A;  5K0U C;  2Q8C A;  1QJZ A;  1L7Q A;  1VB2 A;  5JMC A;  1UZ0 A;  3NJX A;  2A75 A;  5CG9 A;  3DYP A;  2W2I A;  3ZXL A;  1DQ4 A;  1JYI A;  1V00 A;  4XFF A;  1X7N A;  3LDB A;  4P9W A;  4N53 B;  5FZ9 A;  5FWJ A;  1XNA A;  4ARX A;  4GMP 3;  3VUO A;  4N8M A;  4UF0 B;  3DXT A;  5ABJ B;  1QWR A;  1RYY A;  1UU5 A;  1AR6 2;  1XRU A;  3HIF A;  3TN9 2;  3VD3 A;  3MFC A;  4O9E A;  1DGR A;  1QEX A;  2D6K A;  2GME A;  1W6O B;  2V4A A;  2W68 A;  3HNB M;  5FY5 A;  1DCS A;  2K0G A;  3ILR A;  4QD2 A;  3X29 B;  1ASJ 1;  3J8F 2;  1KXG A;  1B35 B;  3ZIW A;  2Y6F A;  2BUK A;  1YI7 A;  1YQ5 A;  4YFW A;  4MGT A;  4F83 A;  4Q2F A;  2UWC A;  5CU1 A;  5FKC A;  1CZS A;  2C0Z A;  2QQO A;  1KDK A;  5FUN A;  1I5P A;  1VBC 1;  2RG4 A;  3D6E A;  5EV7 A;  4AQS A;  5HXV A;  5BNN C;  1JZ6 A;  5BNO B;  1RUD 2;  4FI9 A;  1UN1 A;  3LEG A;  1CAV A;  1WLC A;  1EAH 2;  1C8M 1;  3K75 B;  5FZ0 A;  2Y6G A;  2DUO A;  3UK9 A;  1NQD A;  2VZV A;  3MI8 A;  5CKN A;  3MLK A;  4JX0 A;  4N43 C;  4UFL A;  2L9L A;  5BNN A;  5IJR A;  5IAT A;  5CEH A;  1AR9 1;  2EAA A;  2R04 2;  4MGZ E;  3AVR A;  3ES4 A;  1E5S A;  3MV1 1;  4A6O A;  1GIC A;  3IKW A;  3N7M A;  4QB1 A;  1PIV 2;  1DQ0 A;  2XON A;  4NPL A;  4UW5 A;  4XTM A;  3O5S A;  3T2O A;  3PJQ A;  3WG3 A;  3BUC A;  1OXC A;  4RSU A;  1MZE A;  1J84 A;  2OII A;  1CZV A;  2VW1 A;  3ETP A;  3DKQ A;  4CE8 A;  1O91 A;  5CIR A;  3URF A;  4R8H A;  1TME 1;  1RUF 3;  1VIW B;  5I8S A;  1HIX A;  3WNK A;  1UL9 A;  2A1X A;  2RMU 3;  3OOX A;  4GAL A;  4V2V A;  3CZJ A;  2QVS B;  3OBA A;  3WUD A;  4OUL A;  5A3L A;  5FUI A;  2W91 A;  2RE9 A;  4MVT A;  3V65 A;  3VBH A;  2W52 A;  4CDW C;  3OBT A;  3IM0 A;  4GB3 3;  5FY0 A;  5F5I A;  1O3Q A;  2VY0 A;  2PLV 3;  5AFB A;  1UPI A;  1MS8 A;  1SLB A;  2X05 A;  2FZ2 A;  3AK0 A;  3B94 A;  2AAC A;  4SBV A;  4A45 A;  2WNV A;  1IKP A;  1NLR A;  4QWN A;  2QDN A;  1W6Q B;  3HN1 A;  5BY5 A;  1AXY A;  5FXZ A;  4LUM A;  3I4I A;  4COW A;  4MG2 A;  2BFU L;  2JX9 A;  3H1M A;  1QDO A;  2PXJ A;  3M7A A;  2GNT A;  1AR6 1;  2VW0 A;  1W6N B;  4W8J A;  5C3P A;  1X9T A;  1Y9M A;  3AMN A;  1RUD 1;  1K45 A;  2XWJ B;  3WDU A;  1LGB A;  1QJF A;  2HWE 3;  4N90 A;  4I01 A;  1WLT A;  2VZU A;  4OHX A;  2Z5W A;  1YQC A;  1ND2 A;  5FLI A;  3VBO B;  4EYU A;  3KF3 A;  2X5I C;  5D21 A;  5KC5 A;  5A6Z A;  3V0A A;  2PHR A;  2A7A A;  3LEK A;  1ENX A;  1GV9 A;  4XFH A;  1D4V B;  2JIJ A;  4LO6 B;  2BJS A;  1XNC A;  4AVV A;  1L3J A;  2QKD A;  3CNA A;  3WNX A;  3KT4 A;  3UKV A;  4C1X A;  5LZ6 A;  3TYJ A;  4BQ2 A;  3PU8 A;  2HEV F;  5F5Q A;  4QX2 A;  3POS A;  4QKF A;  2GAU A;  3I3Q A;  4OQ9 A;  1Q8Q A;  4IE5 A;  2YYO A;  2RDQ A;  3TEY A;  5FMO L;  1SMV A;  5AC9 2;  5A6Q A;  3NL1 A;  5BNP B;  4ZZ8 A;  1EP0 A;  5FZF A;  4B1M A;  1AR7 1;  4MZU A;  5GZE A;  4ES8 A;  3KV6 A;  3UT0 A;  4QXH A;  2VUC A;  4OZO A;  4Q4V 1;  2IVI B;  1KFU L;  3RZJ A;  1Q8S A;  3VBU B;  4EJR A;  5KR7 A;  1FXZ A;  1VBE 3;  3KHB A;  1SLI A;  4CDQ C;  3WW2 A;  4C1W A;  2UYB A;  2DF7 A;  2VL4 A;  1W0N A;  5DZF A;  1VBB 3;  3I97 A;  5B2G B;  1H6Y A;  5C4W C;  2D3S A;  2JIG A;  1Q8O A;  2JD4 A;  2RS5 3;  3HWJ A;  1QQP 2;  3WZ1 A;  5HXM A;  4FPO B;  2PQS A;  4LOR A;  1UZV A;  2AGS A;  3III A;  1J83 A;  3NKT A;  4MLO A;  5LAS A;  1QXP A;  4EZH A;  2WA3 A;  3OUI A;  2VNG A;  5HCH A;  1BLZ A;  1W05 A;  2J1T A;  2VOV A;  2EIB A;  5EJ3 A;  3ACI A;  4Y5S A;  2RR1 3;  2XHN A;  4CXX A;  2XUE A;  5GLW A;  3B69 A;  1LB2 A;  5FYC A;  2ARB A;  4E8C A;  1RUJ 2;  4YZ4 A;  3NVC A;  3WD5 A;  2QTW B;  2Z79 A;  3FX3 A;  4UI9 L;  4DOU A;  4FP2 A;  4W65 A;  3RGB A;  1AX1 A;  1MQT B;  3IDC B;  3H50 A;  3I2O A;  4MGS A;  2VR4 A;  4Y1V A;  2DVD A;  2X09 A;  3HR9 A;  1HRV 2;  1XSR A;  3OD4 A;  2WR9 A;  3WG2 A;  4GAZ A;  3ZPY A;  4AK3 A;  4BYY A;  5FY9 A;  4K9S A;  3Q8E A;  4EN8 B;  5IHR A;  4R9B A;  1JOP A;  4RGA A;  5T3N A;  1TME 3;  4DEQ A;  3LEI A;  2PAE A;  3H8R A;  3C7F A;  1RJ7 A;  1RUH 3;  4HLT A;  4QDR A;  2XHK A;  1ULE A;  1DP0 A;  3D8C A;  3OBZ A;  4XC9 A;  1PVC 3;  1JYX A;  4BME A;  4DUW A;  5JXJ A;  2QQU A;  3IPV A;  4DUV A;  4ES9 A;  1GP6 A;  4XFA A;  2FD8 A;  1R09 2;  2RVA A;  1HRI 1;  1XND A;  2BER A;  3UKN A;  2Q1M A;  5CFC C;  3J7M A;  3V0B A;  4N9H A;  1WKY A;  3C7O A;  3OYW B;  1S4C A;  3ITQ A;  1VRH 1;  1Z7S 2;  2R07 1;  2Z42 A;  2ZGP A;  1W3X A;  1MS0 A;  2VCA A;  4JV4 A;  4QPW A;  2VQ0 A;  4N7U A;  2RDR A;  2O1Q A;  2NMO A;  1BEV 1;  4W4Z A;  1ZA4 A;  3AKQ A;  4UXA A;  3I3B A;  3FHA A;  1X8M A;  3MBW A;  2FCV A;  4FPE A;  5FPV A;  3B00 A;  4CCN A;  1JW6 A;  1V0A A;  3POF A;  4QQP A;  4JTO A;  1QJY 1;  3H1Y A;  5F6K A;  1MEC 2;  3NNF A;  4YGD A;  3WDW A;  3RVH A;  1DYP A;  1SCR A;  3AL6 A;  2WWS A;  2IWG B;  1HV0 A;  2ZAA A;  3AYC A;  3VBO C;  2XG3 A;  1H9W A;  4DRR A;  3WW1 A;  4D94 A;  2ERF A;  3BOP A;  2E32 A;  3S5A A;  1DDL A;  1VPH A;  4OHV A;  5G05 L;  3R6S A;  1OPM A;  2W39 A;  2VBB A;  3NQH A;  4QHB A;  3TN9 1;  5I0D A;  2WZR 1;  2JG9 A;  3FUQ A;  2ZZJ A;  1S0I A;  5LRR A;  2DU1 A;  1N1S A;  2DCK A;  2WN3 A;  4PQQ A;  2QQW A;  3MF6 A;  3IMM A;  4B4P A;  2NQY A;  4UFK A;  2GH2 A;  1CPN A;  1NKG A;  1LOF C;  1DYK A;  2SBA A;  4HON A;  1IPS A;  3DN7 A;  1GOH A;  4O9G A;  3RJR A;  1KJL A;  1YJL A;  4JC1 A;  3ZYG A;  1V9U 3;  3CJI C;  3ON7 A;  5FCC A;  4P5Y A;  3ZXF A;  5AVA A;  4L8Q A;  4ATF A;  1Q5O A;  2G9Z A;  2YZ4 A;  1AJO A;  3DL3 A;  4AFB A;  4AVB A;  1C8N A;  4FPJ A;  4DXZ A;  2VC9 A;  1YEW A;  3JXS A;  3THT A;  3NV3 A;  4MAD A;  2PTM A;  2WLP A;  5K7P A;  2W5F A;  1O3R A;  4QPY A;  2E31 A;  5HPO A;  2P17 A;  2ZKL A;  2WRA A;  4CTE A;  1PO2 1;  3RMY A;  1OPO A;  1HQW A;  4GB3 1;  1OLM A;  1W99 A;  2OA2 A;  3ZXK A;  4XPV A;  3T1L A;  3AZY A;  4CU8 A;  3PVE A;  1F8V A;  4OI2 A;  3AKR A;  2R0F A;  3ZVX A;  1NT0 A;  2RS3 2;  4AHZ A;  4BIF A;  1M06 G;  1OLQ A;  4M00 A;  2WN2 A;  1DQ2 A;  3ZKU A;  5LRS A;  3I49 A;  3JD7 1;  1WA4 A;  4WVV A;  4AOC A;  1KRI A;  4F8A A;  4UW3 A;  2VVD A;  4Q0Q A;  1MAC A;  4QDQ A;  1JZ2 A;  3VHN A;  4BIS A;  2WLQ A;  3H8O A;  2D3P A;  2ZHM A;  3AMH A;  5A7N A;  3H3L A;  1W9S A;  4IV1 B;  4FQZ A;  1QJY 2;  1QY4 A;  1RJ8 A;  1NXD 1;  1PK6 C;  3GGL A;  3OGR A;  2V5D A;  1ZNP A;  4MYE A;  3LEM A;  1ZRF A;  1GZC A;  1CN1 A;  4YVS B;  1NLQ A;  1CAU B;  5JR2 A;  1JU3 A;  4CRQ A;  4C0B A;  2DFB A;  4XF3 A;  5DUV A;  1RIN A;  1O4T A;  1HB3 A;  5DDJ 1;  4D7S A;  1XE8 A;  4QHO A;  5A32 B;  4PLO A;  4QX0 A;  1Z78 A;  1BYH A;  5L36 A;  5SV8 A;  1W9F A;  2D5H A;  1PVC 1;  2YFU A;  4I09 A;  4KH9 A;  5D8A C;  1T6G C;  5HCA A;  3WG1 A;  1LOF A;  4AVC A;  1STM A;  4NRP A;  1OF3 A;  2JG8 A;  2R06 1;  4XBL A;  2G19 A;  1PZ7 A;  5FZ4 A;  3M3Q A;  4JDN A;  4RR3 A;  4UFI A;  3BI3 A;  2XDV A;  5GZF A;  4P9X A;  2ZGS A;  2ZGN A;  2ZOE B;  3NKG A;  4AHY A;  4AED A;  4CUA A;  2YPJ A;  5JI9 A;  2MEV 2;  1O4Z A;  2R06 2;  1C1F A;  5JUV A;  4OI0 A;  1LHO A;  3R4S A;  2QBX A;  4LHL A;  4GJY A;  2ATF A;  4YG6 A;  4XJW A;  3VZM A;  5BYN A;  5CFC B;  4IE4 A;  5IVC A;  1KQR A;  4ISR A;  4XIL A;  1SCS A;  1G9C A;  5F5A A;  1X8E A;  1BKZ A;  3I7D A;  1C8M 2;  2AUY A;  4CUC A;  2Y6J A;  4XIK A;  4GMP 0;  2GNB A;  1GFF 2;  4URA A;  2P34 A;  4H14 A;  4EN7 B;  4MGY E;  2AH2 A;  2B9U A;  4IEZ A;  4NRO A;  4XE9 A;  1K12 A;  1W6M A;  5GLU A;  3T3Y A;  1U12 A;  2GN3 A;  4BLJ A;  4Z1V A;  3CEW A;  3KCX A;  5FV3 A;  5IAV A;  1GZT A;  2VMG A;  4FCA A;  4DUX A;  2A3X A;  4JHZ A;  4LBQ A;  3WF1 A;  1TMF 2;  1VP6 A;  3I59 B;  2JE9 A;  3EB7 A;  3Q8B A;  1R09 1;  1C8M 3;  2QJV A;  3KT1 A;  4J1W A;  4ZON A;  2GC2 A;  5T52 A;  4BLI A;  2OW4 A;  1OT5 A;  2ZZQ A;  3AKS A;  5DAV A;  2OQ6 A;  4AI3 A;  4DXT A;  2ZHL A;  4NHX A;  3WNL A;  2CU5 A;  4CU6 A;  1N3P A;  2VEC A;  4PDW C;  5JSR A;  1IS5 A;  2VUJ A;  3NNL A;  1J3P A;  3ZYI B;  1VAM A;  2RS3 3;  1BCX A;  4CEW C;  4XXP A;  5IVB A;  1U5Z A;  1QHD A;  4LO4 B;  5JMO A;  1J3Q A;  2W1W A;  4B7K A;  2WAO A;  1H2L A;  2Y0O A;  2DFC A;  3P3N A;  3LA3 A;  3HD8 B;  1YXW A;  2ZA9 A;  4RGG A;  5KHI A;  3KV4 A;  5A33 A;  4I3G A;  5I8Y A;  3OY8 B;  5A7O A;  1A3K A;  2F4P A;  5FQ0 A;  4ZXK A;  2J1V A;  2K2S A;  1ZM1 A;  5GM0 A;  1QDC A;  3WP3 A;  2FDK A;  1VRH 3;  1NZC A;  3MID A;  2Q30 A;  4LT5 A;  2XGX A;  5FZ7 A;  4XUP A;  1Y7B A;  3VGI A;  1G7Y A;  2VPV A;  1OA4 A;  1DQ5 A;  2JXA A;  1W2N A;  2CAU A;  4FXK B;  4A6S A;  5BNP C;  2J1U A;  2VCM A;  4L9B A;  5FYI A;  4CEY A;  5GZC A;  1SLA A;  2WYF A;  3N9O A;  3I2J A;  3ZN6 B;  4OHY A;  1UCX A;  5T5J A;  4LK6 A;  3PUH A;  2PHF A;  3U11 A;  5FZO A;  4YWA A;  2B42 B;  1SBE A;  2YRO A;  4Q4Y 1;  4XET A;  1UIK A;  2OVU A;  3UGF A;  1W8H A;  2C9K A;  4HKW A;  5DAP A;  5HI0 A;  5FYM A;  3BAL A;  4EE2 A;  3CBN A;  4QDS A;  5CVR A;  2EXJ A;  1UU6 A;  1ZYB A;  3J8F 1;  1RUG 2;  1MPX A;  2JB8 A;  4FQ4 A;  4NN0 A;  3WIN E;  1RED A;  2VUD A;  3KS7 A;  1VRH 2;  1POV 3;  1Z7S 1;  1E5R A;  4HZF A;  4JHT A;  4XIO A;  5FMD A;  4E2G A;  5K4L A;  5K0U B;  1JYN A;  2OZJ A;  3T2T A;  1O8P A;  4GD4 A;  1BMV 2;  1RIR A;  1E5H A;  1ODN A;  4Q4V 2;  1HB1 A;  5JOX A;  4Q8K A;  4L99 A;  4Q4W 1;  4YW5 A;  1J3R A;  2DU0 A;  3ZXD A;  3HJR A;  1V9U 1;  4PI2 A;  1OMI A;  1RTV A;  4S2D A;  5FFO C;  1OHF A;  3PTY A;  4D6S A;  1FNZ A;  1C5H A;  2A73 B;  2UY8 A;  2NLR A;  1XE7 A;  3HAG A;  2ZCW A;  4M0N A;  5FZC A;  4P9J A;  2D6M A;  2VTX A;  2YDE A;  3P3P A;  3B93 A;  2J42 A;  1PIV 3;  2MPF A;  1YFW A;  3ACG A;  4LOT A;  2DVF A;  1IKQ A;  5E6H A;  2YG0 A;  1B35 A;  4M3C F;  3RG0 A;  3H8X A;  3WW4 A;  1CZT A;  2DWR A;  5C8C C;  2C9A A;  3OG2 A;  4B4R A;  1CWP A;  1SLT A;  5JDB A;  2I74 A;  2WL1 A;  4UF0 A;  1EAH 3;  1CES A;  3IMN A;  4AYU A;  3BOD A;  5T5P A;  5FZD A;  3OTF A;  1GWL A;  3U75 A;  3ZXE A;  4Q4Y 2;  3N3H A;  1OA3 A;  1D0G A;  3CO2 A;  1O8S A;  4XW3 A;  1FOD 3;  2FDF A;  2XJQ A;  3NMB A;  1GSL A;  5C5T A;  4DMI A;  1X36 A;  3FN9 A;  3AMP A;  5C9A B;  2VE1 A;  5A3N A;  4BB3 A;  1E5I A;  2WDB A;  3PL0 A;  4BIO A;  5BNQ A;  4YPJ A;  1XE0 A;  4ISQ A;  2WO1 A;  5FYH A;  4JTN A;  1ND3 A;  5DPN A;  4XDP A;  1R1Z A;  2A3W A;  2MEV 1;  2QQM A;  4UFJ A;  1S0B A;  5EQU A;  3S7E A;  3MDP A;  4X8P A;  3TNQ A;  1UZZ A;  2WJS A;  2A6Z A;  2HYX A;  1UXX X;  1OBN A;  2PMW B;  3D5O A;  4I0W B;  3DF0 A;  4QGM A;  4LEJ A;  3ZPO A;  1W8N A;  1YWK A;  2J1R A;  3MUZ 1;  4LHS A;  1PK6 B;  1VAV A;  3POY A;  3MIE A;  3SC7 X;  2WNU A;  3FUO A;  3ST7 A;  1RUH 1;  5F2S A;  2BW8 A;  4BK4 A;  4P00 B;  4RHV 3;  2QQL A;  4XQD A;  1W8T A;  4C90 A;  2WYS A;  4GWN A;  5A80 A;  3SIS A;  3VDD B;  4B7E A;  1ZZ9 A;  3H8U A;  2VMH A;  5KWR A;  2WO7 A;  1OFN A;  5EJ1 B;  2CL2 A;  4RYD A;  4ZS3 A;  3LFI A;  1LHV A;  4ZXE A;  1J1T A;  1O4Y A;  5IAX A;  1OH4 A;  4Q4W 3;  3KB5 A;  2DBN A;  3GYD A;  4AFD A;  5A70 A;  5DAB A;  3VZJ A;  5BUV A;  1AR7 3;  2ZTN A;  4QX1 A;  1ZRR A;  5FZO B;  1YQ2 A;  2WNO A;  4RR3 C;  4OI1 A;  4B1L A;  3OEB A;  4KNC A;  3WVJ A;  4P9Y A;  3AJY A;  4ET7 A;  2RMU 1;  5C7G A;  1JN2 P;  4AQ6 A;  3T2P A;  4R9D A;  1AR8 3;  3MIH A;  1WBL A;  3AVS A;  5JOZ A;  1Y3T A;  2ILM A;  2RS5 1;  4KGQ A;  2YXS A;  3UYJ A;  1OQ1 A;  4IV3 C;  1T2X A;  3E6C C;  4IGO A;  4AI8 A;  5C8W A;  1LAJ A;  1VBB 1;  4LUL A;  4W50 A;  3GM8 A;  4QQH A;  4E4S A;  1PGW 2;  4XDO A;  1UO9 A;  1LTE A;  1YNA A;  1OC1 A;  4GWJ A;  2EF6 A;  5E1R A;  1DG6 A;  2HYK A;  3AP4 A;  4IV3 A;  1DQ6 A;  2D93 A;  4XBN A;  2IXH A;  5GZD A;  4WM7 B;  4QT6 A;  2GND A;  2RS1 1;  2XBO 1;  4QX8 A;  3VZO A;  3J7H A;  2QQN A;  4Q0U A;  2IVJ A;  4FPL A;  3LAG A;  3WNO A;  1PNF A;  4IXL A;  2JG8 B;  1JI6 A;  1VRB A;  2C24 A;  3POB A;  4XZP A;  5T5O A;  2G4I A;  2NPI A;  1O59 A;  2LRO A;  4GB3 2;  3GHM A;  2R6Q A;  2DBI A;  2D7F A;  2UWB A;  5A32 A;  2VMC A;  4JQT A;  1JYC A;  1PO1 2;  5SV5 A;  5FOJ B;  2VBD A;  2EXI A;  3POI A;  4YVW B;  1UMZ A;  2ORZ A;  5C4W B;  3VZN A;  4COU A;  3ATG A;  2FCU A;  3DYO A;  4LIU A;  4Z2A A;  4YW6 A;  5JIU A;  2CDO A;  3S57 A;  1BK0 A;  4AQT A;  4HKO A;  3LWC A;  2CNA A;  4URT A;  1VMH A;  3PUR A;  3SCF A;  4ORF A;  3GHN A;  5C3Q A;  1LRH A;  1ZZ7 A;  5JOW A;  4QKN A;  1UYZ A;  3DXU A;  4CDW B;  1OSG A;  3NW4 A;  4U36 A;  2RMU 2;  4XAA A;  3B9C A;  3L2Y A;  3AP7 A;  5F3C A;  3Q8C A;  4GXL A;  1ZRC A;  1NLS A;  5LA2 A;  1JHN A;  1NA1 A;  1LEM A;  4M0H A;  2D44 A;  5A1F A;  1F5F A;  3WNM A;  3BOW A;  1URX A;  2ZJC A;  4K8R B;  4WVM B;  3C7E A;  4IUG A;  2XH6 A;  2ID4 A;  2Y60 A;  5A3W A;  4HFS A;  4NAO A;  1W0P A;  3KT7 A;  4BZ4 A;  4HVQ A;  3TN9 3;  2P1B A;  5ACA 1;  3B3Q E;  3SCG A;  3PUA A;  3T09 A;  3IAP A;  4HSL A;  3LOB A;  1AUY A;  5J7M A;  2ZGK A;  1AX0 A;  3NV4 A;  4JGY B;  3MW2 A;  2WQ8 A;  5E16 A;  4LKS A;  2WFF 1;  1XSQ A;  5M0T A;  1JYT A;  1FT9 A;  1UMH A;  2E53 A;  4IEV A;  1S1A A;  4D6Q A;  3N7L A;  2VVF A;  1UY1 A;  1LOG A;  3RWN A;  5JPN B;  5FDB A;  1WCK A;  3VBS A;  5LBC A;  1I9R A;  3M4F A;  3SQO A;  3MHZ A;  4M01 A;  4HT1 T;  4EWA A;  2R04 3;  3O1U A;  4ASM B;  4IV1 A;  1HLC A;  5L7O C;  2RR1 2;  1DZQ A;  1GP5 A;  1SFN A;  4Y20 B;  1EAH 1;  1S0C A;  3FWE A;  4XJA A;  1S0F A;  4FXG B;  2HEY F;  3PIG A;  3O1P A;  1L7L A;  5C9A A;  4V2W A;  1VBD 1;  3VV1 A;  1JTZ X;  4CDQ B;  4EN9 B;  1ALY A;  1NCR A;  3CZU A;  4FT8 A;  3FLT A;  2VNR A;  4C0H A;  3GZA A;  1FOD 1;  2TUN A;  5FAX A;  4YW1 A;  3CLP A;  5C3S A;  3KLS A;  5J3U A;  2O14 A;  4R9A A;  5CAD A;  2BVB A;  1QJU 2;  1NCQ A;  2V5Y A;  1FMD 2;  3ZYP A;  1JS9 A;  1WUV A;  2W47 A;  1RHI 2;  4MX3 A;  1VLN A;  3LE0 A;  3U14 A;  3KGL A;  5A6Y A;  3F95 A;  3M8L A;  4AFM A;  5I93 A;  2J1A A;  3VBF A;  5C70 A;  1J1L A;  1D7P M;  4OUE A;  4CP9 A;  2HWF 2;  2EVX A;  1W9T A;  1IPK A;  2BEO A;  2FDJ A;  2WT0 A;  3JB4 C;  5EYX A;  3RZH A;  2H6B A;  1OKO A;  1QXJ A;  5H9S A;  1PGW 1;  3OJB A;  2HWC 3;  1UQX A;  2VCC A;  2WQ4 A;  3HQR A;  4BE3 A;  2W0X A;  5DG1 A;  1ZBA 2;  1J58 A;  3FZ3 A;  4AAP A;  2XWB B;  2XPJ A;  1NX9 A;  4UBH A;  1WCQ A;  2DUR A;  5LB6 A;  3AYE A;  4XJ8 A;  4IV1 C;  1CIY A;  2E9Q A;  1UY3 A;  2VZT A;  3D0J A;  4Q4X 1;  3D4K A;  1YIF A;  4UW6 A;  1KEX A;  2O8O A;  3WCR A;  3HNM A;  3VN4 A;  1C4R A;  1W8O A;  5DAQ A;  4CPB A;  3S7I A;  4CCO A;  3E6B A;  3T30 A;  5IYY A;  4I2O A;  4CDQ A;  5E89 A;  1UOF A;  3QCW A;  4HN0 A;  4NHM A;  1HKD A;  3OBR A;  3OUJ A;  4BQX A;  5C8C B;  3V0B B;  4KL1 A;  2PEL A;  1H8T B;  1YYN A;  1GKB A;  1H9P A;  5KHJ A;  2JJ6 A;  4XZU G;  3B5L B;  2B4K A;  1HX6 A;  5DXD A;  4XMA A;  2BNM A;  3ES1 A;  3WR0 A;  5FMC A;  5BNP A;  4C8D A;  5FP3 A;  1C3H A;  3BVC A;  4E4H A;  1I6X A;  1QH7 A;  5FO9 B;  4P5H A;  2GSY A;  1IPJ A;  2WA4 A;  3LB9 A;  2W1S A;  1ODM A;  4L0P A;  2XML A;  5JXI A;  1V9U 2;  1C57 A;  4GA9 A;  4AEK A;  3FFQ A;  3I2K A;  1GQG A;  4PLN A;  5FQ0 B;  3TWI A;  3ROU A;  4MXW B;  1QH6 A;  3SCH A;  4XHX A;  1QJU 1;  2OUJ A;  3QBQ A;  3WQ0 A;  3ENR A;  4RL7 A;  4YM2 A;  3MF9 A;  1RXF A;  3OPW A;  4ZS2 A;  2JEN A;  3DV8 A;  5I91 A;  2BPA 2;  4Z07 A;  3PUS A;  1LKN A;  2ZGU A;  4M4R A;  5C3R A;  3U37 A;  1GLH A;  1W6P A;  1F35 A;  3K2O A;  3KQR A;  2C4X A;  2R0H A;  3H7Y A;  1Q8V A;  3P5B A;  3ZDS A;  4Y1Z A;  5T5L A;  1RMU 1;  2ET7 A;  4YYO A;  4S2H A;  3AB0 A;  3WW3 A;  4DQA A;  1D4M 3;  4LBO A;  2YC0 A;  2JWP A;  4OLL A;  5FXW A;  1H2M A;  1DF0 A;  4FPY A;  1VBA 1;  1QOS A;  1PNG A;  4IEP A;  3AM2 A;  1DLC A;  5FJH A;  4CDW A;  3B01 A;  1PO2 2;  5EWS A;  5IK4 A;  1WGP A;  2D98 A;  4IET A;  3SKV A;  3S5Q A;  1WLD A;  5FXV A;  1RUD 3;  4KBB A;  4ASL A;  3N9L A;  1W6M B;  1PHM A;  4XOG A;  5FYY A;  4IE7 A;  4QM9 A;  5LCW L;  4C91 A;  1RUI 2;  3ZO0 B;  1AYN 1;  1US2 A;  1TQ5 A;  2AEZ A;  5L9B A;  1S0E A;  3FLR A;  4RHV 2;  2DCZ A;  5FZK A;  4AI0 A;  3LFM A;  3G6J B;  3VD5 A;  5FKB A;  1RUH 2;  5CA6 A;  3OCP A;  3GBG A;  5FYB A;  3LA2 A;  2RM2 2;  1WW7 A;  2IZW A;  2H0B A;  2WUH A;  2JD9 A;  2IXK A;  2QZ2 A;  1V6N A;  3HVD A;  1HXS 2;  2O0O A;  3DEM A;  5FJK A;  4NHY A;  5B4X A;  5FPU A;  5I0S A;  5L7O B;  2LS6 A;  4H7L A;  1CAU A;  1IG0 A;  2VAU A;  4OHW A;  4Q4V 3;  3DYM A;  4Y1Y A;  3B7M A;  2JG8 C;  4AQ2 A;  3MLJ A;  2ZPX A;  2XVG A;  1AJK A;  2VGD A;  1Q8P A;  2P4E A;  2XJP A;  4LMF A;  2UY9 A;  2Q5T A;  4BK5 A;  3HT1 A;  2VNO A;  2AYH A;  4KWL A;  1J59 A;  2XKO A;  1RVF 2;  1R1A 3;  3POG A;  1JZ8 A;  5JXG A;  3WUC A;  1GQP A;  1RUG 3;  2R7E B;  1YIP A;  2KM2 A;  4LOS A;  4OFG A;  4DY3 A;  4MHU A;  1KIT A;  4YVS A;  1TZO A;  1VBD 3;  3RFR A;  5C8C A;  3LZZ A;  3VHO A;  1CX1 A;  1VBA 2;  2VM9 A;  3SEP A;  2ZAB A;  1IG3 A;  3OGS A;  3GZE A;  3JBG 2;  2ZGQ A;  4RGK A;  5FIX A;  4TZD A;  5CKQ A;  2AR6 A;  3TNP B;  5FZ8 A;  3ZXJ A;  4RN5 A;  4YG3 A;  3DPR B;  4RQP C;  2I07 B;  3SNM A;  3N4M A;  2Y0I A;  1W2A X;  3RJ2 X;  3JD7 3;  2AEY A;  5LY1 A;  2GC0 A;  3MW3 A;  4L11 A;  4FFI A;  1RUO A;  2QDR A;  1OVP A;  5EFU A;  4QXB A;  3H9A A;  1DQ1 A;  1YUD A;  1GNY A;  2Y6L A;  3AZX A;  2E51 A;  1XU2 A;  2OZ6 A;  3D82 A;  3SH3 A;  3A22 A;  2WNV C;  2WWJ A;  1IHM A;  3P6B A;  2VZR A;  4A7Z A;  4Z82 A;  5T54 A;  2CTV A;  1ULG A;  2ZMN A;  3NAP B;  3M70 A;  2JKX A;  4Y33 A;  1HXS 1;  2VOX A;  1DIW A;  2YMZ A;  2D6L X;  4XJZ A;  4RHV 1;  4IGP A;  2AEN A;  4FPG A;  2W3J A;  1TMF 1;  5J1X A;  5FP7 A;  4CCL A;  4CSW A;  1CVN A;  4CP0 A;  1FAT A;  1G9B A;  5KC6 A;  3RZL A;  2VO5 A;  4Q8L A;  4UWD A;  4M4P A;  1WCD J;  4WVZ A;  5K8S A;  1GZ9 A;  2A6X A;  2XJV A;  1X9P A;  1NOV A;  2D5F A;  2Y26 A;  3KQ4 B;  1PX3 A;  3DGT A;  2A6Y A;  3ZSE A;  5A7P A;  2B9V A;  5C3O A;  3BTA A;  1VBE 1;  5DN2 A;  1CPM A;  3CMG A;  1U5I A;  3JD7 2;  3M3I A;  3RMX A;  1L7R A;  2ZAC A;  1OI6 A;  3K3N A;  1YJK A;  2XLG A;  4HXC A;  3IN9 A;  5FYT A;  4HN1 A;  1HDK A;  3N9P A;  4XQW A;  3KSC A;  1SLL A;  4H7M A;  4XEZ A;  3CIH A;  1RVF 1;  3JBG 1;  3U07 A;  1R1A 1;  2VME A;  1UZW A;  3IB3 A;  3W21 A;  2BU9 A;  5FLH A;  3KM5 A;  1DZT A;  4ZPI A;  1K42 A;  2BFU S;  2XUM A;  2ARC A;  3JBG 3;  3WY6 A;  1AL2 3;  3PDQ A;  1R08 3;  1LUL A;  3APB A;  4JCK A;  3TB0 A;  4ZU4 A;  4JVA A;  2WFF 2;  4UAP A;  5IVJ A;  1ENR A;  2QQK A;  4J6G A;  3VBS B;  4IER A;  1CQ9 A;  5KHG A;  4CU9 A;  4QPI A;  3WNN A;  1TNR A;  3WLU A;  2XQR A;  2W9X A;  5DDJ 2;  1HB2 A;  3HT2 A;  1COV 3;  4NPM A;  3VBR B;  4BJ0 A;  3PNA A;  4NOT A;  3O0V A;  2E26 A;  4A44 A;  2EAK A;  2ES3 A;  4CCK A;  1QXR A;  3MFA A;  2BGO A;  3AL5 A;  1JZ4 A;  1DGR N;  2WO2 A;  1BBT 3;  4XMI A;  3E1F 1;  5E88 A;  4B3N A;  5IVF A;  3BTY A;  4BQ4 A;  2YY1 A;  3CJX A;  3MPP G;  2B8M A;  2PQQ A;  1V6J A;  1GUI A;  3MEP A;  3W5N A;  4IEW A;  5FMO S;  5GLT A;  4XF9 A;  2P6C A;  2VU9 A;  2FDH A;  3USU A;  4AL9 A;  3O1M A;  1UY0 A;  4FVV A;  3BTX A;  5JZG B;  4CUG A;  3GDB A;  3RYP A;  1FPN 3;  5IK8 A;  2BNN A;  2P6H A;  5T55 A;  3POW A;  4ITC A;  5GKA C;  1EV1 1;  4AAX A;  3E5U A;  1IS6 A;  2H6C A;  1LJ7 A;  2GC1 A;  4YGC A;  1YLL A;  3FMG A;  4XYX A;  3WP5 A;  4ATE A;  4NWV A;  3OUH A;  4YLZ A;  3U4X A;  1WLW A;  2VTX J;  4Y5T A;  5FPA A;  3RI8 A;  1CGP A;  4O61 A;  1YQ6 A;  4F7Z A;  4EWE A;  3ILN A;  4QU2 A;  1AL0 G;  2D6N A;  2YGL A;  3FE5 A;  1JUI A;  1TVG A;  3IIA A;  2CHH A;  3W5M A;  3DPR A;  2BNO A;  2ENR A;  2ZGO A;  2BP6 A;  3JB8 A;  1PGL 2;  4NII A;  1WWY A;  1COV 2;  5JSO A;  3CU7 A;  4JZR A;  1KJR A;  2PHX A;  4HPK A;  3NJZ A;  1IZ3 A;  3WDT A;  3DPR C;  3A21 A;  5A7W A;  2WC2 A;  2VZO A;  3SH4 A;  1RUC 2;  3OPT A;  2X5I A;  3G7D A;  2Y34 A;  1XXN A;  2WIN B;  4XVH A;  3I2H A;  3O1R A;  2OYZ A;  2VQU A;  2XJS A;  4LKD A;  3ZXA C;  4MGK E;  4W6W A;  1SPP B;  2A5Z A;  5HCF A;  1W90 A;  2BTV C;  3K3O A;  2X53 S;  4OZX A;  5CNA A;  2LM3 A;  3I3E A;  2ETE A;  3KV9 A;  4BQ3 A;  4KWK A;  4RR3 B;  2GP5 A;  1FAY A;  3AZW A;  3OGG A;  3VBO A;  1ZZB A;  2FMD A;  4I30 A;  3ZM8 A;  4FSJ A;  4FPC A;  2VZP A;  1MZF A;  4Q1R A;  2RJL A;  4GH4 C;  4TLF A;  4HG6 B;  4P14 A;  1VMF A;  3GJB A;  1POQ A;  3QH6 A;  2HWD 2;  2FDG A;  4WV8 A;  3WF2 A;  4AI1 A;  4LA3 A;  4FBF A;  5GAL A;  2JE7 A;  1SDD B;  1GP4 A;  1RUG 1;  2ZEZ A;  2VOT A;  4HVR A;  2YV8 A;  3H7J A;  4K1Y A;  5FLJ A;  1LOC A;  3HNY M;  3I59 A;  4H3W A;  1YC6 1;  3GBF A;  4GKY A;  1BHG A;  5IVV A;  2GMP A;  1GMM A;  2ZGR A;  4Y3O A;  1RVF 3;  4B8E A;  5A1A A;  4XAC A;  3U78 A;  3WSO A;  5FK8 A;  2IXI A;  4AED C;  3OSD A;  4QKB A;  2HWF 3;  3H3Z A;  4LJH A;  4AE2 A;  1NXM A;  5JOY A;  3KZ4 C;  2PFW A;  1ULD A;  1HRI 2;  1XYO A;  3ECQ A;  3ZDV A;  2DYC A;  2D40 A;  1JH5 A;  1S2B A;  3AFG A;  3JUU A;  2CGN A;  4FO9 A;  2WNV B;  3O0X A;  4Y24 A;  2QCS B;  1MS4 A;  3LQC A;  1LGN A;  2HEW F;  1H8V A;  4LE3 A;  2QQV A;  1DFQ A;  1NY7 1;  2NP0 A;  1ZRD A;  2LW8 A;  3PUI A;  2VCB A;  5ANQ A;  4P9G A;  4CCJ A;  2XJU A;  5JWP A;  3IDE A;  4OHZ A;  2VTF A;  3QD6 A;  1UYX A;  5IVY A;  5EPA A;  2VMF A;  1MZ5 A;  4JRL A;  3USU B;  2ARA A;  1RUF 2;  4BQW A;  1W6P B;  1GOG A;  3ORJ A;  4MO3 M;  1WZX A;  1PK6 A;  1HXS 3;  1Z0H A;  2WT1 A;  2RJK A;  3VD4 A;  5ISL A;  2DVG A;  2V72 A;  1N1Y A;  4NVP A;  3RYK A;  4PT6 A;  1XU1 A;  3C7H A;  5FP4 A;  2BOI A;  4PDW A;  4BHP A;  1LOD A;  1ZBE 1;  1ND3 B;  2GNM A;  5H9R A;  3ZFG A;  3J7L A;  2ZHK A;  4P9L A;  4TYS A;  3BIW E;  2FZ1 A;  2FMY A;  4NRM A;  4P02 B;  4AF9 A;  4BA6 A;  1SQ4 A;  5DQ0 A;  3NAP C;  1XPW A;  2VQT A;  4MSV A;  5APA A;  4XCB A;  4XBQ A;  1Y43 B;  3JCI A;  1UX7 A;  1UOB A;  3DEC A;  1JOB A;  5FWE A;  1OD3 A;  4LO8 A;  2ET1 A;  4IDZ A;  4M3C E;  5D8A A;  4CDX A;  4L92 A;  4LIT A;  2EXK A;  4R52 A;  2WS9 1;  5A1L A;  2J7M A;  3FL7 A;  2EXH A;  2OT7 A;  1YRZ A;  5LBE A;  2JDA A;  5E8A A;  1C1L A;  4JRA A;  1F31 A;  4AI9 A;  4RS5 C;  5A6X A;  3VKN A;  4JDO A;  4XTP A;  4KBZ A;  4QQO A;  5IT6 A;  3EXU A;  4YM3 A;  1CJD A;  3HEI A;  1AYM 2;  3GAL A;  3RRD A;  1K5M B;  4DXS A;  1K5J A;  3THP A;  3TEX A;  1EPZ A;  4HVO A;  4KWU A;  4Y26 A;  2DCT A;  1W0O A;  3OYW A;  3CJI B;  3GZT B;  4HBN A;  4BQY A;  1GWK A;  2WZR 3;  4HKL A;  4N53 A;  4XCA A;  4FP3 A;  4OUS A;  5F3G A;  1R08 2;  3K4D A;  3K4Z A;  1UF2 C;  3Q9O A;  2FBE A;  4G3Y C;  2W87 A;  4NMI A;  1CX4 A;  1DU3 D;  1H4G A;  1W9Y A;  5FZG A;  4CYD A;  4AEM A;  5CIS A;  1MQT C;  2RS1 3;  2XBO 3;  2XLF A;  3AFK A;  5D8A B;  4COV A;  5B4N A;  1QGL A;  4XAB A;  1JZ5 A;  3CKH A;  3LSE A;  5IWF A;  4Q4Y 3;  3ETQ A;  1T6B X;  2Q1F A;  3OF1 A;  4S2G A;  5FR3 A;  4Y22 A;  2IFR A;  2YBS A;  3H3U A;  2WFP A;  3WP6 A;  2W1U A;  3TBD A;  4IEX A;  4AVT A;  4BU2 A;  5DG2 A;  3VKO A;  2GZW A;  2HWE 2;  1O3S A;  1IOA A;  2CGP A;  5F9T A;  1QQP 3;  3EMR A;  2HBU A;  3W9A A;  1MS1 A;  2FCT A;  2I2S A;  3U0Z A;  2YB7 A;  3CF6 E;  4CP2 A;  1C5I A;  2OX0 A;  2E7T A;  2HWC 1;  4WVM A;  1G9F A;  3WOG A;  1ZA7 A;  4YW2 A;  1YFX A;  3T1M A;  5JXH A;  5FZ3 A;  1BQP A;  5IVE A;  3D3A A;  4DZG A;  1ZBE 2;  1ZBE 3;  4PIZ A;  4W6X A;  1JYV A;  2HWC 2;  3BU7 A;  3CJI A;  3RPQ A;  4E2S A;  4D69 A;  1UIJ A;  5AFE A;  3QAC A;  4HAN A;  2HWD 1;  3RSJ A;  4CPB D;  5FUP A;  5AC9 3;  2PAM A;  1K5M A;  4NAM A;  2VXJ A;  4NUB A;  4BOW A;  3RS6 A;  3PUQ A;  3TEZ A;  1NAE A;  3H0O A;  3FBM A;  4LLO A;  3WP4 A;  3ZYJ B;  2QNK A;  5FY7 A;  2VJX A;  3S0M A;  1Y9G A;  5J09 A;  3M3C A;  2FDI A;  3N9Q A;  5EP9 A;  3I2G A;  3N7K A;  4LBQ D;  3IPV B;  2DDU A;  1I3H A;  2X8K A;  3BGA A;  5FZM A;  2IC1 A;  1D2Q A;  1YI9 A;  2D43 A;  5TSW A;  2NZ9 A;  1UAI A;  4AGG A;  4FAG A;  1PMH X;  1ND3 C;  4D8M A;  1KFX L;  1F4H A;  3IWZ A;  1UXZ A;  2TNF A;  2DUQ A;  1H2N A;  4TXW A;  4QGN A;  1NY7 2;  3PIJ A;  3C2U A;  3VHP A;  2HWE 1;  4ONU A;  2ZGM A;  1ZVF A;  1IS3 A;  2ORX A;  1CR7 A;  2WSV A;  3WCS A;  1LCL A;  1XBF A;  4Z8B A;  3ZFF A;  4Q29 A;  2JB4 A;  5DZG A;  3WDY A;  4N43 B;  1IQD C;  1AR8 1;  1LU1 A;  3ABZ A;  5G04 L;  4OQ8 A;  2Z2S B;  3PVO A;  3MZH A;  1QIQ A;  3P1I A;  2ADD A;  3WHT A;  5KHH A;  2UU8 A;  1C28 A;  1OUS A;  2AZ5 A;  3ASI A;  4CDU C;  4A42 A;  4RFR B;  2CWS A;  3KWV A;  1B35 C;  1QQP 1;  3T08 A;  3ZMN A;  3R4U A;  2RHP A;  2DCJ A;  5L9R A;  2DTW A;  5HBA A;  3QOP A;  2B5H A;  5FY8 A;  1WMD A;  1XC6 A;  3E5Q A;  1OQE A;  4HPK B;  2VW2 A;  1PZ8 A;  1AX2 A;  1R09 3;  1UY2 A;  1QJU 3;  4AED B;  1UYY A;  4JKM A;  3OEA A;  1FI2 A;  1ZX5 A;  2TBV A;  3PJY A;  3PLQ A;  4AFC A;  1SBD A;  1VR3 A;  2WII B;  2Y6H A;  3ZYR A;  3BCW A;  1QJE A;  2VOK A;  4K8F A;  1LEN A;  1AYN 3;  1XOY A;  3MIB A;  3JZV A;  4IEU A;  2W1Q A;  5JSP A;  1D0H A;  1BBT 1;  1Y4W A;  3E6D A;  3ZYB A;  1HQL A;  2LAL A;  2ZGT A;  5C4W A;  2DCY A;  5DDJ 3;  1OF4 A;  1REE A;  3SMH A;  2EA7 A;  2DVA A;  3BKZ A;  3MGU A;  4UFH A;  4CA9 A;  3OGJ A;  4U2A A;  3NRU A;  5EXO A;  5LAT A;  2NN8 A;  1FOD 2;  4YSF A;  1QOO A;  3J4U H;  4QB2 A;  3FHQ A;  4RA0 A;  1QJX 1;  1D4M 2;  1GWM A;  1W03 A;  1OUR A;  3EBR A;  3O12 A;  4Q27 A;  3LIH A;  5LBF A;  2F6B A;  4A3Z A;  2WAA A;  1MEC 1;  3PU3 A;  4AW7 A;  3HBK A;  3N9M A;  2NM1 A;  4CEW A;  2ZEX A;  4SLI A;  4J1X A;  1KS5 A;  3E5X A;  5HV0 A;  2BGP A;  5JIA A;  4DNY A;  4LQR A;  4Z92 B;  2XL7 A;  2VD7 A;  3VBR A;  3IAQ A;  1S55 A;  2P3J A;  4ERO A;  2Y6K A;  1LEC A;  5D1I A;  1N3O A;  2YC2 A;  4ASK A;  2YGM A;  5LA1 A;  2O8Q A;  3MW4 A;  5FZ6 A;  2GH8 A;  3F2Z A;  2EIC A;  5DAW A;  3T2Q A;  4COZ A;  1XJA A;  4LNV A;  1SFP A;  4IW3 A;  4COY A;  5IK5 A;  1DBN A;  2D97 A;  1U5X A;  3WT3 A;  1VAL A;  4MUV A;  4Y1U A;  3ZSJ A;  5ACA 2;  5JAX A;  2OXB A;  2QFE A;  3VD9 A;  4QXC A;  4YGB A;  1OLR A;  1RUI 1;  2JDP A;  1GNZ A;  3DCQ A;  1LHW A;  2DTY A;  3ILF A;  2OKX A;  3RI9 A;  1CIW A;  4CZS A;  4G4F A;  4IL7 A;  1SLC A;  2BWA A;  1UWW A;  5DMY A;  3FLP A;  1AYM 1;  1XQN A;  3ELN A;  4PF5 A;  3UL2 A;  1ST8 A;  3I3D A;  5J98 B;  4A41 A;  5JZG A;  1RUJ 1;  2WBK A;  4YW4 A;  1WMF A;  1W9W A;  3WG4 A;  4LO5 B;  5FY4 A;  5I8T A;  1PM7 A;  4CCC A;  2BBV A;  3AKT A;  3U10 A;  5L73 A;  2PHW A;  3HQX A;  2D6O X;  4OUM A;  3USS A;  3ZFE C;  1ZZ6 A;  4FOV A;  4QGL A;  2WNU C;  1UZY A;  2ADE A;  1CAV B;  2BYV E;  4LR4 A;  3VKM A;  1WBF A;  2JDU A;  2OPK A;  3KMH A;  2OS2 A;  5FPB A;  5LBB A;  1QJX 2;  3RZG A;  1N1T A;  1O7F A;  1WCS A;  2OUH A;  3NNM A;  5FPX A;  5J48 A;  1EUU A;  1XYP A;  1NZI A;  4BMB A;  1GYK A;  2R1B A;  3AP9 A;  4D7T A;  5JI7 A;  2HJI A;  3MO4 A;  1H0B A;  2WQZ C;  2HH9 A;  3POE A;  5CZK A;  3VBS C;  5EHD A;  4X8N A;  3T0B A;  5I0U A;  1W28 A;  3VBR C;  4XF4 A;  1D4M 1;  1ULF A;  5F3I A;  4M3C B;  2W08 A;  1BZW A;  4BCU A;  4LBJ A;  2GN7 A;  1BEV 2;  2I45 A;  4IEQ A;  3AMM A;  1AR7 2;  1RUC 3;  2WNE A;  4W6Y A;  3H1W A;  1MS9 A;  1W39 A;  4Z2W A;  1WW6 A;  2B7Y A;  4YZ3 A;  3NJY A;  4UFM A;  2QZ3 A;  1IQA A;  2ARX A;  4H2A A;  3ZN6 A;  1V6K A;  4AZZ A;  4LBK A;  2ZX4 A;  3GF6 A;  5JCT A;  3AMQ A;  2WZR 2;  1H2K A;  3O1S A;  1OKQ A;  1H30 A;  2KD7 A;  1NCQ C;  1TMF 3;  2Q4S A;  5H9P A;  3HQU A;  1JZ3 A;  2MNG A;  4HMZ A;  4EZ4 A;  4PJY A;  3SIT A;  3KHC A;  4XFC A;  1FNY A;  2EID A;  4GWI A;  5BXX A;  2VZS A;  2ZHN A;  2RS1 2;  2XBO 2;  1MS3 A;  1BVP 1;  1UOJ A;  4I02 A;  5EZW A;  3ZOI A;  3ZSM A;  5F2W A;  3MUY 1;  2FHR A;  4PI0 A;  1PVC 2;  1O5L A;  2UYA A;  2JDY A;  5CB7 A;  2VOW A;  3UKT A;  1WME A;  1AHS A;  2W46 A;  1SBF A;  5C33 A;  4AGR A;  4R9C A;  2GAL A;  5FZE A;  3JQX A;  1ND2 C;  3AX4 A;  4Q4X 3;  5KHK A;  3ZX7 A;  1RUI 3;  4UBG A;  1RMU 2;  1JU4 A;  1ZRE A;  2E7Q A;  4D0Q A;  1RGS A;  1EY2 A;  4OMD A;  3O0W A;  5K9Y A;  3ZYF A;  1APN A;  2YU1 A;  1AF9 A;  4YFZ A;  1JZ7 A;  3DKW A;  3ALQ A;  3GJA A;  5K0U A;  4OYU A;  1TE1 B;  1VB4 A;  1XB9 A;  1RUJ 3;  1BBT 2;  1XNK A;  2XL9 A;  3R0R A;  4IV3 B;  1CON A;  4LUK A;  4WVW A;  1D2S A;  4K6B A;  3OB8 A;  4WZC A;  4Q0V A;  2D6P A;  4P9I A;  4XFG A;  4E9K A;  2ZGL A;  3Q8A A;  4IES A;  4QAW A;  4YVS C;  2R49 A;  4LBQ B;  4TN7 A;  3ZFF C;  3HBZ A;  4NJ4 A;  4S2F A;  1OUX A;  2RR1 1;  4EWD A;  1AVB A;  2B45 X;  3S6P A;  2QQJ A;  2ZEY A;  2RM2 1;  3QLQ A;  3ZMO A;  2IXL A;  2JDH A;  4X6R B;  2BQP A;  2ZX3 A;  3UGH A;  1RHI 1;  5ABJ C;  3RZM A;  3J26 N;  4MH0 E;  5C9A C;  4LBM A;  3VDB A;  4ZY9 A;  1BEV 3;  2E6V A;  3ZSL A;  1UKR A;  4TTG A;  2MEV 3;  3THC A;  2ZBJ A;  2X29 A;  3PME A;  2Y64 A;  4CP1 A;  1KGY A;  2OPW A;  3V56 A;  3JQW A;  1SDW A;  5FO8 B;  2XJR A;  4MXV A;  5A33 B;  1CAW B;  5LA9 A;  1PGL 1;  3I2D A;  4XUT A;  4YGE A;  1N3Q A;  4DIQ A;  5LA0 A;  3C7G A;  2VXR A;  4N43 A;  1HRI 3;  3VDC A;  3ZFF B;  3IDA A;  2JDK A;  4YW3 A;  3U1X A;  1LU2 A;  5LK5 A;  2LTN A;  1O6U A;  2ZML A;  1TG7 A;  3UJO A;  1PMJ X;  2DVB A;  3ZFE B;  1GNH A;  4GIQ A;  4YZ5 A;  3BPS A;  4BQ5 A;  3I8T A;  1W2U A;  3NV1 A;  4WM7 A;  5EYY A;  3RNS A;  4DRV A;  4FPH A;  4MXW A;  4R4Z A;  5F37 A;  2ZKN A;  2XLA A;  2W94 A;  1REF A;  1KS4 A;  4PBO A;  5CFD A;  4CCM A;  4FAH A;  1UOG A;  3WEZ A;  1HV1 A;  5F32 A;  1KD7 A;  1S0J A;  2W95 A;  5C6C A;  3A0N A;  2HWD 3;  4N7I A;  2PA7 A;  4ARY A;  5FRE A;  5FP8 A;  1WCU A;  3T0A A;  4FPK A;  1RL3 A;  2V4V A;  2WKK A;  4JQR A;  5C71 A;  4RS5 A;  2BWC A;  5KXD A;  4FPF A;  4IE0 A;  4B29 A;  3Q8F A;  1UNB A;  4CXW A;  4UW4 A;  3WV6 A;  4JGZ A;  1B09 A;  3VZL A;  5KXC A;  1BMV 1;  4CDU B;  1LOE A;  4JAA A;  5FZA A;  2RJ2 A;  1FMD 3;  2GDF A;  3MYX A;  1PM4 A;  2KR2 A;  2ZAH A;  4IEO A;  5IFP A;  5LWB A;  1LOA A;  1YO8 A;  4I0B A;  4X6Q B;  4K1Z A;  4RFT 0;  2WZ8 A;  3RDI A;  4DEV A;  1IS4 A;  1RUE 1;  1R08 1;  4IQP A;  3K48 A;  4L97 A;  5ACA 3;  2R07 3;  3FFZ A;  3K51 A;  1VBA 3;  5FTT C;  2PHT A;  4D3W A;  2RM2 3;  2A6W A;  4BXS V;  1UPS A;  5AVP A;  1COV 1;  1UX6 A;  2GMM A;  4CXY A;  2BGC A;  4FTE A;  4L2N A;  3KGZ A;  2DUP A;  2WZP P;  1XNT A;  5FZI A;  3THD A;  3AZZ A;  2CYF A;  3WXP A;  4UYB A;  3B02 A;  1JUH A;  2VZ1 A;  3SHR A;  4E27 A;  1POV 1;  4OCT A;  4KMQ A;  4QKD A;  4QB6 A;  3AJZ A;  3NJV A;  4LHK A;  3EO6 A;  1NG0 A;  4QQL A;  5LEJ A;  3SXW A;  1X50 A;  3MIC A;  1R64 A;  4WM8 B;  2VVE A;  4Q5O A;  4FOQ A;  1NYW A;  1V6O A;  3CHX A;  1WD3 A;  1QNW A;  1DZR A;  1ZRI A;  3EQE A;  4EQV A;  1GZW A;  2WSU A;  2HWB 3;  1H6X A;  1F4A A;  1FPN 1;  1PZ9 A;  2ZS6 B;  4IGQ A;  3VL8 A;  3W58 A;  1RUN A;  2K9Z A;  4R4X A;  2GU9 A;  3A4U A;  4Q0P A;  4BXF A;  1G6N A;  1HN0 A;  3IT8 A;  4YAR A;  5JVV A;  3TOJ A;  3ZN4 A;  4GMP 1;  5FOB B;  4D6R A;  5FMB A;  4LXL A;  3T0D A;  5FPL A;  2JDZ A;  4YM1 A;  4NE9 A;  4A3X A;  4KI5 M;  4AVA A;  5D2A A;  3DUI A;  1ULO A;  1Q43 A;  4XJ9 A;  4AEJ A;  5KBF A;  4CCD A;  1YFU A;  2ZX2 A;  4QX7 A;  4QMA A;  3VBH C;  4OMC A;  5LK7 B;  1YHF A;  1W8Z A;  1OFS A;  4HOO A;  4MET A;  5DUU A;  3VKF C;  1KDM A;  4I0A A;  4QU1 A;  1HRV 3;  1GR3 A;  2JIC A;  4ZU5 A;  4LBL A;  2PYT A;  1OLM E;  4LE4 A;  3RZZ A;  3WF0 A;  4MGI E;  2ZX1 A;  1G9A A;  2RDN A;  1H1M A;  4GH4 A;  3AYA A;  4MGQ A;  4BM8 A;  4E2Q A;  3OY8 A;  1E57 A;  5T50 A;  3AXD A;  5BPX A;  4LLF A;  1DHK B;  1ZZ8 A;  3KCC A;  5FO7 B;  1WW5 A;  2CAV A;  2JEM A;  1X82 A;  2F4L A;  3HMY A;  4E4D X;  2Q8E A;  5CG8 A;  2PAK A;  2LUW A;  1RC6 A;  4QPG C;  4CDX B;  4YZ2 A;  1SAC A;  2WS9 3;  4GJZ A;  2HWB 2;  4AXO A;  3LSD A;  3ZYH A;  1GZW B;  4JGY C;  4LIV A;  3BTZ A;  5ANN A;  4K3U A;  2PHL A;  3CDZ B;  1GAN A;  1AL2 2;  1NE6 A;  3AP5 A;  2HLE A;  3FJS A;  4WM8 A;  4K21 A;  3ZFG B;  1F5J A;  1Q56 A;  3T4H B;  1VBB 2;  4UOJ A;  2CSG A;  3RWK X;  4Y4R A;  1RIT A;  4K20 A;  1AXZ A;  1ZZC A;  3K46 A;  4EN6 B;  3C3V A;  2H0V A;  3N9N A;  2UUR A;  4PQ9 A;  1VBE 2;  3BN6 A;  4OVE A;  4HET A;  2IXJ A;  3C8X A;  5L9V A;  1H1A A;  3L9J T;  1H8T C;  1RXG A;  2MHF A;  2SLI A;  3A23 A;  3MIF A;  4PIX A;  4AR2 A;  4DPN A;  2YFZ A;  1OOP A;  2KXL A;  1PMI A;  4CDU A;  5CKM A;  5F8P A;  1JMU B;  4NPR A;  4BQ1 A;  1G8W A;  2HWF 1;  2P2K A;  1F9K A;  4NHL A;  1BK1 A;  3WF4 A;  4CEY B;  2BZD A;  2XVK A;  4RS5 B;  2WZE A;  3LCP A;  5FZB A;  2B46 X;  4CU7 A;  4GWM A;  1F2N A;  2A70 A;  3KVA A;  1QJY 3;  4O65 A;  4AVS A;  5CFC A;  5LY2 A;  2EAL A;  2A3Y A;  5CFD B;  4QXK A;  5FZH A;  2J1S A;  1BJQ A;  1HJF A;  1MVQ A;  2J1E A;  4PIY A;  1VE0 A;  2VQA A;  4AG4 A;  2P3K A;  3HOB A;  4F3J A;  4ZU7 A;  2Y33 A;  4RQP A;  1I1E A;  1OQD A;  2G1M A;  3MPB A;  3L2H A;  1EPW A;  3UNP A;  4EN0 A;  3ZFE A;  3IBM A;  5FRA A;  4B4Q A;  4XUR A;  1NUK A;  4FTS A;  1VBC 2;  1VBC 3;  3PMS A;  4XFB A;  5JR7 B;  3VB9 A;  4XFI A;  5KXB A;  3OGV A;  3RYR A;  5F6L B;  4K7J A;  4QQ2 A;  2JEC A;  4KQ7 A;  1EUT A;  1LNS A;  4JGY A;  4LKF A;  4NIH A;  2K46 A;  4FFF A;  4NHK A;  2VUA A;  4E8D A;  2BVV A;  2HWB 1;  3NNG A;  2B39 A;  3SLI A;  5FYV A;  4XUO A;  1S0G A;  3V0A B;  1W8W A;  2V09 A;  3INA A;  4YZ1 A;  3OD0 A;  1DYO A;  4XQ4 A;  1SHW B;  2XB6 C;  1ND2 B;  1WA6 X;  2BDR A;  3QH7 A;  1G9D A;  2JG9 C;  2E33 A;  2P3I A;  2XJT A;  3N35 A;  4ZKT B;  1MEC 3;  4HL0 A;  4P08 A;  5CFD C;  5KXE A;  5J36 A;  3H42 B;  4V1P A;  3HN3 A;  1CAW A;  5HV4 A;  1SPP A;  1US3 A;  5JLV A;  1BXH A;  1NA1 B;  4GZ9 A;  4WM7 C;  1FV3 A;  3UES A;  3ZN5 A;  1JXN A;  1RUC 1;  1TME 2;  3J9S A;  1X33 A;  2CWM A;  4NR1 A;  4DY5 A;  1Z7S 3;  3LD8 A;  1K5M C;  3GBW A;  2Q8D A;  1QF3 A;  2BOJ A;  2QQI A;  2Z4F A;  3KVB A;  3U4S A;  3LDK A;  3AC0 A;  3UGG A;  4KG0 A;  2PHU A;  5F7U A;  2J22 A;  2P5B A;  5H9Q A;  2VBP A;  1IGO A;  3IZO A;  1RUE 3;  4FTB A;  1EV1 3;  4KU7 A;  3VBH B;  5BV6 A;  3VBU A;  3EJK A;  3HPN A;  4RD7 A;  2G9G A;  1EYB A;  2VMI A;  4PLM A;  1A78 A;  1A34 A;  4JGZ C;  2E63 A;  2D3R A;  1FPN 2;  3LIG A;  1JYW A;  5A3M A;  1OD5 A;  2ZXQ A;  5FYU A;  4QX5 A;  2VZ3 A;  4LK7 A;  1LHN A;  3VBU C;  1DLL A;  3GCX A;  1U5Y A;  4QHZ A;  4ZHN A;  3ZIX A;  1GQH A;  1JHJ A;  2VUL A;  2C5D A;  2WS9 2;  2Y8K A;  1AR6 3;  1UW8 A;  5DZE A;  3VDD C;  1AYM 3;  4A7Y A;  4JDM A;  4LTA A;  3UV9 A;  3RQ0 A;  2QE3 A;  4FOW A;  2X10 A;  1W8U A;  3LKJ A;  4XF0 A;  5F5C A;  3VDA A;  3UET A;  5GZG A;  1PGS A;  3J8F 3;  1NQJ A;  2ZEW A;  1EV1 2;  1ASJ 2;  4O7X A;  1RUE 2;  4GKX A;  4PHZ A;  4XDQ A;  3PTR B;  3VBF B;  1SFY A;  2NYY A;  2R06 3;  5JPM B;  1RMU 3;  1F15 A;  4NID A;  2P3Y A;  4G9S B;  5I0T A;  1FYU A;  2W92 A;  3O7O A;  3POJ A;  1QNY A;  1POV 0;  4FOY A;  1LED A;  1OA2 A;  2ZX0 A;  4RQP B;  4NIA A;  1UU4 A;  3WQ7 A;  2JE8 A;  1V70 A;  1W8F A;  2A6V A;  4J25 A;  2HKX A;  1ULC A;  1W6Q A;  4GH4 B;  4LHN A;  4CUB A;  4OI4 A;  2A71 A;  4A2U A;  3BU0 A;  4CVU A;  2VNV A;  5J96 B;  4LO7 A;  3VD7 A;  2UWA A;  5EJZ B;  3ZR6 A;  1AR9 2;  2R04 1;  3N36 A;  3D0S A;  1HJG A;  1JOJ A;  1QKQ A;  2NMN A;  4M3C A;  2IUW A;  3VKL A;  1NCR B;  1S2E A;  3A7Q A;  4Y1X A;  1PIV 1;  4AI2 A;  5AC9 1;  4KU8 A;  3LF7 A;  4FFH A;  1M4W A;  1A8D A;  4PF1 A;  4AGV A;  1SZB A;  3E97 A;  5F3E A;  5IW0 A;  4XF1 A;  4QM8 A;  5CAZ A;  1OOP B;  2BBA A;  1QJX 3;  5A7Q A;  3O14 A;  4YNI A;  1W3V A;  3AXE A;  3ME2 A;  3R05 A;  5CYY A;  3BPZ A;  3NO8 A;  2JKB A;  5IUQ A;  3UJQ A;  3O1V A;  3MIG A;  3PVN A;  1ZBA 3;  1UKG A;  3MV0 1;  4TLG A;  3J7N A;  3ZKY A;  3B9I A;  5L19 A;  3VDD A;  1CAX B;  1ACC A;  2GP3 A;  4MHR A;  3RZK A;  4Y22 B;  1ZBA 1;  1DGL A;  4XXA A;  5FPZ A;  3OPZ A;  2JG9 B;  2EIG A;  3AP6 A;  5GLV A;  3WHU A;  3AZV A;  4PDW B;  1MS5 A;  3ACL A;  3EHK A;  4TSV A;  3LPF A;  3PHM A;  1OVS A;  3FHI B;  2PN5 A;  3SEE A;  2G9F A;  2ARE A;  3GXU A;  1HQN A;  2N7G A;  3MLL A;  3PVB B;  4QPG B;  5FP9 A;  5DAX A;  4CDX C;  1NCQ B;  1W2O A;  2C1F A;  3GZU C;  3NAP A;  1OOP C;  4WM8 C;  4XHB A;  2RDS A;  1ONA A;  1VMJ A;  2YPD A;  1VJ2 A;  1ULP A;  5I0R A;  2IXC A;  2C6S A;  2F17 A;  3M1H A;  4LA2 A;  3W20 A;  4AWD A;  4AFA A;  2ZMK A;  4UT5 A;  1HW5 A;  1FMD 1;  1H1I A;  2WT2 A;  4Q4W 2;  1UY4 A;  2CGO A;  1PO1 3;  3EYP A;  4QPI C;  2R16 A;  2YBK A;  3CL1 A;  4A4A A;  2R32 A;  5EIY B;  2VZQ A;  4MV2 A;  4TWT A;  4JGZ B;  4IND A;  4WBB A;  5ERL A;  3VL9 A;  4Y20 A;  1AXK A;  1RHI 3;  2BRT A;  1AR8 2;  4HSJ A;  1YQ8 A;  2TEP A;  1S2K A;  4FFG A;  1MVE A;  4Q26 A;  1A6C A;  4Q1P A;  4XAE A;  4DXR A;  1ASJ 3;  4N53 C;  1R1A 2;  4CEY C;  1I5Z A;  4D7Y A;  2BV4 A;  2QUO A;  4YVW C;  3WX5 A;  5JZG C;  2YHJ A;  2JDN A;  1V6L A;  1O3T A;  5FBZ A;  5GJ6 A;  3JU9 A;  2Z69 A;  2QQP A;  5A3T A;  3W59 A;  2VH9 A;  3FBY A;  3GCW A;  4GUL A;  3WQ1 A;  4MOA A;  1W2T A;  1BVV A;  2Q1Z B;  1MQT A;  4JKK A;  4CEW B;  4NIG A;  4JKL A;  1TNF A;  2XOM A;  1RB8 G;  1LOB A;  3LOI A;  3R4D B;  4Q4X 2;  1WMX A;  3I54 A;  1LR5 A;  3VLB B;  3ZXG A;  2IFW A;  3CQO A;  3NNJ A;  1MZ6 A;  1AR9 3;  1LHU A;  4NO4 A;  4YW7 A;  5FYZ A;  5L7O A;  3TAY A;  4DB5 A;  1QOT A;  4I3P A;  4PCR A;  5F39 A;  5GLZ A;  1W6N A;  4HK8 A;  4IE6 A;  1G86 A;  2CV6 A;  2V73 A;  4HK9 A;  4XUN A;  3ZFG C;  3GNE A;  5FYS A;  5FZL A;  1P8J A;  3FC0 A;  1N1V A;  4LPL A;  1CJP A;  1QU0 A;  3I3M A;  4DFS A;  1Y9Q A;  1NCR C;  4Q0S A;  1WD4 A;  2WO3 A;  3K77 A;  3M3O A;  5IFT A;  2XVL A;  1AYN 2;  1ENS A;  1PO2 3;  3NV2 A;  5LW9 A;  4DO0 A;  3ACH A;  3V64 A;  1SG3 A;  3WNP A;  4Y4Y A;  2XXZ A;  5DUX A;  4AHW A;  3SH5 A;  3ZR5 A;  4DIN B;  3NWK A;  2HBT A;  1NA1 C;  1PVX A;  1Q3E A;  1GU3 A;  3KF5 A; 
#chains in the Genus database with same CATH homology
 5A70 A;  1OVP A;  1W8F A;  1OUX A;  2WR9 A;  5A6Y A;  2BV4 A;  2JDK A;  1OXC A;  1OUR A;  2JDM A;  2VNV A;  2JDH A;  2JDN A;  5D2A A;  4AOC A;  1UZV A;  4CE8 A;  2JDU A;  5HCH A;  2BOJ A;  4UT5 A;  1W8H A;  1GZT A;  5A6Q A;  2JDP A;  3DCQ A;  2CHH A;  2VUC A;  1OUS A;  2BP6 A;  3ZDV A;  1UQX A;  2XR4 A;  5A6X A;  2WRA A;  2VUD A;  1OVS A;  5A6Z A;  2BOI A;  5A3O A;  2JDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...