1OXOA

Aspartate aminotransferase, h-asp complex, open conformation
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structures and solution studies of oxime adducts of mitochondrial aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Aminotransferase
total genus 150
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1oxoA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1oxoA01
1OHVA 2QLRA 2HZPA 1PMOA 3GJUA 5EIGA 2W7JA 2VGTA 1UU0A 4OYTA 4F5HA 3NU7A 5DX5A 2R5CB 2X3LA 4WYAA 4A0RA 2ZC0A 1GDEA 2C7TA 4E77A 2BYJA 3RCHA 1ARHA 4DBCA 3MAFB 3RI6A 3FQAA 4LW4A 1ASGA 3DXVA 1AAWA 4IX8A 3CQ6A 2D63A 2YRIA 3RUYA 4B9BA 3NU8A 5G4IA 2HORA 1ORDA 3GZDA 1QJ5A 2HUUA 2ZJGA 3WCNA 4A72A 5G2PA 3NUIA 4GDYA 4JF0A 4J5UA 1PFFA 1QITA 2VMSA 1ASAA 4XAUA 2OGAA 1G7WA 2D7ZA 3G0TA 5IWQA 2W8UA 1JS6A 3E9KA 5J8QA 1IBJA 4B98A 1SZKA 2VLHA 3HQTA 4ZSWA 1IX8A 3WY7A 2PO3A 4K2IA 2ORDA 3PGYA 1GCKA 4R5ZA 1B9HA 1KKJA 3WLXA 2VGVA 4OCAA 3MC6A 1GBNA 2VGSA 1ELUA 3N5MA 3BCBA 4MSOA 3RQ1A 1J32A 1TPLA 2Z1YA 1DGEA 3ASAA 5M46A 4N0WA 1JF9A 3FRKA 3COGA 2CINA 3NDNA 1DTYA 2W7EA 5TF5A 3W1JA 2JISA 2E7IA 4A6UA 4WP0A 1SVVA 4KXKA 5EQCA 5LHAA 4AO9A 3JWBA 3FFHA 5G09A 1ASMA 3GZDC 2CTZA 4WBTA 3GETA 3TQXA 1IX7A 4RKCA 4IY7A 3FZ8A 3JZLA 4Y0IA 3VOMA 1CL2A 2R5EA 4WB0B 4ZWMA 4ADBA 1ASEA 3L44A 2X5FA 1UKJA 2QB3A 3ATHA 2G6WA 1O4SA 1LW5A 1S08A 3BB8A 4U1TA 1G4VA 3JTXA 1ARIA 1CJ0A 2R5CA 5HHYA 4AZJA 5M4DA 4GSAA 3MBBA 4CXRA 2W8JA 4F5FA 1GEWA 4I8AA 4BQ0A 1YIYA 1BJNA 1JG8A 1O62A 4RIZA 4W8IA 1B8GA 3WKSA 4AH3A 2VMVA 2ZY5A 1D7VA 2QMAA 3RBLA 1VP4A 4OBVA 3CBFA 4MGRA 1D2FA 4XJLA 3G8MA 3F6TA 5EUNA 1S0AA 4Q76A 4M2MA 4M2KA 3AOVA 4UOYA 4PFNA 1KL1A 4U2HA 1RVYA 2EZ2A 5EIGB 3E77A 1V2EA 4Q6RA 3FVUA 4ADCA 3DR7A 3NYSA 2Q7WA 2ZP7A 3HVYA 4WYEA 5HDMA 1V72A 4JF1A 1Y4IA 4F5JA 5BJ3A 2BIEA 2HP1A 1ARSA 1SZSA 3LV2A 4WYFA 2VLFA 1SPAA 1X29A 2W8VA 2PB2A 4Q75A 1CL1A 2BWNA 1BT4A 1LW4A 3I4JA 4KAMA 2BI2A 2YCPA 2D7YA 2TPLA 3DRDA 3EZ1A 1Z7DA 2QBTA 1BJOA 1KMJA 1M0NA 1WSTA 3E6GA 5G2QA 2W7FA 1IAYA 1I41A 1V2DA 1GC0A 4Y0DA 5EUDA 3EZSA 3JU7A 1M0PA 3VAXA 3VK3A 3DR4A 2Z9WA 1W3UA 3KE3A 4OC9A 1AHGA 2AEUA 5M49A 2W7KA 3NRAA 3HMUA 4WB0A 5EAVA 3EI5A 3F9TA 1LC7A 4A00A 4EB7A 3EUCA 5FT6A 5K8BA 4IXOA 4M2JA 2OQXA 2VYCA 2XBNA 3A2BA 3DXWA 3N0LA 4EMYA 4IW7A 3L8AA 4LNLA 3ASBA 2BHXA 3LY1A 3NNKA 1IX6A 4HVKA 1XEYA 4H51A 4MQPA 3HBXA 2JGTA 4P3MA 2AY6A 2DGLA 4F5IA 1J04A 3LVLB 4WYDA 1TATA 2D64A 3WGCA 1PG8A 2YCTA 3TATA 3NUBA 4LC3A 2W7HA 3E2ZB 3FZ6A 2FYFA 2YKYA 4GRXA 1RVUA 3ELPA 5D95A 3RBFA 4WYCA 3B46A 1ASLA 1JS3A 2YRRA 3FQ8A 1VEFA 3BC8A 2VGUA 1M32A 2W7GA 1AX4A 1ZC9A 1YJYA 3F0HA 3BWNC 4PIWA 2FQ6A 4ZLVA 4JEWA 1MLZA 4IXSA 4MKKA 4ZM4A 2OKKA 4ZDLA 3GZCA 1AAMA 4BMKA 4F5KA 1AICA 3A9XA 1TARA 2DKBA 2V1PA 1ZODA 3FFRA 1S07A 3M5UA 3WCOA 2RFVA 1P3WA 1TOIA 3B1CA 3I5TA 3OKSA 3PDBB 1LKCA 4ITXA 3LVKA 4OTLA 1SF2A 1KKPA 1B4XA 2FNUA 2JJEA 2Z1ZA 3LVJA 3WGBA 2GMUA 2WKAA 2Z9VA 4ADDA 7AATA 3AEMC 1AKAA 2EZ1A 1GC3A 1YJSA 4Q31A 2GSAA 3B8XA 3ISLA 4WYGA 2AY5A 2OKJA 3KGXA 1AHXA 1AMQA 1GD9A 4HF8A 3T32A 4XK1A 3W1HA 2CSTA 1YIZA 2CJGA 1B5PA 2PB0A 4AO4A 2D65A 3FKDA 3VK2A 1BJOB 3ZZJA 3DODA 1C4KA 4N0BA 5G0AA 5FT5A 3UWCA 4AZKA 4K2BA 3IHJA 4EU1A 2WK8A 1M6SA 3E2ZA 3GSBA 2EH6A 1ECXA 2YHKA 4A0HA 3AEJA 2CB1A 3ZRRA 1BKGA 4IYOA 1CZEA 1YOOA 2Z9XA 3ELEA 3MKJA 4DQ6A 1C9CA 1MDZA 4P7YA 4XJOA 5E3KA 3FVXA 1LC5A 1AJSB 1ARTA 2R0TA 2YCNA 4Y0HA 3A9ZA 2FNIA 1C0NA 4OT8A 5E5IA 5M4BA 1W7LA 1WKHA 1BJWA 4R5FA 3ZRPA 5BJ4A 3MC6C 3CAIA 3NYTA 3QN6A 5FT4A 3PAAA 4XEWA 3QI6A 3R9AA 1IUGA 1QIRA 2EGYA 1E5FA 2R2NA 2VMZA 1TOGA 1X28A 3PDBA 4ZASA 2CH2A 3BWOA 4NOGA 2D5YA 1AMSA 5DB5A 2BIAA 1IAXA 3QPGA 1XI9A 5C6UA 1AY4A 2BIGA 4MY5A 2VMTA 4OBUA 3ZRQA 4ATPA 4OMAA 1KMKA 2W8WA 1AY8A 1IVRA 2HUFA 3WZFA 3HT4A 5I92A 1YNUA 8AATA 4LNMA 3BN1A 1WYTB 1YJZA 4ZAHA 3FSLA 4A6TA 4JEYA 1GC4A 3EI6A 3B1EA 3PA9A 2VMOA 3B1DA 2VI9A 4WXBA 3JWAA 2EO5A 4RM1A 2HP2A 5AX8A 1AKBA 2W8TA 2DGMA 4RLGA 2W7MA 3IF2A 5F8VA 1DJEA 1C7GA 2WK7A 2AY2A 2YKXA 2BKWA 1H1CA 1O61A 2AY4A 1LS3A 3AOWA 3LG0A 3R4TA 4F5GA 5E4ZA 4CVQA 1D7RA 1WYUA 3HL2A 1AJSA 3MADA 2CFBA 1C7OA 2Z61A 3PPLA 4JEZA 4W5KA 3A9YA 1C7NA 1ASNA 1AMRA 3DU4A 3QBOA 1O69A 1G7XA 4W1VA 3PD6A 4XJMA 4AOAA 2JJFA 4BHDA 1ZOBA 2BI5A 1H0CA 1OXPA 3K7YA 1YAAA 3GWPA 2D66A 2Z67A 3K28A 3ZZKA 3QM2A 1WKGA 2VMNA 3MAUA 4CBRA 2BI1A 2QA3A 1N31A 4W1XA 1AY5A 2GQNA 2ZSMA 4ATQA 4PFFA 1S06A 1SFFA 4R8DA 4IYOB 2YKVA 2W7LA 3W1IA 2O7CA 4CXQA 3CQ4A 1M4NA 1G4XA 1DKAA 1M7YA 1AMAA 1MDXA 1SZUA 1I43A 2ZUKA 2ZYJA 3AATA 3KGWA 2VMWA 3VK4A 4F4EA 3GBXA 3QHXA 3ECDA 1M0OA 4EFFA 4ADEA 1DJUA 4ZWVA 5JAYA 4QGRA 1GEYA 2FN6A 1B5OA 1AKCA 2HOYA 4WXGA 3BS8A 1WYTA 4FL0A 2VMXA 1TASA 2CY8A 4TMRA 4E3QA 1EJIA 2E7UA 3MEBA 1AIAA 1BW0A 2GB3A 1AHFA 3FDBA 4GE7A 1N8PA 3QGUA 4O6ZA 4RJ0A 4XJPA 3UE8A 4A0GA 2ZSLA 3A8UX 5FT8A 4ZDPA 1N2TA 4JEXA 3USFA 1QISA 1FG7A 4KYOA 4JE5D 4RJYA 2ZY3A 3NX3A 1M0QA 3AEOA 4WLJA 2BWOA 3EIAA 4A0FA 1OXOA 4E3RA 1MGVA 2CH1A 1ELQA 1MDOA 1UU2A 2OGEA 3PJ0A 2VMUA 4MQQA 4FFCA 2GMSA 3VP6A 4GEBA 5EFSA 1BQAA 1W7MA 5D5SA 2FM1A 1GC2A 4WD2A 5EAAA 1DJ9A 1CS1A 1FG3A 1OHWA 3G7QA 3WKRA 4ZSYA 4BA5A 3TFUA 4ZDOA 1CZCA 3BCAA 3K40A 4W91A 1RV3A 3DYDA 4LNJA 3ACZA 2C81A 2C44A 4RITA 5F9SA 3II0A 3BCXA 4WXFA 2YKUA 1S09A 2Z20A 3BV0A 2AEVA 2HOXA 1I48A 2JG2A 3AELA 2XH1A 3E2FA 4UHOA 3FQ7A 1T3IA 1V2FA 1OHYA 4RAEA 3D6KA 1Z3ZA 1AIBA 1WYUB 2C0RA 2VIBA 3EI7A 3FD0A 4ITGA 4CBSA 4J8LA 3EI8A 4LW2A 3PD6B 2AY1A 1CQ7A 4R2NA 1X0MA 1I29A 1X2AA 3WX9A 2WK9A 3FDDA 2VGWA 1TOKA 4GE4A 1DFOA 2BYLA 2AY7A 1W7NA 3Q8NA 2VIAA 5HXXA 2E7JA 2O1BA 1MAQA 1KL2A 3TFTA 1RV4A 1TOJA 3P1TA 1ASFA 1CQ8A 2X8UA 2VMPA 3CQ5A 3NTJA 4F5MA 3JW9A 1WYVB 2Z9UA 2CJDA 2DKJA 1MAPA 3FCRA 2ZY2A 3FZ7A 3AEJC 1QZ9A 1DGDA 4A6RA 2AY3A 3DZZA 2AATA 2F8JA 4ZM3A 3MAFA 2DOUA 2HOZA 4MKJA 2W7IA 1ARGA 3GR9A 2EPJA 3AENB 1GEXA 2BI3A 1ASBA 3AV7A 1IJIA 2VMYA 2CJHA 2VMRA 1BQDA 1QGNA 2BWPA 2VGZA 3FVSA 1E5EA 3KKIA 3TCMA 1ASCA 1U08A 2X5DA 2BI9A 2NMPA 1BJ4A 2CANA 2DGKA 2V0YA 2VMQA 4E1OA 4PVFA 3H7FA 3HLMA 4EB5A 4IXZA 2E54A 3I16A 4UQVA 3LVMA 2JJHA 3E2YA 3RCHB 3H14A 3LWSA 1B9IA 1AHYA 3UAKA 1BS0A 4F5LA 2HUIA 4BA4A 1ASDA 3AEPA 2W7DA 1W23A 1D7UA 1TOEA 3PDXA 2D61A 1AHEA 1VJOA 4TN4A 2O0RA 1PMMA 3NYUA 2OATA 4RKDA 3N75A 5EUEA 2VI8A 3P6KA 3HDOA 2DR1A 4MQRA 1EG5A 4L0OA 3OP7A 5DJ9A 3BWNA 4XQ2A 4UHNA 4UHMA 2ZY4A 1LK9A 5G4JA 1CQ6A 4JEVA 2AY9A 4WLHA 3DC1A 5DJ1A 1D7SA 1WYVA 1FC4A 1OATA 1MLYA 4GE9A 1QJ3A 3PIUA 4W1WA 1UU1A 1LC8A 2JJGA 4TV7A 4DGTA 4ISYA 3EIBA 3FTBA 2QB2A 2YOBA 3EI9A 4K2MA 3AENA 2AY8A 9AATA 3AEMA 5LH9A 1AJRA 1EQBA 4JE5A
chains in the Genus database with same CATH superfamily
1OHVA 2QLRA 2HZPA 1PMOA 3GJUA 5EIGA 2W7JA 2VGTA 1UU0A 4OYTA 4F5HA 3NU7A 5DX5A 2R5CB 2A1VA 2X3LA 4WYAA 4A0RA 2ZC0A 1GDEA 2C7TA 4E77A 2BYJA 3RCHA 1ARHA 4DBCA 3MAFB 3RI6A 3FQAA 4LW4A 1ASGA 3DXVA 1AAWA 4IX8A 3CQ6A 2D63A 2YRIA 3RUYA 4B9BA 3NU8A 5G4IA 2HORA 1ORDA 3GZDA 1QJ5A 2HUUA 2ZJGA 3WCNA 4A72A 5G2PA 3NUIA 4GDYA 4JF0A 3N4XA 4J5UA 1PFFA 1QITA 2VMSA 1ASAA 4XAUA 2OGAA 1G7WA 2D7ZA 3G0TA 5IWQA 2W8UA 1JS6A 2EYQA 3E9KA 5J8QA 1IBJA 4B98A 1SZKA 2VLHA 3HQTA 4ZSWA 1IX8A 3WY7A 2PO3A 4K2IA 2ORDA 3PGYA 1GCKA 4R5ZA 1B9HA 1KKJA 3WLXA 2VGVA 4OCAA 3MC6A 1GBNA 2VGSA 1ELUA 3N5MA 3BCBA 4MSOA 3RQ1A 1J32A 1TPLA 2Z1YA 1DGEA 3ASAA 5M46A 4N0WA 1JF9A 3FRKA 3COGA 2CINA 3NDNA 1DTYA 2W7EA 5TF5A 3W1JA 2JISA 2E7IA 4A6UA 4WP0A 1SVVA 4KXKA 5EQCA 5LHAA 4AO9A 3JWBA 3FFHA 5G09A 1ASMA 3GZDC 2CTZA 4WBTA 3GETA 3TQXA 1IX7A 4RKCA 4IY7A 3FZ8A 3JZLA 4Y0IA 3VOMA 1CL2A 2R5EA 4WB0B 4ZWMA 4ADBA 1ASEA 3L44A 2X5FA 1UKJA 2QB3A 3ATHA 2G6WA 1O4SA 1LW5A 1S08A 3BB8A 4U1TA 1G4VA 3JTXA 1ARIA 1CJ0A 2R5CA 5HHYA 4AZJA 5M4DA 2WB6A 4GSAA 3MBBA 4CXRA 2W8JA 4F5FA 1GEWA 4I8AA 4BQ0A 1YIYA 1BJNA 1JG8A 1O62A 4RIZA 4W8IA 1B8GA 3WKSA 4AH3A 2VMVA 2ZY5A 1D7VA 2QMAA 3RBLA 1VP4A 4OBVA 3CBFA 4MGRA 1D2FA 4XJLA 3G8MA 3F6TA 5EUNA 1S0AA 4Q76A 4M2MA 4M2KA 3AOVA 4UOYA 4PFNA 1KL1A 4U2HA 1RVYA 2EZ2A 5EIGB 3E77A 1V2EA 4Q6RA 3FVUA 4ADCA 4K05A 3DR7A 3NYSA 2Q7WA 2ZP7A 3HVYA 4WYEA 5HDMA 1V72A 4JF1A 1Y4IA 4F5JA 5BJ3A 2BIEA 2HP1A 1ARSA 1SZSA 3LV2A 4WYFA 2VLFA 1SPAA 1X29A 2W8VA 2PB2A 4Q75A 1CL1A 2BWNA 1BT4A 1LW4A 3I4JA 4KAMA 2BI2A 2YCPA 2D7YA 2TPLA 3DRDA 3EZ1A 1Z7DA 2QBTA 1BJOA 1KMJA 1M0NA 1WSTA 3E6GA 5G2QA 2W7FA 1IAYA 1I41A 1V2DA 1GC0A 4Y0DA 5EUDA 3EZSA 3JU7A 1M0PA 3VAXA 3VK3A 3DR4A 2Z9WA 1W3UA 3KE3A 4OC9A 1AHGA 2AEUA 5M49A 2W7KA 3NRAA 3HMUA 4WB0A 5EAVA 3EI5A 3F9TA 1LC7A 4A00A 4EB7A 3EUCA 5FT6A 5K8BA 4IXOA 4M2JA 2OQXA 2VYCA 2XBNA 3A2BA 3DXWA 2QSRA 3N0LA 3H9XA 4EMYA 4IW7A 3L8AA 4LNLA 3ASBA 2BHXA 3LY1A 3NNKA 1IX6A 4HVKA 1XEYA 4H51A 4MQPA 3HBXA 2JGTA 4P3MA 2AY6A 2DGLA 4F5IA 1J04A 3LVLB 4WYDA 1TATA 2D64A 3WGCA 1PG8A 2YCTA 3TATA 3NUBA 4LC3A 2W7HA 3E2ZB 3FZ6A 2FYFA 2YKYA 4GRXA 1RVUA 3ELPA 5D95A 3RBFA 4WYCA 3B46A 1ASLA 1JS3A 2YRRA 3FQ8A 1VEFA 3BC8A 2VGUA 1M32A 2W7GA 1AX4A 1ZC9A 1YJYA 3F0HA 3BWNC 4PIWA 2FQ6A 4ZLVA 4JEWA 1MLZA 4IXSA 4MKKA 4ZM4A 2OKKA 4ZDLA 3GZCA 1AAMA 4BMKA 4F5KA 1AICA 3A9XA 1TARA 2DKBA 2V1PA 1ZODA 3FFRA 1S07A 3M5UA 3WCOA 2RFVA 1P3WA 1TOIA 3B1CA 3I5TA 3OKSA 3PDBB 1LKCA 4ITXA 3LVKA 4OTLA 1SF2A 1KKPA 1B4XA 2FNUA 2JJEA 2Z1ZA 3LVJA 3WGBA 2GMUA 2WKAA 2Z9VA 4ADDA 7AATA 3AEMC 1AKAA 2EZ1A 1GC3A 1YJSA 4Q31A 2GSAA 3B8XA 3ISLA 4WYGA 2AY5A 2OKJA 3KGXA 1AHXA 1AMQA 1GD9A 4HF8A 3T32A 4XK1A 3W1HA 2CSTA 1YIZA 2CJGA 1B5PA 2PB0A 4AO4A 2D65A 3FKDA 3VK2A 3N7NA 1BJOB 3ZZJA 3DODA 1C4KA 4N0BA 5G0AA 5FT5A 3UWCA 4AZKA 4K2BA 3IHJA 4EU1A 2WK8A 1M6SA 3E2ZA 3GSBA 2EH6A 1ECXA 2YHKA 4A0HA 3AEJA 2CB1A 3ZRRA 1BKGA 4IYOA 1CZEA 1YOOA 2Z9XA 3ELEA 3MKJA 4DQ6A 1C9CA 1MDZA 4P7YA 4XJOA 5E3KA 3FVXA 1LC5A 1AJSB 1ARTA 2R0TA 2YCNA 4Y0HA 3A9ZA 2FNIA 1C0NA 4OT8A 5E5IA 5M4BA 1W7LA 1WKHA 1BJWA 4R5FA 3ZRPA 5BJ4A 3MC6C 3CAIA 3NYTA 3QN6A 5FT4A 3PAAA 4XEWA 3QI6A 3R9AA 1IUGA 1QIRA 2EGYA 1E5FA 2R2NA 2VMZA 1TOGA 1X28A 3PDBA 4ZASA 2CH2A 3BWOA 4NOGA 2D5YA 1AMSA 5DB5A 2BIAA 1IAXA 3QPGA 1XI9A 5C6UA 1AY4A 2BIGA 4MY5A 2VMTA 4OBUA 3ZRQA 4ATPA 4OMAA 1KMKA 2W8WA 1AY8A 1IVRA 2HUFA 3WZFA 3HT4A 5I92A 1YNUA 8AATA 4LNMA 3BN1A 1WYTB 1YJZA 4ZAHA 3FSLA 4A6TA 4JEYA 1GC4A 3EI6A 3B1EA 3PA9A 2VMOA 3B1DA 2VI9A 4WXBA 3JWAA 2EO5A 4RM1A 2HP2A 5AX8A 1AKBA 2W8TA 2DGMA 4RLGA 2W7MA 3IF2A 5F8VA 1DJEA 1C7GA 2WK7A 2AY2A 2YKXA 2BKWA 1H1CA 1O61A 2AY4A 1LS3A 3AOWA 3LG0A 3R4TA 4F5GA 5E4ZA 4CVQA 1D7RA 1WYUA 3HL2A 1AJSA 3MADA 2CFBA 1C7OA 2Z61A 3PPLA 4JEZA 4W5KA 3A9YA 1C7NA 1ASNA 1AMRA 3DU4A 3QBOA 1O69A 1G7XA 4W1VA 3PD6A 4XJMA 4AOAA 2JJFA 4BHDA 1ZOBA 2BI5A 1H0CA 1OXPA 3K7YA 2FKIA 1YAAA 3GWPA 2D66A 2Z67A 3K28A 3ZZKA 3QM2A 1WKGA 2VMNA 3MAUA 4CBRA 2BI1A 2QA3A 1N31A 4W1XA 1AY5A 2GQNA 2ZSMA 3N4SA 4ATQA 4PFFA 1S06A 1SFFA 4R8DA 4IYOB 2YKVA 2W7LA 3W1IA 2O7CA 4CXQA 3CQ4A 1M4NA 1G4XA 1DKAA 1M7YA 1AMAA 1MDXA 1SZUA 1I43A 2ZUKA 2ZYJA 3AATA 3KGWA 2VMWA 3VK4A 4F4EA 3GBXA 2KFPA 3QHXA 3ECDA 1M0OA 4EFFA 4ADEA 1DJUA 4ZWVA 5JAYA 4QGRA 1GEYA 2FN6A 1B5OA 1AKCA 2HOYA 4WXGA 3BS8A 1WYTA 4FL0A 2VMXA 1TASA 2CY8A 4TMRA 4E3QA 1EJIA 2E7UA 3MEBA 1AIAA 1BW0A 2GB3A 1AHFA 3FDBA 4GE7A 1N8PA 3QGUA 4O6ZA 4RJ0A 4XJPA 3UE8A 4A0GA 2ZSLA 3A8UX 5FT8A 4ZDPA 1N2TA 4JEXA 3USFA 1QISA 1FG7A 4KYOA 4JE5D 4RJYA 2ZY3A 3NX3A 1M0QA 3AEOA 4WLJA 2BWOA 3EIAA 4A0FA 1OXOA 4E3RA 1MGVA 2CH1A 1ELQA 1MDOA 1UU2A 2OGEA 3PJ0A 2VMUA 4MQQA 4FFCA 2GMSA 3VP6A 4GEBA 5EFSA 1BQAA 1W7MA 5D5SA 2FM1A 1GC2A 4WD2A 5EAAA 1DJ9A 1CS1A 1FG3A 1OHWA 3G7QA 3WKRA 4ZSYA 4BA5A 3TFUA 4ZDOA 1CZCA 3BCAA 3K40A 4W91A 1RV3A 3DYDA 4LNJA 3ACZA 2C81A 2C44A 4RITA 5F9SA 3II0A 3BCXA 4WXFA 2YKUA 1S09A 2Z20A 3BV0A 2AEVA 2HOXA 1I48A 2JG2A 3AELA 2XH1A 3E2FA 4UHOA 3FQ7A 1T3IA 1V2FA 1OHYA 4RAEA 3D6KA 1Z3ZA 1AIBA 1WYUB 2C0RA 2VIBA 3EI7A 3FD0A 4ITGA 4CBSA 4J8LA 3EI8A 4LW2A 3PD6B 2AY1A 1CQ7A 4R2NA 1X0MA 1I29A 1X2AA 3WX9A 2WK9A 3FDDA 2VGWA 1TOKA 4GE4A 1DFOA 2BYLA 2AY7A 1W7NA 3Q8NA 2VIAA 5HXXA 2E7JA 2O1BA 1MAQA 1KL2A 3TFTA 1RV4A 3N4RA 1TOJA 3P1TA 1ASFA 1CQ8A 5KTBA 2X8UA 2VMPA 3CQ5A 3NTJA 4F5MA 3JW9A 1WYVB 2Z9UA 2CJDA 2DKJA 1MAPA 3FCRA 2ZY2A 3FZ7A 3AEJC 1QZ9A 1DGDA 4A6RA 2AY3A 3DZZA 2AATA 2F8JA 4ZM3A 3MAFA 2DOUA 2HOZA 4MKJA 2W7IA 1ARGA 3GR9A 2EPJA 3AENB 1GEXA 2BI3A 1ASBA 3AV7A 1IJIA 2VMYA 2CJHA 2VMRA 1BQDA 1QGNA 2BWPA 2VGZA 3FVSA 1E5EA 3KKIA 3TCMA 1ASCA 1U08A 2X5DA 2BI9A 2NMPA 1BJ4A 2CANA 2DGKA 2V0YA 2VMQA 2G7JA 4E1OA 4PVFA 3H7FA 3HLMA 4EB5A 4IXZA 2E54A 3I16A 4UQVA 3LVMA 2JJHA 3E2YA 3RCHB 3H14A 3LWSA 1B9IA 1AHYA 3UAKA 1BS0A 4F5LA 2HUIA 4BA4A 1ASDA 3AEPA 2W7DA 4H63Q 1W23A 1D7UA 1TOEA 3PDXA 2D61A 1AHEA 1VJOA 4TN4A 2O0RA 1PMMA 3NYUA 2OATA 4RKDA 3N75A 5EUEA 2VI8A 3P6KA 3HDOA 2DR1A 4MQRA 1EG5A 1KAFA 4L0OA 3OP7A 5DJ9A 3BWNA 4XQ2A 4UHNA 4UHMA 2ZY4A 1LK9A 5G4JA 1CQ6A 4JEVA 2AY9A 4WLHA 3DC1A 5DJ1A 1D7SA 1WYVA 1FC4A 1OATA 1MLYA 4GE9A 1QJ3A 3PIUA 4W1WA 1UU1A 1LC8A 2JJGA 4TV7A 4DGTA 4ISYA 3EIBA 3FTBA 2QB2A 2YOBA 3EI9A 4K2MA 3AENA 2AY8A 9AATA 3AEMA 5LH9A 1AJRA 1EQBA 4JE5A
chains in the Genus database with same CATH topology
1OHVA 2QLRA 2HZPA 1PMOA 3GJUA 5EIGA 2W7JA 2VGTA 1UU0A 4OYTA 4F5HA 3NU7A 5DX5A 2R5CB 2A1VA 2X3LA 4WYAA 4A0RA 2ZC0A 1GDEA 2C7TA 4E77A 2BYJA 3RCHA 1ARHA 4DBCA 3MAFB 3RI6A 3FQAA 4LW4A 1ASGA 3DXVA 1AAWA 4IX8A 3CQ6A 2D63A 2YRIA 3RUYA 4B9BA 3NU8A 5G4IA 2HORA 1ORDA 3GZDA 1QJ5A 2HUUA 2ZJGA 3WCNA 4A72A 5G2PA 3NUIA 4GDYA 4JF0A 3N4XA 4J5UA 1PFFA 1QITA 2VMSA 1ASAA 4XAUA 2OGAA 1G7WA 2D7ZA 3G0TA 5IWQA 2W8UA 1JS6A 2EYQA 3E9KA 5J8QA 1IBJA 4B98A 1SZKA 2VLHA 3HQTA 4ZSWA 1IX8A 3WY7A 2PO3A 4K2IA 2ORDA 3PGYA 1GCKA 4R5ZA 1B9HA 1KKJA 3WLXA 2VGVA 4OCAA 3MC6A 1GBNA 2VGSA 1ELUA 3N5MA 3BCBA 4MSOA 3RQ1A 1J32A 1TPLA 2Z1YA 1DGEA 3ASAA 5M46A 4N0WA 1JF9A 3FRKA 3COGA 2CINA 3NDNA 1DTYA 2W7EA 5TF5A 3W1JA 2JISA 2E7IA 4A6UA 4WP0A 1SVVA 4KXKA 5EQCA 5LHAA 4AO9A 3JWBA 3FFHA 5G09A 1ASMA 3GZDC 2CTZA 4WBTA 3GETA 3TQXA 1IX7A 4RKCA 4IY7A 3FZ8A 3JZLA 4Y0IA 3VOMA 1CL2A 2R5EA 4WB0B 4ZWMA 4ADBA 1ASEA 3L44A 2X5FA 1UKJA 2QB3A 3ATHA 2G6WA 1O4SA 1LW5A 1S08A 3BB8A 4U1TA 1G4VA 3JTXA 1ARIA 1CJ0A 2R5CA 5HHYA 4AZJA 5M4DA 2WB6A 4GSAA 3MBBA 4CXRA 2W8JA 4F5FA 1GEWA 4I8AA 4BQ0A 1YIYA 1BJNA 1JG8A 1O62A 4RIZA 4W8IA 1B8GA 3WKSA 4AH3A 2VMVA 2ZY5A 1D7VA 2QMAA 3RBLA 1VP4A 4OBVA 3CBFA 4MGRA 1D2FA 4XJLA 3G8MA 3F6TA 5EUNA 1S0AA 4Q76A 4M2MA 4M2KA 3AOVA 4UOYA 4PFNA 1KL1A 4U2HA 1RVYA 2EZ2A 5EIGB 3E77A 1V2EA 4Q6RA 3FVUA 4ADCA 4K05A 3DR7A 3NYSA 2Q7WA 2ZP7A 3HVYA 4WYEA 5HDMA 1V72A 4JF1A 1Y4IA 4F5JA 5BJ3A 2BIEA 2HP1A 1ARSA 1SZSA 3LV2A 4WYFA 2VLFA 1SPAA 1X29A 2W8VA 2PB2A 4Q75A 1CL1A 2BWNA 1BT4A 1LW4A 3I4JA 4KAMA 2BI2A 2YCPA 2D7YA 2TPLA 3DRDA 3EZ1A 1Z7DA 2QBTA 1BJOA 1KMJA 1M0NA 1WSTA 3E6GA 5G2QA 2W7FA 1IAYA 1I41A 1V2DA 1GC0A 4Y0DA 5EUDA 3EZSA 3JU7A 1M0PA 3VAXA 3VK3A 3DR4A 2Z9WA 1W3UA 3KE3A 4OC9A 1AHGA 2AEUA 5M49A 2W7KA 3NRAA 3HMUA 4WB0A 5EAVA 3EI5A 3F9TA 1LC7A 4A00A 4EB7A 3EUCA 5FT6A 5K8BA 4IXOA 4M2JA 2OQXA 2VYCA 2XBNA 3A2BA 3DXWA 2QSRA 3N0LA 3H9XA 4EMYA 4IW7A 3L8AA 4LNLA 3ASBA 2BHXA 3LY1A 3NNKA 1IX6A 4HVKA 1XEYA 4H51A 4MQPA 3HBXA 2JGTA 4P3MA 2AY6A 2DGLA 4F5IA 1J04A 3LVLB 4WYDA 1TATA 2D64A 3WGCA 1PG8A 2YCTA 3TATA 3NUBA 4LC3A 2W7HA 3E2ZB 3FZ6A 2FYFA 2YKYA 4GRXA 1RVUA 3ELPA 5D95A 3RBFA 4WYCA 3B46A 1ASLA 1JS3A 2YRRA 3FQ8A 1VEFA 3BC8A 2VGUA 1M32A 2W7GA 1AX4A 1ZC9A 1YJYA 3F0HA 3BWNC 4PIWA 2FQ6A 4ZLVA 4JEWA 1MLZA 4IXSA 4MKKA 4ZM4A 2OKKA 4ZDLA 3GZCA 1AAMA 4BMKA 4F5KA 1AICA 3A9XA 1TARA 2DKBA 2V1PA 1ZODA 3FFRA 1S07A 3M5UA 3WCOA 2RFVA 1P3WA 1TOIA 3B1CA 3I5TA 3OKSA 3PDBB 1LKCA 4ITXA 3LVKA 4OTLA 1SF2A 1KKPA 1B4XA 2FNUA 2JJEA 2Z1ZA 3LVJA 3WGBA 2GMUA 2WKAA 2Z9VA 4ADDA 7AATA 3AEMC 1AKAA 2EZ1A 1GC3A 1YJSA 4Q31A 2GSAA 3B8XA 3ISLA 4WYGA 2AY5A 2OKJA 3KGXA 1AHXA 1AMQA 1GD9A 4HF8A 3T32A 4XK1A 3W1HA 2CSTA 1YIZA 2CJGA 1B5PA 2PB0A 4AO4A 2D65A 3FKDA 3VK2A 3N7NA 1BJOB 3ZZJA 3DODA 1C4KA 4N0BA 5G0AA 5FT5A 3UWCA 4AZKA 4K2BA 3IHJA 4EU1A 2WK8A 1M6SA 3E2ZA 3GSBA 2EH6A 1ECXA 2YHKA 4A0HA 3AEJA 2CB1A 3ZRRA 1BKGA 4IYOA 1CZEA 1YOOA 2Z9XA 3ELEA 3MKJA 4DQ6A 1C9CA 1MDZA 4P7YA 4XJOA 5E3KA 3FVXA 1LC5A 1AJSB 1ARTA 2R0TA 2YCNA 4Y0HA 3A9ZA 2FNIA 1C0NA 4OT8A 5E5IA 5M4BA 1W7LA 1WKHA 1BJWA 4R5FA 3ZRPA 5BJ4A 3MC6C 3CAIA 3NYTA 3QN6A 5FT4A 3PAAA 4XEWA 3QI6A 3R9AA 1IUGA 1QIRA 2EGYA 1E5FA 2R2NA 2VMZA 1TOGA 1X28A 3PDBA 4ZASA 2CH2A 3BWOA 4NOGA 2D5YA 1AMSA 5DB5A 2BIAA 1IAXA 3QPGA 1XI9A 5C6UA 1AY4A 2BIGA 4MY5A 2VMTA 4OBUA 3ZRQA 4ATPA 4OMAA 1KMKA 2W8WA 1AY8A 1IVRA 2HUFA 3WZFA 3HT4A 5I92A 1YNUA 8AATA 4LNMA 3BN1A 1WYTB 1YJZA 4ZAHA 3FSLA 4A6TA 4JEYA 1GC4A 3EI6A 3B1EA 3PA9A 2VMOA 3B1DA 2VI9A 4WXBA 3JWAA 2EO5A 4RM1A 2HP2A 5AX8A 1AKBA 2W8TA 2DGMA 4RLGA 2W7MA 3IF2A 5F8VA 1DJEA 1C7GA 2WK7A 2AY2A 2YKXA 2BKWA 1H1CA 1O61A 2AY4A 1LS3A 3AOWA 3LG0A 3R4TA 4F5GA 5E4ZA 4CVQA 1D7RA 1WYUA 3HL2A 1AJSA 3MADA 2CFBA 1C7OA 2Z61A 3PPLA 4JEZA 4W5KA 3A9YA 1C7NA 1ASNA 1AMRA 3DU4A 3QBOA 1O69A 1G7XA 4W1VA 3PD6A 4XJMA 4AOAA 2JJFA 4BHDA 1ZOBA 2BI5A 1H0CA 1OXPA 3K7YA 2FKIA 1YAAA 3GWPA 2D66A 2Z67A 3K28A 3ZZKA 3QM2A 1WKGA 2VMNA 3MAUA 4CBRA 2BI1A 2QA3A 1N31A 4W1XA 1AY5A 2GQNA 2ZSMA 3N4SA 4ATQA 4PFFA 1S06A 1SFFA 4R8DA 4IYOB 2YKVA 2W7LA 3W1IA 2O7CA 4CXQA 3CQ4A 1M4NA 1G4XA 1DKAA 1M7YA 1AMAA 1MDXA 1SZUA 1I43A 2ZUKA 2ZYJA 3AATA 3KGWA 2VMWA 3VK4A 4F4EA 3GBXA 2KFPA 3QHXA 3ECDA 1M0OA 4EFFA 4ADEA 1DJUA 4ZWVA 5JAYA 4QGRA 1GEYA 2FN6A 1B5OA 1AKCA 2HOYA 4WXGA 3BS8A 1WYTA 4FL0A 2VMXA 1TASA 2CY8A 4TMRA 4E3QA 1EJIA 2E7UA 3MEBA 1AIAA 1BW0A 2GB3A 1AHFA 3FDBA 4GE7A 1N8PA 3QGUA 4O6ZA 4RJ0A 4XJPA 3UE8A 4A0GA 2ZSLA 3A8UX 5FT8A 4ZDPA 1N2TA 4JEXA 3USFA 1QISA 1FG7A 4KYOA 4JE5D 4RJYA 2ZY3A 3NX3A 1M0QA 3AEOA 4WLJA 2BWOA 3EIAA 4A0FA 1OXOA 4E3RA 1MGVA 2CH1A 1ELQA 1MDOA 1UU2A 2OGEA 3PJ0A 2VMUA 4MQQA 4FFCA 2GMSA 3VP6A 4GEBA 5EFSA 1BQAA 1W7MA 5D5SA 2FM1A 1GC2A 4WD2A 5EAAA 1DJ9A 1CS1A 1FG3A 1OHWA 3G7QA 3WKRA 4ZSYA 4BA5A 3TFUA 4ZDOA 1CZCA 3BCAA 3K40A 4W91A 1RV3A 3DYDA 4LNJA 3ACZA 2C81A 2C44A 4RITA 5F9SA 3II0A 3BCXA 4WXFA 2YKUA 1S09A 2Z20A 3BV0A 2AEVA 2HOXA 1I48A 2JG2A 3AELA 2XH1A 3E2FA 4UHOA 3FQ7A 1T3IA 1V2FA 1OHYA 4RAEA 3D6KA 1Z3ZA 1AIBA 1WYUB 2C0RA 2VIBA 3EI7A 3FD0A 4ITGA 4CBSA 4J8LA 3EI8A 4LW2A 3PD6B 2AY1A 1CQ7A 4R2NA 1X0MA 1I29A 1X2AA 3WX9A 2WK9A 3FDDA 2VGWA 1TOKA 4GE4A 1DFOA 2BYLA 2AY7A 1W7NA 3Q8NA 2VIAA 5HXXA 2E7JA 2O1BA 1MAQA 1KL2A 3TFTA 1RV4A 3N4RA 1TOJA 3P1TA 1ASFA 1CQ8A 5KTBA 2X8UA 2VMPA 3CQ5A 3NTJA 4F5MA 3JW9A 1WYVB 2Z9UA 2CJDA 2DKJA 1MAPA 3FCRA 2ZY2A 3FZ7A 3AEJC 1QZ9A 1DGDA 4A6RA 2AY3A 3DZZA 2AATA 2F8JA 4ZM3A 3MAFA 2DOUA 2HOZA 4MKJA 2W7IA 1ARGA 3GR9A 2EPJA 3AENB 1GEXA 2BI3A 1ASBA 3AV7A 1IJIA 2VMYA 2CJHA 2VMRA 1BQDA 1QGNA 2BWPA 2VGZA 3FVSA 1E5EA 3KKIA 3TCMA 1ASCA 1U08A 2X5DA 2BI9A 2NMPA 1BJ4A 2CANA 2DGKA 2V0YA 2VMQA 2G7JA 4E1OA 4PVFA 3H7FA 3HLMA 4EB5A 4IXZA 2E54A 3I16A 4UQVA 3LVMA 2JJHA 3E2YA 3RCHB 3H14A 3LWSA 1B9IA 1AHYA 3UAKA 1BS0A 4F5LA 2HUIA 4BA4A 1ASDA 3AEPA 2W7DA 4H63Q 1W23A 1D7UA 1TOEA 3PDXA 2D61A 1AHEA 1VJOA 4TN4A 2O0RA 1PMMA 3NYUA 2OATA 4RKDA 3N75A 5EUEA 2VI8A 3P6KA 3HDOA 2DR1A 4MQRA 1EG5A 4L0OA 3OP7A 5DJ9A 3BWNA 4XQ2A 4UHNA 4UHMA 2ZY4A 1LK9A 5G4JA 1CQ6A 4JEVA 2AY9A 4WLHA 3DC1A 5DJ1A 1D7SA 1WYVA 1FC4A 1OATA 1MLYA 4GE9A 1QJ3A 3PIUA 4W1WA 1UU1A 1LC8A 2JJGA 4TV7A 4DGTA 4ISYA 3EIBA 3FTBA 2QB2A 2YOBA 3EI9A 4K2MA 3AENA 2AY8A 9AATA 3AEMA 5LH9A 1AJRA 1EQBA 4JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHV A;  2QLR A;  2HZP A;  1PMO A;  3GJU A;  5EIG A;  2W7J A;  2VGT A;  1UU0 A;  4OYT A;  4F5H A;  3NU7 A;  5DX5 A;  2R5C B;  2X3L A;  4WYA A;  4A0R A;  2ZC0 A;  1GDE A;  2C7T A;  4E77 A;  2BYJ A;  3RCH A;  1ARH A;  4DBC A;  3MAF B;  3RI6 A;  3FQA A;  4LW4 A;  1ASG A;  3DXV A;  1AAW A;  4IX8 A;  3CQ6 A;  2D63 A;  2YRI A;  3RUY A;  4B9B A;  3NU8 A;  5G4I A;  2HOR A;  1ORD A;  3GZD A;  1QJ5 A;  2HUU A;  2ZJG A;  3WCN A;  4A72 A;  5G2P A;  3NUI A;  4GDY A;  4JF0 A;  4J5U A;  1PFF A;  1QIT A;  2VMS A;  1ASA A;  4XAU A;  2OGA A;  1G7W A;  2D7Z A;  3G0T A;  5IWQ A;  2W8U A;  1JS6 A;  3E9K A;  5J8Q A;  1IBJ A;  4B98 A;  1SZK A;  2VLH A;  3HQT A;  4ZSW A;  1IX8 A;  3WY7 A;  2PO3 A;  4K2I A;  2ORD A;  3PGY A;  1GCK A;  4R5Z A;  1B9H A;  1KKJ A;  3WLX A;  2VGV A;  4OCA A;  3MC6 A;  1GBN A;  2VGS A;  1ELU A;  3N5M A;  3BCB A;  4MSO A;  3RQ1 A;  1J32 A;  1TPL A;  2Z1Y A;  1DGE A;  3ASA A;  5M46 A;  4N0W A;  1JF9 A;  3FRK A;  3COG A;  2CIN A;  3NDN A;  1DTY A;  2W7E A;  5TF5 A;  3W1J A;  2JIS A;  2E7I A;  4A6U A;  4WP0 A;  1SVV A;  4KXK A;  5EQC A;  5LHA A;  4AO9 A;  3JWB A;  3FFH A;  5G09 A;  1ASM A;  3GZD C;  2CTZ A;  4WBT A;  3GET A;  3TQX A;  1IX7 A;  4RKC A;  4IY7 A;  3FZ8 A;  3JZL A;  4Y0I A;  3VOM A;  1CL2 A;  2R5E A;  4WB0 B;  4ZWM A;  4ADB A;  1ASE A;  3L44 A;  2X5F A;  1UKJ A;  2QB3 A;  3ATH A;  2G6W A;  1O4S A;  1LW5 A;  1S08 A;  3BB8 A;  4U1T A;  1G4V A;  3JTX A;  1ARI A;  1CJ0 A;  2R5C A;  5HHY A;  4AZJ A;  5M4D A;  4GSA A;  3MBB A;  4CXR A;  2W8J A;  4F5F A;  1GEW A;  4I8A A;  4BQ0 A;  1YIY A;  1BJN A;  1JG8 A;  1O62 A;  4RIZ A;  4W8I A;  1B8G A;  3WKS A;  4AH3 A;  2VMV A;  2ZY5 A;  1D7V A;  2QMA A;  3RBL A;  1VP4 A;  4OBV A;  3CBF A;  4MGR A;  1D2F A;  4XJL A;  3G8M A;  3F6T A;  5EUN A;  1S0A A;  4Q76 A;  4M2M A;  4M2K A;  3AOV A;  4UOY A;  4PFN A;  1KL1 A;  4U2H A;  1RVY A;  2EZ2 A;  5EIG B;  3E77 A;  1V2E A;  4Q6R A;  3FVU A;  4ADC A;  3DR7 A;  3NYS A;  2Q7W A;  2ZP7 A;  3HVY A;  4WYE A;  5HDM A;  1V72 A;  4JF1 A;  1Y4I A;  4F5J A;  5BJ3 A;  2BIE A;  2HP1 A;  1ARS A;  1SZS A;  3LV2 A;  4WYF A;  2VLF A;  1SPA A;  1X29 A;  2W8V A;  2PB2 A;  4Q75 A;  1CL1 A;  2BWN A;  1BT4 A;  1LW4 A;  3I4J A;  4KAM A;  2BI2 A;  2YCP A;  2D7Y A;  2TPL A;  3DRD A;  3EZ1 A;  1Z7D A;  2QBT A;  1BJO A;  1KMJ A;  1M0N A;  1WST A;  3E6G A;  5G2Q A;  2W7F A;  1IAY A;  1I41 A;  1V2D A;  1GC0 A;  4Y0D A;  5EUD A;  3EZS A;  3JU7 A;  1M0P A;  3VAX A;  3VK3 A;  3DR4 A;  2Z9W A;  1W3U A;  3KE3 A;  4OC9 A;  1AHG A;  2AEU A;  5M49 A;  2W7K A;  3NRA A;  3HMU A;  4WB0 A;  5EAV A;  3EI5 A;  3F9T A;  1LC7 A;  4A00 A;  4EB7 A;  3EUC A;  5FT6 A;  5K8B A;  4IXO A;  4M2J A;  2OQX A;  2VYC A;  2XBN A;  3A2B A;  3DXW A;  3N0L A;  4EMY A;  4IW7 A;  3L8A A;  4LNL A;  3ASB A;  2BHX A;  3LY1 A;  3NNK A;  1IX6 A;  4HVK A;  1XEY A;  4H51 A;  4MQP A;  3HBX A;  2JGT A;  4P3M A;  2AY6 A;  2DGL A;  4F5I A;  1J04 A;  3LVL B;  4WYD A;  1TAT A;  2D64 A;  3WGC A;  1PG8 A;  2YCT A;  3TAT A;  3NUB A;  4LC3 A;  2W7H A;  3E2Z B;  3FZ6 A;  2FYF A;  2YKY A;  4GRX A;  1RVU A;  3ELP A;  5D95 A;  3RBF A;  4WYC A;  3B46 A;  1ASL A;  1JS3 A;  2YRR A;  3FQ8 A;  1VEF A;  3BC8 A;  2VGU A;  1M32 A;  2W7G A;  1AX4 A;  1ZC9 A;  1YJY A;  3F0H A;  3BWN C;  4PIW A;  2FQ6 A;  4ZLV A;  4JEW A;  1MLZ A;  4IXS A;  4MKK A;  4ZM4 A;  2OKK A;  4ZDL A;  3GZC A;  1AAM A;  4BMK A;  4F5K A;  1AIC A;  3A9X A;  1TAR A;  2DKB A;  2V1P A;  1ZOD A;  3FFR A;  1S07 A;  3M5U A;  3WCO A;  2RFV A;  1P3W A;  1TOI A;  3B1C A;  3I5T A;  3OKS A;  3PDB B;  1LKC A;  4ITX A;  3LVK A;  4OTL A;  1SF2 A;  1KKP A;  1B4X A;  2FNU A;  2JJE A;  2Z1Z A;  3LVJ A;  3WGB A;  2GMU A;  2WKA A;  2Z9V A;  4ADD A;  7AAT A;  3AEM C;  1AKA A;  2EZ1 A;  1GC3 A;  1YJS A;  4Q31 A;  2GSA A;  3B8X A;  3ISL A;  4WYG A;  2AY5 A;  2OKJ A;  3KGX A;  1AHX A;  1AMQ A;  1GD9 A;  4HF8 A;  3T32 A;  4XK1 A;  3W1H A;  2CST A;  1YIZ A;  2CJG A;  1B5P A;  2PB0 A;  4AO4 A;  2D65 A;  3FKD A;  3VK2 A;  1BJO B;  3ZZJ A;  3DOD A;  1C4K A;  4N0B A;  5G0A A;  5FT5 A;  3UWC A;  4AZK A;  4K2B A;  3IHJ A;  4EU1 A;  2WK8 A;  1M6S A;  3E2Z A;  3GSB A;  2EH6 A;  1ECX A;  2YHK A;  4A0H A;  3AEJ A;  2CB1 A;  3ZRR A;  1BKG A;  4IYO A;  1CZE A;  1YOO A;  2Z9X A;  3ELE A;  3MKJ A;  4DQ6 A;  1C9C A;  1MDZ A;  4P7Y A;  4XJO A;  5E3K A;  3FVX A;  1LC5 A;  1AJS B;  1ART A;  2R0T A;  2YCN A;  4Y0H A;  3A9Z A;  2FNI A;  1C0N A;  4OT8 A;  5E5I A;  5M4B A;  1W7L A;  1WKH A;  1BJW A;  4R5F A;  3ZRP A;  5BJ4 A;  3MC6 C;  3CAI A;  3NYT A;  3QN6 A;  5FT4 A;  3PAA A;  4XEW A;  3QI6 A;  3R9A A;  1IUG A;  1QIR A;  2EGY A;  1E5F A;  2R2N A;  2VMZ A;  1TOG A;  1X28 A;  3PDB A;  4ZAS A;  2CH2 A;  3BWO A;  4NOG A;  2D5Y A;  1AMS A;  5DB5 A;  2BIA A;  1IAX A;  3QPG A;  1XI9 A;  5C6U A;  1AY4 A;  2BIG A;  4MY5 A;  2VMT A;  4OBU A;  3ZRQ A;  4ATP A;  4OMA A;  1KMK A;  2W8W A;  1AY8 A;  1IVR A;  2HUF A;  3WZF A;  3HT4 A;  5I92 A;  1YNU A;  8AAT A;  4LNM A;  3BN1 A;  1WYT B;  1YJZ A;  4ZAH A;  3FSL A;  4A6T A;  4JEY A;  1GC4 A;  3EI6 A;  3B1E A;  3PA9 A;  2VMO A;  3B1D A;  2VI9 A;  4WXB A;  3JWA A;  2EO5 A;  4RM1 A;  2HP2 A;  5AX8 A;  1AKB A;  2W8T A;  2DGM A;  4RLG A;  2W7M A;  3IF2 A;  5F8V A;  1DJE A;  1C7G A;  2WK7 A;  2AY2 A;  2YKX A;  2BKW A;  1H1C A;  1O61 A;  2AY4 A;  1LS3 A;  3AOW A;  3LG0 A;  3R4T A;  4F5G A;  5E4Z A;  4CVQ A;  1D7R A;  1WYU A;  3HL2 A;  1AJS A;  3MAD A;  2CFB A;  1C7O A;  2Z61 A;  3PPL A;  4JEZ A;  4W5K A;  3A9Y A;  1C7N A;  1ASN A;  1AMR A;  3DU4 A;  3QBO A;  1O69 A;  1G7X A;  4W1V A;  3PD6 A;  4XJM A;  4AOA A;  2JJF A;  4BHD A;  1ZOB A;  2BI5 A;  1H0C A;  1OXP A;  3K7Y A;  1YAA A;  3GWP A;  2D66 A;  2Z67 A;  3K28 A;  3ZZK A;  3QM2 A;  1WKG A;  2VMN A;  3MAU A;  4CBR A;  2BI1 A;  2QA3 A;  1N31 A;  4W1X A;  1AY5 A;  2GQN A;  2ZSM A;  4ATQ A;  4PFF A;  1S06 A;  1SFF A;  4R8D A;  4IYO B;  2YKV A;  2W7L A;  3W1I A;  2O7C A;  4CXQ A;  3CQ4 A;  1M4N A;  1G4X A;  1DKA A;  1M7Y A;  1AMA A;  1MDX A;  1SZU A;  1I43 A;  2ZUK A;  2ZYJ A;  3AAT A;  3KGW A;  2VMW A;  3VK4 A;  4F4E A;  3GBX A;  3QHX A;  3ECD A;  1M0O A;  4EFF A;  4ADE A;  1DJU A;  4ZWV A;  5JAY A;  4QGR A;  1GEY A;  2FN6 A;  1B5O A;  1AKC A;  2HOY A;  4WXG A;  3BS8 A;  1WYT A;  4FL0 A;  2VMX A;  1TAS A;  2CY8 A;  4TMR A;  4E3Q A;  1EJI A;  2E7U A;  3MEB A;  1AIA A;  1BW0 A;  2GB3 A;  1AHF A;  3FDB A;  4GE7 A;  1N8P A;  3QGU A;  4O6Z A;  4RJ0 A;  4XJP A;  3UE8 A;  4A0G A;  2ZSL A;  3A8U X;  5FT8 A;  4ZDP A;  1N2T A;  4JEX A;  3USF A;  1QIS A;  1FG7 A;  4KYO A;  4JE5 D;  4RJY A;  2ZY3 A;  3NX3 A;  1M0Q A;  3AEO A;  4WLJ A;  2BWO A;  3EIA A;  4A0F A;  1OXO A;  4E3R A;  1MGV A;  2CH1 A;  1ELQ A;  1MDO A;  1UU2 A;  2OGE A;  3PJ0 A;  2VMU A;  4MQQ A;  4FFC A;  2GMS A;  3VP6 A;  4GEB A;  5EFS A;  1BQA A;  1W7M A;  5D5S A;  2FM1 A;  1GC2 A;  4WD2 A;  5EAA A;  1DJ9 A;  1CS1 A;  1FG3 A;  1OHW A;  3G7Q A;  3WKR A;  4ZSY A;  4BA5 A;  3TFU A;  4ZDO A;  1CZC A;  3BCA A;  3K40 A;  4W91 A;  1RV3 A;  3DYD A;  4LNJ A;  3ACZ A;  2C81 A;  2C44 A;  4RIT A;  5F9S A;  3II0 A;  3BCX A;  4WXF A;  2YKU A;  1S09 A;  2Z20 A;  3BV0 A;  2AEV A;  2HOX A;  1I48 A;  2JG2 A;  3AEL A;  2XH1 A;  3E2F A;  4UHO A;  3FQ7 A;  1T3I A;  1V2F A;  1OHY A;  4RAE A;  3D6K A;  1Z3Z A;  1AIB A;  1WYU B;  2C0R A;  2VIB A;  3EI7 A;  3FD0 A;  4ITG A;  4CBS A;  4J8L A;  3EI8 A;  4LW2 A;  3PD6 B;  2AY1 A;  1CQ7 A;  4R2N A;  1X0M A;  1I29 A;  1X2A A;  3WX9 A;  2WK9 A;  3FDD A;  2VGW A;  1TOK A;  4GE4 A;  1DFO A;  2BYL A;  2AY7 A;  1W7N A;  3Q8N A;  2VIA A;  5HXX A;  2E7J A;  2O1B A;  1MAQ A;  1KL2 A;  3TFT A;  1RV4 A;  1TOJ A;  3P1T A;  1ASF A;  1CQ8 A;  2X8U A;  2VMP A;  3CQ5 A;  3NTJ A;  4F5M A;  3JW9 A;  1WYV B;  2Z9U A;  2CJD A;  2DKJ A;  1MAP A;  3FCR A;  2ZY2 A;  3FZ7 A;  3AEJ C;  1QZ9 A;  1DGD A;  4A6R A;  2AY3 A;  3DZZ A;  2AAT A;  2F8J A;  4ZM3 A;  3MAF A;  2DOU A;  2HOZ A;  4MKJ A;  2W7I A;  1ARG A;  3GR9 A;  2EPJ A;  3AEN B;  1GEX A;  2BI3 A;  1ASB A;  3AV7 A;  1IJI A;  2VMY A;  2CJH A;  2VMR A;  1BQD A;  1QGN A;  2BWP A;  2VGZ A;  3FVS A;  1E5E A;  3KKI A;  3TCM A;  1ASC A;  1U08 A;  2X5D A;  2BI9 A;  2NMP A;  1BJ4 A;  2CAN A;  2DGK A;  2V0Y A;  2VMQ A;  4E1O A;  4PVF A;  3H7F A;  3HLM A;  4EB5 A;  4IXZ A;  2E54 A;  3I16 A;  4UQV A;  3LVM A;  2JJH A;  3E2Y A;  3RCH B;  3H14 A;  3LWS A;  1B9I A;  1AHY A;  3UAK A;  1BS0 A;  4F5L A;  2HUI A;  4BA4 A;  1ASD A;  3AEP A;  2W7D A;  1W23 A;  1D7U A;  1TOE A;  3PDX A;  2D61 A;  1AHE A;  1VJO A;  4TN4 A;  2O0R A;  1PMM A;  3NYU A;  2OAT A;  4RKD A;  3N75 A;  5EUE A;  2VI8 A;  3P6K A;  3HDO A;  2DR1 A;  4MQR A;  1EG5 A;  4L0O A;  3OP7 A;  5DJ9 A;  3BWN A;  4XQ2 A;  4UHN A;  4UHM A;  2ZY4 A;  1LK9 A;  5G4J A;  1CQ6 A;  4JEV A;  2AY9 A;  4WLH A;  3DC1 A;  5DJ1 A;  1D7S A;  1WYV A;  1FC4 A;  1OAT A;  1MLY A;  4GE9 A;  1QJ3 A;  3PIU A;  4W1W A;  1UU1 A;  1LC8 A;  2JJG A;  4TV7 A;  4DGT A;  4ISY A;  3EIB A;  3FTB A;  2QB2 A;  2YOB A;  3EI9 A;  4K2M A;  3AEN A;  2AY8 A;  9AAT A;  3AEM A;  5LH9 A;  1AJR A;  1EQB A;  4JE5 A; 
#chains in the Genus database with same CATH topology
 1OHV A;  2QLR A;  2HZP A;  1PMO A;  3GJU A;  5EIG A;  2W7J A;  2VGT A;  1UU0 A;  4OYT A;  4F5H A;  3NU7 A;  5DX5 A;  2R5C B;  2A1V A;  2X3L A;  4WYA A;  4A0R A;  2ZC0 A;  1GDE A;  2C7T A;  4E77 A;  2BYJ A;  3RCH A;  1ARH A;  4DBC A;  3MAF B;  3RI6 A;  3FQA A;  4LW4 A;  1ASG A;  3DXV A;  1AAW A;  4IX8 A;  3CQ6 A;  2D63 A;  2YRI A;  3RUY A;  4B9B A;  3NU8 A;  5G4I A;  2HOR A;  1ORD A;  3GZD A;  1QJ5 A;  2HUU A;  2ZJG A;  3WCN A;  4A72 A;  5G2P A;  3NUI A;  4GDY A;  4JF0 A;  3N4X A;  4J5U A;  1PFF A;  1QIT A;  2VMS A;  1ASA A;  4XAU A;  2OGA A;  1G7W A;  2D7Z A;  3G0T A;  5IWQ A;  2W8U A;  1JS6 A;  2EYQ A;  3E9K A;  5J8Q A;  1IBJ A;  4B98 A;  1SZK A;  2VLH A;  3HQT A;  4ZSW A;  1IX8 A;  3WY7 A;  2PO3 A;  4K2I A;  2ORD A;  3PGY A;  1GCK A;  4R5Z A;  1B9H A;  1KKJ A;  3WLX A;  2VGV A;  4OCA A;  3MC6 A;  1GBN A;  2VGS A;  1ELU A;  3N5M A;  3BCB A;  4MSO A;  3RQ1 A;  1J32 A;  1TPL A;  2Z1Y A;  1DGE A;  3ASA A;  5M46 A;  4N0W A;  1JF9 A;  3FRK A;  3COG A;  2CIN A;  3NDN A;  1DTY A;  2W7E A;  5TF5 A;  3W1J A;  2JIS A;  2E7I A;  4A6U A;  4WP0 A;  1SVV A;  4KXK A;  5EQC A;  5LHA A;  4AO9 A;  3JWB A;  3FFH A;  5G09 A;  1ASM A;  3GZD C;  2CTZ A;  4WBT A;  3GET A;  3TQX A;  1IX7 A;  4RKC A;  4IY7 A;  3FZ8 A;  3JZL A;  4Y0I A;  3VOM A;  1CL2 A;  2R5E A;  4WB0 B;  4ZWM A;  4ADB A;  1ASE A;  3L44 A;  2X5F A;  1UKJ A;  2QB3 A;  3ATH A;  2G6W A;  1O4S A;  1LW5 A;  1S08 A;  3BB8 A;  4U1T A;  1G4V A;  3JTX A;  1ARI A;  1CJ0 A;  2R5C A;  5HHY A;  4AZJ A;  5M4D A;  2WB6 A;  4GSA A;  3MBB A;  4CXR A;  2W8J A;  4F5F A;  1GEW A;  4I8A A;  4BQ0 A;  1YIY A;  1BJN A;  1JG8 A;  1O62 A;  4RIZ A;  4W8I A;  1B8G A;  3WKS A;  4AH3 A;  2VMV A;  2ZY5 A;  1D7V A;  2QMA A;  3RBL A;  1VP4 A;  4OBV A;  3CBF A;  4MGR A;  1D2F A;  4XJL A;  3G8M A;  3F6T A;  5EUN A;  1S0A A;  4Q76 A;  4M2M A;  4M2K A;  3AOV A;  4UOY A;  4PFN A;  1KL1 A;  4U2H A;  1RVY A;  2EZ2 A;  5EIG B;  3E77 A;  1V2E A;  4Q6R A;  3FVU A;  4ADC A;  4K05 A;  3DR7 A;  3NYS A;  2Q7W A;  2ZP7 A;  3HVY A;  4WYE A;  5HDM A;  1V72 A;  4JF1 A;  1Y4I A;  4F5J A;  5BJ3 A;  2BIE A;  2HP1 A;  1ARS A;  1SZS A;  3LV2 A;  4WYF A;  2VLF A;  1SPA A;  1X29 A;  2W8V A;  2PB2 A;  4Q75 A;  1CL1 A;  2BWN A;  1BT4 A;  1LW4 A;  3I4J A;  4KAM A;  2BI2 A;  2YCP A;  2D7Y A;  2TPL A;  3DRD A;  3EZ1 A;  1Z7D A;  2QBT A;  1BJO A;  1KMJ A;  1M0N A;  1WST A;  3E6G A;  5G2Q A;  2W7F A;  1IAY A;  1I41 A;  1V2D A;  1GC0 A;  4Y0D A;  5EUD A;  3EZS A;  3JU7 A;  1M0P A;  3VAX A;  3VK3 A;  3DR4 A;  2Z9W A;  1W3U A;  3KE3 A;  4OC9 A;  1AHG A;  2AEU A;  5M49 A;  2W7K A;  3NRA A;  3HMU A;  4WB0 A;  5EAV A;  3EI5 A;  3F9T A;  1LC7 A;  4A00 A;  4EB7 A;  3EUC A;  5FT6 A;  5K8B A;  4IXO A;  4M2J A;  2OQX A;  2VYC A;  2XBN A;  3A2B A;  3DXW A;  2QSR A;  3N0L A;  3H9X A;  4EMY A;  4IW7 A;  3L8A A;  4LNL A;  3ASB A;  2BHX A;  3LY1 A;  3NNK A;  1IX6 A;  4HVK A;  1XEY A;  4H51 A;  4MQP A;  3HBX A;  2JGT A;  4P3M A;  2AY6 A;  2DGL A;  4F5I A;  1J04 A;  3LVL B;  4WYD A;  1TAT A;  2D64 A;  3WGC A;  1PG8 A;  2YCT A;  3TAT A;  3NUB A;  4LC3 A;  2W7H A;  3E2Z B;  3FZ6 A;  2FYF A;  2YKY A;  4GRX A;  1RVU A;  3ELP A;  5D95 A;  3RBF A;  4WYC A;  3B46 A;  1ASL A;  1JS3 A;  2YRR A;  3FQ8 A;  1VEF A;  3BC8 A;  2VGU A;  1M32 A;  2W7G A;  1AX4 A;  1ZC9 A;  1YJY A;  3F0H A;  3BWN C;  4PIW A;  2FQ6 A;  4ZLV A;  4JEW A;  1MLZ A;  4IXS A;  4MKK A;  4ZM4 A;  2OKK A;  4ZDL A;  3GZC A;  1AAM A;  4BMK A;  4F5K A;  1AIC A;  3A9X A;  1TAR A;  2DKB A;  2V1P A;  1ZOD A;  3FFR A;  1S07 A;  3M5U A;  3WCO A;  2RFV A;  1P3W A;  1TOI A;  3B1C A;  3I5T A;  3OKS A;  3PDB B;  1LKC A;  4ITX A;  3LVK A;  4OTL A;  1SF2 A;  1KKP A;  1B4X A;  2FNU A;  2JJE A;  2Z1Z A;  3LVJ A;  3WGB A;  2GMU A;  2WKA A;  2Z9V A;  4ADD A;  7AAT A;  3AEM C;  1AKA A;  2EZ1 A;  1GC3 A;  1YJS A;  4Q31 A;  2GSA A;  3B8X A;  3ISL A;  4WYG A;  2AY5 A;  2OKJ A;  3KGX A;  1AHX A;  1AMQ A;  1GD9 A;  4HF8 A;  3T32 A;  4XK1 A;  3W1H A;  2CST A;  1YIZ A;  2CJG A;  1B5P A;  2PB0 A;  4AO4 A;  2D65 A;  3FKD A;  3VK2 A;  3N7N A;  1BJO B;  3ZZJ A;  3DOD A;  1C4K A;  4N0B A;  5G0A A;  5FT5 A;  3UWC A;  4AZK A;  4K2B A;  3IHJ A;  4EU1 A;  2WK8 A;  1M6S A;  3E2Z A;  3GSB A;  2EH6 A;  1ECX A;  2YHK A;  4A0H A;  3AEJ A;  2CB1 A;  3ZRR A;  1BKG A;  4IYO A;  1CZE A;  1YOO A;  2Z9X A;  3ELE A;  3MKJ A;  4DQ6 A;  1C9C A;  1MDZ A;  4P7Y A;  4XJO A;  5E3K A;  3FVX A;  1LC5 A;  1AJS B;  1ART A;  2R0T A;  2YCN A;  4Y0H A;  3A9Z A;  2FNI A;  1C0N A;  4OT8 A;  5E5I A;  5M4B A;  1W7L A;  1WKH A;  1BJW A;  4R5F A;  3ZRP A;  5BJ4 A;  3MC6 C;  3CAI A;  3NYT A;  3QN6 A;  5FT4 A;  3PAA A;  4XEW A;  3QI6 A;  3R9A A;  1IUG A;  1QIR A;  2EGY A;  1E5F A;  2R2N A;  2VMZ A;  1TOG A;  1X28 A;  3PDB A;  4ZAS A;  2CH2 A;  3BWO A;  4NOG A;  2D5Y A;  1AMS A;  5DB5 A;  2BIA A;  1IAX A;  3QPG A;  1XI9 A;  5C6U A;  1AY4 A;  2BIG A;  4MY5 A;  2VMT A;  4OBU A;  3ZRQ A;  4ATP A;  4OMA A;  1KMK A;  2W8W A;  1AY8 A;  1IVR A;  2HUF A;  3WZF A;  3HT4 A;  5I92 A;  1YNU A;  8AAT A;  4LNM A;  3BN1 A;  1WYT B;  1YJZ A;  4ZAH A;  3FSL A;  4A6T A;  4JEY A;  1GC4 A;  3EI6 A;  3B1E A;  3PA9 A;  2VMO A;  3B1D A;  2VI9 A;  4WXB A;  3JWA A;  2EO5 A;  4RM1 A;  2HP2 A;  5AX8 A;  1AKB A;  2W8T A;  2DGM A;  4RLG A;  2W7M A;  3IF2 A;  5F8V A;  1DJE A;  1C7G A;  2WK7 A;  2AY2 A;  2YKX A;  2BKW A;  1H1C A;  1O61 A;  2AY4 A;  1LS3 A;  3AOW A;  3LG0 A;  3R4T A;  4F5G A;  5E4Z A;  4CVQ A;  1D7R A;  1WYU A;  3HL2 A;  1AJS A;  3MAD A;  2CFB A;  1C7O A;  2Z61 A;  3PPL A;  4JEZ A;  4W5K A;  3A9Y A;  1C7N A;  1ASN A;  1AMR A;  3DU4 A;  3QBO A;  1O69 A;  1G7X A;  4W1V A;  3PD6 A;  4XJM A;  4AOA A;  2JJF A;  4BHD A;  1ZOB A;  2BI5 A;  1H0C A;  1OXP A;  3K7Y A;  2FKI A;  1YAA A;  3GWP A;  2D66 A;  2Z67 A;  3K28 A;  3ZZK A;  3QM2 A;  1WKG A;  2VMN A;  3MAU A;  4CBR A;  2BI1 A;  2QA3 A;  1N31 A;  4W1X A;  1AY5 A;  2GQN A;  2ZSM A;  3N4S A;  4ATQ A;  4PFF A;  1S06 A;  1SFF A;  4R8D A;  4IYO B;  2YKV A;  2W7L A;  3W1I A;  2O7C A;  4CXQ A;  3CQ4 A;  1M4N A;  1G4X A;  1DKA A;  1M7Y A;  1AMA A;  1MDX A;  1SZU A;  1I43 A;  2ZUK A;  2ZYJ A;  3AAT A;  3KGW A;  2VMW A;  3VK4 A;  4F4E A;  3GBX A;  2KFP A;  3QHX A;  3ECD A;  1M0O A;  4EFF A;  4ADE A;  1DJU A;  4ZWV A;  5JAY A;  4QGR A;  1GEY A;  2FN6 A;  1B5O A;  1AKC A;  2HOY A;  4WXG A;  3BS8 A;  1WYT A;  4FL0 A;  2VMX A;  1TAS A;  2CY8 A;  4TMR A;  4E3Q A;  1EJI A;  2E7U A;  3MEB A;  1AIA A;  1BW0 A;  2GB3 A;  1AHF A;  3FDB A;  4GE7 A;  1N8P A;  3QGU A;  4O6Z A;  4RJ0 A;  4XJP A;  3UE8 A;  4A0G A;  2ZSL A;  3A8U X;  5FT8 A;  4ZDP A;  1N2T A;  4JEX A;  3USF A;  1QIS A;  1FG7 A;  4KYO A;  4JE5 D;  4RJY A;  2ZY3 A;  3NX3 A;  1M0Q A;  3AEO A;  4WLJ A;  2BWO A;  3EIA A;  4A0F A;  1OXO A;  4E3R A;  1MGV A;  2CH1 A;  1ELQ A;  1MDO A;  1UU2 A;  2OGE A;  3PJ0 A;  2VMU A;  4MQQ A;  4FFC A;  2GMS A;  3VP6 A;  4GEB A;  5EFS A;  1BQA A;  1W7M A;  5D5S A;  2FM1 A;  1GC2 A;  4WD2 A;  5EAA A;  1DJ9 A;  1CS1 A;  1FG3 A;  1OHW A;  3G7Q A;  3WKR A;  4ZSY A;  4BA5 A;  3TFU A;  4ZDO A;  1CZC A;  3BCA A;  3K40 A;  4W91 A;  1RV3 A;  3DYD A;  4LNJ A;  3ACZ A;  2C81 A;  2C44 A;  4RIT A;  5F9S A;  3II0 A;  3BCX A;  4WXF A;  2YKU A;  1S09 A;  2Z20 A;  3BV0 A;  2AEV A;  2HOX A;  1I48 A;  2JG2 A;  3AEL A;  2XH1 A;  3E2F A;  4UHO A;  3FQ7 A;  1T3I A;  1V2F A;  1OHY A;  4RAE A;  3D6K A;  1Z3Z A;  1AIB A;  1WYU B;  2C0R A;  2VIB A;  3EI7 A;  3FD0 A;  4ITG A;  4CBS A;  4J8L A;  3EI8 A;  4LW2 A;  3PD6 B;  2AY1 A;  1CQ7 A;  4R2N A;  1X0M A;  1I29 A;  1X2A A;  3WX9 A;  2WK9 A;  3FDD A;  2VGW A;  1TOK A;  4GE4 A;  1DFO A;  2BYL A;  2AY7 A;  1W7N A;  3Q8N A;  2VIA A;  5HXX A;  2E7J A;  2O1B A;  1MAQ A;  1KL2 A;  3TFT A;  1RV4 A;  3N4R A;  1TOJ A;  3P1T A;  1ASF A;  1CQ8 A;  5KTB A;  2X8U A;  2VMP A;  3CQ5 A;  3NTJ A;  4F5M A;  3JW9 A;  1WYV B;  2Z9U A;  2CJD A;  2DKJ A;  1MAP A;  3FCR A;  2ZY2 A;  3FZ7 A;  3AEJ C;  1QZ9 A;  1DGD A;  4A6R A;  2AY3 A;  3DZZ A;  2AAT A;  2F8J A;  4ZM3 A;  3MAF A;  2DOU A;  2HOZ A;  4MKJ A;  2W7I A;  1ARG A;  3GR9 A;  2EPJ A;  3AEN B;  1GEX A;  2BI3 A;  1ASB A;  3AV7 A;  1IJI A;  2VMY A;  2CJH A;  2VMR A;  1BQD A;  1QGN A;  2BWP A;  2VGZ A;  3FVS A;  1E5E A;  3KKI A;  3TCM A;  1ASC A;  1U08 A;  2X5D A;  2BI9 A;  2NMP A;  1BJ4 A;  2CAN A;  2DGK A;  2V0Y A;  2VMQ A;  2G7J A;  4E1O A;  4PVF A;  3H7F A;  3HLM A;  4EB5 A;  4IXZ A;  2E54 A;  3I16 A;  4UQV A;  3LVM A;  2JJH A;  3E2Y A;  3RCH B;  3H14 A;  3LWS A;  1B9I A;  1AHY A;  3UAK A;  1BS0 A;  4F5L A;  2HUI A;  4BA4 A;  1ASD A;  3AEP A;  2W7D A;  4H63 Q;  1W23 A;  1D7U A;  1TOE A;  3PDX A;  2D61 A;  1AHE A;  1VJO A;  4TN4 A;  2O0R A;  1PMM A;  3NYU A;  2OAT A;  4RKD A;  3N75 A;  5EUE A;  2VI8 A;  3P6K A;  3HDO A;  2DR1 A;  4MQR A;  1EG5 A;  1KAF A;  4L0O A;  3OP7 A;  5DJ9 A;  3BWN A;  4XQ2 A;  4UHN A;  4UHM A;  2ZY4 A;  1LK9 A;  5G4J A;  1CQ6 A;  4JEV A;  2AY9 A;  4WLH A;  3DC1 A;  5DJ1 A;  1D7S A;  1WYV A;  1FC4 A;  1OAT A;  1MLY A;  4GE9 A;  1QJ3 A;  3PIU A;  4W1W A;  1UU1 A;  1LC8 A;  2JJG A;  4TV7 A;  4DGT A;  4ISY A;  3EIB A;  3FTB A;  2QB2 A;  2YOB A;  3EI9 A;  4K2M A;  3AEN A;  2AY8 A;  9AAT A;  3AEM A;  5LH9 A;  1AJR A;  1EQB A;  4JE5 A; 
#chains in the Genus database with same CATH homology
 1OHV A;  2QLR A;  2HZP A;  1PMO A;  3GJU A;  5EIG A;  2W7J A;  2VGT A;  1UU0 A;  4OYT A;  4F5H A;  3NU7 A;  5DX5 A;  2R5C B;  2A1V A;  2X3L A;  4WYA A;  4A0R A;  2ZC0 A;  1GDE A;  2C7T A;  4E77 A;  2BYJ A;  3RCH A;  1ARH A;  4DBC A;  3MAF B;  3RI6 A;  3FQA A;  4LW4 A;  1ASG A;  3DXV A;  1AAW A;  4IX8 A;  3CQ6 A;  2D63 A;  2YRI A;  3RUY A;  4B9B A;  3NU8 A;  5G4I A;  2HOR A;  1ORD A;  3GZD A;  1QJ5 A;  2HUU A;  2ZJG A;  3WCN A;  4A72 A;  5G2P A;  3NUI A;  4GDY A;  4JF0 A;  3N4X A;  4J5U A;  1PFF A;  1QIT A;  2VMS A;  1ASA A;  4XAU A;  2OGA A;  1G7W A;  2D7Z A;  3G0T A;  5IWQ A;  2W8U A;  1JS6 A;  2EYQ A;  3E9K A;  5J8Q A;  1IBJ A;  4B98 A;  1SZK A;  2VLH A;  3HQT A;  4ZSW A;  1IX8 A;  3WY7 A;  2PO3 A;  4K2I A;  2ORD A;  3PGY A;  1GCK A;  4R5Z A;  1B9H A;  1KKJ A;  3WLX A;  2VGV A;  4OCA A;  3MC6 A;  1GBN A;  2VGS A;  1ELU A;  3N5M A;  3BCB A;  4MSO A;  3RQ1 A;  1J32 A;  1TPL A;  2Z1Y A;  1DGE A;  3ASA A;  5M46 A;  4N0W A;  1JF9 A;  3FRK A;  3COG A;  2CIN A;  3NDN A;  1DTY A;  2W7E A;  5TF5 A;  3W1J A;  2JIS A;  2E7I A;  4A6U A;  4WP0 A;  1SVV A;  4KXK A;  5EQC A;  5LHA A;  4AO9 A;  3JWB A;  3FFH A;  5G09 A;  1ASM A;  3GZD C;  2CTZ A;  4WBT A;  3GET A;  3TQX A;  1IX7 A;  4RKC A;  4IY7 A;  3FZ8 A;  3JZL A;  4Y0I A;  3VOM A;  1CL2 A;  2R5E A;  4WB0 B;  4ZWM A;  4ADB A;  1ASE A;  3L44 A;  2X5F A;  1UKJ A;  2QB3 A;  3ATH A;  2G6W A;  1O4S A;  1LW5 A;  1S08 A;  3BB8 A;  4U1T A;  1G4V A;  3JTX A;  1ARI A;  1CJ0 A;  2R5C A;  5HHY A;  4AZJ A;  5M4D A;  2WB6 A;  4GSA A;  3MBB A;  4CXR A;  2W8J A;  4F5F A;  1GEW A;  4I8A A;  4BQ0 A;  1YIY A;  1BJN A;  1JG8 A;  1O62 A;  4RIZ A;  4W8I A;  1B8G A;  3WKS A;  4AH3 A;  2VMV A;  2ZY5 A;  1D7V A;  2QMA A;  3RBL A;  1VP4 A;  4OBV A;  3CBF A;  4MGR A;  1D2F A;  4XJL A;  3G8M A;  3F6T A;  5EUN A;  1S0A A;  4Q76 A;  4M2M A;  4M2K A;  3AOV A;  4UOY A;  4PFN A;  1KL1 A;  4U2H A;  1RVY A;  2EZ2 A;  5EIG B;  3E77 A;  1V2E A;  4Q6R A;  3FVU A;  4ADC A;  4K05 A;  3DR7 A;  3NYS A;  2Q7W A;  2ZP7 A;  3HVY A;  4WYE A;  5HDM A;  1V72 A;  4JF1 A;  1Y4I A;  4F5J A;  5BJ3 A;  2BIE A;  2HP1 A;  1ARS A;  1SZS A;  3LV2 A;  4WYF A;  2VLF A;  1SPA A;  1X29 A;  2W8V A;  2PB2 A;  4Q75 A;  1CL1 A;  2BWN A;  1BT4 A;  1LW4 A;  3I4J A;  4KAM A;  2BI2 A;  2YCP A;  2D7Y A;  2TPL A;  3DRD A;  3EZ1 A;  1Z7D A;  2QBT A;  1BJO A;  1KMJ A;  1M0N A;  1WST A;  3E6G A;  5G2Q A;  2W7F A;  1IAY A;  1I41 A;  1V2D A;  1GC0 A;  4Y0D A;  5EUD A;  3EZS A;  3JU7 A;  1M0P A;  3VAX A;  3VK3 A;  3DR4 A;  2Z9W A;  1W3U A;  3KE3 A;  4OC9 A;  1AHG A;  2AEU A;  5M49 A;  2W7K A;  3NRA A;  3HMU A;  4WB0 A;  5EAV A;  3EI5 A;  3F9T A;  1LC7 A;  4A00 A;  4EB7 A;  3EUC A;  5FT6 A;  5K8B A;  4IXO A;  4M2J A;  2OQX A;  2VYC A;  2XBN A;  3A2B A;  3DXW A;  2QSR A;  3N0L A;  3H9X A;  4EMY A;  4IW7 A;  3L8A A;  4LNL A;  3ASB A;  2BHX A;  3LY1 A;  3NNK A;  1IX6 A;  4HVK A;  1XEY A;  4H51 A;  4MQP A;  3HBX A;  2JGT A;  4P3M A;  2AY6 A;  2DGL A;  4F5I A;  1J04 A;  3LVL B;  4WYD A;  1TAT A;  2D64 A;  3WGC A;  1PG8 A;  2YCT A;  3TAT A;  3NUB A;  4LC3 A;  2W7H A;  3E2Z B;  3FZ6 A;  2FYF A;  2YKY A;  4GRX A;  1RVU A;  3ELP A;  5D95 A;  3RBF A;  4WYC A;  3B46 A;  1ASL A;  1JS3 A;  2YRR A;  3FQ8 A;  1VEF A;  3BC8 A;  2VGU A;  1M32 A;  2W7G A;  1AX4 A;  1ZC9 A;  1YJY A;  3F0H A;  3BWN C;  4PIW A;  2FQ6 A;  4ZLV A;  4JEW A;  1MLZ A;  4IXS A;  4MKK A;  4ZM4 A;  2OKK A;  4ZDL A;  3GZC A;  1AAM A;  4BMK A;  4F5K A;  1AIC A;  3A9X A;  1TAR A;  2DKB A;  2V1P A;  1ZOD A;  3FFR A;  1S07 A;  3M5U A;  3WCO A;  2RFV A;  1P3W A;  1TOI A;  3B1C A;  3I5T A;  3OKS A;  3PDB B;  1LKC A;  4ITX A;  3LVK A;  4OTL A;  1SF2 A;  1KKP A;  1B4X A;  2FNU A;  2JJE A;  2Z1Z A;  3LVJ A;  3WGB A;  2GMU A;  2WKA A;  2Z9V A;  4ADD A;  7AAT A;  3AEM C;  1AKA A;  2EZ1 A;  1GC3 A;  1YJS A;  4Q31 A;  2GSA A;  3B8X A;  3ISL A;  4WYG A;  2AY5 A;  2OKJ A;  3KGX A;  1AHX A;  1AMQ A;  1GD9 A;  4HF8 A;  3T32 A;  4XK1 A;  3W1H A;  2CST A;  1YIZ A;  2CJG A;  1B5P A;  2PB0 A;  4AO4 A;  2D65 A;  3FKD A;  3VK2 A;  3N7N A;  1BJO B;  3ZZJ A;  3DOD A;  1C4K A;  4N0B A;  5G0A A;  5FT5 A;  3UWC A;  4AZK A;  4K2B A;  3IHJ A;  4EU1 A;  2WK8 A;  1M6S A;  3E2Z A;  3GSB A;  2EH6 A;  1ECX A;  2YHK A;  4A0H A;  3AEJ A;  2CB1 A;  3ZRR A;  1BKG A;  4IYO A;  1CZE A;  1YOO A;  2Z9X A;  3ELE A;  3MKJ A;  4DQ6 A;  1C9C A;  1MDZ A;  4P7Y A;  4XJO A;  5E3K A;  3FVX A;  1LC5 A;  1AJS B;  1ART A;  2R0T A;  2YCN A;  4Y0H A;  3A9Z A;  2FNI A;  1C0N A;  4OT8 A;  5E5I A;  5M4B A;  1W7L A;  1WKH A;  1BJW A;  4R5F A;  3ZRP A;  5BJ4 A;  3MC6 C;  3CAI A;  3NYT A;  3QN6 A;  5FT4 A;  3PAA A;  4XEW A;  3QI6 A;  3R9A A;  1IUG A;  1QIR A;  2EGY A;  1E5F A;  2R2N A;  2VMZ A;  1TOG A;  1X28 A;  3PDB A;  4ZAS A;  2CH2 A;  3BWO A;  4NOG A;  2D5Y A;  1AMS A;  5DB5 A;  2BIA A;  1IAX A;  3QPG A;  1XI9 A;  5C6U A;  1AY4 A;  2BIG A;  4MY5 A;  2VMT A;  4OBU A;  3ZRQ A;  4ATP A;  4OMA A;  1KMK A;  2W8W A;  1AY8 A;  1IVR A;  2HUF A;  3WZF A;  3HT4 A;  5I92 A;  1YNU A;  8AAT A;  4LNM A;  3BN1 A;  1WYT B;  1YJZ A;  4ZAH A;  3FSL A;  4A6T A;  4JEY A;  1GC4 A;  3EI6 A;  3B1E A;  3PA9 A;  2VMO A;  3B1D A;  2VI9 A;  4WXB A;  3JWA A;  2EO5 A;  4RM1 A;  2HP2 A;  5AX8 A;  1AKB A;  2W8T A;  2DGM A;  4RLG A;  2W7M A;  3IF2 A;  5F8V A;  1DJE A;  1C7G A;  2WK7 A;  2AY2 A;  2YKX A;  2BKW A;  1H1C A;  1O61 A;  2AY4 A;  1LS3 A;  3AOW A;  3LG0 A;  3R4T A;  4F5G A;  5E4Z A;  4CVQ A;  1D7R A;  1WYU A;  3HL2 A;  1AJS A;  3MAD A;  2CFB A;  1C7O A;  2Z61 A;  3PPL A;  4JEZ A;  4W5K A;  3A9Y A;  1C7N A;  1ASN A;  1AMR A;  3DU4 A;  3QBO A;  1O69 A;  1G7X A;  4W1V A;  3PD6 A;  4XJM A;  4AOA A;  2JJF A;  4BHD A;  1ZOB A;  2BI5 A;  1H0C A;  1OXP A;  3K7Y A;  2FKI A;  1YAA A;  3GWP A;  2D66 A;  2Z67 A;  3K28 A;  3ZZK A;  3QM2 A;  1WKG A;  2VMN A;  3MAU A;  4CBR A;  2BI1 A;  2QA3 A;  1N31 A;  4W1X A;  1AY5 A;  2GQN A;  2ZSM A;  3N4S A;  4ATQ A;  4PFF A;  1S06 A;  1SFF A;  4R8D A;  4IYO B;  2YKV A;  2W7L A;  3W1I A;  2O7C A;  4CXQ A;  3CQ4 A;  1M4N A;  1G4X A;  1DKA A;  1M7Y A;  1AMA A;  1MDX A;  1SZU A;  1I43 A;  2ZUK A;  2ZYJ A;  3AAT A;  3KGW A;  2VMW A;  3VK4 A;  4F4E A;  3GBX A;  2KFP A;  3QHX A;  3ECD A;  1M0O A;  4EFF A;  4ADE A;  1DJU A;  4ZWV A;  5JAY A;  4QGR A;  1GEY A;  2FN6 A;  1B5O A;  1AKC A;  2HOY A;  4WXG A;  3BS8 A;  1WYT A;  4FL0 A;  2VMX A;  1TAS A;  2CY8 A;  4TMR A;  4E3Q A;  1EJI A;  2E7U A;  3MEB A;  1AIA A;  1BW0 A;  2GB3 A;  1AHF A;  3FDB A;  4GE7 A;  1N8P A;  3QGU A;  4O6Z A;  4RJ0 A;  4XJP A;  3UE8 A;  4A0G A;  2ZSL A;  3A8U X;  5FT8 A;  4ZDP A;  1N2T A;  4JEX A;  3USF A;  1QIS A;  1FG7 A;  4KYO A;  4JE5 D;  4RJY A;  2ZY3 A;  3NX3 A;  1M0Q A;  3AEO A;  4WLJ A;  2BWO A;  3EIA A;  4A0F A;  1OXO A;  4E3R A;  1MGV A;  2CH1 A;  1ELQ A;  1MDO A;  1UU2 A;  2OGE A;  3PJ0 A;  2VMU A;  4MQQ A;  4FFC A;  2GMS A;  3VP6 A;  4GEB A;  5EFS A;  1BQA A;  1W7M A;  5D5S A;  2FM1 A;  1GC2 A;  4WD2 A;  5EAA A;  1DJ9 A;  1CS1 A;  1FG3 A;  1OHW A;  3G7Q A;  3WKR A;  4ZSY A;  4BA5 A;  3TFU A;  4ZDO A;  1CZC A;  3BCA A;  3K40 A;  4W91 A;  1RV3 A;  3DYD A;  4LNJ A;  3ACZ A;  2C81 A;  2C44 A;  4RIT A;  5F9S A;  3II0 A;  3BCX A;  4WXF A;  2YKU A;  1S09 A;  2Z20 A;  3BV0 A;  2AEV A;  2HOX A;  1I48 A;  2JG2 A;  3AEL A;  2XH1 A;  3E2F A;  4UHO A;  3FQ7 A;  1T3I A;  1V2F A;  1OHY A;  4RAE A;  3D6K A;  1Z3Z A;  1AIB A;  1WYU B;  2C0R A;  2VIB A;  3EI7 A;  3FD0 A;  4ITG A;  4CBS A;  4J8L A;  3EI8 A;  4LW2 A;  3PD6 B;  2AY1 A;  1CQ7 A;  4R2N A;  1X0M A;  1I29 A;  1X2A A;  3WX9 A;  2WK9 A;  3FDD A;  2VGW A;  1TOK A;  4GE4 A;  1DFO A;  2BYL A;  2AY7 A;  1W7N A;  3Q8N A;  2VIA A;  5HXX A;  2E7J A;  2O1B A;  1MAQ A;  1KL2 A;  3TFT A;  1RV4 A;  3N4R A;  1TOJ A;  3P1T A;  1ASF A;  1CQ8 A;  5KTB A;  2X8U A;  2VMP A;  3CQ5 A;  3NTJ A;  4F5M A;  3JW9 A;  1WYV B;  2Z9U A;  2CJD A;  2DKJ A;  1MAP A;  3FCR A;  2ZY2 A;  3FZ7 A;  3AEJ C;  1QZ9 A;  1DGD A;  4A6R A;  2AY3 A;  3DZZ A;  2AAT A;  2F8J A;  4ZM3 A;  3MAF A;  2DOU A;  2HOZ A;  4MKJ A;  2W7I A;  1ARG A;  3GR9 A;  2EPJ A;  3AEN B;  1GEX A;  2BI3 A;  1ASB A;  3AV7 A;  1IJI A;  2VMY A;  2CJH A;  2VMR A;  1BQD A;  1QGN A;  2BWP A;  2VGZ A;  3FVS A;  1E5E A;  3KKI A;  3TCM A;  1ASC A;  1U08 A;  2X5D A;  2BI9 A;  2NMP A;  1BJ4 A;  2CAN A;  2DGK A;  2V0Y A;  2VMQ A;  2G7J A;  4E1O A;  4PVF A;  3H7F A;  3HLM A;  4EB5 A;  4IXZ A;  2E54 A;  3I16 A;  4UQV A;  3LVM A;  2JJH A;  3E2Y A;  3RCH B;  3H14 A;  3LWS A;  1B9I A;  1AHY A;  3UAK A;  1BS0 A;  4F5L A;  2HUI A;  4BA4 A;  1ASD A;  3AEP A;  2W7D A;  4H63 Q;  1W23 A;  1D7U A;  1TOE A;  3PDX A;  2D61 A;  1AHE A;  1VJO A;  4TN4 A;  2O0R A;  1PMM A;  3NYU A;  2OAT A;  4RKD A;  3N75 A;  5EUE A;  2VI8 A;  3P6K A;  3HDO A;  2DR1 A;  4MQR A;  1EG5 A;  4L0O A;  3OP7 A;  5DJ9 A;  3BWN A;  4XQ2 A;  4UHN A;  4UHM A;  2ZY4 A;  1LK9 A;  5G4J A;  1CQ6 A;  4JEV A;  2AY9 A;  4WLH A;  3DC1 A;  5DJ1 A;  1D7S A;  1WYV A;  1FC4 A;  1OAT A;  1MLY A;  4GE9 A;  1QJ3 A;  3PIU A;  4W1W A;  1UU1 A;  1LC8 A;  2JJG A;  4TV7 A;  4DGT A;  4ISY A;  3EIB A;  3FTB A;  2QB2 A;  2YOB A;  3EI9 A;  4K2M A;  3AEN A;  2AY8 A;  9AAT A;  3AEM A;  5LH9 A;  1AJR A;  1EQB A;  4JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...