1OXOA

Aspartate aminotransferase, h-asp complex, open conformation
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
401
structure length
401
Chain Sequence
b'SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structures and solution studies of oxime adducts of mitochondrial aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Aminotransferase
total genus 150
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1oxoA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1oxoA01
4WB0B 1RVYA 1TOJA 4B9BA 1RVUA 1B4XA 1TOKA 2HORA 2ZP7A 1ASMA 2O1BA 3NTJA 1C7NA 3ASBA 1ASLA 1I41A 2BIGA 2BYLA 3NYTA 1QISA 2E54A 2FN6A 2VMRA 1WYUA 4LNLA 4AZJA 4F4EA 2E7IA 1J04A 1M6SA 2W7FA 1MDOA 3OKSA 5EQCA 4AOAA 3Q8NA 2W7LA 1VEFA 2X3LA 4XJLA 3EI8A 2W8UA 1BQAA 1G7XA 2QBTA 3MAUA 4JE5A 7AATA 1GEWA 2X8UA 4W1WA 1C4KA 4ISYA 1G7WA 3AEOA 3FFHA 3VK2A 3TCMA 2R0TA 3ZZKA 3DR7A 5DX5A 2JJFA 1WYVA 3DXWA 3BS8A 2W7JA 2CH1A 1UKJA 3NU8A 1S09A 2C44A 3DRDA 1ARTA 3ELPA 1GC4A 3HVYA 2VGZA 3NUBA 3WY7A 3EI7A 4E3RA 1MLYA 1PMMA 1H0CA 2VGSA 3MC6C 1ORDA 1WKGA 4WYGA 1DJUA 3AENB 4MQRA 4ZASA 2ZY4A 4ZLVA 5LH9A 3E9KA 3IF2A 4W1VA 5HDMA 1W7NA 3MBBA 4JEYA 1ARSA 3AV7A 1OXPA 3D6KA 3HBXA 4O6ZA 2XH1A 2AY9A 2PB0A 4GE4A 4M2KA 2YRIA 4ZM4A 2BI1A 3FZ6A 4QGRA 1QIRA 1GD9A 5K8BA 3R4TA 3I16A 4EB7A 1M7YA 1MDXA 3MADA 2Z1YA 3GSBA 5FT6A 2D7ZA 2V0YA 1Z3ZA 1IX6A 3JW9A 2W7DA 4ADCA 4Q75A 2BI5A 4ADBA 1ZODA 3L44A 4XJPA 8AATA 3CBFA 4J8LA 4U1TA 2CJHA 2AY7A 1ASEA 1CJ0A 3COGA 3PAAA 2QLRA 2D61A 1S07A 2JJHA 3DXVA 1MAQA 4A0RA 1DKAA 4ZDOA 2AEVA 1AKBA 3EZ1A 2AY5A 3AENA 3JWBA 1LC7A 4MGRA 3LVKA 4TMRA 1XEYA 3KE3A 1SZUA 1BJOB 1W7MA 3GR9A 5M46A 4AO9A 4AH3A 3WCNA 4A0HA 3E2ZB 1EG5A 2FNUA 1BW0A 1G4XA 3ZRQA 4XJMA 4WYEA 4EMYA 2OATA 1V2EA 4MKKA 3ELEA 1I48A 1FG3A 1KKPA 5G2QA 1TATA 4OMAA 2OQXA 2DGLA 2VGUA 4E1OA 1AY8A 4JEZA 5FT4A 1I43A 4IYOB 4OCAA 4TV7A 1LW4A 2YKUA 1M32A 3NDNA 2FM1A 3N75A 5EUDA 4ZM3A 4W5KA 1CZEA 2WK7A 3CQ4A 2CB1A 4JF0A 1YNUA 4OBVA 1SPAA 3BCBA 1B9IA 3FTBA 1JG8A 4R5FA 4RKCA 1DGEA 1U08A 1QJ5A 3MC6A 3KGXA 2BWOA 2CSTA 2Z9XA 3FZ8A 4KYOA 1SVVA 4R5ZA 3UE8A 3GBXA 1J32A 2VLFA 1M0OA 2VMPA 2DR1A 3OP7A 4GRXA 4F5HA 2AY6A 3K7YA 1BJOA 1B8GA 2D65A 4WYDA 4ZWMA 2VMUA 3WLXA 3NYSA 5EAVA 3RCHB 4LNJA 3QM2A 3N5MA 4IXOA 2ZY5A 4LC3A 3E2ZA 3FQAA 4OYTA 5I92A 3B1CA 2W8VA 4WBTA 3HDOA 3K40A 2HUUA 3DYDA 2BKWA 2BIEA 2HOZA 2FNIA 1V72A 2F8JA 2CANA 1AKCA 3LVJA 2VMSA 2BHXA 4FL0A 1D7UA 1G4VA 2CJDA 3CAIA 5EIGB 4Q6RA 1YAAA 4CXQA 2AY1A 5E5IA 3VAXA 3BCXA 5M4BA 2HUIA 3HMUA 1GEYA 2JGTA 5BJ4A 1CS1A 1KL1A 3W1HA 1AIAA 2Q7WA 2YKXA 1B9HA 1BT4A 2XBNA 1AAMA 1X0MA 1X2AA 3IHJA 4WP0A 1DFOA 1CL2A 2W8WA 2FQ6A 3FDDA 3RCHA 1AMQA 4GSAA 4P7YA 4CBRA 1X28A 1MAPA 3I4JA 4A72A 3GZCA 5DJ9A 1IVRA 3W1IA 2NMPA 4Y0IA 1DJEA 1ZOBA 4XAUA 3FQ8A 3EIAA 4ZAHA 4WYCA 4UHMA 2PO3A 1RV3A 4CBSA 3GJUA 3QHXA 3ATHA 4WD2A 2DGKA 3LVMA 1ARGA 2VYCA 2BI2A 3PDXA 1IAXA 3TQXA 3LWSA 1AICA 1AHYA 4RJ0A 3QN6A 4WB0A 4ATPA 3A9YA 2ZJGA 3UAKA 3WX9A 4HF8A 1FG7A 4PFFA 3LV2A 3QBOA 4K2IA 3TATA 4WLHA 3A9XA 3F6TA 3RUYA 3DODA 1N2TA 4W1XA 4IXSA 4R8DA 2GMSA 2W8JA 1O4SA 2ZSMA 3FVSA 5G2PA 4A0FA 4A6RA 2DKBA 3ASAA 1AHEA 1ZC9A 4WYFA 1Z7DA 4BA5A 1JF9A 4MY5A 3TFUA 1N8PA 5EFSA 2OKKA 1TPLA 1QJ3A 2O7CA 3FQ7A 1E5FA 2YCPA 3JWAA 5D5SA 3F0HA 2VMNA 2VIAA 3MEBA 4OT8A 1GC3A 2BI9A 4UOYA 3FCRA 4A6TA 3QI6A 1LC5A 2ZUKA 2ORDA 4E77A 4TN4A 2VMVA 3ECDA 1O69A 2ZY3A 4KAMA 3DU4A 1ASBA 3PD6B 4KXKA 1SZKA 3AEJC 3NU7A 1GBNA 4ZSYA 3F9TA 3BN1A 3RBLA 4DBCA 2EO5A 2BI3A 1KL2A 1YOOA 3B8XA 4R2NA 1JS6A 2WKAA 4BQ0A 1AMRA 1AIBA 3FDBA 2HOXA 4M2MA 1SFFA 3VK4A 4Q76A 1BQDA 2AY8A 1C0NA 3P1TA 5HXXA 3FD0A 2HZPA 3PPLA 2JG2A 2ZYJA 5G4JA 4CVQA 1OHYA 1W23A 1N31A 3BCAA 1GCKA 3MAFB 1VJOA 4IW7A 4DGTA 5G4IA 5JAYA 3WGCA 1EQBA 2AY4A 2FYFA 3P6KA 2OGEA 2CY8A 1TOEA 2O0RA 2EPJA 3BWOA 1LC8A 1LS3A 4A6UA 3GWPA 2C7TA 1PG8A 3R9AA 2HUFA 3H7FA 4ITGA 2YCTA 1QGNA 2Z1ZA 3PD6A 3FSLA 3H14A 4PIWA 1ASCA 4F5IA 3JTXA 3FFRA 2D66A 3A9ZA 2VMYA 3GZDC 4MQQA 2D64A 1P3WA 3PDBB 1CZCA 3FVXA 1FC4A 1UU1A 3AEPA 2GB3A 3ZZJA 2JJGA 1UU0A 1VP4A 2JISA 4OTLA 4RLGA 3B1DA 3GETA 2TPLA 5EAAA 2OGAA 1YJYA 4UHNA 3VP6A 4J5UA 5AX8A 2VGVA 2AY3A 1ELQA 2YOBA 4BHDA 1QZ9A 3AOVA 4JF1A 4F5KA 1CL1A 1YIZA 4XJOA 4U2HA 1E5EA 3MAFA 3E2FA 4GE9A 1LKCA 4ZSWA 4Y0HA 3G8MA 1M0PA 4GDYA 2JJEA 5G09A 1AHXA 2QB2A 4A00A 4LW2A 3MKJA 4MSOA 1D7VA 1O62A 3BV0A 3DC1A 4GEBA 1AAWA 1D2FA 3A8UX 4RM1A 1W7LA 4K2MA 4BA4A 4PVFA 1JS3A 1LK9A 4JEVA 5M4DA 4WXFA 1AJSB 1PMOA 1BJ4A 3BWNC 4WLJA 4IYOA 1AJRA 1DJ9A 1UU2A 3AEJA 1TOIA 3PGYA 4ATQA 3EI6A 3PDBA 2ZY2A 1T3IA 4UQVA 2VMOA 2AEUA 4IXZA 2BWPA 2CINA 2E7UA 2Z9WA 3ACZA 4K2BA 5FT5A 5J8QA 1D7RA 1YIYA 1H1CA 3I5TA 2WK8A 1S06A 1BS0A 1AY4A 1ECXA 1KMKA 2HP2A 3WZFA 4HVKA 3B46A 1TASA 1DGDA 3E77A 1MLZA 2Z9VA 1W3UA 3HLMA 9AATA 1M0NA 1X29A 2V1PA 4XQ2A 1CQ6A 4Q31A 3T32A 1ASDA 1SF2A 4XK1A 5G0AA 2DOUA 3RQ1A 2EGYA 2VMWA 1I29A 1D7SA 1YJZA 3DZZA 1GC0A 1AJSA 1ASAA 2VMZA 2CH2A 1ASNA 4LNMA 4W8IA 1BKGA 5EIGA 1AMSA 1AHFA 1C9CA 1SZSA 1TARA 2YRRA 3ISLA 3GZDA 4RITA 4UHOA 1BJNA 5FT8A 1S0AA 2W7MA 3EZSA 3II0A 2D7YA 2EH6A 3LY1A 4WXGA 4JEXA 4M2JA 1AMAA 1OHVA 2ZSLA 1QITA 1C7OA 2BIAA 2BYJA 1ARHA 1IUGA 2EZ2A 5LHAA 2Z67A 1IX7A 4GE7A 2YHKA 2YKYA 3KGWA 3HQTA 3KKIA 5M49A 4W91A 4L0OA 4EFFA 3PA9A 1AHGA 4H51A 3NYUA 3ZRPA 3EUCA 4ADDA 4LW4A 3UWCA 1AKAA 1CQ8A 2VMXA 2ZC0A 3WKRA 3NUIA 3CQ6A 1PFFA 1LW5A 4F5JA 1AX4A 2VIBA 4P3MA 5D95A 3WGBA 2VLHA 4N0BA 1MGVA 4RJYA 1AY5A 1O61A 2RFVA 3NNKA 5C6UA 3BWNA 5IWQA 1WSTA 1ARIA 5HHYA 2OKJA 2DGMA 3G7QA 4DQ6A 4F5LA 3USFA 1M4NA 1V2DA 2CTZA 2VGTA 3EIBA 1OXOA 4I8AA 3BC8A 3FKDA 3AOWA 2C0RA 1B5OA 3AEMC 3G0TA 2QA3A 2EZ1A 4ZDLA 3QGUA 2AY2A 3ZRRA 3BB8A 2VGWA 3QPGA 4ZWVA 3WKSA 4XEWA 4F5FA 1IAYA 2Z9UA 5EUNA 3B1EA 3RI6A 1BJWA 3FRKA 3FZ7A 1YJSA 4EB5A 1B5PA 1RV4A 1GDEA 2YKVA 1IX8A 5BJ3A 4B98A 5F8VA 1WKHA 2DKJA 1C7GA 3AELA 3A2BA 4CXRA 3PJ0A 3N0LA 4ADEA 4JEWA 2WK9A 3NRAA 2GQNA 3PIUA 2Z20A 4F5MA 3K28A 2R5CB 2X5DA 2E7JA 3FVUA 5EUEA 3JZLA 3W1JA 1GC2A 1EJIA 2X5FA 1M0QA 2VI9A 4MKJA 2Z61A 4A0GA 2G6WA 1WYTB 2BWNA 3LVLB 1V2FA 4IX8A 4Y0DA 5E4ZA 4RKDA 4RAEA 2C81A 1KKJA 4WXBA 3EI9A 1IJIA 2VI8A 4RIZA 4AZKA 3CQ5A 4BMKA 2W7KA 1GEXA 1TOGA 4E3QA 1CQ7A 2W7HA 2QMAA 1OATA 3LG0A 2CFBA 2CJGA 3WCOA 1ASFA 2YCNA 3VK3A 4AO4A 1ELUA 1XI9A 1Y4IA 3L8AA 3TFTA 4PFNA 4EU1A 1MDZA 4F5GA 1OHWA 1S08A 5E3KA 2GMUA 2R2NA 4WYAA 5TF5A 2W7EA 4JE5D 1KMJA 3M5UA 3RBFA 1WYUB 2VMTA 3AATA 3E2YA 4MQPA 5F9SA 3E6GA 2R5CA 2W7GA 4OC9A 2HP1A 3DR4A 5DJ1A 4N0WA 3HL2A 1ASGA 4ITXA 2HOYA 3EI5A 2W8TA 5DB5A 3VOMA 1WYTA 2QB3A 3AEMA 3NX3A 2VMQA 2W7IA 2D5YA 2PB2A 3HT4A 2D63A 3JU7A 4NOGA 1DTYA 2AATA 4IY7A 2R5EA 4ZDPA 2GSAA 1WYVB 4OBUA 1IBJA 4FFCA
chains in the Genus database with same CATH superfamily
4WB0B 1RVYA 1TOJA 4B9BA 1RVUA 1B4XA 1TOKA 2HORA 2ZP7A 1ASMA 2O1BA 3NTJA 1C7NA 3ASBA 1ASLA 1I41A 2BIGA 2BYLA 3NYTA 1QISA 2E54A 2FN6A 2VMRA 1WYUA 4LNLA 4AZJA 4F4EA 2E7IA 1J04A 1M6SA 2W7FA 1MDOA 3OKSA 5EQCA 4AOAA 3Q8NA 2W7LA 1VEFA 2X3LA 4XJLA 3EI8A 2W8UA 1BQAA 1G7XA 2QBTA 3MAUA 4JE5A 7AATA 1GEWA 2X8UA 4W1WA 1C4KA 4ISYA 1G7WA 3AEOA 3FFHA 3VK2A 3TCMA 2R0TA 3ZZKA 3DR7A 5DX5A 2JJFA 1WYVA 3DXWA 3BS8A 2W7JA 2CH1A 1UKJA 3NU8A 1S09A 2C44A 3DRDA 1ARTA 3ELPA 1GC4A 3HVYA 2VGZA 3NUBA 3WY7A 3EI7A 4E3RA 1MLYA 1PMMA 1H0CA 2VGSA 3MC6C 1ORDA 1WKGA 4WYGA 1DJUA 3AENB 4MQRA 4ZASA 3N4XA 2ZY4A 4ZLVA 5LH9A 3E9KA 3IF2A 4W1VA 5HDMA 1W7NA 3MBBA 4JEYA 1ARSA 3AV7A 1OXPA 3D6KA 3HBXA 4O6ZA 2XH1A 2AY9A 2PB0A 4GE4A 4M2KA 2YRIA 4ZM4A 2BI1A 3FZ6A 4QGRA 1QIRA 1GD9A 5K8BA 3R4TA 3I16A 4EB7A 1M7YA 1MDXA 3MADA 2Z1YA 3GSBA 5FT6A 2D7ZA 2V0YA 1Z3ZA 1IX6A 3JW9A 2W7DA 4ADCA 4Q75A 2BI5A 4ADBA 1ZODA 1KAFA 3L44A 4XJPA 8AATA 3CBFA 4J8LA 4U1TA 2CJHA 2AY7A 1ASEA 1CJ0A 3COGA 3PAAA 2QLRA 2D61A 1S07A 2JJHA 3DXVA 1MAQA 4A0RA 1DKAA 4ZDOA 2AEVA 1AKBA 3EZ1A 2AY5A 3AENA 3JWBA 1LC7A 4MGRA 3LVKA 4TMRA 1XEYA 3KE3A 1SZUA 1BJOB 1W7MA 3GR9A 5M46A 4AO9A 4AH3A 3WCNA 4A0HA 3E2ZB 1EG5A 2FNUA 1BW0A 2FKIA 1G4XA 3ZRQA 4XJMA 4WYEA 4EMYA 2OATA 1V2EA 4MKKA 3ELEA 1I48A 1FG3A 1KKPA 5G2QA 1TATA 4OMAA 2OQXA 2DGLA 2VGUA 4E1OA 1AY8A 4JEZA 5FT4A 1I43A 4IYOB 4OCAA 4TV7A 1LW4A 2YKUA 1M32A 3NDNA 2FM1A 3N75A 5EUDA 4ZM3A 4W5KA 1CZEA 2WK7A 3CQ4A 2CB1A 4JF0A 1YNUA 4OBVA 1SPAA 3BCBA 1B9IA 3FTBA 1JG8A 4R5FA 4RKCA 1DGEA 1U08A 1QJ5A 3MC6A 3KGXA 2BWOA 2CSTA 2Z9XA 3FZ8A 4KYOA 1SVVA 4R5ZA 3UE8A 3GBXA 2A1VA 1J32A 2VLFA 1M0OA 2VMPA 2DR1A 3OP7A 4GRXA 4F5HA 2AY6A 3K7YA 1BJOA 1B8GA 2D65A 4WYDA 4ZWMA 2VMUA 3WLXA 3NYSA 5EAVA 3RCHB 4LNJA 3QM2A 3N5MA 4IXOA 2ZY5A 4LC3A 3E2ZA 3FQAA 4OYTA 5I92A 3B1CA 2W8VA 4WBTA 3HDOA 3K40A 2HUUA 3DYDA 2BKWA 2BIEA 2HOZA 2FNIA 1V72A 2F8JA 3N4SA 2CANA 1AKCA 3LVJA 2VMSA 2BHXA 4FL0A 1D7UA 1G4VA 2CJDA 3CAIA 5EIGB 4Q6RA 1YAAA 4CXQA 2AY1A 5E5IA 3VAXA 3BCXA 5M4BA 2HUIA 3HMUA 1GEYA 2JGTA 5BJ4A 1CS1A 1KL1A 3W1HA 1AIAA 2Q7WA 2YKXA 1B9HA 1BT4A 2XBNA 1AAMA 1X0MA 1X2AA 3IHJA 4WP0A 1DFOA 1CL2A 2W8WA 2FQ6A 3FDDA 3RCHA 1AMQA 4GSAA 4P7YA 4CBRA 1X28A 1MAPA 3I4JA 4A72A 3GZCA 5DJ9A 1IVRA 3W1IA 2NMPA 3H9XA 4Y0IA 1DJEA 1ZOBA 4XAUA 3FQ8A 3EIAA 4ZAHA 4WYCA 4UHMA 2PO3A 1RV3A 4CBSA 3GJUA 3QHXA 3ATHA 4WD2A 2DGKA 3LVMA 1ARGA 2VYCA 2BI2A 3PDXA 1IAXA 3TQXA 3LWSA 1AICA 1AHYA 4RJ0A 3QN6A 4WB0A 4ATPA 3A9YA 2ZJGA 3UAKA 3WX9A 4HF8A 1FG7A 4PFFA 3LV2A 3QBOA 4K2IA 3TATA 4WLHA 3A9XA 3F6TA 3RUYA 3DODA 1N2TA 4W1XA 4IXSA 4R8DA 2GMSA 2W8JA 1O4SA 2ZSMA 3FVSA 5G2PA 4A0FA 4A6RA 2DKBA 3ASAA 1AHEA 1ZC9A 4WYFA 1Z7DA 4BA5A 1JF9A 4MY5A 3TFUA 1N8PA 5EFSA 2OKKA 1TPLA 1QJ3A 2O7CA 3FQ7A 1E5FA 2YCPA 3JWAA 5D5SA 3F0HA 2VMNA 2VIAA 3MEBA 4OT8A 1GC3A 2BI9A 4UOYA 3FCRA 4A6TA 3QI6A 1LC5A 2ZUKA 2ORDA 4E77A 4TN4A 2VMVA 3ECDA 1O69A 2ZY3A 4KAMA 3DU4A 1ASBA 3PD6B 4KXKA 1SZKA 3AEJC 3NU7A 1GBNA 4ZSYA 3F9TA 3BN1A 3RBLA 4DBCA 2EO5A 2BI3A 1KL2A 1YOOA 3B8XA 4R2NA 1JS6A 2WKAA 4BQ0A 1AMRA 1AIBA 3FDBA 2HOXA 4M2MA 1SFFA 3VK4A 4Q76A 1BQDA 2AY8A 1C0NA 3P1TA 5HXXA 3FD0A 2HZPA 3PPLA 2JG2A 2ZYJA 5G4JA 4CVQA 1OHYA 1W23A 1N31A 3BCAA 1GCKA 3MAFB 1VJOA 4IW7A 4DGTA 5G4IA 5JAYA 3WGCA 1EQBA 2AY4A 2FYFA 3P6KA 2OGEA 2CY8A 1TOEA 2O0RA 2EPJA 3BWOA 1LC8A 1LS3A 4A6UA 3GWPA 2C7TA 1PG8A 3R9AA 2HUFA 3H7FA 4ITGA 2YCTA 1QGNA 2Z1ZA 3PD6A 3FSLA 3H14A 4PIWA 1ASCA 4F5IA 3JTXA 3FFRA 2D66A 3A9ZA 2VMYA 3GZDC 4MQQA 2D64A 1P3WA 3PDBB 1CZCA 3FVXA 1FC4A 3N7NA 1UU1A 3AEPA 2GB3A 3ZZJA 2JJGA 1UU0A 1VP4A 2JISA 4OTLA 4RLGA 3B1DA 3GETA 2TPLA 5EAAA 2OGAA 1YJYA 4UHNA 3VP6A 4J5UA 5AX8A 2VGVA 2AY3A 1ELQA 2YOBA 4BHDA 1QZ9A 3AOVA 4JF1A 4F5KA 1CL1A 1YIZA 4XJOA 4U2HA 1E5EA 3MAFA 3E2FA 4GE9A 1LKCA 4ZSWA 4Y0HA 3G8MA 1M0PA 4GDYA 2JJEA 5G09A 1AHXA 2QB2A 4A00A 4LW2A 3MKJA 4MSOA 1D7VA 1O62A 3BV0A 3DC1A 4GEBA 1AAWA 1D2FA 3A8UX 4RM1A 1W7LA 4K2MA 4BA4A 4PVFA 1JS3A 1LK9A 4JEVA 5M4DA 4WXFA 1AJSB 1PMOA 1BJ4A 3BWNC 4WLJA 4IYOA 1AJRA 1DJ9A 1UU2A 3AEJA 1TOIA 3PGYA 4ATQA 3EI6A 3PDBA 2ZY2A 1T3IA 4UQVA 2VMOA 2AEUA 4IXZA 2BWPA 2CINA 2E7UA 2Z9WA 3ACZA 4K2BA 5FT5A 5J8QA 1D7RA 1YIYA 1H1CA 3I5TA 2WK8A 1S06A 1BS0A 1AY4A 1ECXA 1KMKA 2HP2A 3WZFA 4HVKA 3B46A 1TASA 1DGDA 3E77A 4K05A 1MLZA 2Z9VA 1W3UA 3HLMA 9AATA 1M0NA 1X29A 2V1PA 4XQ2A 1CQ6A 4Q31A 3T32A 1ASDA 1SF2A 4XK1A 5G0AA 2DOUA 3RQ1A 2EGYA 2VMWA 1I29A 1D7SA 1YJZA 3DZZA 1GC0A 1AJSA 1ASAA 2VMZA 2CH2A 1ASNA 4LNMA 4W8IA 1BKGA 5EIGA 1AMSA 1AHFA 1C9CA 1SZSA 1TARA 2YRRA 3ISLA 3GZDA 4RITA 4UHOA 1BJNA 5FT8A 1S0AA 2W7MA 3EZSA 3II0A 2D7YA 2EH6A 3LY1A 4WXGA 4JEXA 4M2JA 1AMAA 1OHVA 2ZSLA 1QITA 1C7OA 2BIAA 2BYJA 4H63Q 1ARHA 1IUGA 2EZ2A 5LHAA 2Z67A 1IX7A 4GE7A 2YHKA 2YKYA 3KGWA 3HQTA 3KKIA 5M49A 4W91A 4L0OA 4EFFA 3PA9A 1AHGA 4H51A 3NYUA 3ZRPA 3EUCA 4ADDA 4LW4A 3UWCA 1AKAA 1CQ8A 2VMXA 2ZC0A 3WKRA 3NUIA 3CQ6A 1PFFA 1LW5A 4F5JA 1AX4A 2VIBA 4P3MA 5D95A 2QSRA 3WGBA 2VLHA 4N0BA 1MGVA 3N4RA 4RJYA 1AY5A 1O61A 2RFVA 3NNKA 5C6UA 3BWNA 5IWQA 1WSTA 1ARIA 5HHYA 2OKJA 2DGMA 3G7QA 4DQ6A 4F5LA 3USFA 1M4NA 1V2DA 2CTZA 2VGTA 3EIBA 1OXOA 4I8AA 3BC8A 3FKDA 3AOWA 2C0RA 1B5OA 3AEMC 3G0TA 2QA3A 2EZ1A 4ZDLA 3QGUA 2AY2A 3ZRRA 3BB8A 2VGWA 3QPGA 4ZWVA 3WKSA 4XEWA 4F5FA 1IAYA 2Z9UA 5EUNA 3B1EA 3RI6A 1BJWA 3FRKA 3FZ7A 1YJSA 4EB5A 2EYQA 1B5PA 1RV4A 1GDEA 2YKVA 1IX8A 5BJ3A 4B98A 5F8VA 1WKHA 2DKJA 1C7GA 3AELA 2WB6A 3A2BA 4CXRA 3PJ0A 2KFPA 3N0LA 4ADEA 4JEWA 2WK9A 3NRAA 2GQNA 3PIUA 2Z20A 4F5MA 3K28A 2R5CB 2G7JA 2X5DA 2E7JA 3FVUA 5EUEA 3JZLA 3W1JA 1GC2A 1EJIA 2X5FA 1M0QA 2VI9A 4MKJA 2Z61A 4A0GA 2G6WA 1WYTB 2BWNA 3LVLB 1V2FA 4IX8A 4Y0DA 5E4ZA 4RKDA 4RAEA 2C81A 1KKJA 4WXBA 3EI9A 1IJIA 2VI8A 4RIZA 4AZKA 3CQ5A 4BMKA 2W7KA 1GEXA 1TOGA 4E3QA 1CQ7A 2W7HA 2QMAA 1OATA 3LG0A 2CFBA 2CJGA 3WCOA 1ASFA 2YCNA 3VK3A 4AO4A 1ELUA 1XI9A 1Y4IA 3L8AA 3TFTA 4PFNA 4EU1A 1MDZA 4F5GA 1OHWA 1S08A 5E3KA 2GMUA 2R2NA 4WYAA 5TF5A 2W7EA 4JE5D 1KMJA 3M5UA 3RBFA 1WYUB 2VMTA 3AATA 3E2YA 4MQPA 5F9SA 3E6GA 2R5CA 2W7GA 4OC9A 2HP1A 3DR4A 5DJ1A 4N0WA 3HL2A 1ASGA 4ITXA 2HOYA 3EI5A 2W8TA 5DB5A 3VOMA 1WYTA 2QB3A 3AEMA 3NX3A 2VMQA 2W7IA 2D5YA 2PB2A 3HT4A 2D63A 3JU7A 4NOGA 1DTYA 2AATA 4IY7A 2R5EA 4ZDPA 2GSAA 1WYVB 5KTBA 4OBUA 1IBJA 4FFCA
chains in the Genus database with same CATH topology
4WB0B 1RVYA 1TOJA 4B9BA 1RVUA 1B4XA 1TOKA 2HORA 2ZP7A 1ASMA 2O1BA 3NTJA 1C7NA 3ASBA 1ASLA 1I41A 2BIGA 2BYLA 3NYTA 1QISA 2E54A 2FN6A 2VMRA 1WYUA 4LNLA 4AZJA 4F4EA 2E7IA 1J04A 1M6SA 2W7FA 1MDOA 3OKSA 5EQCA 4AOAA 3Q8NA 2W7LA 1VEFA 2X3LA 4XJLA 3EI8A 2W8UA 1BQAA 1G7XA 2QBTA 3MAUA 4JE5A 7AATA 1GEWA 2X8UA 4W1WA 1C4KA 4ISYA 1G7WA 3AEOA 3FFHA 3VK2A 3TCMA 2R0TA 3ZZKA 3DR7A 5DX5A 2JJFA 1WYVA 3DXWA 3BS8A 2W7JA 2CH1A 1UKJA 3NU8A 1S09A 2C44A 3DRDA 1ARTA 3ELPA 1GC4A 3HVYA 2VGZA 3NUBA 3WY7A 3EI7A 4E3RA 1MLYA 1PMMA 1H0CA 2VGSA 3MC6C 1ORDA 1WKGA 4WYGA 1DJUA 3AENB 4MQRA 4ZASA 3N4XA 2ZY4A 4ZLVA 5LH9A 3E9KA 3IF2A 4W1VA 5HDMA 1W7NA 3MBBA 4JEYA 1ARSA 3AV7A 1OXPA 3D6KA 3HBXA 4O6ZA 2XH1A 2AY9A 2PB0A 4GE4A 4M2KA 2YRIA 4ZM4A 2BI1A 3FZ6A 4QGRA 1QIRA 1GD9A 5K8BA 3R4TA 3I16A 4EB7A 1M7YA 1MDXA 3MADA 2Z1YA 3GSBA 5FT6A 2D7ZA 2V0YA 1Z3ZA 1IX6A 3JW9A 2W7DA 4ADCA 4Q75A 2BI5A 4ADBA 1ZODA 3L44A 4XJPA 8AATA 3CBFA 4J8LA 4U1TA 2CJHA 2AY7A 1ASEA 1CJ0A 3COGA 3PAAA 2QLRA 2D61A 1S07A 2JJHA 3DXVA 1MAQA 4A0RA 1DKAA 4ZDOA 2AEVA 1AKBA 3EZ1A 2AY5A 3AENA 3JWBA 1LC7A 4MGRA 3LVKA 4TMRA 1XEYA 3KE3A 1SZUA 1BJOB 1W7MA 3GR9A 5M46A 4AO9A 4AH3A 3WCNA 4A0HA 3E2ZB 1EG5A 2FNUA 1BW0A 2FKIA 1G4XA 3ZRQA 4XJMA 4WYEA 4EMYA 2OATA 1V2EA 4MKKA 3ELEA 1I48A 1FG3A 1KKPA 5G2QA 1TATA 4OMAA 2OQXA 2DGLA 2VGUA 4E1OA 1AY8A 4JEZA 5FT4A 1I43A 4IYOB 4OCAA 4TV7A 1LW4A 2YKUA 1M32A 3NDNA 2FM1A 3N75A 5EUDA 4ZM3A 4W5KA 1CZEA 2WK7A 3CQ4A 2CB1A 4JF0A 1YNUA 4OBVA 1SPAA 3BCBA 1B9IA 3FTBA 1JG8A 4R5FA 4RKCA 1DGEA 1U08A 1QJ5A 3MC6A 3KGXA 2BWOA 2CSTA 2Z9XA 3FZ8A 4KYOA 1SVVA 4R5ZA 3UE8A 3GBXA 2A1VA 1J32A 2VLFA 1M0OA 2VMPA 2DR1A 3OP7A 4GRXA 4F5HA 2AY6A 3K7YA 1BJOA 1B8GA 2D65A 4WYDA 4ZWMA 2VMUA 3WLXA 3NYSA 5EAVA 3RCHB 4LNJA 3QM2A 3N5MA 4IXOA 2ZY5A 4LC3A 3E2ZA 3FQAA 4OYTA 5I92A 3B1CA 2W8VA 4WBTA 3HDOA 3K40A 2HUUA 3DYDA 2BKWA 2BIEA 2HOZA 2FNIA 1V72A 2F8JA 3N4SA 2CANA 1AKCA 3LVJA 2VMSA 2BHXA 4FL0A 1D7UA 1G4VA 2CJDA 3CAIA 5EIGB 4Q6RA 1YAAA 4CXQA 2AY1A 5E5IA 3VAXA 3BCXA 5M4BA 2HUIA 3HMUA 1GEYA 2JGTA 5BJ4A 1CS1A 1KL1A 3W1HA 1AIAA 2Q7WA 2YKXA 1B9HA 1BT4A 2XBNA 1AAMA 1X0MA 1X2AA 3IHJA 4WP0A 1DFOA 1CL2A 2W8WA 2FQ6A 3FDDA 3RCHA 1AMQA 4GSAA 4P7YA 4CBRA 1X28A 1MAPA 3I4JA 4A72A 3GZCA 5DJ9A 1IVRA 3W1IA 2NMPA 3H9XA 4Y0IA 1DJEA 1ZOBA 4XAUA 3FQ8A 3EIAA 4ZAHA 4WYCA 4UHMA 2PO3A 1RV3A 4CBSA 3GJUA 3QHXA 3ATHA 4WD2A 2DGKA 3LVMA 1ARGA 2VYCA 2BI2A 3PDXA 1IAXA 3TQXA 3LWSA 1AICA 1AHYA 4RJ0A 3QN6A 4WB0A 4ATPA 3A9YA 2ZJGA 3UAKA 3WX9A 4HF8A 1FG7A 4PFFA 3LV2A 3QBOA 4K2IA 3TATA 4WLHA 3A9XA 3F6TA 3RUYA 3DODA 1N2TA 4W1XA 4IXSA 4R8DA 2GMSA 2W8JA 1O4SA 2ZSMA 3FVSA 5G2PA 4A0FA 4A6RA 2DKBA 3ASAA 1AHEA 1ZC9A 4WYFA 1Z7DA 4BA5A 1JF9A 4MY5A 3TFUA 1N8PA 5EFSA 2OKKA 1TPLA 1QJ3A 2O7CA 3FQ7A 1E5FA 2YCPA 3JWAA 5D5SA 3F0HA 2VMNA 2VIAA 3MEBA 4OT8A 1GC3A 2BI9A 4UOYA 3FCRA 4A6TA 3QI6A 1LC5A 2ZUKA 2ORDA 4E77A 4TN4A 2VMVA 3ECDA 1O69A 2ZY3A 4KAMA 3DU4A 1ASBA 3PD6B 4KXKA 1SZKA 3AEJC 3NU7A 1GBNA 4ZSYA 3F9TA 3BN1A 3RBLA 4DBCA 2EO5A 2BI3A 1KL2A 1YOOA 3B8XA 4R2NA 1JS6A 2WKAA 4BQ0A 1AMRA 1AIBA 3FDBA 2HOXA 4M2MA 1SFFA 3VK4A 4Q76A 1BQDA 2AY8A 1C0NA 3P1TA 5HXXA 3FD0A 2HZPA 3PPLA 2JG2A 2ZYJA 5G4JA 4CVQA 1OHYA 1W23A 1N31A 3BCAA 1GCKA 3MAFB 1VJOA 4IW7A 4DGTA 5G4IA 5JAYA 3WGCA 1EQBA 2AY4A 2FYFA 3P6KA 2OGEA 2CY8A 1TOEA 2O0RA 2EPJA 3BWOA 1LC8A 1LS3A 4A6UA 3GWPA 2C7TA 1PG8A 3R9AA 2HUFA 3H7FA 4ITGA 2YCTA 1QGNA 2Z1ZA 3PD6A 3FSLA 3H14A 4PIWA 1ASCA 4F5IA 3JTXA 3FFRA 2D66A 3A9ZA 2VMYA 3GZDC 4MQQA 2D64A 1P3WA 3PDBB 1CZCA 3FVXA 1FC4A 3N7NA 1UU1A 3AEPA 2GB3A 3ZZJA 2JJGA 1UU0A 1VP4A 2JISA 4OTLA 4RLGA 3B1DA 3GETA 2TPLA 5EAAA 2OGAA 1YJYA 4UHNA 3VP6A 4J5UA 5AX8A 2VGVA 2AY3A 1ELQA 2YOBA 4BHDA 1QZ9A 3AOVA 4JF1A 4F5KA 1CL1A 1YIZA 4XJOA 4U2HA 1E5EA 3MAFA 3E2FA 4GE9A 1LKCA 4ZSWA 4Y0HA 3G8MA 1M0PA 4GDYA 2JJEA 5G09A 1AHXA 2QB2A 4A00A 4LW2A 3MKJA 4MSOA 1D7VA 1O62A 3BV0A 3DC1A 4GEBA 1AAWA 1D2FA 3A8UX 4RM1A 1W7LA 4K2MA 4BA4A 4PVFA 1JS3A 1LK9A 4JEVA 5M4DA 4WXFA 1AJSB 1PMOA 1BJ4A 3BWNC 4WLJA 4IYOA 1AJRA 1DJ9A 1UU2A 3AEJA 1TOIA 3PGYA 4ATQA 3EI6A 3PDBA 2ZY2A 1T3IA 4UQVA 2VMOA 2AEUA 4IXZA 2BWPA 2CINA 2E7UA 2Z9WA 3ACZA 4K2BA 5FT5A 5J8QA 1D7RA 1YIYA 1H1CA 3I5TA 2WK8A 1S06A 1BS0A 1AY4A 1ECXA 1KMKA 2HP2A 3WZFA 4HVKA 3B46A 1TASA 1DGDA 3E77A 4K05A 1MLZA 2Z9VA 1W3UA 3HLMA 9AATA 1M0NA 1X29A 2V1PA 4XQ2A 1CQ6A 4Q31A 3T32A 1ASDA 1SF2A 4XK1A 5G0AA 2DOUA 3RQ1A 2EGYA 2VMWA 1I29A 1D7SA 1YJZA 3DZZA 1GC0A 1AJSA 1ASAA 2VMZA 2CH2A 1ASNA 4LNMA 4W8IA 1BKGA 5EIGA 1AMSA 1AHFA 1C9CA 1SZSA 1TARA 2YRRA 3ISLA 3GZDA 4RITA 4UHOA 1BJNA 5FT8A 1S0AA 2W7MA 3EZSA 3II0A 2D7YA 2EH6A 3LY1A 4WXGA 4JEXA 4M2JA 1AMAA 1OHVA 2ZSLA 1QITA 1C7OA 2BIAA 2BYJA 4H63Q 1ARHA 1IUGA 2EZ2A 5LHAA 2Z67A 1IX7A 4GE7A 2YHKA 2YKYA 3KGWA 3HQTA 3KKIA 5M49A 4W91A 4L0OA 4EFFA 3PA9A 1AHGA 4H51A 3NYUA 3ZRPA 3EUCA 4ADDA 4LW4A 3UWCA 1AKAA 1CQ8A 2VMXA 2ZC0A 3WKRA 3NUIA 3CQ6A 1PFFA 1LW5A 4F5JA 1AX4A 2VIBA 4P3MA 5D95A 2QSRA 3WGBA 2VLHA 4N0BA 1MGVA 3N4RA 4RJYA 1AY5A 1O61A 2RFVA 3NNKA 5C6UA 3BWNA 5IWQA 1WSTA 1ARIA 5HHYA 2OKJA 2DGMA 3G7QA 4DQ6A 4F5LA 3USFA 1M4NA 1V2DA 2CTZA 2VGTA 3EIBA 1OXOA 4I8AA 3BC8A 3FKDA 3AOWA 2C0RA 1B5OA 3AEMC 3G0TA 2QA3A 2EZ1A 4ZDLA 3QGUA 2AY2A 3ZRRA 3BB8A 2VGWA 3QPGA 4ZWVA 3WKSA 4XEWA 4F5FA 1IAYA 2Z9UA 5EUNA 3B1EA 3RI6A 1BJWA 3FRKA 3FZ7A 1YJSA 4EB5A 2EYQA 1B5PA 1RV4A 1GDEA 2YKVA 1IX8A 5BJ3A 4B98A 5F8VA 1WKHA 2DKJA 1C7GA 3AELA 2WB6A 3A2BA 4CXRA 3PJ0A 2KFPA 3N0LA 4ADEA 4JEWA 2WK9A 3NRAA 2GQNA 3PIUA 2Z20A 4F5MA 3K28A 2R5CB 2G7JA 2X5DA 2E7JA 3FVUA 5EUEA 3JZLA 3W1JA 1GC2A 1EJIA 2X5FA 1M0QA 2VI9A 4MKJA 2Z61A 4A0GA 2G6WA 1WYTB 2BWNA 3LVLB 1V2FA 4IX8A 4Y0DA 5E4ZA 4RKDA 4RAEA 2C81A 1KKJA 4WXBA 3EI9A 1IJIA 2VI8A 4RIZA 4AZKA 3CQ5A 4BMKA 2W7KA 1GEXA 1TOGA 4E3QA 1CQ7A 2W7HA 2QMAA 1OATA 3LG0A 2CFBA 2CJGA 3WCOA 1ASFA 2YCNA 3VK3A 4AO4A 1ELUA 1XI9A 1Y4IA 3L8AA 3TFTA 4PFNA 4EU1A 1MDZA 4F5GA 1OHWA 1S08A 5E3KA 2GMUA 2R2NA 4WYAA 5TF5A 2W7EA 4JE5D 1KMJA 3M5UA 3RBFA 1WYUB 2VMTA 3AATA 3E2YA 4MQPA 5F9SA 3E6GA 2R5CA 2W7GA 4OC9A 2HP1A 3DR4A 5DJ1A 4N0WA 3HL2A 1ASGA 4ITXA 2HOYA 3EI5A 2W8TA 5DB5A 3VOMA 1WYTA 2QB3A 3AEMA 3NX3A 2VMQA 2W7IA 2D5YA 2PB2A 3HT4A 2D63A 3JU7A 4NOGA 1DTYA 2AATA 4IY7A 2R5EA 4ZDPA 2GSAA 1WYVB 5KTBA 4OBUA 1IBJA 4FFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WB0 B;  1RVY A;  1TOJ A;  4B9B A;  1RVU A;  1B4X A;  1TOK A;  2HOR A;  2ZP7 A;  1ASM A;  2O1B A;  3NTJ A;  1C7N A;  3ASB A;  1ASL A;  1I41 A;  2BIG A;  2BYL A;  3NYT A;  1QIS A;  2E54 A;  2FN6 A;  2VMR A;  1WYU A;  4LNL A;  4AZJ A;  4F4E A;  2E7I A;  1J04 A;  1M6S A;  2W7F A;  1MDO A;  3OKS A;  5EQC A;  4AOA A;  3Q8N A;  2W7L A;  1VEF A;  2X3L A;  4XJL A;  3EI8 A;  2W8U A;  1BQA A;  1G7X A;  2QBT A;  3MAU A;  4JE5 A;  7AAT A;  1GEW A;  2X8U A;  4W1W A;  1C4K A;  4ISY A;  1G7W A;  3AEO A;  3FFH A;  3VK2 A;  3TCM A;  2R0T A;  3ZZK A;  3DR7 A;  5DX5 A;  2JJF A;  1WYV A;  3DXW A;  3BS8 A;  2W7J A;  2CH1 A;  1UKJ A;  3NU8 A;  1S09 A;  2C44 A;  3DRD A;  1ART A;  3ELP A;  1GC4 A;  3HVY A;  2VGZ A;  3NUB A;  3WY7 A;  3EI7 A;  4E3R A;  1MLY A;  1PMM A;  1H0C A;  2VGS A;  3MC6 C;  1ORD A;  1WKG A;  4WYG A;  1DJU A;  3AEN B;  4MQR A;  4ZAS A;  2ZY4 A;  4ZLV A;  5LH9 A;  3E9K A;  3IF2 A;  4W1V A;  5HDM A;  1W7N A;  3MBB A;  4JEY A;  1ARS A;  3AV7 A;  1OXP A;  3D6K A;  3HBX A;  4O6Z A;  2XH1 A;  2AY9 A;  2PB0 A;  4GE4 A;  4M2K A;  2YRI A;  4ZM4 A;  2BI1 A;  3FZ6 A;  4QGR A;  1QIR A;  1GD9 A;  5K8B A;  3R4T A;  3I16 A;  4EB7 A;  1M7Y A;  1MDX A;  3MAD A;  2Z1Y A;  3GSB A;  5FT6 A;  2D7Z A;  2V0Y A;  1Z3Z A;  1IX6 A;  3JW9 A;  2W7D A;  4ADC A;  4Q75 A;  2BI5 A;  4ADB A;  1ZOD A;  3L44 A;  4XJP A;  8AAT A;  3CBF A;  4J8L A;  4U1T A;  2CJH A;  2AY7 A;  1ASE A;  1CJ0 A;  3COG A;  3PAA A;  2QLR A;  2D61 A;  1S07 A;  2JJH A;  3DXV A;  1MAQ A;  4A0R A;  1DKA A;  4ZDO A;  2AEV A;  1AKB A;  3EZ1 A;  2AY5 A;  3AEN A;  3JWB A;  1LC7 A;  4MGR A;  3LVK A;  4TMR A;  1XEY A;  3KE3 A;  1SZU A;  1BJO B;  1W7M A;  3GR9 A;  5M46 A;  4AO9 A;  4AH3 A;  3WCN A;  4A0H A;  3E2Z B;  1EG5 A;  2FNU A;  1BW0 A;  1G4X A;  3ZRQ A;  4XJM A;  4WYE A;  4EMY A;  2OAT A;  1V2E A;  4MKK A;  3ELE A;  1I48 A;  1FG3 A;  1KKP A;  5G2Q A;  1TAT A;  4OMA A;  2OQX A;  2DGL A;  2VGU A;  4E1O A;  1AY8 A;  4JEZ A;  5FT4 A;  1I43 A;  4IYO B;  4OCA A;  4TV7 A;  1LW4 A;  2YKU A;  1M32 A;  3NDN A;  2FM1 A;  3N75 A;  5EUD A;  4ZM3 A;  4W5K A;  1CZE A;  2WK7 A;  3CQ4 A;  2CB1 A;  4JF0 A;  1YNU A;  4OBV A;  1SPA A;  3BCB A;  1B9I A;  3FTB A;  1JG8 A;  4R5F A;  4RKC A;  1DGE A;  1U08 A;  1QJ5 A;  3MC6 A;  3KGX A;  2BWO A;  2CST A;  2Z9X A;  3FZ8 A;  4KYO A;  1SVV A;  4R5Z A;  3UE8 A;  3GBX A;  1J32 A;  2VLF A;  1M0O A;  2VMP A;  2DR1 A;  3OP7 A;  4GRX A;  4F5H A;  2AY6 A;  3K7Y A;  1BJO A;  1B8G A;  2D65 A;  4WYD A;  4ZWM A;  2VMU A;  3WLX A;  3NYS A;  5EAV A;  3RCH B;  4LNJ A;  3QM2 A;  3N5M A;  4IXO A;  2ZY5 A;  4LC3 A;  3E2Z A;  3FQA A;  4OYT A;  5I92 A;  3B1C A;  2W8V A;  4WBT A;  3HDO A;  3K40 A;  2HUU A;  3DYD A;  2BKW A;  2BIE A;  2HOZ A;  2FNI A;  1V72 A;  2F8J A;  2CAN A;  1AKC A;  3LVJ A;  2VMS A;  2BHX A;  4FL0 A;  1D7U A;  1G4V A;  2CJD A;  3CAI A;  5EIG B;  4Q6R A;  1YAA A;  4CXQ A;  2AY1 A;  5E5I A;  3VAX A;  3BCX A;  5M4B A;  2HUI A;  3HMU A;  1GEY A;  2JGT A;  5BJ4 A;  1CS1 A;  1KL1 A;  3W1H A;  1AIA A;  2Q7W A;  2YKX A;  1B9H A;  1BT4 A;  2XBN A;  1AAM A;  1X0M A;  1X2A A;  3IHJ A;  4WP0 A;  1DFO A;  1CL2 A;  2W8W A;  2FQ6 A;  3FDD A;  3RCH A;  1AMQ A;  4GSA A;  4P7Y A;  4CBR A;  1X28 A;  1MAP A;  3I4J A;  4A72 A;  3GZC A;  5DJ9 A;  1IVR A;  3W1I A;  2NMP A;  4Y0I A;  1DJE A;  1ZOB A;  4XAU A;  3FQ8 A;  3EIA A;  4ZAH A;  4WYC A;  4UHM A;  2PO3 A;  1RV3 A;  4CBS A;  3GJU A;  3QHX A;  3ATH A;  4WD2 A;  2DGK A;  3LVM A;  1ARG A;  2VYC A;  2BI2 A;  3PDX A;  1IAX A;  3TQX A;  3LWS A;  1AIC A;  1AHY A;  4RJ0 A;  3QN6 A;  4WB0 A;  4ATP A;  3A9Y A;  2ZJG A;  3UAK A;  3WX9 A;  4HF8 A;  1FG7 A;  4PFF A;  3LV2 A;  3QBO A;  4K2I A;  3TAT A;  4WLH A;  3A9X A;  3F6T A;  3RUY A;  3DOD A;  1N2T A;  4W1X A;  4IXS A;  4R8D A;  2GMS A;  2W8J A;  1O4S A;  2ZSM A;  3FVS A;  5G2P A;  4A0F A;  4A6R A;  2DKB A;  3ASA A;  1AHE A;  1ZC9 A;  4WYF A;  1Z7D A;  4BA5 A;  1JF9 A;  4MY5 A;  3TFU A;  1N8P A;  5EFS A;  2OKK A;  1TPL A;  1QJ3 A;  2O7C A;  3FQ7 A;  1E5F A;  2YCP A;  3JWA A;  5D5S A;  3F0H A;  2VMN A;  2VIA A;  3MEB A;  4OT8 A;  1GC3 A;  2BI9 A;  4UOY A;  3FCR A;  4A6T A;  3QI6 A;  1LC5 A;  2ZUK A;  2ORD A;  4E77 A;  4TN4 A;  2VMV A;  3ECD A;  1O69 A;  2ZY3 A;  4KAM A;  3DU4 A;  1ASB A;  3PD6 B;  4KXK A;  1SZK A;  3AEJ C;  3NU7 A;  1GBN A;  4ZSY A;  3F9T A;  3BN1 A;  3RBL A;  4DBC A;  2EO5 A;  2BI3 A;  1KL2 A;  1YOO A;  3B8X A;  4R2N A;  1JS6 A;  2WKA A;  4BQ0 A;  1AMR A;  1AIB A;  3FDB A;  2HOX A;  4M2M A;  1SFF A;  3VK4 A;  4Q76 A;  1BQD A;  2AY8 A;  1C0N A;  3P1T A;  5HXX A;  3FD0 A;  2HZP A;  3PPL A;  2JG2 A;  2ZYJ A;  5G4J A;  4CVQ A;  1OHY A;  1W23 A;  1N31 A;  3BCA A;  1GCK A;  3MAF B;  1VJO A;  4IW7 A;  4DGT A;  5G4I A;  5JAY A;  3WGC A;  1EQB A;  2AY4 A;  2FYF A;  3P6K A;  2OGE A;  2CY8 A;  1TOE A;  2O0R A;  2EPJ A;  3BWO A;  1LC8 A;  1LS3 A;  4A6U A;  3GWP A;  2C7T A;  1PG8 A;  3R9A A;  2HUF A;  3H7F A;  4ITG A;  2YCT A;  1QGN A;  2Z1Z A;  3PD6 A;  3FSL A;  3H14 A;  4PIW A;  1ASC A;  4F5I A;  3JTX A;  3FFR A;  2D66 A;  3A9Z A;  2VMY A;  3GZD C;  4MQQ A;  2D64 A;  1P3W A;  3PDB B;  1CZC A;  3FVX A;  1FC4 A;  1UU1 A;  3AEP A;  2GB3 A;  3ZZJ A;  2JJG A;  1UU0 A;  1VP4 A;  2JIS A;  4OTL A;  4RLG A;  3B1D A;  3GET A;  2TPL A;  5EAA A;  2OGA A;  1YJY A;  4UHN A;  3VP6 A;  4J5U A;  5AX8 A;  2VGV A;  2AY3 A;  1ELQ A;  2YOB A;  4BHD A;  1QZ9 A;  3AOV A;  4JF1 A;  4F5K A;  1CL1 A;  1YIZ A;  4XJO A;  4U2H A;  1E5E A;  3MAF A;  3E2F A;  4GE9 A;  1LKC A;  4ZSW A;  4Y0H A;  3G8M A;  1M0P A;  4GDY A;  2JJE A;  5G09 A;  1AHX A;  2QB2 A;  4A00 A;  4LW2 A;  3MKJ A;  4MSO A;  1D7V A;  1O62 A;  3BV0 A;  3DC1 A;  4GEB A;  1AAW A;  1D2F A;  3A8U X;  4RM1 A;  1W7L A;  4K2M A;  4BA4 A;  4PVF A;  1JS3 A;  1LK9 A;  4JEV A;  5M4D A;  4WXF A;  1AJS B;  1PMO A;  1BJ4 A;  3BWN C;  4WLJ A;  4IYO A;  1AJR A;  1DJ9 A;  1UU2 A;  3AEJ A;  1TOI A;  3PGY A;  4ATQ A;  3EI6 A;  3PDB A;  2ZY2 A;  1T3I A;  4UQV A;  2VMO A;  2AEU A;  4IXZ A;  2BWP A;  2CIN A;  2E7U A;  2Z9W A;  3ACZ A;  4K2B A;  5FT5 A;  5J8Q A;  1D7R A;  1YIY A;  1H1C A;  3I5T A;  2WK8 A;  1S06 A;  1BS0 A;  1AY4 A;  1ECX A;  1KMK A;  2HP2 A;  3WZF A;  4HVK A;  3B46 A;  1TAS A;  1DGD A;  3E77 A;  1MLZ A;  2Z9V A;  1W3U A;  3HLM A;  9AAT A;  1M0N A;  1X29 A;  2V1P A;  4XQ2 A;  1CQ6 A;  4Q31 A;  3T32 A;  1ASD A;  1SF2 A;  4XK1 A;  5G0A A;  2DOU A;  3RQ1 A;  2EGY A;  2VMW A;  1I29 A;  1D7S A;  1YJZ A;  3DZZ A;  1GC0 A;  1AJS A;  1ASA A;  2VMZ A;  2CH2 A;  1ASN A;  4LNM A;  4W8I A;  1BKG A;  5EIG A;  1AMS A;  1AHF A;  1C9C A;  1SZS A;  1TAR A;  2YRR A;  3ISL A;  3GZD A;  4RIT A;  4UHO A;  1BJN A;  5FT8 A;  1S0A A;  2W7M A;  3EZS A;  3II0 A;  2D7Y A;  2EH6 A;  3LY1 A;  4WXG A;  4JEX A;  4M2J A;  1AMA A;  1OHV A;  2ZSL A;  1QIT A;  1C7O A;  2BIA A;  2BYJ A;  1ARH A;  1IUG A;  2EZ2 A;  5LHA A;  2Z67 A;  1IX7 A;  4GE7 A;  2YHK A;  2YKY A;  3KGW A;  3HQT A;  3KKI A;  5M49 A;  4W91 A;  4L0O A;  4EFF A;  3PA9 A;  1AHG A;  4H51 A;  3NYU A;  3ZRP A;  3EUC A;  4ADD A;  4LW4 A;  3UWC A;  1AKA A;  1CQ8 A;  2VMX A;  2ZC0 A;  3WKR A;  3NUI A;  3CQ6 A;  1PFF A;  1LW5 A;  4F5J A;  1AX4 A;  2VIB A;  4P3M A;  5D95 A;  3WGB A;  2VLH A;  4N0B A;  1MGV A;  4RJY A;  1AY5 A;  1O61 A;  2RFV A;  3NNK A;  5C6U A;  3BWN A;  5IWQ A;  1WST A;  1ARI A;  5HHY A;  2OKJ A;  2DGM A;  3G7Q A;  4DQ6 A;  4F5L A;  3USF A;  1M4N A;  1V2D A;  2CTZ A;  2VGT A;  3EIB A;  1OXO A;  4I8A A;  3BC8 A;  3FKD A;  3AOW A;  2C0R A;  1B5O A;  3AEM C;  3G0T A;  2QA3 A;  2EZ1 A;  4ZDL A;  3QGU A;  2AY2 A;  3ZRR A;  3BB8 A;  2VGW A;  3QPG A;  4ZWV A;  3WKS A;  4XEW A;  4F5F A;  1IAY A;  2Z9U A;  5EUN A;  3B1E A;  3RI6 A;  1BJW A;  3FRK A;  3FZ7 A;  1YJS A;  4EB5 A;  1B5P A;  1RV4 A;  1GDE A;  2YKV A;  1IX8 A;  5BJ3 A;  4B98 A;  5F8V A;  1WKH A;  2DKJ A;  1C7G A;  3AEL A;  3A2B A;  4CXR A;  3PJ0 A;  3N0L A;  4ADE A;  4JEW A;  2WK9 A;  3NRA A;  2GQN A;  3PIU A;  2Z20 A;  4F5M A;  3K28 A;  2R5C B;  2X5D A;  2E7J A;  3FVU A;  5EUE A;  3JZL A;  3W1J A;  1GC2 A;  1EJI A;  2X5F A;  1M0Q A;  2VI9 A;  4MKJ A;  2Z61 A;  4A0G A;  2G6W A;  1WYT B;  2BWN A;  3LVL B;  1V2F A;  4IX8 A;  4Y0D A;  5E4Z A;  4RKD A;  4RAE A;  2C81 A;  1KKJ A;  4WXB A;  3EI9 A;  1IJI A;  2VI8 A;  4RIZ A;  4AZK A;  3CQ5 A;  4BMK A;  2W7K A;  1GEX A;  1TOG A;  4E3Q A;  1CQ7 A;  2W7H A;  2QMA A;  1OAT A;  3LG0 A;  2CFB A;  2CJG A;  3WCO A;  1ASF A;  2YCN A;  3VK3 A;  4AO4 A;  1ELU A;  1XI9 A;  1Y4I A;  3L8A A;  3TFT A;  4PFN A;  4EU1 A;  1MDZ A;  4F5G A;  1OHW A;  1S08 A;  5E3K A;  2GMU A;  2R2N A;  4WYA A;  5TF5 A;  2W7E A;  4JE5 D;  1KMJ A;  3M5U A;  3RBF A;  1WYU B;  2VMT A;  3AAT A;  3E2Y A;  4MQP A;  5F9S A;  3E6G A;  2R5C A;  2W7G A;  4OC9 A;  2HP1 A;  3DR4 A;  5DJ1 A;  4N0W A;  3HL2 A;  1ASG A;  4ITX A;  2HOY A;  3EI5 A;  2W8T A;  5DB5 A;  3VOM A;  1WYT A;  2QB3 A;  3AEM A;  3NX3 A;  2VMQ A;  2W7I A;  2D5Y A;  2PB2 A;  3HT4 A;  2D63 A;  3JU7 A;  4NOG A;  1DTY A;  2AAT A;  4IY7 A;  2R5E A;  4ZDP A;  2GSA A;  1WYV B;  4OBU A;  1IBJ A;  4FFC A; 
#chains in the Genus database with same CATH topology
 4WB0 B;  1RVY A;  1TOJ A;  4B9B A;  1RVU A;  1B4X A;  1TOK A;  2HOR A;  2ZP7 A;  1ASM A;  2O1B A;  3NTJ A;  1C7N A;  3ASB A;  1ASL A;  1I41 A;  2BIG A;  2BYL A;  3NYT A;  1QIS A;  2E54 A;  2FN6 A;  2VMR A;  1WYU A;  4LNL A;  4AZJ A;  4F4E A;  2E7I A;  1J04 A;  1M6S A;  2W7F A;  1MDO A;  3OKS A;  5EQC A;  4AOA A;  3Q8N A;  2W7L A;  1VEF A;  2X3L A;  4XJL A;  3EI8 A;  2W8U A;  1BQA A;  1G7X A;  2QBT A;  3MAU A;  4JE5 A;  7AAT A;  1GEW A;  2X8U A;  4W1W A;  1C4K A;  4ISY A;  1G7W A;  3AEO A;  3FFH A;  3VK2 A;  3TCM A;  2R0T A;  3ZZK A;  3DR7 A;  5DX5 A;  2JJF A;  1WYV A;  3DXW A;  3BS8 A;  2W7J A;  2CH1 A;  1UKJ A;  3NU8 A;  1S09 A;  2C44 A;  3DRD A;  1ART A;  3ELP A;  1GC4 A;  3HVY A;  2VGZ A;  3NUB A;  3WY7 A;  3EI7 A;  4E3R A;  1MLY A;  1PMM A;  1H0C A;  2VGS A;  3MC6 C;  1ORD A;  1WKG A;  4WYG A;  1DJU A;  3AEN B;  4MQR A;  4ZAS A;  3N4X A;  2ZY4 A;  4ZLV A;  5LH9 A;  3E9K A;  3IF2 A;  4W1V A;  5HDM A;  1W7N A;  3MBB A;  4JEY A;  1ARS A;  3AV7 A;  1OXP A;  3D6K A;  3HBX A;  4O6Z A;  2XH1 A;  2AY9 A;  2PB0 A;  4GE4 A;  4M2K A;  2YRI A;  4ZM4 A;  2BI1 A;  3FZ6 A;  4QGR A;  1QIR A;  1GD9 A;  5K8B A;  3R4T A;  3I16 A;  4EB7 A;  1M7Y A;  1MDX A;  3MAD A;  2Z1Y A;  3GSB A;  5FT6 A;  2D7Z A;  2V0Y A;  1Z3Z A;  1IX6 A;  3JW9 A;  2W7D A;  4ADC A;  4Q75 A;  2BI5 A;  4ADB A;  1ZOD A;  1KAF A;  3L44 A;  4XJP A;  8AAT A;  3CBF A;  4J8L A;  4U1T A;  2CJH A;  2AY7 A;  1ASE A;  1CJ0 A;  3COG A;  3PAA A;  2QLR A;  2D61 A;  1S07 A;  2JJH A;  3DXV A;  1MAQ A;  4A0R A;  1DKA A;  4ZDO A;  2AEV A;  1AKB A;  3EZ1 A;  2AY5 A;  3AEN A;  3JWB A;  1LC7 A;  4MGR A;  3LVK A;  4TMR A;  1XEY A;  3KE3 A;  1SZU A;  1BJO B;  1W7M A;  3GR9 A;  5M46 A;  4AO9 A;  4AH3 A;  3WCN A;  4A0H A;  3E2Z B;  1EG5 A;  2FNU A;  1BW0 A;  2FKI A;  1G4X A;  3ZRQ A;  4XJM A;  4WYE A;  4EMY A;  2OAT A;  1V2E A;  4MKK A;  3ELE A;  1I48 A;  1FG3 A;  1KKP A;  5G2Q A;  1TAT A;  4OMA A;  2OQX A;  2DGL A;  2VGU A;  4E1O A;  1AY8 A;  4JEZ A;  5FT4 A;  1I43 A;  4IYO B;  4OCA A;  4TV7 A;  1LW4 A;  2YKU A;  1M32 A;  3NDN A;  2FM1 A;  3N75 A;  5EUD A;  4ZM3 A;  4W5K A;  1CZE A;  2WK7 A;  3CQ4 A;  2CB1 A;  4JF0 A;  1YNU A;  4OBV A;  1SPA A;  3BCB A;  1B9I A;  3FTB A;  1JG8 A;  4R5F A;  4RKC A;  1DGE A;  1U08 A;  1QJ5 A;  3MC6 A;  3KGX A;  2BWO A;  2CST A;  2Z9X A;  3FZ8 A;  4KYO A;  1SVV A;  4R5Z A;  3UE8 A;  3GBX A;  2A1V A;  1J32 A;  2VLF A;  1M0O A;  2VMP A;  2DR1 A;  3OP7 A;  4GRX A;  4F5H A;  2AY6 A;  3K7Y A;  1BJO A;  1B8G A;  2D65 A;  4WYD A;  4ZWM A;  2VMU A;  3WLX A;  3NYS A;  5EAV A;  3RCH B;  4LNJ A;  3QM2 A;  3N5M A;  4IXO A;  2ZY5 A;  4LC3 A;  3E2Z A;  3FQA A;  4OYT A;  5I92 A;  3B1C A;  2W8V A;  4WBT A;  3HDO A;  3K40 A;  2HUU A;  3DYD A;  2BKW A;  2BIE A;  2HOZ A;  2FNI A;  1V72 A;  2F8J A;  3N4S A;  2CAN A;  1AKC A;  3LVJ A;  2VMS A;  2BHX A;  4FL0 A;  1D7U A;  1G4V A;  2CJD A;  3CAI A;  5EIG B;  4Q6R A;  1YAA A;  4CXQ A;  2AY1 A;  5E5I A;  3VAX A;  3BCX A;  5M4B A;  2HUI A;  3HMU A;  1GEY A;  2JGT A;  5BJ4 A;  1CS1 A;  1KL1 A;  3W1H A;  1AIA A;  2Q7W A;  2YKX A;  1B9H A;  1BT4 A;  2XBN A;  1AAM A;  1X0M A;  1X2A A;  3IHJ A;  4WP0 A;  1DFO A;  1CL2 A;  2W8W A;  2FQ6 A;  3FDD A;  3RCH A;  1AMQ A;  4GSA A;  4P7Y A;  4CBR A;  1X28 A;  1MAP A;  3I4J A;  4A72 A;  3GZC A;  5DJ9 A;  1IVR A;  3W1I A;  2NMP A;  3H9X A;  4Y0I A;  1DJE A;  1ZOB A;  4XAU A;  3FQ8 A;  3EIA A;  4ZAH A;  4WYC A;  4UHM A;  2PO3 A;  1RV3 A;  4CBS A;  3GJU A;  3QHX A;  3ATH A;  4WD2 A;  2DGK A;  3LVM A;  1ARG A;  2VYC A;  2BI2 A;  3PDX A;  1IAX A;  3TQX A;  3LWS A;  1AIC A;  1AHY A;  4RJ0 A;  3QN6 A;  4WB0 A;  4ATP A;  3A9Y A;  2ZJG A;  3UAK A;  3WX9 A;  4HF8 A;  1FG7 A;  4PFF A;  3LV2 A;  3QBO A;  4K2I A;  3TAT A;  4WLH A;  3A9X A;  3F6T A;  3RUY A;  3DOD A;  1N2T A;  4W1X A;  4IXS A;  4R8D A;  2GMS A;  2W8J A;  1O4S A;  2ZSM A;  3FVS A;  5G2P A;  4A0F A;  4A6R A;  2DKB A;  3ASA A;  1AHE A;  1ZC9 A;  4WYF A;  1Z7D A;  4BA5 A;  1JF9 A;  4MY5 A;  3TFU A;  1N8P A;  5EFS A;  2OKK A;  1TPL A;  1QJ3 A;  2O7C A;  3FQ7 A;  1E5F A;  2YCP A;  3JWA A;  5D5S A;  3F0H A;  2VMN A;  2VIA A;  3MEB A;  4OT8 A;  1GC3 A;  2BI9 A;  4UOY A;  3FCR A;  4A6T A;  3QI6 A;  1LC5 A;  2ZUK A;  2ORD A;  4E77 A;  4TN4 A;  2VMV A;  3ECD A;  1O69 A;  2ZY3 A;  4KAM A;  3DU4 A;  1ASB A;  3PD6 B;  4KXK A;  1SZK A;  3AEJ C;  3NU7 A;  1GBN A;  4ZSY A;  3F9T A;  3BN1 A;  3RBL A;  4DBC A;  2EO5 A;  2BI3 A;  1KL2 A;  1YOO A;  3B8X A;  4R2N A;  1JS6 A;  2WKA A;  4BQ0 A;  1AMR A;  1AIB A;  3FDB A;  2HOX A;  4M2M A;  1SFF A;  3VK4 A;  4Q76 A;  1BQD A;  2AY8 A;  1C0N A;  3P1T A;  5HXX A;  3FD0 A;  2HZP A;  3PPL A;  2JG2 A;  2ZYJ A;  5G4J A;  4CVQ A;  1OHY A;  1W23 A;  1N31 A;  3BCA A;  1GCK A;  3MAF B;  1VJO A;  4IW7 A;  4DGT A;  5G4I A;  5JAY A;  3WGC A;  1EQB A;  2AY4 A;  2FYF A;  3P6K A;  2OGE A;  2CY8 A;  1TOE A;  2O0R A;  2EPJ A;  3BWO A;  1LC8 A;  1LS3 A;  4A6U A;  3GWP A;  2C7T A;  1PG8 A;  3R9A A;  2HUF A;  3H7F A;  4ITG A;  2YCT A;  1QGN A;  2Z1Z A;  3PD6 A;  3FSL A;  3H14 A;  4PIW A;  1ASC A;  4F5I A;  3JTX A;  3FFR A;  2D66 A;  3A9Z A;  2VMY A;  3GZD C;  4MQQ A;  2D64 A;  1P3W A;  3PDB B;  1CZC A;  3FVX A;  1FC4 A;  3N7N A;  1UU1 A;  3AEP A;  2GB3 A;  3ZZJ A;  2JJG A;  1UU0 A;  1VP4 A;  2JIS A;  4OTL A;  4RLG A;  3B1D A;  3GET A;  2TPL A;  5EAA A;  2OGA A;  1YJY A;  4UHN A;  3VP6 A;  4J5U A;  5AX8 A;  2VGV A;  2AY3 A;  1ELQ A;  2YOB A;  4BHD A;  1QZ9 A;  3AOV A;  4JF1 A;  4F5K A;  1CL1 A;  1YIZ A;  4XJO A;  4U2H A;  1E5E A;  3MAF A;  3E2F A;  4GE9 A;  1LKC A;  4ZSW A;  4Y0H A;  3G8M A;  1M0P A;  4GDY A;  2JJE A;  5G09 A;  1AHX A;  2QB2 A;  4A00 A;  4LW2 A;  3MKJ A;  4MSO A;  1D7V A;  1O62 A;  3BV0 A;  3DC1 A;  4GEB A;  1AAW A;  1D2F A;  3A8U X;  4RM1 A;  1W7L A;  4K2M A;  4BA4 A;  4PVF A;  1JS3 A;  1LK9 A;  4JEV A;  5M4D A;  4WXF A;  1AJS B;  1PMO A;  1BJ4 A;  3BWN C;  4WLJ A;  4IYO A;  1AJR A;  1DJ9 A;  1UU2 A;  3AEJ A;  1TOI A;  3PGY A;  4ATQ A;  3EI6 A;  3PDB A;  2ZY2 A;  1T3I A;  4UQV A;  2VMO A;  2AEU A;  4IXZ A;  2BWP A;  2CIN A;  2E7U A;  2Z9W A;  3ACZ A;  4K2B A;  5FT5 A;  5J8Q A;  1D7R A;  1YIY A;  1H1C A;  3I5T A;  2WK8 A;  1S06 A;  1BS0 A;  1AY4 A;  1ECX A;  1KMK A;  2HP2 A;  3WZF A;  4HVK A;  3B46 A;  1TAS A;  1DGD A;  3E77 A;  4K05 A;  1MLZ A;  2Z9V A;  1W3U A;  3HLM A;  9AAT A;  1M0N A;  1X29 A;  2V1P A;  4XQ2 A;  1CQ6 A;  4Q31 A;  3T32 A;  1ASD A;  1SF2 A;  4XK1 A;  5G0A A;  2DOU A;  3RQ1 A;  2EGY A;  2VMW A;  1I29 A;  1D7S A;  1YJZ A;  3DZZ A;  1GC0 A;  1AJS A;  1ASA A;  2VMZ A;  2CH2 A;  1ASN A;  4LNM A;  4W8I A;  1BKG A;  5EIG A;  1AMS A;  1AHF A;  1C9C A;  1SZS A;  1TAR A;  2YRR A;  3ISL A;  3GZD A;  4RIT A;  4UHO A;  1BJN A;  5FT8 A;  1S0A A;  2W7M A;  3EZS A;  3II0 A;  2D7Y A;  2EH6 A;  3LY1 A;  4WXG A;  4JEX A;  4M2J A;  1AMA A;  1OHV A;  2ZSL A;  1QIT A;  1C7O A;  2BIA A;  2BYJ A;  4H63 Q;  1ARH A;  1IUG A;  2EZ2 A;  5LHA A;  2Z67 A;  1IX7 A;  4GE7 A;  2YHK A;  2YKY A;  3KGW A;  3HQT A;  3KKI A;  5M49 A;  4W91 A;  4L0O A;  4EFF A;  3PA9 A;  1AHG A;  4H51 A;  3NYU A;  3ZRP A;  3EUC A;  4ADD A;  4LW4 A;  3UWC A;  1AKA A;  1CQ8 A;  2VMX A;  2ZC0 A;  3WKR A;  3NUI A;  3CQ6 A;  1PFF A;  1LW5 A;  4F5J A;  1AX4 A;  2VIB A;  4P3M A;  5D95 A;  2QSR A;  3WGB A;  2VLH A;  4N0B A;  1MGV A;  3N4R A;  4RJY A;  1AY5 A;  1O61 A;  2RFV A;  3NNK A;  5C6U A;  3BWN A;  5IWQ A;  1WST A;  1ARI A;  5HHY A;  2OKJ A;  2DGM A;  3G7Q A;  4DQ6 A;  4F5L A;  3USF A;  1M4N A;  1V2D A;  2CTZ A;  2VGT A;  3EIB A;  1OXO A;  4I8A A;  3BC8 A;  3FKD A;  3AOW A;  2C0R A;  1B5O A;  3AEM C;  3G0T A;  2QA3 A;  2EZ1 A;  4ZDL A;  3QGU A;  2AY2 A;  3ZRR A;  3BB8 A;  2VGW A;  3QPG A;  4ZWV A;  3WKS A;  4XEW A;  4F5F A;  1IAY A;  2Z9U A;  5EUN A;  3B1E A;  3RI6 A;  1BJW A;  3FRK A;  3FZ7 A;  1YJS A;  4EB5 A;  2EYQ A;  1B5P A;  1RV4 A;  1GDE A;  2YKV A;  1IX8 A;  5BJ3 A;  4B98 A;  5F8V A;  1WKH A;  2DKJ A;  1C7G A;  3AEL A;  2WB6 A;  3A2B A;  4CXR A;  3PJ0 A;  2KFP A;  3N0L A;  4ADE A;  4JEW A;  2WK9 A;  3NRA A;  2GQN A;  3PIU A;  2Z20 A;  4F5M A;  3K28 A;  2R5C B;  2G7J A;  2X5D A;  2E7J A;  3FVU A;  5EUE A;  3JZL A;  3W1J A;  1GC2 A;  1EJI A;  2X5F A;  1M0Q A;  2VI9 A;  4MKJ A;  2Z61 A;  4A0G A;  2G6W A;  1WYT B;  2BWN A;  3LVL B;  1V2F A;  4IX8 A;  4Y0D A;  5E4Z A;  4RKD A;  4RAE A;  2C81 A;  1KKJ A;  4WXB A;  3EI9 A;  1IJI A;  2VI8 A;  4RIZ A;  4AZK A;  3CQ5 A;  4BMK A;  2W7K A;  1GEX A;  1TOG A;  4E3Q A;  1CQ7 A;  2W7H A;  2QMA A;  1OAT A;  3LG0 A;  2CFB A;  2CJG A;  3WCO A;  1ASF A;  2YCN A;  3VK3 A;  4AO4 A;  1ELU A;  1XI9 A;  1Y4I A;  3L8A A;  3TFT A;  4PFN A;  4EU1 A;  1MDZ A;  4F5G A;  1OHW A;  1S08 A;  5E3K A;  2GMU A;  2R2N A;  4WYA A;  5TF5 A;  2W7E A;  4JE5 D;  1KMJ A;  3M5U A;  3RBF A;  1WYU B;  2VMT A;  3AAT A;  3E2Y A;  4MQP A;  5F9S A;  3E6G A;  2R5C A;  2W7G A;  4OC9 A;  2HP1 A;  3DR4 A;  5DJ1 A;  4N0W A;  3HL2 A;  1ASG A;  4ITX A;  2HOY A;  3EI5 A;  2W8T A;  5DB5 A;  3VOM A;  1WYT A;  2QB3 A;  3AEM A;  3NX3 A;  2VMQ A;  2W7I A;  2D5Y A;  2PB2 A;  3HT4 A;  2D63 A;  3JU7 A;  4NOG A;  1DTY A;  2AAT A;  4IY7 A;  2R5E A;  4ZDP A;  2GSA A;  1WYV B;  5KTB A;  4OBU A;  1IBJ A;  4FFC A; 
#chains in the Genus database with same CATH homology
 4WB0 B;  1RVY A;  1TOJ A;  4B9B A;  1RVU A;  1B4X A;  1TOK A;  2HOR A;  2ZP7 A;  1ASM A;  2O1B A;  3NTJ A;  1C7N A;  3ASB A;  1ASL A;  1I41 A;  2BIG A;  2BYL A;  3NYT A;  1QIS A;  2E54 A;  2FN6 A;  2VMR A;  1WYU A;  4LNL A;  4AZJ A;  4F4E A;  2E7I A;  1J04 A;  1M6S A;  2W7F A;  1MDO A;  3OKS A;  5EQC A;  4AOA A;  3Q8N A;  2W7L A;  1VEF A;  2X3L A;  4XJL A;  3EI8 A;  2W8U A;  1BQA A;  1G7X A;  2QBT A;  3MAU A;  4JE5 A;  7AAT A;  1GEW A;  2X8U A;  4W1W A;  1C4K A;  4ISY A;  1G7W A;  3AEO A;  3FFH A;  3VK2 A;  3TCM A;  2R0T A;  3ZZK A;  3DR7 A;  5DX5 A;  2JJF A;  1WYV A;  3DXW A;  3BS8 A;  2W7J A;  2CH1 A;  1UKJ A;  3NU8 A;  1S09 A;  2C44 A;  3DRD A;  1ART A;  3ELP A;  1GC4 A;  3HVY A;  2VGZ A;  3NUB A;  3WY7 A;  3EI7 A;  4E3R A;  1MLY A;  1PMM A;  1H0C A;  2VGS A;  3MC6 C;  1ORD A;  1WKG A;  4WYG A;  1DJU A;  3AEN B;  4MQR A;  4ZAS A;  3N4X A;  2ZY4 A;  4ZLV A;  5LH9 A;  3E9K A;  3IF2 A;  4W1V A;  5HDM A;  1W7N A;  3MBB A;  4JEY A;  1ARS A;  3AV7 A;  1OXP A;  3D6K A;  3HBX A;  4O6Z A;  2XH1 A;  2AY9 A;  2PB0 A;  4GE4 A;  4M2K A;  2YRI A;  4ZM4 A;  2BI1 A;  3FZ6 A;  4QGR A;  1QIR A;  1GD9 A;  5K8B A;  3R4T A;  3I16 A;  4EB7 A;  1M7Y A;  1MDX A;  3MAD A;  2Z1Y A;  3GSB A;  5FT6 A;  2D7Z A;  2V0Y A;  1Z3Z A;  1IX6 A;  3JW9 A;  2W7D A;  4ADC A;  4Q75 A;  2BI5 A;  4ADB A;  1ZOD A;  3L44 A;  4XJP A;  8AAT A;  3CBF A;  4J8L A;  4U1T A;  2CJH A;  2AY7 A;  1ASE A;  1CJ0 A;  3COG A;  3PAA A;  2QLR A;  2D61 A;  1S07 A;  2JJH A;  3DXV A;  1MAQ A;  4A0R A;  1DKA A;  4ZDO A;  2AEV A;  1AKB A;  3EZ1 A;  2AY5 A;  3AEN A;  3JWB A;  1LC7 A;  4MGR A;  3LVK A;  4TMR A;  1XEY A;  3KE3 A;  1SZU A;  1BJO B;  1W7M A;  3GR9 A;  5M46 A;  4AO9 A;  4AH3 A;  3WCN A;  4A0H A;  3E2Z B;  1EG5 A;  2FNU A;  1BW0 A;  2FKI A;  1G4X A;  3ZRQ A;  4XJM A;  4WYE A;  4EMY A;  2OAT A;  1V2E A;  4MKK A;  3ELE A;  1I48 A;  1FG3 A;  1KKP A;  5G2Q A;  1TAT A;  4OMA A;  2OQX A;  2DGL A;  2VGU A;  4E1O A;  1AY8 A;  4JEZ A;  5FT4 A;  1I43 A;  4IYO B;  4OCA A;  4TV7 A;  1LW4 A;  2YKU A;  1M32 A;  3NDN A;  2FM1 A;  3N75 A;  5EUD A;  4ZM3 A;  4W5K A;  1CZE A;  2WK7 A;  3CQ4 A;  2CB1 A;  4JF0 A;  1YNU A;  4OBV A;  1SPA A;  3BCB A;  1B9I A;  3FTB A;  1JG8 A;  4R5F A;  4RKC A;  1DGE A;  1U08 A;  1QJ5 A;  3MC6 A;  3KGX A;  2BWO A;  2CST A;  2Z9X A;  3FZ8 A;  4KYO A;  1SVV A;  4R5Z A;  3UE8 A;  3GBX A;  2A1V A;  1J32 A;  2VLF A;  1M0O A;  2VMP A;  2DR1 A;  3OP7 A;  4GRX A;  4F5H A;  2AY6 A;  3K7Y A;  1BJO A;  1B8G A;  2D65 A;  4WYD A;  4ZWM A;  2VMU A;  3WLX A;  3NYS A;  5EAV A;  3RCH B;  4LNJ A;  3QM2 A;  3N5M A;  4IXO A;  2ZY5 A;  4LC3 A;  3E2Z A;  3FQA A;  4OYT A;  5I92 A;  3B1C A;  2W8V A;  4WBT A;  3HDO A;  3K40 A;  2HUU A;  3DYD A;  2BKW A;  2BIE A;  2HOZ A;  2FNI A;  1V72 A;  2F8J A;  3N4S A;  2CAN A;  1AKC A;  3LVJ A;  2VMS A;  2BHX A;  4FL0 A;  1D7U A;  1G4V A;  2CJD A;  3CAI A;  5EIG B;  4Q6R A;  1YAA A;  4CXQ A;  2AY1 A;  5E5I A;  3VAX A;  3BCX A;  5M4B A;  2HUI A;  3HMU A;  1GEY A;  2JGT A;  5BJ4 A;  1CS1 A;  1KL1 A;  3W1H A;  1AIA A;  2Q7W A;  2YKX A;  1B9H A;  1BT4 A;  2XBN A;  1AAM A;  1X0M A;  1X2A A;  3IHJ A;  4WP0 A;  1DFO A;  1CL2 A;  2W8W A;  2FQ6 A;  3FDD A;  3RCH A;  1AMQ A;  4GSA A;  4P7Y A;  4CBR A;  1X28 A;  1MAP A;  3I4J A;  4A72 A;  3GZC A;  5DJ9 A;  1IVR A;  3W1I A;  2NMP A;  3H9X A;  4Y0I A;  1DJE A;  1ZOB A;  4XAU A;  3FQ8 A;  3EIA A;  4ZAH A;  4WYC A;  4UHM A;  2PO3 A;  1RV3 A;  4CBS A;  3GJU A;  3QHX A;  3ATH A;  4WD2 A;  2DGK A;  3LVM A;  1ARG A;  2VYC A;  2BI2 A;  3PDX A;  1IAX A;  3TQX A;  3LWS A;  1AIC A;  1AHY A;  4RJ0 A;  3QN6 A;  4WB0 A;  4ATP A;  3A9Y A;  2ZJG A;  3UAK A;  3WX9 A;  4HF8 A;  1FG7 A;  4PFF A;  3LV2 A;  3QBO A;  4K2I A;  3TAT A;  4WLH A;  3A9X A;  3F6T A;  3RUY A;  3DOD A;  1N2T A;  4W1X A;  4IXS A;  4R8D A;  2GMS A;  2W8J A;  1O4S A;  2ZSM A;  3FVS A;  5G2P A;  4A0F A;  4A6R A;  2DKB A;  3ASA A;  1AHE A;  1ZC9 A;  4WYF A;  1Z7D A;  4BA5 A;  1JF9 A;  4MY5 A;  3TFU A;  1N8P A;  5EFS A;  2OKK A;  1TPL A;  1QJ3 A;  2O7C A;  3FQ7 A;  1E5F A;  2YCP A;  3JWA A;  5D5S A;  3F0H A;  2VMN A;  2VIA A;  3MEB A;  4OT8 A;  1GC3 A;  2BI9 A;  4UOY A;  3FCR A;  4A6T A;  3QI6 A;  1LC5 A;  2ZUK A;  2ORD A;  4E77 A;  4TN4 A;  2VMV A;  3ECD A;  1O69 A;  2ZY3 A;  4KAM A;  3DU4 A;  1ASB A;  3PD6 B;  4KXK A;  1SZK A;  3AEJ C;  3NU7 A;  1GBN A;  4ZSY A;  3F9T A;  3BN1 A;  3RBL A;  4DBC A;  2EO5 A;  2BI3 A;  1KL2 A;  1YOO A;  3B8X A;  4R2N A;  1JS6 A;  2WKA A;  4BQ0 A;  1AMR A;  1AIB A;  3FDB A;  2HOX A;  4M2M A;  1SFF A;  3VK4 A;  4Q76 A;  1BQD A;  2AY8 A;  1C0N A;  3P1T A;  5HXX A;  3FD0 A;  2HZP A;  3PPL A;  2JG2 A;  2ZYJ A;  5G4J A;  4CVQ A;  1OHY A;  1W23 A;  1N31 A;  3BCA A;  1GCK A;  3MAF B;  1VJO A;  4IW7 A;  4DGT A;  5G4I A;  5JAY A;  3WGC A;  1EQB A;  2AY4 A;  2FYF A;  3P6K A;  2OGE A;  2CY8 A;  1TOE A;  2O0R A;  2EPJ A;  3BWO A;  1LC8 A;  1LS3 A;  4A6U A;  3GWP A;  2C7T A;  1PG8 A;  3R9A A;  2HUF A;  3H7F A;  4ITG A;  2YCT A;  1QGN A;  2Z1Z A;  3PD6 A;  3FSL A;  3H14 A;  4PIW A;  1ASC A;  4F5I A;  3JTX A;  3FFR A;  2D66 A;  3A9Z A;  2VMY A;  3GZD C;  4MQQ A;  2D64 A;  1P3W A;  3PDB B;  1CZC A;  3FVX A;  1FC4 A;  3N7N A;  1UU1 A;  3AEP A;  2GB3 A;  3ZZJ A;  2JJG A;  1UU0 A;  1VP4 A;  2JIS A;  4OTL A;  4RLG A;  3B1D A;  3GET A;  2TPL A;  5EAA A;  2OGA A;  1YJY A;  4UHN A;  3VP6 A;  4J5U A;  5AX8 A;  2VGV A;  2AY3 A;  1ELQ A;  2YOB A;  4BHD A;  1QZ9 A;  3AOV A;  4JF1 A;  4F5K A;  1CL1 A;  1YIZ A;  4XJO A;  4U2H A;  1E5E A;  3MAF A;  3E2F A;  4GE9 A;  1LKC A;  4ZSW A;  4Y0H A;  3G8M A;  1M0P A;  4GDY A;  2JJE A;  5G09 A;  1AHX A;  2QB2 A;  4A00 A;  4LW2 A;  3MKJ A;  4MSO A;  1D7V A;  1O62 A;  3BV0 A;  3DC1 A;  4GEB A;  1AAW A;  1D2F A;  3A8U X;  4RM1 A;  1W7L A;  4K2M A;  4BA4 A;  4PVF A;  1JS3 A;  1LK9 A;  4JEV A;  5M4D A;  4WXF A;  1AJS B;  1PMO A;  1BJ4 A;  3BWN C;  4WLJ A;  4IYO A;  1AJR A;  1DJ9 A;  1UU2 A;  3AEJ A;  1TOI A;  3PGY A;  4ATQ A;  3EI6 A;  3PDB A;  2ZY2 A;  1T3I A;  4UQV A;  2VMO A;  2AEU A;  4IXZ A;  2BWP A;  2CIN A;  2E7U A;  2Z9W A;  3ACZ A;  4K2B A;  5FT5 A;  5J8Q A;  1D7R A;  1YIY A;  1H1C A;  3I5T A;  2WK8 A;  1S06 A;  1BS0 A;  1AY4 A;  1ECX A;  1KMK A;  2HP2 A;  3WZF A;  4HVK A;  3B46 A;  1TAS A;  1DGD A;  3E77 A;  4K05 A;  1MLZ A;  2Z9V A;  1W3U A;  3HLM A;  9AAT A;  1M0N A;  1X29 A;  2V1P A;  4XQ2 A;  1CQ6 A;  4Q31 A;  3T32 A;  1ASD A;  1SF2 A;  4XK1 A;  5G0A A;  2DOU A;  3RQ1 A;  2EGY A;  2VMW A;  1I29 A;  1D7S A;  1YJZ A;  3DZZ A;  1GC0 A;  1AJS A;  1ASA A;  2VMZ A;  2CH2 A;  1ASN A;  4LNM A;  4W8I A;  1BKG A;  5EIG A;  1AMS A;  1AHF A;  1C9C A;  1SZS A;  1TAR A;  2YRR A;  3ISL A;  3GZD A;  4RIT A;  4UHO A;  1BJN A;  5FT8 A;  1S0A A;  2W7M A;  3EZS A;  3II0 A;  2D7Y A;  2EH6 A;  3LY1 A;  4WXG A;  4JEX A;  4M2J A;  1AMA A;  1OHV A;  2ZSL A;  1QIT A;  1C7O A;  2BIA A;  2BYJ A;  4H63 Q;  1ARH A;  1IUG A;  2EZ2 A;  5LHA A;  2Z67 A;  1IX7 A;  4GE7 A;  2YHK A;  2YKY A;  3KGW A;  3HQT A;  3KKI A;  5M49 A;  4W91 A;  4L0O A;  4EFF A;  3PA9 A;  1AHG A;  4H51 A;  3NYU A;  3ZRP A;  3EUC A;  4ADD A;  4LW4 A;  3UWC A;  1AKA A;  1CQ8 A;  2VMX A;  2ZC0 A;  3WKR A;  3NUI A;  3CQ6 A;  1PFF A;  1LW5 A;  4F5J A;  1AX4 A;  2VIB A;  4P3M A;  5D95 A;  2QSR A;  3WGB A;  2VLH A;  4N0B A;  1MGV A;  3N4R A;  4RJY A;  1AY5 A;  1O61 A;  2RFV A;  3NNK A;  5C6U A;  3BWN A;  5IWQ A;  1WST A;  1ARI A;  5HHY A;  2OKJ A;  2DGM A;  3G7Q A;  4DQ6 A;  4F5L A;  3USF A;  1M4N A;  1V2D A;  2CTZ A;  2VGT A;  3EIB A;  1OXO A;  4I8A A;  3BC8 A;  3FKD A;  3AOW A;  2C0R A;  1B5O A;  3AEM C;  3G0T A;  2QA3 A;  2EZ1 A;  4ZDL A;  3QGU A;  2AY2 A;  3ZRR A;  3BB8 A;  2VGW A;  3QPG A;  4ZWV A;  3WKS A;  4XEW A;  4F5F A;  1IAY A;  2Z9U A;  5EUN A;  3B1E A;  3RI6 A;  1BJW A;  3FRK A;  3FZ7 A;  1YJS A;  4EB5 A;  2EYQ A;  1B5P A;  1RV4 A;  1GDE A;  2YKV A;  1IX8 A;  5BJ3 A;  4B98 A;  5F8V A;  1WKH A;  2DKJ A;  1C7G A;  3AEL A;  2WB6 A;  3A2B A;  4CXR A;  3PJ0 A;  2KFP A;  3N0L A;  4ADE A;  4JEW A;  2WK9 A;  3NRA A;  2GQN A;  3PIU A;  2Z20 A;  4F5M A;  3K28 A;  2R5C B;  2G7J A;  2X5D A;  2E7J A;  3FVU A;  5EUE A;  3JZL A;  3W1J A;  1GC2 A;  1EJI A;  2X5F A;  1M0Q A;  2VI9 A;  4MKJ A;  2Z61 A;  4A0G A;  2G6W A;  1WYT B;  2BWN A;  3LVL B;  1V2F A;  4IX8 A;  4Y0D A;  5E4Z A;  4RKD A;  4RAE A;  2C81 A;  1KKJ A;  4WXB A;  3EI9 A;  1IJI A;  2VI8 A;  4RIZ A;  4AZK A;  3CQ5 A;  4BMK A;  2W7K A;  1GEX A;  1TOG A;  4E3Q A;  1CQ7 A;  2W7H A;  2QMA A;  1OAT A;  3LG0 A;  2CFB A;  2CJG A;  3WCO A;  1ASF A;  2YCN A;  3VK3 A;  4AO4 A;  1ELU A;  1XI9 A;  1Y4I A;  3L8A A;  3TFT A;  4PFN A;  4EU1 A;  1MDZ A;  4F5G A;  1OHW A;  1S08 A;  5E3K A;  2GMU A;  2R2N A;  4WYA A;  5TF5 A;  2W7E A;  4JE5 D;  1KMJ A;  3M5U A;  3RBF A;  1WYU B;  2VMT A;  3AAT A;  3E2Y A;  4MQP A;  5F9S A;  3E6G A;  2R5C A;  2W7G A;  4OC9 A;  2HP1 A;  3DR4 A;  5DJ1 A;  4N0W A;  3HL2 A;  1ASG A;  4ITX A;  2HOY A;  3EI5 A;  2W8T A;  5DB5 A;  3VOM A;  1WYT A;  2QB3 A;  3AEM A;  3NX3 A;  2VMQ A;  2W7I A;  2D5Y A;  2PB2 A;  3HT4 A;  2D63 A;  3JU7 A;  4NOG A;  1DTY A;  2AAT A;  4IY7 A;  2R5E A;  4ZDP A;  2GSA A;  1WYV B;  5KTB A;  4OBU A;  1IBJ A;  4FFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...