1OXPA

Aspartate aminotransferase, h-asp complex, closed conformation
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and solution studies of oxime adducts of mitochondrial aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 138
structure length 401
sequence length 401
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1oxpA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1oxpA01
3RBLA 1AKBA 1LK9A 1KKPA 3MC6C 1O69A 1OXOA 3BN1A 4EB5A 2D7ZA 4U1TA 4W1XA 4LNMA 2FNUA 3RCHA 4IXSA 1AIBA 3LVLB 3F6TA 2VI8A 3HDOA 2Z67A 4KXKA 3KKIA 4JEWA 4BA4A 1VJOA 3H7FA 3NX3A 4XK1A 3MKJA 1IVRA 3ISLA 1B9HA 1ZODA 3IHJA 4LW2A 1IBJA 1CL1A 4W1WA 2HOZA 2VLHA 2W7JA 3GWPA 4EMYA 1S0AA 2EZ2A 2DR1A 2G6WA 2VMXA 1LC8A 4GDYA 1OHVA 4GE7A 1PMMA 1W7NA 2OATA 5EAVA 3FFRA 3MC6A 3GETA 4MQRA 2JJHA 2QB2A 1Y4IA 3B1DA 1RV4A 1LS3A 4PIWA 2BWPA 2D7YA 2PO3A 2X8UA 4MQQA 4UHOA 5EUEA 1TOGA 2CTZA 4L0OA 2W8TA 2QA3A 2XBNA 2BKWA 2E7UA 1GBNA 3FFHA 2VMVA 2W7HA 4ADEA 1TOIA 1VP4A 3WX9A 4DBCA 1GD9A 2W7MA 1G7XA 5E4ZA 4AZKA 3COGA 2BIGA 2D61A 4CVQA 1T3IA 2W7EA 4K2MA 4MGRA 2AEUA 2W7IA 4AH3A 1AHEA 2AY7A 2C44A 5D5SA 2QB3A 4WP0A 1BJWA 4R8DA 2Z20A 4E3QA 2ZY3A 5DX5A 2VMQA 2ZP7A 3CQ6A 2ZSLA 3K28A 1ASAA 4OBVA 3BV0A 1ARHA 3NUBA 4WB0A 4EFFA 1YJYA 3BCXA 2BWOA 3UAKA 4WBTA 1JG8A 2BI3A 2DKJA 2W8UA 1PG8A 5EUNA 2DGLA 3OP7A 3PDBB 1RVYA 2AY5A 3P1TA 2E7JA 1ASGA 2OKJA 2R5CA 7AATA 4GE4A 3VP6A 2AY9A 4WYCA 4CBSA 2CJHA 4O6ZA 2CH1A 2YKUA 4IXZA 5G09A 2GMSA 1S07A 4J5UA 4WXGA 3K7YA 4XJLA 1KMJA 4W91A 2ZYJA 1C4KA 3BC8A 4OBUA 3AV7A 1CZEA 2BI2A 1MAPA 2CFBA 2WKAA 3ACZA 3DRDA 3I16A 2PB2A 3EIAA 3WGCA 4Y0HA 2W8VA 1AICA 3ZZKA 3AOWA 1DFOA 3MAFA 4M2MA 3DC1A 2YCNA 4M2JA 2JGTA 3FVXA 4A0FA 4ATQA 3E6GA 2D66A 4JEZA 4P3MA 1O4SA 4F5LA 1V72A 3FDBA 4LNLA 1EG5A 1IX7A 1P3WA 2ORDA 2OQXA 3PIUA 4IW7A 3QPGA 2W8JA 4UOYA 4XJPA 5EIGB 1G7WA 1ELQA 4ZWMA 4OCAA 1OATA 3I5TA 2OKKA 4IX8A 1MDOA 1MGVA 2VMZA 3R4TA 4Q6RA 1IX6A 1V2FA 4ITGA 1YOOA 2DKBA 1UU2A 3G0TA 2AY6A 3BS8A 3PD6B 2VLFA 4ZM4A 1AX4A 3M5UA 3G8MA 2FM1A 1QGNA 3L44A 3I4JA 4UQVA 1KL2A 3TFTA 1ASLA 4IYOB 2BHXA 4DQ6A 2AY8A 4UHNA 4TMRA 3JU7A 4TN4A 1IUGA 3TATA 2DGMA 5EIGA 1C7OA 3WCOA 1DTYA 3EUCA 3OKSA 3W1JA 2VMYA 2ZJGA 3CQ4A 3FD0A 1O62A 4J8LA 2EO5A 2Z9WA 1S08A 1SZUA 1V2EA 3E2ZB 4N0WA 3AOVA 4WLHA 4ADBA 2AY2A 1LC5A 3B46A 3NYSA 2O1BA 3ELEA 1ASFA 1C7GA 2VI9A 4MKJA 3NTJA 4F5JA 2VMSA 1LW4A 3FZ8A 4JEYA 3ZRRA 1X28A 4Y0DA 3VAXA 1UU1A 2Q7WA 4K2IA 1D7VA 1ELUA 3MEBA 1H0CA 2YRRA 1C0NA 1JF9A 1GEWA 2VGSA 1TATA 1WKGA 1AHYA 3GZDC 3W1IA 1QIRA 1ZOBA 3E2FA 5M4DA 1WSTA 3E9KA 4F5KA 1M32A 1BS0A 4QGRA 1LKCA 2HP2A 2YKYA 3WGBA 1AKCA 2VMRA 2BIAA 4GEBA 2VMOA 1D7SA 1DJEA 2R0TA 3NYUA 3WCNA 3B1EA 3ELPA 1C9CA 3II0A 4Q31A 2TPLA 2VGWA 1AAMA 3BCAA 3FTBA 4WB0B 1IAYA 2Z9VA 1OHYA 3AENA 3QI6A 3EI6A 4A6UA 3AELA 3A2BA 4BHDA 5F8VA 5FT8A 5LH9A 5AX8A 4F4EA 1SPAA 1B8GA 1YIYA 2BWNA 4A6RA 4WXBA 2EH6A 4F5HA 3VK3A 3QM2A 2YRIA 4E1OA 2F8JA 3Q8NA 4Q76A 4DGTA 3HLMA 3FZ6A 3HMUA 1DGEA 1WYUB 1LW5A 5G4JA 1B5OA 1BQDA 1SZSA 3FQAA 4R2NA 3DU4A 2V1PA 3DR4A 4XQ2A 5M4BA 1UU0A 4ADDA 1AMRA 1I48A 4MQPA 3GR9A 2BI1A 3RCHB 2VGZA 3AENB 3A9ZA 4MKKA 2CJGA 3IF2A 4WYDA 3N75A 4ZLVA 2O0RA 3R9AA 3PDBA 3ZZJA 1ASCA 1AMSA 4W8IA 1ARSA 1ORDA 1W3UA 2YOBA 3NRAA 4ZASA 2VGUA 4RKDA 5HHYA 5HDMA 4HVKA 3BWNA 4UHMA 3GZCA 4WYGA 3K40A 4FL0A 1RV3A 1M7YA 2AY4A 4NOGA 3GSBA 1M0QA 1BJ4A 3JTXA 4FFCA 3FCRA 2RFVA 4AO4A 2HP1A 3BWOA 1JS6A 1QITA 2NMPA 9AATA 3CQ5A 3NYTA 4WLJA 1BW0A 3LG0A 4WYFA 3JWBA 2W7DA 3WZFA 2PB0A 1M0OA 2V0YA 4TV7A 1AHFA 1PMOA 3E77A 3ASBA 2CY8A 1CJ0A 1BQAA 1ZC9A 2CJDA 3AATA 1CQ7A 1ASEA 1AJSB 1GEYA 2C7TA 1N8PA 3MADA 3AEJC 3FVSA 4GRXA 2D63A 1M6SA 1TOKA 1GDEA 1WYTB 1BJOA 1YJZA 2YCPA 3CAIA 5EQCA 1X0MA 1ASNA 2VIAA 4Q75A 4IYOA 2W7LA 5EFSA 5I92A 3RI6A 3HBXA 2Z1YA 3TQXA 4P7YA 3KGXA 1M4NA 5G0AA 4JEVA 1QJ5A 3PAAA 1N31A 4M2KA 1EJIA 3GZDA 2EGYA 2EPJA 4B98A 3HT4A 4B9BA 1AJSA 1AMQA 2HUUA 3TCMA 4OT8A 5HXXA 1SZKA 2DOUA 1ARTA 3EIBA 3HQTA 4GSAA 5G2PA 4AO9A 4XJMA 2AY1A 2VMWA 4U2HA 3RUYA 2HOYA 2GQNA 5G4IA 1V2DA 2D65A 3EZ1A 5F9SA 4JEXA 3USFA 4WYAA 2FQ6A 1TPLA 3LVKA 5BJ4A 1I41A 2JJGA 3DXWA 1WYVA 2GB3A 4KAMA 3ZRPA 4XEWA 1Z3ZA 1J04A 4ZM3A 4PFNA 2WK8A 2HOXA 4OMAA 3HVYA 2ZUKA 4KYOA 1M0PA 4JF1A 2BI5A 2GSAA 1DJ9A 3WKSA 1ASDA 1AY8A 1ARIA 5FT6A 1DGDA 2HUIA 3RBFA 3FZ7A 4ISYA 3A9YA 5E5IA 4BA5A 3LVMA 3B1CA 1G4XA 4WXFA 2FNIA 2JJFA 4LNJA 2VIBA 4LC3A 1D2FA 2HUFA 3A8UX 3E2YA 3EI5A 3RQ1A 4W1VA 2VGTA 3QHXA 3DXVA 5DJ9A 1X2AA 5TF5A 4AOAA 1KL1A 2W8WA 5EAAA 4CXRA 3AEMC 1BT4A 2D64A 3N0LA 1W23A 1TARA 4MY5A 5J8QA 3KGWA 5D95A 2JG2A 1DJUA 3QGUA 1MLZA 5DB5A 1GEXA 3BB8A 3DODA 4OTLA 1ASMA 3ASAA 2FN6A 3ATHA 3F9TA 3PA9A 4A0GA 4A0HA 1U08A 1I29A 2YCTA 2CSTA 3NU8A 4F5MA 4PFFA 2CINA 4JE5A 2VMTA 3ZRQA 1G4VA 3FDDA 2W7GA 2E7IA 4GE9A 1OXPA 3ECDA 3MAUA 1FG7A 3AEPA 2JISA 4LW4A 4RAEA 1EQBA 5G2QA 3JW9A 3UE8A 3LV2A 1AJRA 5EUDA 2OGAA 2C81A 4ZWVA 3FVUA 4ZDPA 1W7LA 1CZCA 4IY7A 4XAUA 2Z1ZA 1AY4A 1B9IA 3E2ZA 1RVUA 2AEVA 3N5MA 4ITXA 3A9XA 4K2BA 4E3RA 5JAYA 1N2TA 5IWQA 3AEOA 1QZ9A 4HF8A 4E77A 3NUIA 3NDNA 4CBRA 1IX8A 1QISA 2CB1A 2W7FA 4BQ0A 3TFUA 1SF2A 2R2NA 3JZLA 2Z61A 3BCBA 1M0NA 1OHWA 1B5PA 3AEJA 4F5IA 2WK9A 3DYDA 4RLGA 3VOMA 4ADCA 2QBTA 4WD2A 1GC3A 1AAWA 1BJNA 2VYCA 3KE3A 1ASBA 1MDXA 3FKDA 5C6UA 3EI8A 2YKXA 4ATPA 3DZZA 1CS1A 1KKJA 2CANA 3JWAA 2Z9XA 4I8AA 1LC7A 3NU7A 1WYUA 1DKAA 2BI9A 3CBFA 3L8AA 2VMUA 4F5GA 4ZSYA 4JF0A 3W1HA 2JJEA 1MLYA 1FC4A 3DR7A 4IXOA 1GCKA 1TOJA 3F0HA 5FT4A 3PD6A 4RJ0A 1IAXA 1J32A 1TOEA 4MSOA 2HORA 5LHAA 1YIZA 1AIAA 1W7MA 2WK7A 2YHKA 4N0BA 3VK2A 4PVFA 2OGEA 1SFFA 3NNKA 1JS3A 2R5CB 1AMAA 1AKAA 3H14A 3T32A 2ZSMA 3MBBA 2VGVA 3QBOA 1PFFA 2O7CA 1FG3A 4RJYA 2FYFA 1BKGA 1E5FA 1D7UA 4H51A 1QJ3A 1S09A 3G7QA 2ZC0A 2E54A 5BJ3A 2YKVA 3FSLA 4F5FA 1AHGA 3PPLA 4RITA 4R5ZA 5E3KA 1IJIA 4CXQA 4ZDLA 2ZY2A 1Z7DA 1AY5A 1BJOB 3EZSA 5M46A 3D6KA 3EI7A 2CH2A 4XJOA 3QN6A 1O61A 4RIZA 5FT5A 1GC0A 1XI9A 2GMUA 2R5EA 8AATA 1AHXA 3WLXA 4WYEA 1C7NA 3UWCA 2W7KA 3PJ0A 4EU1A 1MDZA 1GC2A 1ARGA 3GBXA 3BWNC 4A6TA 1TASA 2ZY4A 1UKJA 2AATA 4R5FA 1KMKA 3AEMA 3MAFB 2HZPA 1GC4A 4RM1A 3LY1A 1I43A 2D5YA 1H1CA 3FQ8A 2BYJA 1WYTA 1E5EA 2VMNA 3WY7A 4A0RA 5M49A 3HL2A 3GJUA 1S06A 2VMPA 4RKCA 4AZJA 2XH1A 2Z9UA 3EI9A 1WYVB 5DJ1A 1ECXA 3VK4A 2QMAA 5K8BA 4OYTA 1CQ8A 2X5FA 2AY3A 2QLRA 4ZAHA 2ZY5A 3PGYA 1VEFA 2BYLA 1YNUA 3PDXA 4ZSWA 4OC9A 2C0RA 1YAAA 1MAQA 3FQ7A 4JE5D 1X29A 3FRKA 1CQ6A 1WKHA 4A72A 2DGKA 2X3LA 2BIEA 2EZ1A 3LWSA 4ZDOA 1XEYA 4Y0IA 3WKRA 1YJSA 1B4XA 1D7RA 4EB7A 4BMKA 3P6KA 1CL2A 3LVJA 2X5DA 3B8XA 4W5KA 1SVVA 4A00A
chains in the Genus database with same CATH superfamily
3RBLA 1AKBA 1LK9A 1KKPA 3MC6C 1O69A 1OXOA 3BN1A 4EB5A 2D7ZA 4U1TA 4W1XA 4LNMA 2FNUA 3RCHA 4IXSA 1AIBA 3LVLB 3F6TA 2FKIA 2VI8A 3HDOA 2Z67A 4KXKA 3KKIA 4JEWA 4BA4A 1VJOA 3H7FA 3NX3A 4XK1A 3MKJA 1IVRA 3ISLA 1B9HA 1ZODA 3N4SA 3IHJA 4LW2A 1IBJA 1CL1A 4W1WA 2HOZA 2VLHA 2W7JA 3GWPA 4EMYA 1S0AA 2EZ2A 2DR1A 2G6WA 2VMXA 1LC8A 4GDYA 1OHVA 4GE7A 1PMMA 1W7NA 2OATA 5EAVA 3FFRA 3MC6A 3GETA 4MQRA 2JJHA 2QB2A 1Y4IA 3B1DA 1RV4A 1LS3A 4PIWA 2BWPA 2D7YA 2PO3A 2X8UA 4MQQA 4UHOA 5EUEA 2G7JA 1TOGA 2CTZA 4L0OA 2W8TA 2QA3A 2XBNA 2BKWA 2E7UA 1GBNA 3FFHA 2VMVA 2W7HA 4ADEA 1TOIA 1VP4A 3WX9A 4DBCA 1GD9A 2W7MA 1G7XA 5E4ZA 4AZKA 3COGA 2BIGA 2D61A 4CVQA 1T3IA 2W7EA 4K2MA 4MGRA 2AEUA 2W7IA 4AH3A 1AHEA 2AY7A 2C44A 5D5SA 2QB3A 4WP0A 1BJWA 4R8DA 2Z20A 4E3QA 2ZY3A 5DX5A 2VMQA 2ZP7A 3CQ6A 2ZSLA 3K28A 1ASAA 4OBVA 3BV0A 1ARHA 3NUBA 4WB0A 4EFFA 1YJYA 3BCXA 2BWOA 3UAKA 4WBTA 1JG8A 2BI3A 2DKJA 2W8UA 1PG8A 5EUNA 2DGLA 3OP7A 3PDBB 1RVYA 2AY5A 3P1TA 2E7JA 1ASGA 2OKJA 2R5CA 7AATA 4GE4A 3VP6A 2AY9A 4WYCA 4CBSA 2CJHA 4O6ZA 2CH1A 2YKUA 4IXZA 5G09A 2GMSA 1S07A 4J5UA 4WXGA 3K7YA 4XJLA 1KMJA 4W91A 2ZYJA 1C4KA 3BC8A 4OBUA 3AV7A 1CZEA 2BI2A 1MAPA 2CFBA 2WKAA 3ACZA 3DRDA 3I16A 2PB2A 3EIAA 3WGCA 4Y0HA 2W8VA 1AICA 3ZZKA 3AOWA 1DFOA 3MAFA 4M2MA 3DC1A 2YCNA 4M2JA 2JGTA 3FVXA 4A0FA 4ATQA 3E6GA 2D66A 4JEZA 4P3MA 1O4SA 4F5LA 1V72A 3FDBA 4LNLA 1EG5A 1IX7A 1P3WA 2ORDA 2OQXA 3PIUA 4IW7A 3QPGA 2W8JA 4UOYA 4XJPA 5EIGB 1G7WA 1ELQA 4ZWMA 4OCAA 1OATA 3I5TA 3N4RA 2OKKA 4IX8A 1MDOA 1MGVA 2VMZA 3R4TA 4Q6RA 1IX6A 1V2FA 4ITGA 1YOOA 2DKBA 1UU2A 3G0TA 2AY6A 5KTBA 3BS8A 3PD6B 2VLFA 4ZM4A 1AX4A 3M5UA 3G8MA 2FM1A 1QGNA 3L44A 3I4JA 4UQVA 1KL2A 3TFTA 1ASLA 4IYOB 2BHXA 4DQ6A 2AY8A 4UHNA 4TMRA 3JU7A 4TN4A 1IUGA 3TATA 2DGMA 5EIGA 1C7OA 3WCOA 1DTYA 3EUCA 3OKSA 3W1JA 3H9XA 2VMYA 2ZJGA 3CQ4A 3FD0A 1O62A 4J8LA 2EO5A 2Z9WA 1S08A 1SZUA 1V2EA 3E2ZB 4N0WA 3AOVA 4WLHA 4ADBA 2AY2A 1LC5A 3B46A 3NYSA 2O1BA 3ELEA 1ASFA 1C7GA 2VI9A 4MKJA 3NTJA 4F5JA 2VMSA 1LW4A 3FZ8A 4JEYA 3ZRRA 1X28A 4Y0DA 3VAXA 1UU1A 2Q7WA 4K2IA 1D7VA 1ELUA 3MEBA 1H0CA 2YRRA 1C0NA 1JF9A 1GEWA 2VGSA 1TATA 1WKGA 1AHYA 3GZDC 3W1IA 1QIRA 1ZOBA 3E2FA 5M4DA 2WB6A 1WSTA 3E9KA 4F5KA 1M32A 1BS0A 4QGRA 1LKCA 2HP2A 2YKYA 3WGBA 1AKCA 2VMRA 2BIAA 4GEBA 2VMOA 1D7SA 1DJEA 2R0TA 3NYUA 3WCNA 3B1EA 3ELPA 1C9CA 3II0A 4Q31A 2TPLA 2VGWA 1AAMA 3BCAA 3FTBA 4WB0B 1IAYA 2Z9VA 1OHYA 3AENA 3QI6A 3EI6A 1KAFA 4A6UA 3AELA 3A2BA 4BHDA 5F8VA 5FT8A 5LH9A 5AX8A 4F4EA 1SPAA 1B8GA 1YIYA 2BWNA 4A6RA 4WXBA 2EH6A 4F5HA 3VK3A 3QM2A 2YRIA 2A1VA 4E1OA 2F8JA 3Q8NA 4Q76A 4DGTA 3HLMA 3FZ6A 3HMUA 1DGEA 1WYUB 1LW5A 5G4JA 1B5OA 1BQDA 1SZSA 3FQAA 4R2NA 3DU4A 2V1PA 3DR4A 4XQ2A 5M4BA 1UU0A 4ADDA 1AMRA 1I48A 4MQPA 3GR9A 2BI1A 3RCHB 2VGZA 3AENB 3A9ZA 4MKKA 2CJGA 3IF2A 4WYDA 3N75A 4ZLVA 2O0RA 3R9AA 3PDBA 3ZZJA 2EYQA 1ASCA 1AMSA 4W8IA 1ARSA 1ORDA 1W3UA 2YOBA 3NRAA 4ZASA 2VGUA 4RKDA 5HHYA 5HDMA 4HVKA 3BWNA 4UHMA 3GZCA 4WYGA 3K40A 4FL0A 4H63Q 1RV3A 1M7YA 2AY4A 4NOGA 3GSBA 1M0QA 1BJ4A 3JTXA 4FFCA 3FCRA 2RFVA 4AO4A 2HP1A 3BWOA 1JS6A 1QITA 2NMPA 9AATA 3CQ5A 3NYTA 4WLJA 1BW0A 3LG0A 4WYFA 3JWBA 2W7DA 3WZFA 2PB0A 1M0OA 2V0YA 4TV7A 1AHFA 1PMOA 3E77A 3ASBA 2CY8A 1CJ0A 1BQAA 1ZC9A 2CJDA 3AATA 1CQ7A 1ASEA 1AJSB 1GEYA 2C7TA 1N8PA 3MADA 3AEJC 3FVSA 4GRXA 2D63A 1M6SA 1TOKA 1GDEA 1WYTB 1BJOA 1YJZA 2YCPA 3N4XA 3CAIA 5EQCA 1X0MA 1ASNA 2VIAA 4Q75A 4IYOA 2W7LA 5EFSA 5I92A 3RI6A 3HBXA 2Z1YA 3TQXA 4P7YA 3KGXA 1M4NA 5G0AA 4JEVA 1QJ5A 3PAAA 1N31A 4M2KA 1EJIA 3GZDA 2EGYA 2EPJA 4B98A 3HT4A 4B9BA 1AJSA 1AMQA 2HUUA 3TCMA 4OT8A 5HXXA 1SZKA 2DOUA 1ARTA 3EIBA 3HQTA 4GSAA 5G2PA 4AO9A 4XJMA 2AY1A 2VMWA 4U2HA 3RUYA 2HOYA 2GQNA 5G4IA 1V2DA 2D65A 3EZ1A 5F9SA 4JEXA 3USFA 4WYAA 2FQ6A 1TPLA 3LVKA 5BJ4A 1I41A 2JJGA 3DXWA 1WYVA 2GB3A 4KAMA 3ZRPA 4XEWA 1Z3ZA 1J04A 4ZM3A 4PFNA 2WK8A 2HOXA 4OMAA 3HVYA 2ZUKA 4KYOA 1M0PA 4JF1A 2BI5A 2GSAA 1DJ9A 3WKSA 1ASDA 1AY8A 1ARIA 5FT6A 1DGDA 2HUIA 3RBFA 2KFPA 3FZ7A 4ISYA 3A9YA 5E5IA 4BA5A 3LVMA 3B1CA 1G4XA 4WXFA 2FNIA 2JJFA 4LNJA 2VIBA 4LC3A 1D2FA 2HUFA 3A8UX 3E2YA 3EI5A 3RQ1A 4W1VA 2VGTA 3QHXA 3DXVA 5DJ9A 1X2AA 5TF5A 4AOAA 1KL1A 2W8WA 5EAAA 4CXRA 3AEMC 4K05A 1BT4A 2D64A 3N0LA 1W23A 1TARA 4MY5A 5J8QA 3KGWA 5D95A 2JG2A 1DJUA 3QGUA 1MLZA 5DB5A 1GEXA 3BB8A 3DODA 4OTLA 1ASMA 3ASAA 2FN6A 3ATHA 3F9TA 3PA9A 4A0GA 4A0HA 1U08A 1I29A 2YCTA 2CSTA 3NU8A 4F5MA 4PFFA 2CINA 4JE5A 2VMTA 3ZRQA 1G4VA 3FDDA 2W7GA 2E7IA 4GE9A 1OXPA 3ECDA 3MAUA 1FG7A 3AEPA 2JISA 4LW4A 4RAEA 1EQBA 5G2QA 3JW9A 3UE8A 3LV2A 1AJRA 5EUDA 2OGAA 2C81A 4ZWVA 3FVUA 4ZDPA 1W7LA 1CZCA 4IY7A 4XAUA 2Z1ZA 1AY4A 1B9IA 3E2ZA 1RVUA 2AEVA 3N5MA 4ITXA 3A9XA 4K2BA 4E3RA 5JAYA 1N2TA 5IWQA 3AEOA 1QZ9A 4HF8A 4E77A 3NUIA 3NDNA 4CBRA 1IX8A 1QISA 2CB1A 2W7FA 4BQ0A 3TFUA 1SF2A 2R2NA 3JZLA 2Z61A 3BCBA 1M0NA 1OHWA 1B5PA 3AEJA 4F5IA 2WK9A 3DYDA 4RLGA 3VOMA 4ADCA 2QBTA 4WD2A 1GC3A 1AAWA 1BJNA 2VYCA 3KE3A 1ASBA 1MDXA 3FKDA 5C6UA 3EI8A 2YKXA 4ATPA 3DZZA 1CS1A 1KKJA 2CANA 3JWAA 2Z9XA 4I8AA 1LC7A 3NU7A 1WYUA 1DKAA 2BI9A 3CBFA 3L8AA 2VMUA 4F5GA 4ZSYA 4JF0A 3W1HA 2JJEA 1MLYA 1FC4A 3DR7A 4IXOA 1GCKA 1TOJA 3F0HA 5FT4A 3PD6A 4RJ0A 1IAXA 1J32A 1TOEA 4MSOA 2HORA 5LHAA 1YIZA 1AIAA 1W7MA 2WK7A 2YHKA 4N0BA 3VK2A 4PVFA 2OGEA 1SFFA 3NNKA 1JS3A 2R5CB 1AMAA 1AKAA 3H14A 3T32A 2ZSMA 3MBBA 2VGVA 3QBOA 1PFFA 2O7CA 1FG3A 4RJYA 2FYFA 1BKGA 1E5FA 1D7UA 4H51A 1QJ3A 1S09A 3G7QA 2ZC0A 2E54A 5BJ3A 2YKVA 3FSLA 4F5FA 1AHGA 3PPLA 4RITA 4R5ZA 5E3KA 1IJIA 4CXQA 4ZDLA 2ZY2A 1Z7DA 1AY5A 1BJOB 3EZSA 5M46A 3D6KA 3EI7A 2CH2A 4XJOA 3QN6A 1O61A 4RIZA 5FT5A 1GC0A 1XI9A 2GMUA 2R5EA 8AATA 1AHXA 3WLXA 4WYEA 1C7NA 3UWCA 2W7KA 3PJ0A 4EU1A 1MDZA 1GC2A 1ARGA 3GBXA 3BWNC 4A6TA 3N7NA 1TASA 2ZY4A 1UKJA 2AATA 4R5FA 1KMKA 3AEMA 3MAFB 2HZPA 1GC4A 4RM1A 3LY1A 1I43A 2D5YA 1H1CA 3FQ8A 2BYJA 1WYTA 1E5EA 2VMNA 3WY7A 4A0RA 5M49A 3HL2A 3GJUA 1S06A 2VMPA 4RKCA 4AZJA 2XH1A 2Z9UA 3EI9A 1WYVB 5DJ1A 1ECXA 3VK4A 2QMAA 5K8BA 4OYTA 1CQ8A 2X5FA 2AY3A 2QLRA 4ZAHA 2ZY5A 3PGYA 1VEFA 2BYLA 1YNUA 3PDXA 4ZSWA 2QSRA 4OC9A 2C0RA 1YAAA 1MAQA 3FQ7A 4JE5D 1X29A 3FRKA 1CQ6A 1WKHA 4A72A 2DGKA 2X3LA 2BIEA 2EZ1A 3LWSA 4ZDOA 1XEYA 4Y0IA 3WKRA 1YJSA 1B4XA 1D7RA 4EB7A 4BMKA 3P6KA 1CL2A 3LVJA 2X5DA 3B8XA 4W5KA 1SVVA 4A00A
chains in the Genus database with same CATH topology
3RBLA 1AKBA 1LK9A 1KKPA 3MC6C 1O69A 1OXOA 3BN1A 4EB5A 2D7ZA 4U1TA 4W1XA 4LNMA 2FNUA 3RCHA 4IXSA 1AIBA 3LVLB 3F6TA 2FKIA 2VI8A 3HDOA 2Z67A 4KXKA 3KKIA 4JEWA 4BA4A 1VJOA 3H7FA 3NX3A 4XK1A 3MKJA 1IVRA 3ISLA 1B9HA 1ZODA 3N4SA 3IHJA 4LW2A 1IBJA 1CL1A 4W1WA 2HOZA 2VLHA 2W7JA 3GWPA 4EMYA 1S0AA 2EZ2A 2DR1A 2G6WA 2VMXA 1LC8A 4GDYA 1OHVA 4GE7A 1PMMA 1W7NA 2OATA 5EAVA 3FFRA 3MC6A 3GETA 4MQRA 2JJHA 2QB2A 1Y4IA 3B1DA 1RV4A 1LS3A 4PIWA 2BWPA 2D7YA 2PO3A 2X8UA 4MQQA 4UHOA 5EUEA 2G7JA 1TOGA 2CTZA 4L0OA 2W8TA 2QA3A 2XBNA 2BKWA 2E7UA 1GBNA 3FFHA 2VMVA 2W7HA 4ADEA 1TOIA 1VP4A 3WX9A 4DBCA 1GD9A 2W7MA 1G7XA 5E4ZA 4AZKA 3COGA 2BIGA 2D61A 4CVQA 1T3IA 2W7EA 4K2MA 4MGRA 2AEUA 2W7IA 4AH3A 1AHEA 2AY7A 2C44A 5D5SA 2QB3A 4WP0A 1BJWA 4R8DA 2Z20A 4E3QA 2ZY3A 5DX5A 2VMQA 2ZP7A 3CQ6A 2ZSLA 3K28A 1ASAA 4OBVA 3BV0A 1ARHA 3NUBA 4WB0A 4EFFA 1YJYA 3BCXA 2BWOA 3UAKA 4WBTA 1JG8A 2BI3A 2DKJA 2W8UA 1PG8A 5EUNA 2DGLA 3OP7A 3PDBB 1RVYA 2AY5A 3P1TA 2E7JA 1ASGA 2OKJA 2R5CA 7AATA 4GE4A 3VP6A 2AY9A 4WYCA 4CBSA 2CJHA 4O6ZA 2CH1A 2YKUA 4IXZA 5G09A 2GMSA 1S07A 4J5UA 4WXGA 3K7YA 4XJLA 1KMJA 4W91A 2ZYJA 1C4KA 3BC8A 4OBUA 3AV7A 1CZEA 2BI2A 1MAPA 2CFBA 2WKAA 3ACZA 3DRDA 3I16A 2PB2A 3EIAA 3WGCA 4Y0HA 2W8VA 1AICA 3ZZKA 3AOWA 1DFOA 3MAFA 4M2MA 3DC1A 2YCNA 4M2JA 2JGTA 3FVXA 4A0FA 4ATQA 3E6GA 2D66A 4JEZA 4P3MA 1O4SA 4F5LA 1V72A 3FDBA 4LNLA 1EG5A 1IX7A 1P3WA 2ORDA 2OQXA 3PIUA 4IW7A 3QPGA 2W8JA 4UOYA 4XJPA 5EIGB 1G7WA 1ELQA 4ZWMA 4OCAA 1OATA 3I5TA 3N4RA 2OKKA 4IX8A 1MDOA 1MGVA 2VMZA 3R4TA 4Q6RA 1IX6A 1V2FA 4ITGA 1YOOA 2DKBA 1UU2A 3G0TA 2AY6A 5KTBA 3BS8A 3PD6B 2VLFA 4ZM4A 1AX4A 3M5UA 3G8MA 2FM1A 1QGNA 3L44A 3I4JA 4UQVA 1KL2A 3TFTA 1ASLA 4IYOB 2BHXA 4DQ6A 2AY8A 4UHNA 4TMRA 3JU7A 4TN4A 1IUGA 3TATA 2DGMA 5EIGA 1C7OA 3WCOA 1DTYA 3EUCA 3OKSA 3W1JA 3H9XA 2VMYA 2ZJGA 3CQ4A 3FD0A 1O62A 4J8LA 2EO5A 2Z9WA 1S08A 1SZUA 1V2EA 3E2ZB 4N0WA 3AOVA 4WLHA 4ADBA 2AY2A 1LC5A 3B46A 3NYSA 2O1BA 3ELEA 1ASFA 1C7GA 2VI9A 4MKJA 3NTJA 4F5JA 2VMSA 1LW4A 3FZ8A 4JEYA 3ZRRA 1X28A 4Y0DA 3VAXA 1UU1A 2Q7WA 4K2IA 1D7VA 1ELUA 3MEBA 1H0CA 2YRRA 1C0NA 1JF9A 1GEWA 2VGSA 1TATA 1WKGA 1AHYA 3GZDC 3W1IA 1QIRA 1ZOBA 3E2FA 5M4DA 2WB6A 1WSTA 3E9KA 4F5KA 1M32A 1BS0A 4QGRA 1LKCA 2HP2A 2YKYA 3WGBA 1AKCA 2VMRA 2BIAA 4GEBA 2VMOA 1D7SA 1DJEA 2R0TA 3NYUA 3WCNA 3B1EA 3ELPA 1C9CA 3II0A 4Q31A 2TPLA 2VGWA 1AAMA 3BCAA 3FTBA 4WB0B 1IAYA 2Z9VA 1OHYA 3AENA 3QI6A 3EI6A 4A6UA 3AELA 3A2BA 4BHDA 5F8VA 5FT8A 5LH9A 5AX8A 4F4EA 1SPAA 1B8GA 1YIYA 2BWNA 4A6RA 4WXBA 2EH6A 4F5HA 3VK3A 3QM2A 2YRIA 2A1VA 4E1OA 2F8JA 3Q8NA 4Q76A 4DGTA 3HLMA 3FZ6A 3HMUA 1DGEA 1WYUB 1LW5A 5G4JA 1B5OA 1BQDA 1SZSA 3FQAA 4R2NA 3DU4A 2V1PA 3DR4A 4XQ2A 5M4BA 1UU0A 4ADDA 1AMRA 1I48A 4MQPA 3GR9A 2BI1A 3RCHB 2VGZA 3AENB 3A9ZA 4MKKA 2CJGA 3IF2A 4WYDA 3N75A 4ZLVA 2O0RA 3R9AA 3PDBA 3ZZJA 2EYQA 1ASCA 1AMSA 4W8IA 1ARSA 1ORDA 1W3UA 2YOBA 3NRAA 4ZASA 2VGUA 4RKDA 5HHYA 5HDMA 4HVKA 3BWNA 4UHMA 3GZCA 4WYGA 3K40A 4FL0A 4H63Q 1RV3A 1M7YA 2AY4A 4NOGA 3GSBA 1M0QA 1BJ4A 3JTXA 4FFCA 3FCRA 2RFVA 4AO4A 2HP1A 3BWOA 1JS6A 1QITA 2NMPA 9AATA 3CQ5A 3NYTA 4WLJA 1BW0A 3LG0A 4WYFA 3JWBA 2W7DA 3WZFA 2PB0A 1M0OA 2V0YA 4TV7A 1AHFA 1PMOA 3E77A 3ASBA 2CY8A 1CJ0A 1BQAA 1ZC9A 2CJDA 3AATA 1CQ7A 1ASEA 1AJSB 1GEYA 2C7TA 1N8PA 3MADA 3AEJC 3FVSA 4GRXA 2D63A 1M6SA 1TOKA 1GDEA 1WYTB 1BJOA 1YJZA 2YCPA 3N4XA 3CAIA 5EQCA 1X0MA 1ASNA 2VIAA 4Q75A 4IYOA 2W7LA 5EFSA 5I92A 3RI6A 3HBXA 2Z1YA 3TQXA 4P7YA 3KGXA 1M4NA 5G0AA 4JEVA 1QJ5A 3PAAA 1N31A 4M2KA 1EJIA 3GZDA 2EGYA 2EPJA 4B98A 3HT4A 4B9BA 1AJSA 1AMQA 2HUUA 3TCMA 4OT8A 5HXXA 1SZKA 2DOUA 1ARTA 3EIBA 3HQTA 4GSAA 5G2PA 4AO9A 4XJMA 2AY1A 2VMWA 4U2HA 3RUYA 2HOYA 2GQNA 5G4IA 1V2DA 2D65A 3EZ1A 5F9SA 4JEXA 3USFA 4WYAA 2FQ6A 1TPLA 3LVKA 5BJ4A 1I41A 2JJGA 3DXWA 1WYVA 2GB3A 4KAMA 3ZRPA 4XEWA 1Z3ZA 1J04A 4ZM3A 4PFNA 2WK8A 2HOXA 4OMAA 3HVYA 2ZUKA 4KYOA 1M0PA 4JF1A 2BI5A 2GSAA 1DJ9A 3WKSA 1ASDA 1AY8A 1ARIA 5FT6A 1DGDA 2HUIA 3RBFA 2KFPA 3FZ7A 4ISYA 3A9YA 5E5IA 4BA5A 3LVMA 3B1CA 1G4XA 4WXFA 2FNIA 2JJFA 4LNJA 2VIBA 4LC3A 1D2FA 2HUFA 3A8UX 3E2YA 3EI5A 3RQ1A 4W1VA 2VGTA 3QHXA 3DXVA 5DJ9A 1X2AA 5TF5A 4AOAA 1KL1A 2W8WA 5EAAA 4CXRA 3AEMC 4K05A 1BT4A 2D64A 3N0LA 1W23A 1TARA 4MY5A 5J8QA 3KGWA 5D95A 2JG2A 1DJUA 3QGUA 1MLZA 5DB5A 1GEXA 3BB8A 3DODA 4OTLA 1ASMA 3ASAA 2FN6A 3ATHA 3F9TA 3PA9A 4A0GA 4A0HA 1U08A 1I29A 2YCTA 2CSTA 3NU8A 4F5MA 4PFFA 2CINA 4JE5A 2VMTA 3ZRQA 1G4VA 3FDDA 2W7GA 2E7IA 4GE9A 1OXPA 3ECDA 3MAUA 1FG7A 3AEPA 2JISA 4LW4A 4RAEA 1EQBA 5G2QA 3JW9A 3UE8A 3LV2A 1AJRA 5EUDA 2OGAA 2C81A 4ZWVA 3FVUA 4ZDPA 1W7LA 1CZCA 4IY7A 4XAUA 2Z1ZA 1AY4A 1B9IA 3E2ZA 1RVUA 2AEVA 3N5MA 4ITXA 3A9XA 4K2BA 4E3RA 5JAYA 1N2TA 5IWQA 3AEOA 1QZ9A 4HF8A 4E77A 3NUIA 3NDNA 4CBRA 1IX8A 1QISA 2CB1A 2W7FA 4BQ0A 3TFUA 1SF2A 2R2NA 3JZLA 2Z61A 3BCBA 1M0NA 1OHWA 1B5PA 3AEJA 4F5IA 2WK9A 3DYDA 4RLGA 3VOMA 4ADCA 2QBTA 4WD2A 1GC3A 1AAWA 1BJNA 2VYCA 3KE3A 1ASBA 1MDXA 3FKDA 5C6UA 3EI8A 2YKXA 4ATPA 3DZZA 1CS1A 1KKJA 2CANA 3JWAA 2Z9XA 4I8AA 1LC7A 3NU7A 1WYUA 1DKAA 2BI9A 3CBFA 3L8AA 2VMUA 4F5GA 4ZSYA 4JF0A 3W1HA 2JJEA 1MLYA 1FC4A 3DR7A 4IXOA 1GCKA 1TOJA 3F0HA 5FT4A 3PD6A 4RJ0A 1IAXA 1J32A 1TOEA 4MSOA 2HORA 5LHAA 1YIZA 1AIAA 1W7MA 2WK7A 2YHKA 4N0BA 3VK2A 4PVFA 2OGEA 1SFFA 3NNKA 1JS3A 2R5CB 1AMAA 1AKAA 3H14A 3T32A 2ZSMA 3MBBA 2VGVA 3QBOA 1PFFA 2O7CA 1FG3A 4RJYA 2FYFA 1BKGA 1E5FA 1D7UA 4H51A 1QJ3A 1S09A 3G7QA 2ZC0A 2E54A 5BJ3A 2YKVA 3FSLA 4F5FA 1AHGA 3PPLA 4RITA 4R5ZA 5E3KA 1IJIA 4CXQA 4ZDLA 2ZY2A 1Z7DA 1AY5A 1BJOB 3EZSA 5M46A 3D6KA 3EI7A 2CH2A 4XJOA 3QN6A 1O61A 4RIZA 5FT5A 1GC0A 1XI9A 2GMUA 2R5EA 8AATA 1AHXA 3WLXA 4WYEA 1C7NA 3UWCA 2W7KA 3PJ0A 4EU1A 1MDZA 1GC2A 1ARGA 3GBXA 3BWNC 4A6TA 3N7NA 1TASA 2ZY4A 1UKJA 2AATA 4R5FA 1KMKA 3AEMA 3MAFB 2HZPA 1GC4A 4RM1A 3LY1A 1I43A 2D5YA 1H1CA 3FQ8A 2BYJA 1WYTA 1E5EA 2VMNA 3WY7A 4A0RA 5M49A 3HL2A 3GJUA 1S06A 2VMPA 4RKCA 4AZJA 2XH1A 2Z9UA 3EI9A 1WYVB 5DJ1A 1ECXA 3VK4A 2QMAA 5K8BA 4OYTA 1CQ8A 2X5FA 2AY3A 2QLRA 4ZAHA 2ZY5A 3PGYA 1VEFA 2BYLA 1YNUA 3PDXA 4ZSWA 2QSRA 4OC9A 2C0RA 1YAAA 1MAQA 3FQ7A 4JE5D 1X29A 3FRKA 1CQ6A 1WKHA 4A72A 2DGKA 2X3LA 2BIEA 2EZ1A 3LWSA 4ZDOA 1XEYA 4Y0IA 3WKRA 1YJSA 1B4XA 1D7RA 4EB7A 4BMKA 3P6KA 1CL2A 3LVJA 2X5DA 3B8XA 4W5KA 1SVVA 4A00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBL A;  1AKB A;  1LK9 A;  1KKP A;  3MC6 C;  1O69 A;  1OXO A;  3BN1 A;  4EB5 A;  2D7Z A;  4U1T A;  4W1X A;  4LNM A;  2FNU A;  3RCH A;  4IXS A;  1AIB A;  3LVL B;  3F6T A;  2VI8 A;  3HDO A;  2Z67 A;  4KXK A;  3KKI A;  4JEW A;  4BA4 A;  1VJO A;  3H7F A;  3NX3 A;  4XK1 A;  3MKJ A;  1IVR A;  3ISL A;  1B9H A;  1ZOD A;  3IHJ A;  4LW2 A;  1IBJ A;  1CL1 A;  4W1W A;  2HOZ A;  2VLH A;  2W7J A;  3GWP A;  4EMY A;  1S0A A;  2EZ2 A;  2DR1 A;  2G6W A;  2VMX A;  1LC8 A;  4GDY A;  1OHV A;  4GE7 A;  1PMM A;  1W7N A;  2OAT A;  5EAV A;  3FFR A;  3MC6 A;  3GET A;  4MQR A;  2JJH A;  2QB2 A;  1Y4I A;  3B1D A;  1RV4 A;  1LS3 A;  4PIW A;  2BWP A;  2D7Y A;  2PO3 A;  2X8U A;  4MQQ A;  4UHO A;  5EUE A;  1TOG A;  2CTZ A;  4L0O A;  2W8T A;  2QA3 A;  2XBN A;  2BKW A;  2E7U A;  1GBN A;  3FFH A;  2VMV A;  2W7H A;  4ADE A;  1TOI A;  1VP4 A;  3WX9 A;  4DBC A;  1GD9 A;  2W7M A;  1G7X A;  5E4Z A;  4AZK A;  3COG A;  2BIG A;  2D61 A;  4CVQ A;  1T3I A;  2W7E A;  4K2M A;  4MGR A;  2AEU A;  2W7I A;  4AH3 A;  1AHE A;  2AY7 A;  2C44 A;  5D5S A;  2QB3 A;  4WP0 A;  1BJW A;  4R8D A;  2Z20 A;  4E3Q A;  2ZY3 A;  5DX5 A;  2VMQ A;  2ZP7 A;  3CQ6 A;  2ZSL A;  3K28 A;  1ASA A;  4OBV A;  3BV0 A;  1ARH A;  3NUB A;  4WB0 A;  4EFF A;  1YJY A;  3BCX A;  2BWO A;  3UAK A;  4WBT A;  1JG8 A;  2BI3 A;  2DKJ A;  2W8U A;  1PG8 A;  5EUN A;  2DGL A;  3OP7 A;  3PDB B;  1RVY A;  2AY5 A;  3P1T A;  2E7J A;  1ASG A;  2OKJ A;  2R5C A;  7AAT A;  4GE4 A;  3VP6 A;  2AY9 A;  4WYC A;  4CBS A;  2CJH A;  4O6Z A;  2CH1 A;  2YKU A;  4IXZ A;  5G09 A;  2GMS A;  1S07 A;  4J5U A;  4WXG A;  3K7Y A;  4XJL A;  1KMJ A;  4W91 A;  2ZYJ A;  1C4K A;  3BC8 A;  4OBU A;  3AV7 A;  1CZE A;  2BI2 A;  1MAP A;  2CFB A;  2WKA A;  3ACZ A;  3DRD A;  3I16 A;  2PB2 A;  3EIA A;  3WGC A;  4Y0H A;  2W8V A;  1AIC A;  3ZZK A;  3AOW A;  1DFO A;  3MAF A;  4M2M A;  3DC1 A;  2YCN A;  4M2J A;  2JGT A;  3FVX A;  4A0F A;  4ATQ A;  3E6G A;  2D66 A;  4JEZ A;  4P3M A;  1O4S A;  4F5L A;  1V72 A;  3FDB A;  4LNL A;  1EG5 A;  1IX7 A;  1P3W A;  2ORD A;  2OQX A;  3PIU A;  4IW7 A;  3QPG A;  2W8J A;  4UOY A;  4XJP A;  5EIG B;  1G7W A;  1ELQ A;  4ZWM A;  4OCA A;  1OAT A;  3I5T A;  2OKK A;  4IX8 A;  1MDO A;  1MGV A;  2VMZ A;  3R4T A;  4Q6R A;  1IX6 A;  1V2F A;  4ITG A;  1YOO A;  2DKB A;  1UU2 A;  3G0T A;  2AY6 A;  3BS8 A;  3PD6 B;  2VLF A;  4ZM4 A;  1AX4 A;  3M5U A;  3G8M A;  2FM1 A;  1QGN A;  3L44 A;  3I4J A;  4UQV A;  1KL2 A;  3TFT A;  1ASL A;  4IYO B;  2BHX A;  4DQ6 A;  2AY8 A;  4UHN A;  4TMR A;  3JU7 A;  4TN4 A;  1IUG A;  3TAT A;  2DGM A;  5EIG A;  1C7O A;  3WCO A;  1DTY A;  3EUC A;  3OKS A;  3W1J A;  2VMY A;  2ZJG A;  3CQ4 A;  3FD0 A;  1O62 A;  4J8L A;  2EO5 A;  2Z9W A;  1S08 A;  1SZU A;  1V2E A;  3E2Z B;  4N0W A;  3AOV A;  4WLH A;  4ADB A;  2AY2 A;  1LC5 A;  3B46 A;  3NYS A;  2O1B A;  3ELE A;  1ASF A;  1C7G A;  2VI9 A;  4MKJ A;  3NTJ A;  4F5J A;  2VMS A;  1LW4 A;  3FZ8 A;  4JEY A;  3ZRR A;  1X28 A;  4Y0D A;  3VAX A;  1UU1 A;  2Q7W A;  4K2I A;  1D7V A;  1ELU A;  3MEB A;  1H0C A;  2YRR A;  1C0N A;  1JF9 A;  1GEW A;  2VGS A;  1TAT A;  1WKG A;  1AHY A;  3GZD C;  3W1I A;  1QIR A;  1ZOB A;  3E2F A;  5M4D A;  1WST A;  3E9K A;  4F5K A;  1M32 A;  1BS0 A;  4QGR A;  1LKC A;  2HP2 A;  2YKY A;  3WGB A;  1AKC A;  2VMR A;  2BIA A;  4GEB A;  2VMO A;  1D7S A;  1DJE A;  2R0T A;  3NYU A;  3WCN A;  3B1E A;  3ELP A;  1C9C A;  3II0 A;  4Q31 A;  2TPL A;  2VGW A;  1AAM A;  3BCA A;  3FTB A;  4WB0 B;  1IAY A;  2Z9V A;  1OHY A;  3AEN A;  3QI6 A;  3EI6 A;  4A6U A;  3AEL A;  3A2B A;  4BHD A;  5F8V A;  5FT8 A;  5LH9 A;  5AX8 A;  4F4E A;  1SPA A;  1B8G A;  1YIY A;  2BWN A;  4A6R A;  4WXB A;  2EH6 A;  4F5H A;  3VK3 A;  3QM2 A;  2YRI A;  4E1O A;  2F8J A;  3Q8N A;  4Q76 A;  4DGT A;  3HLM A;  3FZ6 A;  3HMU A;  1DGE A;  1WYU B;  1LW5 A;  5G4J A;  1B5O A;  1BQD A;  1SZS A;  3FQA A;  4R2N A;  3DU4 A;  2V1P A;  3DR4 A;  4XQ2 A;  5M4B A;  1UU0 A;  4ADD A;  1AMR A;  1I48 A;  4MQP A;  3GR9 A;  2BI1 A;  3RCH B;  2VGZ A;  3AEN B;  3A9Z A;  4MKK A;  2CJG A;  3IF2 A;  4WYD A;  3N75 A;  4ZLV A;  2O0R A;  3R9A A;  3PDB A;  3ZZJ A;  1ASC A;  1AMS A;  4W8I A;  1ARS A;  1ORD A;  1W3U A;  2YOB A;  3NRA A;  4ZAS A;  2VGU A;  4RKD A;  5HHY A;  5HDM A;  4HVK A;  3BWN A;  4UHM A;  3GZC A;  4WYG A;  3K40 A;  4FL0 A;  1RV3 A;  1M7Y A;  2AY4 A;  4NOG A;  3GSB A;  1M0Q A;  1BJ4 A;  3JTX A;  4FFC A;  3FCR A;  2RFV A;  4AO4 A;  2HP1 A;  3BWO A;  1JS6 A;  1QIT A;  2NMP A;  9AAT A;  3CQ5 A;  3NYT A;  4WLJ A;  1BW0 A;  3LG0 A;  4WYF A;  3JWB A;  2W7D A;  3WZF A;  2PB0 A;  1M0O A;  2V0Y A;  4TV7 A;  1AHF A;  1PMO A;  3E77 A;  3ASB A;  2CY8 A;  1CJ0 A;  1BQA A;  1ZC9 A;  2CJD A;  3AAT A;  1CQ7 A;  1ASE A;  1AJS B;  1GEY A;  2C7T A;  1N8P A;  3MAD A;  3AEJ C;  3FVS A;  4GRX A;  2D63 A;  1M6S A;  1TOK A;  1GDE A;  1WYT B;  1BJO A;  1YJZ A;  2YCP A;  3CAI A;  5EQC A;  1X0M A;  1ASN A;  2VIA A;  4Q75 A;  4IYO A;  2W7L A;  5EFS A;  5I92 A;  3RI6 A;  3HBX A;  2Z1Y A;  3TQX A;  4P7Y A;  3KGX A;  1M4N A;  5G0A A;  4JEV A;  1QJ5 A;  3PAA A;  1N31 A;  4M2K A;  1EJI A;  3GZD A;  2EGY A;  2EPJ A;  4B98 A;  3HT4 A;  4B9B A;  1AJS A;  1AMQ A;  2HUU A;  3TCM A;  4OT8 A;  5HXX A;  1SZK A;  2DOU A;  1ART A;  3EIB A;  3HQT A;  4GSA A;  5G2P A;  4AO9 A;  4XJM A;  2AY1 A;  2VMW A;  4U2H A;  3RUY A;  2HOY A;  2GQN A;  5G4I A;  1V2D A;  2D65 A;  3EZ1 A;  5F9S A;  4JEX A;  3USF A;  4WYA A;  2FQ6 A;  1TPL A;  3LVK A;  5BJ4 A;  1I41 A;  2JJG A;  3DXW A;  1WYV A;  2GB3 A;  4KAM A;  3ZRP A;  4XEW A;  1Z3Z A;  1J04 A;  4ZM3 A;  4PFN A;  2WK8 A;  2HOX A;  4OMA A;  3HVY A;  2ZUK A;  4KYO A;  1M0P A;  4JF1 A;  2BI5 A;  2GSA A;  1DJ9 A;  3WKS A;  1ASD A;  1AY8 A;  1ARI A;  5FT6 A;  1DGD A;  2HUI A;  3RBF A;  3FZ7 A;  4ISY A;  3A9Y A;  5E5I A;  4BA5 A;  3LVM A;  3B1C A;  1G4X A;  4WXF A;  2FNI A;  2JJF A;  4LNJ A;  2VIB A;  4LC3 A;  1D2F A;  2HUF A;  3A8U X;  3E2Y A;  3EI5 A;  3RQ1 A;  4W1V A;  2VGT A;  3QHX A;  3DXV A;  5DJ9 A;  1X2A A;  5TF5 A;  4AOA A;  1KL1 A;  2W8W A;  5EAA A;  4CXR A;  3AEM C;  1BT4 A;  2D64 A;  3N0L A;  1W23 A;  1TAR A;  4MY5 A;  5J8Q A;  3KGW A;  5D95 A;  2JG2 A;  1DJU A;  3QGU A;  1MLZ A;  5DB5 A;  1GEX A;  3BB8 A;  3DOD A;  4OTL A;  1ASM A;  3ASA A;  2FN6 A;  3ATH A;  3F9T A;  3PA9 A;  4A0G A;  4A0H A;  1U08 A;  1I29 A;  2YCT A;  2CST A;  3NU8 A;  4F5M A;  4PFF A;  2CIN A;  4JE5 A;  2VMT A;  3ZRQ A;  1G4V A;  3FDD A;  2W7G A;  2E7I A;  4GE9 A;  1OXP A;  3ECD A;  3MAU A;  1FG7 A;  3AEP A;  2JIS A;  4LW4 A;  4RAE A;  1EQB A;  5G2Q A;  3JW9 A;  3UE8 A;  3LV2 A;  1AJR A;  5EUD A;  2OGA A;  2C81 A;  4ZWV A;  3FVU A;  4ZDP A;  1W7L A;  1CZC A;  4IY7 A;  4XAU A;  2Z1Z A;  1AY4 A;  1B9I A;  3E2Z A;  1RVU A;  2AEV A;  3N5M A;  4ITX A;  3A9X A;  4K2B A;  4E3R A;  5JAY A;  1N2T A;  5IWQ A;  3AEO A;  1QZ9 A;  4HF8 A;  4E77 A;  3NUI A;  3NDN A;  4CBR A;  1IX8 A;  1QIS A;  2CB1 A;  2W7F A;  4BQ0 A;  3TFU A;  1SF2 A;  2R2N A;  3JZL A;  2Z61 A;  3BCB A;  1M0N A;  1OHW A;  1B5P A;  3AEJ A;  4F5I A;  2WK9 A;  3DYD A;  4RLG A;  3VOM A;  4ADC A;  2QBT A;  4WD2 A;  1GC3 A;  1AAW A;  1BJN A;  2VYC A;  3KE3 A;  1ASB A;  1MDX A;  3FKD A;  5C6U A;  3EI8 A;  2YKX A;  4ATP A;  3DZZ A;  1CS1 A;  1KKJ A;  2CAN A;  3JWA A;  2Z9X A;  4I8A A;  1LC7 A;  3NU7 A;  1WYU A;  1DKA A;  2BI9 A;  3CBF A;  3L8A A;  2VMU A;  4F5G A;  4ZSY A;  4JF0 A;  3W1H A;  2JJE A;  1MLY A;  1FC4 A;  3DR7 A;  4IXO A;  1GCK A;  1TOJ A;  3F0H A;  5FT4 A;  3PD6 A;  4RJ0 A;  1IAX A;  1J32 A;  1TOE A;  4MSO A;  2HOR A;  5LHA A;  1YIZ A;  1AIA A;  1W7M A;  2WK7 A;  2YHK A;  4N0B A;  3VK2 A;  4PVF A;  2OGE A;  1SFF A;  3NNK A;  1JS3 A;  2R5C B;  1AMA A;  1AKA A;  3H14 A;  3T32 A;  2ZSM A;  3MBB A;  2VGV A;  3QBO A;  1PFF A;  2O7C A;  1FG3 A;  4RJY A;  2FYF A;  1BKG A;  1E5F A;  1D7U A;  4H51 A;  1QJ3 A;  1S09 A;  3G7Q A;  2ZC0 A;  2E54 A;  5BJ3 A;  2YKV A;  3FSL A;  4F5F A;  1AHG A;  3PPL A;  4RIT A;  4R5Z A;  5E3K A;  1IJI A;  4CXQ A;  4ZDL A;  2ZY2 A;  1Z7D A;  1AY5 A;  1BJO B;  3EZS A;  5M46 A;  3D6K A;  3EI7 A;  2CH2 A;  4XJO A;  3QN6 A;  1O61 A;  4RIZ A;  5FT5 A;  1GC0 A;  1XI9 A;  2GMU A;  2R5E A;  8AAT A;  1AHX A;  3WLX A;  4WYE A;  1C7N A;  3UWC A;  2W7K A;  3PJ0 A;  4EU1 A;  1MDZ A;  1GC2 A;  1ARG A;  3GBX A;  3BWN C;  4A6T A;  1TAS A;  2ZY4 A;  1UKJ A;  2AAT A;  4R5F A;  1KMK A;  3AEM A;  3MAF B;  2HZP A;  1GC4 A;  4RM1 A;  3LY1 A;  1I43 A;  2D5Y A;  1H1C A;  3FQ8 A;  2BYJ A;  1WYT A;  1E5E A;  2VMN A;  3WY7 A;  4A0R A;  5M49 A;  3HL2 A;  3GJU A;  1S06 A;  2VMP A;  4RKC A;  4AZJ A;  2XH1 A;  2Z9U A;  3EI9 A;  1WYV B;  5DJ1 A;  1ECX A;  3VK4 A;  2QMA A;  5K8B A;  4OYT A;  1CQ8 A;  2X5F A;  2AY3 A;  2QLR A;  4ZAH A;  2ZY5 A;  3PGY A;  1VEF A;  2BYL A;  1YNU A;  3PDX A;  4ZSW A;  4OC9 A;  2C0R A;  1YAA A;  1MAQ A;  3FQ7 A;  4JE5 D;  1X29 A;  3FRK A;  1CQ6 A;  1WKH A;  4A72 A;  2DGK A;  2X3L A;  2BIE A;  2EZ1 A;  3LWS A;  4ZDO A;  1XEY A;  4Y0I A;  3WKR A;  1YJS A;  1B4X A;  1D7R A;  4EB7 A;  4BMK A;  3P6K A;  1CL2 A;  3LVJ A;  2X5D A;  3B8X A;  4W5K A;  1SVV A;  4A00 A; 
#chains in the Genus database with same CATH topology
 3RBL A;  1AKB A;  1LK9 A;  1KKP A;  3MC6 C;  1O69 A;  1OXO A;  3BN1 A;  4EB5 A;  2D7Z A;  4U1T A;  4W1X A;  4LNM A;  2FNU A;  3RCH A;  4IXS A;  1AIB A;  3LVL B;  3F6T A;  2FKI A;  2VI8 A;  3HDO A;  2Z67 A;  4KXK A;  3KKI A;  4JEW A;  4BA4 A;  1VJO A;  3H7F A;  3NX3 A;  4XK1 A;  3MKJ A;  1IVR A;  3ISL A;  1B9H A;  1ZOD A;  3N4S A;  3IHJ A;  4LW2 A;  1IBJ A;  1CL1 A;  4W1W A;  2HOZ A;  2VLH A;  2W7J A;  3GWP A;  4EMY A;  1S0A A;  2EZ2 A;  2DR1 A;  2G6W A;  2VMX A;  1LC8 A;  4GDY A;  1OHV A;  4GE7 A;  1PMM A;  1W7N A;  2OAT A;  5EAV A;  3FFR A;  3MC6 A;  3GET A;  4MQR A;  2JJH A;  2QB2 A;  1Y4I A;  3B1D A;  1RV4 A;  1LS3 A;  4PIW A;  2BWP A;  2D7Y A;  2PO3 A;  2X8U A;  4MQQ A;  4UHO A;  5EUE A;  2G7J A;  1TOG A;  2CTZ A;  4L0O A;  2W8T A;  2QA3 A;  2XBN A;  2BKW A;  2E7U A;  1GBN A;  3FFH A;  2VMV A;  2W7H A;  4ADE A;  1TOI A;  1VP4 A;  3WX9 A;  4DBC A;  1GD9 A;  2W7M A;  1G7X A;  5E4Z A;  4AZK A;  3COG A;  2BIG A;  2D61 A;  4CVQ A;  1T3I A;  2W7E A;  4K2M A;  4MGR A;  2AEU A;  2W7I A;  4AH3 A;  1AHE A;  2AY7 A;  2C44 A;  5D5S A;  2QB3 A;  4WP0 A;  1BJW A;  4R8D A;  2Z20 A;  4E3Q A;  2ZY3 A;  5DX5 A;  2VMQ A;  2ZP7 A;  3CQ6 A;  2ZSL A;  3K28 A;  1ASA A;  4OBV A;  3BV0 A;  1ARH A;  3NUB A;  4WB0 A;  4EFF A;  1YJY A;  3BCX A;  2BWO A;  3UAK A;  4WBT A;  1JG8 A;  2BI3 A;  2DKJ A;  2W8U A;  1PG8 A;  5EUN A;  2DGL A;  3OP7 A;  3PDB B;  1RVY A;  2AY5 A;  3P1T A;  2E7J A;  1ASG A;  2OKJ A;  2R5C A;  7AAT A;  4GE4 A;  3VP6 A;  2AY9 A;  4WYC A;  4CBS A;  2CJH A;  4O6Z A;  2CH1 A;  2YKU A;  4IXZ A;  5G09 A;  2GMS A;  1S07 A;  4J5U A;  4WXG A;  3K7Y A;  4XJL A;  1KMJ A;  4W91 A;  2ZYJ A;  1C4K A;  3BC8 A;  4OBU A;  3AV7 A;  1CZE A;  2BI2 A;  1MAP A;  2CFB A;  2WKA A;  3ACZ A;  3DRD A;  3I16 A;  2PB2 A;  3EIA A;  3WGC A;  4Y0H A;  2W8V A;  1AIC A;  3ZZK A;  3AOW A;  1DFO A;  3MAF A;  4M2M A;  3DC1 A;  2YCN A;  4M2J A;  2JGT A;  3FVX A;  4A0F A;  4ATQ A;  3E6G A;  2D66 A;  4JEZ A;  4P3M A;  1O4S A;  4F5L A;  1V72 A;  3FDB A;  4LNL A;  1EG5 A;  1IX7 A;  1P3W A;  2ORD A;  2OQX A;  3PIU A;  4IW7 A;  3QPG A;  2W8J A;  4UOY A;  4XJP A;  5EIG B;  1G7W A;  1ELQ A;  4ZWM A;  4OCA A;  1OAT A;  3I5T A;  3N4R A;  2OKK A;  4IX8 A;  1MDO A;  1MGV A;  2VMZ A;  3R4T A;  4Q6R A;  1IX6 A;  1V2F A;  4ITG A;  1YOO A;  2DKB A;  1UU2 A;  3G0T A;  2AY6 A;  5KTB A;  3BS8 A;  3PD6 B;  2VLF A;  4ZM4 A;  1AX4 A;  3M5U A;  3G8M A;  2FM1 A;  1QGN A;  3L44 A;  3I4J A;  4UQV A;  1KL2 A;  3TFT A;  1ASL A;  4IYO B;  2BHX A;  4DQ6 A;  2AY8 A;  4UHN A;  4TMR A;  3JU7 A;  4TN4 A;  1IUG A;  3TAT A;  2DGM A;  5EIG A;  1C7O A;  3WCO A;  1DTY A;  3EUC A;  3OKS A;  3W1J A;  3H9X A;  2VMY A;  2ZJG A;  3CQ4 A;  3FD0 A;  1O62 A;  4J8L A;  2EO5 A;  2Z9W A;  1S08 A;  1SZU A;  1V2E A;  3E2Z B;  4N0W A;  3AOV A;  4WLH A;  4ADB A;  2AY2 A;  1LC5 A;  3B46 A;  3NYS A;  2O1B A;  3ELE A;  1ASF A;  1C7G A;  2VI9 A;  4MKJ A;  3NTJ A;  4F5J A;  2VMS A;  1LW4 A;  3FZ8 A;  4JEY A;  3ZRR A;  1X28 A;  4Y0D A;  3VAX A;  1UU1 A;  2Q7W A;  4K2I A;  1D7V A;  1ELU A;  3MEB A;  1H0C A;  2YRR A;  1C0N A;  1JF9 A;  1GEW A;  2VGS A;  1TAT A;  1WKG A;  1AHY A;  3GZD C;  3W1I A;  1QIR A;  1ZOB A;  3E2F A;  5M4D A;  2WB6 A;  1WST A;  3E9K A;  4F5K A;  1M32 A;  1BS0 A;  4QGR A;  1LKC A;  2HP2 A;  2YKY A;  3WGB A;  1AKC A;  2VMR A;  2BIA A;  4GEB A;  2VMO A;  1D7S A;  1DJE A;  2R0T A;  3NYU A;  3WCN A;  3B1E A;  3ELP A;  1C9C A;  3II0 A;  4Q31 A;  2TPL A;  2VGW A;  1AAM A;  3BCA A;  3FTB A;  4WB0 B;  1IAY A;  2Z9V A;  1OHY A;  3AEN A;  3QI6 A;  3EI6 A;  1KAF A;  4A6U A;  3AEL A;  3A2B A;  4BHD A;  5F8V A;  5FT8 A;  5LH9 A;  5AX8 A;  4F4E A;  1SPA A;  1B8G A;  1YIY A;  2BWN A;  4A6R A;  4WXB A;  2EH6 A;  4F5H A;  3VK3 A;  3QM2 A;  2YRI A;  2A1V A;  4E1O A;  2F8J A;  3Q8N A;  4Q76 A;  4DGT A;  3HLM A;  3FZ6 A;  3HMU A;  1DGE A;  1WYU B;  1LW5 A;  5G4J A;  1B5O A;  1BQD A;  1SZS A;  3FQA A;  4R2N A;  3DU4 A;  2V1P A;  3DR4 A;  4XQ2 A;  5M4B A;  1UU0 A;  4ADD A;  1AMR A;  1I48 A;  4MQP A;  3GR9 A;  2BI1 A;  3RCH B;  2VGZ A;  3AEN B;  3A9Z A;  4MKK A;  2CJG A;  3IF2 A;  4WYD A;  3N75 A;  4ZLV A;  2O0R A;  3R9A A;  3PDB A;  3ZZJ A;  2EYQ A;  1ASC A;  1AMS A;  4W8I A;  1ARS A;  1ORD A;  1W3U A;  2YOB A;  3NRA A;  4ZAS A;  2VGU A;  4RKD A;  5HHY A;  5HDM A;  4HVK A;  3BWN A;  4UHM A;  3GZC A;  4WYG A;  3K40 A;  4FL0 A;  4H63 Q;  1RV3 A;  1M7Y A;  2AY4 A;  4NOG A;  3GSB A;  1M0Q A;  1BJ4 A;  3JTX A;  4FFC A;  3FCR A;  2RFV A;  4AO4 A;  2HP1 A;  3BWO A;  1JS6 A;  1QIT A;  2NMP A;  9AAT A;  3CQ5 A;  3NYT A;  4WLJ A;  1BW0 A;  3LG0 A;  4WYF A;  3JWB A;  2W7D A;  3WZF A;  2PB0 A;  1M0O A;  2V0Y A;  4TV7 A;  1AHF A;  1PMO A;  3E77 A;  3ASB A;  2CY8 A;  1CJ0 A;  1BQA A;  1ZC9 A;  2CJD A;  3AAT A;  1CQ7 A;  1ASE A;  1AJS B;  1GEY A;  2C7T A;  1N8P A;  3MAD A;  3AEJ C;  3FVS A;  4GRX A;  2D63 A;  1M6S A;  1TOK A;  1GDE A;  1WYT B;  1BJO A;  1YJZ A;  2YCP A;  3N4X A;  3CAI A;  5EQC A;  1X0M A;  1ASN A;  2VIA A;  4Q75 A;  4IYO A;  2W7L A;  5EFS A;  5I92 A;  3RI6 A;  3HBX A;  2Z1Y A;  3TQX A;  4P7Y A;  3KGX A;  1M4N A;  5G0A A;  4JEV A;  1QJ5 A;  3PAA A;  1N31 A;  4M2K A;  1EJI A;  3GZD A;  2EGY A;  2EPJ A;  4B98 A;  3HT4 A;  4B9B A;  1AJS A;  1AMQ A;  2HUU A;  3TCM A;  4OT8 A;  5HXX A;  1SZK A;  2DOU A;  1ART A;  3EIB A;  3HQT A;  4GSA A;  5G2P A;  4AO9 A;  4XJM A;  2AY1 A;  2VMW A;  4U2H A;  3RUY A;  2HOY A;  2GQN A;  5G4I A;  1V2D A;  2D65 A;  3EZ1 A;  5F9S A;  4JEX A;  3USF A;  4WYA A;  2FQ6 A;  1TPL A;  3LVK A;  5BJ4 A;  1I41 A;  2JJG A;  3DXW A;  1WYV A;  2GB3 A;  4KAM A;  3ZRP A;  4XEW A;  1Z3Z A;  1J04 A;  4ZM3 A;  4PFN A;  2WK8 A;  2HOX A;  4OMA A;  3HVY A;  2ZUK A;  4KYO A;  1M0P A;  4JF1 A;  2BI5 A;  2GSA A;  1DJ9 A;  3WKS A;  1ASD A;  1AY8 A;  1ARI A;  5FT6 A;  1DGD A;  2HUI A;  3RBF A;  2KFP A;  3FZ7 A;  4ISY A;  3A9Y A;  5E5I A;  4BA5 A;  3LVM A;  3B1C A;  1G4X A;  4WXF A;  2FNI A;  2JJF A;  4LNJ A;  2VIB A;  4LC3 A;  1D2F A;  2HUF A;  3A8U X;  3E2Y A;  3EI5 A;  3RQ1 A;  4W1V A;  2VGT A;  3QHX A;  3DXV A;  5DJ9 A;  1X2A A;  5TF5 A;  4AOA A;  1KL1 A;  2W8W A;  5EAA A;  4CXR A;  3AEM C;  4K05 A;  1BT4 A;  2D64 A;  3N0L A;  1W23 A;  1TAR A;  4MY5 A;  5J8Q A;  3KGW A;  5D95 A;  2JG2 A;  1DJU A;  3QGU A;  1MLZ A;  5DB5 A;  1GEX A;  3BB8 A;  3DOD A;  4OTL A;  1ASM A;  3ASA A;  2FN6 A;  3ATH A;  3F9T A;  3PA9 A;  4A0G A;  4A0H A;  1U08 A;  1I29 A;  2YCT A;  2CST A;  3NU8 A;  4F5M A;  4PFF A;  2CIN A;  4JE5 A;  2VMT A;  3ZRQ A;  1G4V A;  3FDD A;  2W7G A;  2E7I A;  4GE9 A;  1OXP A;  3ECD A;  3MAU A;  1FG7 A;  3AEP A;  2JIS A;  4LW4 A;  4RAE A;  1EQB A;  5G2Q A;  3JW9 A;  3UE8 A;  3LV2 A;  1AJR A;  5EUD A;  2OGA A;  2C81 A;  4ZWV A;  3FVU A;  4ZDP A;  1W7L A;  1CZC A;  4IY7 A;  4XAU A;  2Z1Z A;  1AY4 A;  1B9I A;  3E2Z A;  1RVU A;  2AEV A;  3N5M A;  4ITX A;  3A9X A;  4K2B A;  4E3R A;  5JAY A;  1N2T A;  5IWQ A;  3AEO A;  1QZ9 A;  4HF8 A;  4E77 A;  3NUI A;  3NDN A;  4CBR A;  1IX8 A;  1QIS A;  2CB1 A;  2W7F A;  4BQ0 A;  3TFU A;  1SF2 A;  2R2N A;  3JZL A;  2Z61 A;  3BCB A;  1M0N A;  1OHW A;  1B5P A;  3AEJ A;  4F5I A;  2WK9 A;  3DYD A;  4RLG A;  3VOM A;  4ADC A;  2QBT A;  4WD2 A;  1GC3 A;  1AAW A;  1BJN A;  2VYC A;  3KE3 A;  1ASB A;  1MDX A;  3FKD A;  5C6U A;  3EI8 A;  2YKX A;  4ATP A;  3DZZ A;  1CS1 A;  1KKJ A;  2CAN A;  3JWA A;  2Z9X A;  4I8A A;  1LC7 A;  3NU7 A;  1WYU A;  1DKA A;  2BI9 A;  3CBF A;  3L8A A;  2VMU A;  4F5G A;  4ZSY A;  4JF0 A;  3W1H A;  2JJE A;  1MLY A;  1FC4 A;  3DR7 A;  4IXO A;  1GCK A;  1TOJ A;  3F0H A;  5FT4 A;  3PD6 A;  4RJ0 A;  1IAX A;  1J32 A;  1TOE A;  4MSO A;  2HOR A;  5LHA A;  1YIZ A;  1AIA A;  1W7M A;  2WK7 A;  2YHK A;  4N0B A;  3VK2 A;  4PVF A;  2OGE A;  1SFF A;  3NNK A;  1JS3 A;  2R5C B;  1AMA A;  1AKA A;  3H14 A;  3T32 A;  2ZSM A;  3MBB A;  2VGV A;  3QBO A;  1PFF A;  2O7C A;  1FG3 A;  4RJY A;  2FYF A;  1BKG A;  1E5F A;  1D7U A;  4H51 A;  1QJ3 A;  1S09 A;  3G7Q A;  2ZC0 A;  2E54 A;  5BJ3 A;  2YKV A;  3FSL A;  4F5F A;  1AHG A;  3PPL A;  4RIT A;  4R5Z A;  5E3K A;  1IJI A;  4CXQ A;  4ZDL A;  2ZY2 A;  1Z7D A;  1AY5 A;  1BJO B;  3EZS A;  5M46 A;  3D6K A;  3EI7 A;  2CH2 A;  4XJO A;  3QN6 A;  1O61 A;  4RIZ A;  5FT5 A;  1GC0 A;  1XI9 A;  2GMU A;  2R5E A;  8AAT A;  1AHX A;  3WLX A;  4WYE A;  1C7N A;  3UWC A;  2W7K A;  3PJ0 A;  4EU1 A;  1MDZ A;  1GC2 A;  1ARG A;  3GBX A;  3BWN C;  4A6T A;  3N7N A;  1TAS A;  2ZY4 A;  1UKJ A;  2AAT A;  4R5F A;  1KMK A;  3AEM A;  3MAF B;  2HZP A;  1GC4 A;  4RM1 A;  3LY1 A;  1I43 A;  2D5Y A;  1H1C A;  3FQ8 A;  2BYJ A;  1WYT A;  1E5E A;  2VMN A;  3WY7 A;  4A0R A;  5M49 A;  3HL2 A;  3GJU A;  1S06 A;  2VMP A;  4RKC A;  4AZJ A;  2XH1 A;  2Z9U A;  3EI9 A;  1WYV B;  5DJ1 A;  1ECX A;  3VK4 A;  2QMA A;  5K8B A;  4OYT A;  1CQ8 A;  2X5F A;  2AY3 A;  2QLR A;  4ZAH A;  2ZY5 A;  3PGY A;  1VEF A;  2BYL A;  1YNU A;  3PDX A;  4ZSW A;  2QSR A;  4OC9 A;  2C0R A;  1YAA A;  1MAQ A;  3FQ7 A;  4JE5 D;  1X29 A;  3FRK A;  1CQ6 A;  1WKH A;  4A72 A;  2DGK A;  2X3L A;  2BIE A;  2EZ1 A;  3LWS A;  4ZDO A;  1XEY A;  4Y0I A;  3WKR A;  1YJS A;  1B4X A;  1D7R A;  4EB7 A;  4BMK A;  3P6K A;  1CL2 A;  3LVJ A;  2X5D A;  3B8X A;  4W5K A;  1SVV A;  4A00 A; 
#chains in the Genus database with same CATH homology
 3RBL A;  1AKB A;  1LK9 A;  1KKP A;  3MC6 C;  1O69 A;  1OXO A;  3BN1 A;  4EB5 A;  2D7Z A;  4U1T A;  4W1X A;  4LNM A;  2FNU A;  3RCH A;  4IXS A;  1AIB A;  3LVL B;  3F6T A;  2FKI A;  2VI8 A;  3HDO A;  2Z67 A;  4KXK A;  3KKI A;  4JEW A;  4BA4 A;  1VJO A;  3H7F A;  3NX3 A;  4XK1 A;  3MKJ A;  1IVR A;  3ISL A;  1B9H A;  1ZOD A;  3N4S A;  3IHJ A;  4LW2 A;  1IBJ A;  1CL1 A;  4W1W A;  2HOZ A;  2VLH A;  2W7J A;  3GWP A;  4EMY A;  1S0A A;  2EZ2 A;  2DR1 A;  2G6W A;  2VMX A;  1LC8 A;  4GDY A;  1OHV A;  4GE7 A;  1PMM A;  1W7N A;  2OAT A;  5EAV A;  3FFR A;  3MC6 A;  3GET A;  4MQR A;  2JJH A;  2QB2 A;  1Y4I A;  3B1D A;  1RV4 A;  1LS3 A;  4PIW A;  2BWP A;  2D7Y A;  2PO3 A;  2X8U A;  4MQQ A;  4UHO A;  5EUE A;  2G7J A;  1TOG A;  2CTZ A;  4L0O A;  2W8T A;  2QA3 A;  2XBN A;  2BKW A;  2E7U A;  1GBN A;  3FFH A;  2VMV A;  2W7H A;  4ADE A;  1TOI A;  1VP4 A;  3WX9 A;  4DBC A;  1GD9 A;  2W7M A;  1G7X A;  5E4Z A;  4AZK A;  3COG A;  2BIG A;  2D61 A;  4CVQ A;  1T3I A;  2W7E A;  4K2M A;  4MGR A;  2AEU A;  2W7I A;  4AH3 A;  1AHE A;  2AY7 A;  2C44 A;  5D5S A;  2QB3 A;  4WP0 A;  1BJW A;  4R8D A;  2Z20 A;  4E3Q A;  2ZY3 A;  5DX5 A;  2VMQ A;  2ZP7 A;  3CQ6 A;  2ZSL A;  3K28 A;  1ASA A;  4OBV A;  3BV0 A;  1ARH A;  3NUB A;  4WB0 A;  4EFF A;  1YJY A;  3BCX A;  2BWO A;  3UAK A;  4WBT A;  1JG8 A;  2BI3 A;  2DKJ A;  2W8U A;  1PG8 A;  5EUN A;  2DGL A;  3OP7 A;  3PDB B;  1RVY A;  2AY5 A;  3P1T A;  2E7J A;  1ASG A;  2OKJ A;  2R5C A;  7AAT A;  4GE4 A;  3VP6 A;  2AY9 A;  4WYC A;  4CBS A;  2CJH A;  4O6Z A;  2CH1 A;  2YKU A;  4IXZ A;  5G09 A;  2GMS A;  1S07 A;  4J5U A;  4WXG A;  3K7Y A;  4XJL A;  1KMJ A;  4W91 A;  2ZYJ A;  1C4K A;  3BC8 A;  4OBU A;  3AV7 A;  1CZE A;  2BI2 A;  1MAP A;  2CFB A;  2WKA A;  3ACZ A;  3DRD A;  3I16 A;  2PB2 A;  3EIA A;  3WGC A;  4Y0H A;  2W8V A;  1AIC A;  3ZZK A;  3AOW A;  1DFO A;  3MAF A;  4M2M A;  3DC1 A;  2YCN A;  4M2J A;  2JGT A;  3FVX A;  4A0F A;  4ATQ A;  3E6G A;  2D66 A;  4JEZ A;  4P3M A;  1O4S A;  4F5L A;  1V72 A;  3FDB A;  4LNL A;  1EG5 A;  1IX7 A;  1P3W A;  2ORD A;  2OQX A;  3PIU A;  4IW7 A;  3QPG A;  2W8J A;  4UOY A;  4XJP A;  5EIG B;  1G7W A;  1ELQ A;  4ZWM A;  4OCA A;  1OAT A;  3I5T A;  3N4R A;  2OKK A;  4IX8 A;  1MDO A;  1MGV A;  2VMZ A;  3R4T A;  4Q6R A;  1IX6 A;  1V2F A;  4ITG A;  1YOO A;  2DKB A;  1UU2 A;  3G0T A;  2AY6 A;  5KTB A;  3BS8 A;  3PD6 B;  2VLF A;  4ZM4 A;  1AX4 A;  3M5U A;  3G8M A;  2FM1 A;  1QGN A;  3L44 A;  3I4J A;  4UQV A;  1KL2 A;  3TFT A;  1ASL A;  4IYO B;  2BHX A;  4DQ6 A;  2AY8 A;  4UHN A;  4TMR A;  3JU7 A;  4TN4 A;  1IUG A;  3TAT A;  2DGM A;  5EIG A;  1C7O A;  3WCO A;  1DTY A;  3EUC A;  3OKS A;  3W1J A;  3H9X A;  2VMY A;  2ZJG A;  3CQ4 A;  3FD0 A;  1O62 A;  4J8L A;  2EO5 A;  2Z9W A;  1S08 A;  1SZU A;  1V2E A;  3E2Z B;  4N0W A;  3AOV A;  4WLH A;  4ADB A;  2AY2 A;  1LC5 A;  3B46 A;  3NYS A;  2O1B A;  3ELE A;  1ASF A;  1C7G A;  2VI9 A;  4MKJ A;  3NTJ A;  4F5J A;  2VMS A;  1LW4 A;  3FZ8 A;  4JEY A;  3ZRR A;  1X28 A;  4Y0D A;  3VAX A;  1UU1 A;  2Q7W A;  4K2I A;  1D7V A;  1ELU A;  3MEB A;  1H0C A;  2YRR A;  1C0N A;  1JF9 A;  1GEW A;  2VGS A;  1TAT A;  1WKG A;  1AHY A;  3GZD C;  3W1I A;  1QIR A;  1ZOB A;  3E2F A;  5M4D A;  2WB6 A;  1WST A;  3E9K A;  4F5K A;  1M32 A;  1BS0 A;  4QGR A;  1LKC A;  2HP2 A;  2YKY A;  3WGB A;  1AKC A;  2VMR A;  2BIA A;  4GEB A;  2VMO A;  1D7S A;  1DJE A;  2R0T A;  3NYU A;  3WCN A;  3B1E A;  3ELP A;  1C9C A;  3II0 A;  4Q31 A;  2TPL A;  2VGW A;  1AAM A;  3BCA A;  3FTB A;  4WB0 B;  1IAY A;  2Z9V A;  1OHY A;  3AEN A;  3QI6 A;  3EI6 A;  4A6U A;  3AEL A;  3A2B A;  4BHD A;  5F8V A;  5FT8 A;  5LH9 A;  5AX8 A;  4F4E A;  1SPA A;  1B8G A;  1YIY A;  2BWN A;  4A6R A;  4WXB A;  2EH6 A;  4F5H A;  3VK3 A;  3QM2 A;  2YRI A;  2A1V A;  4E1O A;  2F8J A;  3Q8N A;  4Q76 A;  4DGT A;  3HLM A;  3FZ6 A;  3HMU A;  1DGE A;  1WYU B;  1LW5 A;  5G4J A;  1B5O A;  1BQD A;  1SZS A;  3FQA A;  4R2N A;  3DU4 A;  2V1P A;  3DR4 A;  4XQ2 A;  5M4B A;  1UU0 A;  4ADD A;  1AMR A;  1I48 A;  4MQP A;  3GR9 A;  2BI1 A;  3RCH B;  2VGZ A;  3AEN B;  3A9Z A;  4MKK A;  2CJG A;  3IF2 A;  4WYD A;  3N75 A;  4ZLV A;  2O0R A;  3R9A A;  3PDB A;  3ZZJ A;  2EYQ A;  1ASC A;  1AMS A;  4W8I A;  1ARS A;  1ORD A;  1W3U A;  2YOB A;  3NRA A;  4ZAS A;  2VGU A;  4RKD A;  5HHY A;  5HDM A;  4HVK A;  3BWN A;  4UHM A;  3GZC A;  4WYG A;  3K40 A;  4FL0 A;  4H63 Q;  1RV3 A;  1M7Y A;  2AY4 A;  4NOG A;  3GSB A;  1M0Q A;  1BJ4 A;  3JTX A;  4FFC A;  3FCR A;  2RFV A;  4AO4 A;  2HP1 A;  3BWO A;  1JS6 A;  1QIT A;  2NMP A;  9AAT A;  3CQ5 A;  3NYT A;  4WLJ A;  1BW0 A;  3LG0 A;  4WYF A;  3JWB A;  2W7D A;  3WZF A;  2PB0 A;  1M0O A;  2V0Y A;  4TV7 A;  1AHF A;  1PMO A;  3E77 A;  3ASB A;  2CY8 A;  1CJ0 A;  1BQA A;  1ZC9 A;  2CJD A;  3AAT A;  1CQ7 A;  1ASE A;  1AJS B;  1GEY A;  2C7T A;  1N8P A;  3MAD A;  3AEJ C;  3FVS A;  4GRX A;  2D63 A;  1M6S A;  1TOK A;  1GDE A;  1WYT B;  1BJO A;  1YJZ A;  2YCP A;  3N4X A;  3CAI A;  5EQC A;  1X0M A;  1ASN A;  2VIA A;  4Q75 A;  4IYO A;  2W7L A;  5EFS A;  5I92 A;  3RI6 A;  3HBX A;  2Z1Y A;  3TQX A;  4P7Y A;  3KGX A;  1M4N A;  5G0A A;  4JEV A;  1QJ5 A;  3PAA A;  1N31 A;  4M2K A;  1EJI A;  3GZD A;  2EGY A;  2EPJ A;  4B98 A;  3HT4 A;  4B9B A;  1AJS A;  1AMQ A;  2HUU A;  3TCM A;  4OT8 A;  5HXX A;  1SZK A;  2DOU A;  1ART A;  3EIB A;  3HQT A;  4GSA A;  5G2P A;  4AO9 A;  4XJM A;  2AY1 A;  2VMW A;  4U2H A;  3RUY A;  2HOY A;  2GQN A;  5G4I A;  1V2D A;  2D65 A;  3EZ1 A;  5F9S A;  4JEX A;  3USF A;  4WYA A;  2FQ6 A;  1TPL A;  3LVK A;  5BJ4 A;  1I41 A;  2JJG A;  3DXW A;  1WYV A;  2GB3 A;  4KAM A;  3ZRP A;  4XEW A;  1Z3Z A;  1J04 A;  4ZM3 A;  4PFN A;  2WK8 A;  2HOX A;  4OMA A;  3HVY A;  2ZUK A;  4KYO A;  1M0P A;  4JF1 A;  2BI5 A;  2GSA A;  1DJ9 A;  3WKS A;  1ASD A;  1AY8 A;  1ARI A;  5FT6 A;  1DGD A;  2HUI A;  3RBF A;  2KFP A;  3FZ7 A;  4ISY A;  3A9Y A;  5E5I A;  4BA5 A;  3LVM A;  3B1C A;  1G4X A;  4WXF A;  2FNI A;  2JJF A;  4LNJ A;  2VIB A;  4LC3 A;  1D2F A;  2HUF A;  3A8U X;  3E2Y A;  3EI5 A;  3RQ1 A;  4W1V A;  2VGT A;  3QHX A;  3DXV A;  5DJ9 A;  1X2A A;  5TF5 A;  4AOA A;  1KL1 A;  2W8W A;  5EAA A;  4CXR A;  3AEM C;  4K05 A;  1BT4 A;  2D64 A;  3N0L A;  1W23 A;  1TAR A;  4MY5 A;  5J8Q A;  3KGW A;  5D95 A;  2JG2 A;  1DJU A;  3QGU A;  1MLZ A;  5DB5 A;  1GEX A;  3BB8 A;  3DOD A;  4OTL A;  1ASM A;  3ASA A;  2FN6 A;  3ATH A;  3F9T A;  3PA9 A;  4A0G A;  4A0H A;  1U08 A;  1I29 A;  2YCT A;  2CST A;  3NU8 A;  4F5M A;  4PFF A;  2CIN A;  4JE5 A;  2VMT A;  3ZRQ A;  1G4V A;  3FDD A;  2W7G A;  2E7I A;  4GE9 A;  1OXP A;  3ECD A;  3MAU A;  1FG7 A;  3AEP A;  2JIS A;  4LW4 A;  4RAE A;  1EQB A;  5G2Q A;  3JW9 A;  3UE8 A;  3LV2 A;  1AJR A;  5EUD A;  2OGA A;  2C81 A;  4ZWV A;  3FVU A;  4ZDP A;  1W7L A;  1CZC A;  4IY7 A;  4XAU A;  2Z1Z A;  1AY4 A;  1B9I A;  3E2Z A;  1RVU A;  2AEV A;  3N5M A;  4ITX A;  3A9X A;  4K2B A;  4E3R A;  5JAY A;  1N2T A;  5IWQ A;  3AEO A;  1QZ9 A;  4HF8 A;  4E77 A;  3NUI A;  3NDN A;  4CBR A;  1IX8 A;  1QIS A;  2CB1 A;  2W7F A;  4BQ0 A;  3TFU A;  1SF2 A;  2R2N A;  3JZL A;  2Z61 A;  3BCB A;  1M0N A;  1OHW A;  1B5P A;  3AEJ A;  4F5I A;  2WK9 A;  3DYD A;  4RLG A;  3VOM A;  4ADC A;  2QBT A;  4WD2 A;  1GC3 A;  1AAW A;  1BJN A;  2VYC A;  3KE3 A;  1ASB A;  1MDX A;  3FKD A;  5C6U A;  3EI8 A;  2YKX A;  4ATP A;  3DZZ A;  1CS1 A;  1KKJ A;  2CAN A;  3JWA A;  2Z9X A;  4I8A A;  1LC7 A;  3NU7 A;  1WYU A;  1DKA A;  2BI9 A;  3CBF A;  3L8A A;  2VMU A;  4F5G A;  4ZSY A;  4JF0 A;  3W1H A;  2JJE A;  1MLY A;  1FC4 A;  3DR7 A;  4IXO A;  1GCK A;  1TOJ A;  3F0H A;  5FT4 A;  3PD6 A;  4RJ0 A;  1IAX A;  1J32 A;  1TOE A;  4MSO A;  2HOR A;  5LHA A;  1YIZ A;  1AIA A;  1W7M A;  2WK7 A;  2YHK A;  4N0B A;  3VK2 A;  4PVF A;  2OGE A;  1SFF A;  3NNK A;  1JS3 A;  2R5C B;  1AMA A;  1AKA A;  3H14 A;  3T32 A;  2ZSM A;  3MBB A;  2VGV A;  3QBO A;  1PFF A;  2O7C A;  1FG3 A;  4RJY A;  2FYF A;  1BKG A;  1E5F A;  1D7U A;  4H51 A;  1QJ3 A;  1S09 A;  3G7Q A;  2ZC0 A;  2E54 A;  5BJ3 A;  2YKV A;  3FSL A;  4F5F A;  1AHG A;  3PPL A;  4RIT A;  4R5Z A;  5E3K A;  1IJI A;  4CXQ A;  4ZDL A;  2ZY2 A;  1Z7D A;  1AY5 A;  1BJO B;  3EZS A;  5M46 A;  3D6K A;  3EI7 A;  2CH2 A;  4XJO A;  3QN6 A;  1O61 A;  4RIZ A;  5FT5 A;  1GC0 A;  1XI9 A;  2GMU A;  2R5E A;  8AAT A;  1AHX A;  3WLX A;  4WYE A;  1C7N A;  3UWC A;  2W7K A;  3PJ0 A;  4EU1 A;  1MDZ A;  1GC2 A;  1ARG A;  3GBX A;  3BWN C;  4A6T A;  3N7N A;  1TAS A;  2ZY4 A;  1UKJ A;  2AAT A;  4R5F A;  1KMK A;  3AEM A;  3MAF B;  2HZP A;  1GC4 A;  4RM1 A;  3LY1 A;  1I43 A;  2D5Y A;  1H1C A;  3FQ8 A;  2BYJ A;  1WYT A;  1E5E A;  2VMN A;  3WY7 A;  4A0R A;  5M49 A;  3HL2 A;  3GJU A;  1S06 A;  2VMP A;  4RKC A;  4AZJ A;  2XH1 A;  2Z9U A;  3EI9 A;  1WYV B;  5DJ1 A;  1ECX A;  3VK4 A;  2QMA A;  5K8B A;  4OYT A;  1CQ8 A;  2X5F A;  2AY3 A;  2QLR A;  4ZAH A;  2ZY5 A;  3PGY A;  1VEF A;  2BYL A;  1YNU A;  3PDX A;  4ZSW A;  2QSR A;  4OC9 A;  2C0R A;  1YAA A;  1MAQ A;  3FQ7 A;  4JE5 D;  1X29 A;  3FRK A;  1CQ6 A;  1WKH A;  4A72 A;  2DGK A;  2X3L A;  2BIE A;  2EZ1 A;  3LWS A;  4ZDO A;  1XEY A;  4Y0I A;  3WKR A;  1YJS A;  1B4X A;  1D7R A;  4EB7 A;  4BMK A;  3P6K A;  1CL2 A;  3LVJ A;  2X5D A;  3B8X A;  4W5K A;  1SVV A;  4A00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...