1OXSC

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
352
structure length
352
Chain Sequence
b'MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 106
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
C PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxsC03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxsC02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxsC01
4I1UA 2B3GA 1I3QH 2CK3D 2ZREA 2B92A 3AVUA 2O8EA 1GJXA 1WOCA 4DV1Q 3PO2H 2A9KA 4QBHA 4US1R 5JEAJ 2QGQA 4DV4Q 1XMVA 1W36C 4B3GA 3H3VH 2AK2A 4BPBA 1XPUA 2GXQA 1ZC4A 3WBJA 3SQXA 5SZIA 2H92A 1ONLA 1EWIA 5GADC 2WB1G 1QDEA 3H3VI 1K8OA 3RRZA 4PHHA 2IL1A 4DAYB 2DB3A 5IDVA 1JXOA 1I2MA 1XPOA 4Q4LA 1I50H 3LGJA 2BKEA 4LBWA 1N6PA 1OE0A 1WI5A 2EU8A 4B2LA 1CFMA 2EYQA 2AXPA 4XTRA 2OSBA 2ZROA 5FI0B 5HE8A 5BQ5A 4OI1A 3IEUA 2Z83A 4GP6A 3QKSB 3CWZA 1T0JB 2OO7A 1F2TB 2CWPA 1GSIA 3GTQH 2N1BA 2NIPA 5HCIA 1WBDA 3K7AH 4ABYA 2ZSBA 4C0SA 1G64A 1GKUB 3RVBA 4BLQA 3GQBA 2ZXUA 4O2DA 1Q7YC 3OEHA 3HOVH 4UP8A 1E79A 4PHFA 1D2EA 2VBCA 4C0HA 1L4UA 2OCYC 3U58A 3KQKA 3CCVA 2GDJA 2RHSB 3U9SA 3K0FA 2A5YB 4BUJA 4DR5L 2ZSAA 2GJSA 2O8BB 1U9IA 3HKZG 4B3ML 5H70A 4EQ6A 1SROA 1QRAA 2D2FA 3U4QA 1P2SA 5FOWA 1XTJA 4AKIA 3OYYA 2BEJA 2KBFA 4HI0E 1PH2A 5G53C 1NY4A 2J0QA 4JG2A 3WWVA 4NYMR 4II7A 2BBTA 4TMVA 1Y1VG 2XOKD 5DNYB 4RVCA 5EUMA 2DWOA 1HNXQ 2ZRHA 3M4QA 3QQ5A 2OWOA 4A3GH 3W3AA 4V02A 1SVSA 4PAOA 1UE7A 4P0TA 2FSFA 1ZCAA 3LFUA 3SYNA 1BKDR 2DPXA 2O8CB 5KDLA 2ZS8A 2VQSA 4EQ5A 4H1UA 3U3KA 2ZAOA 3N5CA 3PO3H 3DEFA 5JHHB 5FPYA 2A69C 1NBME 4MYCA 2KCMA 5A35A 5IK2D 3ZLJA 4L9SA 5L3RA 4DUYL 2ONKA 4Q01A 3TSWA 1NY5A 2E75C 4OO1G 3BAFA 5IY0A 3ZDQA 2V9PA 3UK6A 5C3EG 1EFCA 2IYSA 4M0LA 4NONA 3B6YA 4TN1A 4QGUA 1E1RA 1T3SA 2KBEA 4AQYL 2WJIA 2WWFA 4OJQA 5TARA 1EQRA 4OHWA 5J4HA 5DISB 4CEIA 1GAJA 3W5IA 3IPXA 1JAIA 2ZETA 4MRRA 1KJZA 1AK2A 1E69A 1Q46A 3E1SA 5FTMA 3VQTA 5DI9A 3SU8A 4X65Q 1FMJA 4C7OA 2A6HD 4BZQA 1N36L 4H1VA 4UXJA 2O8FA 1W49A 1MO6A 5C0XI 1ZRHA 2ASEA 2IA5A 2EIFA 1J70A 3QENA 2J7PA 3QBTA 1F60A 1HA3A 2I1QA 1Q22A 4IVPA 1GUSA 3FHCB 4KSCA 4B3SL 2QSZA 1YVCA 2WJJA 3IGFA 1LM0A 4JI5Q 5EXXA 4HIDA 4KHPL 1T8UA 2ZITA 3VKHA 3FYHA 3QPVA 4URZR 4BRWA 4QL3A 2BH2A 2QPTA 3F8TA 3GDEA 2J41A 3GEIA 1I5FA 2F4VQ 3BXZA 4QBGB 5IWAL 3DHWC 2IYXA 4JI0Q 1CJTC 2ZSDA 3QPWA 2Z5FA 1TL7C 3RZDH 3S1AB 1G3RA 3UKDA 2QBYB 4A76A 1BS1A 3VR3A 1RYFA 1OJLA 2ZJRA 1IBLL 1ZM3A 3RWMB 1K83H 1HE1C 3RC8A 4JBXA 3ZD7A 5CIWA 1T3HA 1H9SA 3OPOA 2QE7A 4Q7MB 1M7HA 3GTLH 3CC2A 3AEVA 2QMEA 2LSSA 1W44A 2QNRA 1E2PA 1ZM9A 4M9QA 2CL7X 4JL8A 3Q9LA 4GOPA 2AMCB 1JJVA 4FCWA 2OILA 1CP2A 1CKOA 1XPRA 1G19A 2QT1A 3RR5A 3THXA 1YEZA 3BORA 3TQYA 5IE8A 1IHUA 1OIVA 1UBEA 2IYRA 3KJIA 2Z6KC 1JB7A 5DLQE 3D8BA 4Q9IA 5HKKD 3THYA 1FX0B 1UADA 2ZI5A 2ZTCA 1Z0FA 1X3GA 3RABA 3R9WA 1W1WA 2FSHA 2A68C 5TDHA 2FPKA 1GUTA 1UBGA 3MJHA 3DLLA 2BHRA 4LYFA 4UNPA 4C4PA 3I1FA 3VR5A 3OEEA 3EA5A 5D3MA 1P9WA 2GJ9A 3B2EA 4IEEA 2ZRPA 2ZU0C 1CJVC 1E4VA 4DR6Q 1CKMA 1JPNA 5KTYA 2FFHA 3HGBA 2CKZB 1RJ9A 1X86B 2VO1A 2F1MA 1E2IA 5CJPA 1NF3A 3WNBA 1X6VA 3T1YL 2DFKB 4URVR 1WDTA 2NO7A 1MO3A 2QGNA 4EFMA 3FKSA 4C0KA 4DIDA 4JI8Q 1FJGQ 2R93G 2YWFA 4IO9A 1GDDA 2QP9X 4W5HA 5AK0A 4L15A 1VTKA 4HIOA 3NHAA 1N2CE 4DK0A 4IOAA 2F1RA 3QKSA 2GJAA 3LV8A 4PTLA 1F2TA 5DE3A 5JS8A 1GNQA 3ZIAD 3A7AB 4B2IA 1N3BA 4YXWD 3X1ZA 1ZIOA 2ERXA 2WWXA 3UPUA 4L5SA 5KDOA 4DLWA 5AUPB 3OIYA 1G5TA 4M9SA 1NE3A 2E2JH 3FVQA 4HB3A 1YR7A 4LRWA 4A2QA 4LPSA 4TL7A 1E3PA 1E2QA 4YWLA 3Q8XB 3J81k 2FMXA 3TZUA 4PPNA 1YZTA 1WB9A 4KKTA 1TU3A 3CCMA 2QY9A 1OXVA 4BLOA 4LK2A 1UEIA 1N6IA 2OHFA 2Q3HA 3GPLA 1B23P 4MRSA 2W2XA 4GOJA 4ACAA 3IEVA 4DUYQ 1UKZA 4B3BA 2ZYTX 1MIUA 5J4YA 1VYUA 5JSZA 2GILA 3CC7A 2QTVB 4A93H 4AQYQ 1UWVA 1P75A 4BWYA 3TVTA 2MFIA 3VHXA 3ASZA 2CL6X 4JI7Q 2V4DA 2C35B 5IP7H 1P2UA 1E1QD 2WV9A 4RY2A 4H13C 1E6CA 1QHSA 3SOPA 1EIFA 2A6ED 3A8KE 1O78A 2F6RA 3H2YA 3M6AA 4TVAB 2B8TA 1ZNZA 3CRMA 4JLNA 2CHVA 2R6DA 2OBLA 3OZXA 3FB4A 1XXHE 5FOVA 1KIXA 2OUKA 4ARZA 1V1QA 2YNMA 4B3SQ 4JLMA 3BFKA 3OIWA 3EQLC 1D8LA 2KJQA 2VP0A 3J80i 1Z2CA 3P27A 1P3JA 4A3FG 2W6IA 1TWCH 4GZLA 4OYHA 3TUJC 2ZI9A 4IOLA 2K50A 1A1VA 1C4OA 1JQLB 1U2RA 1G8GA 1Z0IA 2JLRA 2WKPA 4IEIA 3CONA 4JMPA 3WMGA 4D4JA 1E4YA 3GTOH 4B76A 5G3YA 4IPDA 5KSPA 4YDSA 3R8CA 1Z6AA 1JAHA 4L5QA 5FBWB 4R1JA 3WYAA 2CW0C 2ZJBA 1ESNA 1FNMA 3OAAA 1KOFA 2Q9BA 2BBWA 2RGGA 3H84A 1I2DA 3WHKA 1CJKC 4D2IA 1VHLA 2V54A 4APVA 4IOJA 4WZBE 4GFDA 2HYDA 1GHJA 2WIBA 2DBYA 2LXKA 2Y0SE 1II9A 3BJUA 1VQPA 2BBOA 4RCNA 2HLDD 2IYZA 2I5LX 1JQJC 2IUTA 4X62Q 2QM7A 4HLDA 2K75A 4ITRC 5IYDG 1Q0UA 1VQ5A 4DDVA 2DYKA 4GN3B 4PQRA 2BMJA 5DN6D 3GLIA 1AZSC 4KFRA 2PZFA 5B57C 1H8HD 1G16A 2QENA 3PIOA 4BFZA 4BEJA 3H4MA 2JLXA 2VPPA 1G8FA 4BEBA 2D2EA 1B9NA 4XH9B 1G3IA 2AWNA 1US8A 5JJKA 1LTQA 4OQNA 4RZ3A 2AUKA 4NL4H 4PO8A 3BS4A 2L15A 3MWKA 1FFHA 1NLFA 3FMIA 2PX3A 2ZSFA 1TF2A 1CUKA 4A3KG 1DEKA 3MRSA 3OIVA 3EIVA 4G5RA 3CCSA 3IBYA 4AD8A 2N49A 2QTFA 4QBIA 4C0JA 4DCNA 5LB4A 3SFVA 2NOAA 4HDCA 2I5MX 4YC7A 2V4ZA 2HHHL 1W2HA 1E0JA 2RHDA 4B75A 3E5HA 2AKAB 2R6GA 2FNAA 5K8LA 1SVIA 3T56B 4OWTB 3GEHA 3LQRA 3ICEA 2IC5A 2VH5R 4LJ8A 4XVQA 4BFTA 5E3HA 4DV5L 3Q72A 4J15A 4AC9A 1AJEA 1EOVA 1JR3D 1FX0A 4Z1MA 1D7QA 4IVQA 1GIAA 4MKFA 3KQHA 4R71A 3EPHA 3T35A 4B3CA 5F9HA 4BBSG 1FPMA 3T1HL 5JWHA 1I4DD 1MRSA 1UDWA 2QP4A 2TMKA 1YHAA 1WF3A 2Z6KA 2ZYWX 4KBFA 1A2BA 3BIFA 5JI3E 5C0XG 2PLFA 3VNVA 1KO8A 1R2QA 4NMMA 4NYJR 4U00A 2QI9C 5IP9G 4IPCA 1DTSA 1S96A 1X8LA 4HZUB 5A4JA 3J81i 4IKEA 5BYKA 4ZPXA 1SXJD 1WMSA 4PMWA 2CEAA 3I4NH 1XXHB 2J1LA 4DR1Q 4Q5IA 3PV0A 1J90A 3TS2A 1AGRA 3U7FB 4UNSA 4Q03A 4I4LA 4MKIA 2CBZA 3RSOA 4G1UC 1N0VC 4ERNA 3K0CC 3RYTC 2GNOA 1X3EA 121PA 2P3SA 1D5CA 4K8OA 3ZJYA 5JRZA 2ZRIA 1TWGH 4GS3A 3BC1A 5DO9A 5FL7A 4IPGA 4A3CH 2KHJA 2UZ3A 1E2MA 3IIJA 4M1OA 4A36A 1ZC3A 1IN4A 2XGTA 2YHSA 4JLAA 3W9YA 1HNWL 4CRWB 2ZS9A 3WRXC 3A1SA 3AKCA 5FOSA 3PJRA 4C2UA 2BE5C 4OGQC 3HOUH 4KMUC 3VA7A 3EZ9A 3QF7A 1ODFA 4DKXA 3ICQB 2DR3A 2PI2A 4A3LH 3LDAA 4TKOB 3BJIC 2IYYA 4Z8YA 1G3UA 1N6NA 2B63G 3QF4B 3QVVA 1ESMA 5CDFE 4X66L 4HUQB 3BE4A 3CWQA 4KYUA 3TSZA 5EJEA 1Y8NB 1L8QA 2FV8A 5LBIA 4D6PA 1PH4A 4DC9A 3U7HB 3CRVA 3JVVA 5K36H 3SJBA 2X1VA 3U6KA 1L1OC 4AYTA 1IBKQ 4Q4JB 2GEUA 1P72A 3FHTA 1HR0L 3VU9B 1X55A 4GMDA 2Q6TA 1PFSA 2HT1A 1A63A 3CNOA 5EP4A 4AIMA 1KAWA 1RZ3A 1OXXK 4DKAC 4Q4HB 1SMYC 1Q81C 1II8B 5JS7A 1X1SA 2A30A 1HJPA 3A5ZB 4JBJA 3D3QA 5EZ6B 1F3OA 1GUGA 2QL6A 3FMFA 3NC0C 5C44G 3W3ZB 2GVAA 2OTJA 4PZZA 1YE8A 2H5XA 4E5UA 2PCFB 1VQDA 4NCJA 4GKKL 2JA5H 4LF5Q 2WMNB 4DR7Q 5LD2B 1Z6YA 5FR1A 4QG7A 5M5YH 1KTVA 3KDFB 2P6UA 2QAGC 3HU3A 1YNJC 1CJUC 4LJ7A 4BE7B 2O5IC 4DK1A 4DLTA 1E9FA 3W34A 1FMLA 4ZI3A 1OW3B 2RCNA 4LFBL 1H9RA 1JJ7A 2JAQA 2JDIA 3AVTA 1YQTA 2CVHA 2IBMA 3F3YA 1YIJA 1R5BA 3S17H 2H1LA 4E03A 2JLYA 1KIMA 1IY0A 4KN4C 1UE1A 2EWVA 5AJXA 4Q18A 4G5GA 4MRPA 2ZRFA 3OTOL 4LHVA 4A3BH 4AYWA 4PG3A 3K0XA 2EFHB 4PO1A 4JV5L 3PEUA 1R0WA 4DLYA 4A15A 2GXAA 4NBSA 4NHOA 3KJOA 1KI6B 5BW8A 4UXIA 4A92A 4A3DH 1S40A 2VRWA 4PZ8A 4URUR 1FQJA 4MDFA 1VF7A 2A5JA 1E7ZA 3L0SA 1N5KA 1RC8A 1KQSA 1DG1G 2X8AA 3PEWA 3PF5A 4JI6Q 2UXCL 1X9NA 3PR1A 4JVNA 2B7CA 4KSBA 4P3YA 5JZVA 5DSZA 4K0KQ 4EKDA 1ZD9A 3K9NA 1N5JA 1EYGA 5BN5A 4DK3C 3REGA 3ZYCA 4AURA 1HR0W 4BRUA 1I94Q 4ZDJA 4JI1Q 5GJWC 1G7CA 3AF0A 2GXUA 3TEHB 5LMNL 4B3DA 3KL4A 4RFVA 5L8VA 3BOSA 1KK1A 1KL9A 1IYJB 4AG6A 4RG1A 1U8AA 4MGZR 1UFQA 3T51B 3S1QH 2VHJA 1IW7D 4D81A 2XB2A 1DPFA 3W1BA 4LYJA 4XD7A 3QEOA 1OB2A 2R7ZG 5LMUL 1X8JA 2GZAA 1G7RA 2CQOA 3LVQE 1O7LA 4R4CA 1DAMA 3RANA 3RS7A 5GQOA 4G7ZC 1E2GA 3SDZA 3OW7A 1OSNA 1VQLA 3U50C 3AF3A 3PENA 5M3FG 4G01B 2GEDA 1CF4A 2JA7G 2ZE5A 4WA7A 3E70C 3S1RH 1IYVA 4IXNA 3IHLA 3LNNA 3T15A 2H5EA 1BH2A 1KMHA 3B9PA 3AKYA 3LH5A 3VX3A 3CR8A 3S15H 3BZKA 2QUZA 1W3SA 3HKZE 3KTAA 1OFIA 2DN8A 4D82A 3L82B 4YLGA 1XMOQ 3TBKA 2GHIA 4MTNA 1Z5ZA 3GCGA 1T9HA 1SR3A 2PEZA 3B7GA 4WW0A 3KKMA 1KI3A 4A2WA 1AGPA 4C9BA 4B44A 1P16A 2UU9Q 4TTQA 3GTPH 3HU1A 2CNWD 1ZBDA 4O3MA 2YJTD 4GOKA 2JLZA 2KHIA 1R0YA 3RSLA 1ZAKA 4G0NA 2ZEJA 3K0CA 2G6BA 4RD6A 1Q1ZA 1KSFX 2PLRA 4M21A 4IPHA 1JEDA 3UG7A 4FXPA 4DDUA 5C4MA 1XEWY 4Y0AA 5C46F 1BDOA 4OO1H 2RF4A 3K9GA 4MRVA 1A5TA 1EFRD 1KDOA 4S2EA 4Y7NH 3TK1A 2I0QA 2YWGA 3DKPA 3WMFA 1HH2P 4MH0R 3K70C 2CWAA 4LF4L 4OO1I 1G8YA 4TMWA 1EK0A 1SZPA 2D06A 3EIHA 2ZJQA 4TL8A 2ZJPA 1E99A 3GFOA 4IFDJ 1N5LA 1P4SA 2R44A 3LX8A 4US0R 1ZD8A 3UG6A 1JJGA 4DCVA 3VU9A 5DIFA 3KF8B 3AQQA 4LFCQ 5J47A 1IXRC 3CRKC 4B73A 4LOAA 4H0LC 3KF6B 3RN5A 1VQOA 1EFWA 1LS1A 1L1OA 4A3EG 3U4ZA 2W6JD 2J0SA 4O0AA 1IOZA 3CB4A 1NG1A 4MUAA 3K7UC 1GM5A 1YZGA 2NO9A 3K0FB 3LNCA 1VQMA 4BFUA 1ZW6A 4JKIA 1O3YA 3CPWA 1E96A 1MV5A 2C9OA 3OEHD 3GTMH 4EQ6B 2Z6VA 3FGNA 1P8LA 3I8XA 1GUNA 4AYXA 4X64L 1E9AA 2H16A 4O2RA 1NY6A 1S3OA 1PV4A 2YC2C 3TRZA 2GK7A 1Z2AA 1OH6A 3HJNA 4M8NE 3EZ2A 1P6XA 4CF7A 3GLFA 1XMSA 4JSTA 4G7OC 4XSGA 1KD1C 1R8QA 2HIXA 1DAEA 1OT3A 1DVRA 2WJHA 3JAMc 4IW3B 1XB2A 3HOXG 4N3NA 1ZYUA 2G1JA 4O2LA 4DRZA 5UKDA 3QIAA 3CF0A 5CM8B 2VY3A 2WOJA 1X6OA 2IYUA 1Z07A 1ZINA 4IJLA 1FP7A 1H8EA 1RKBA 2QAGA 3NTUA 3Q7PA 2BCJQ 5L3QA 3UDIA 3AP1A 3PQCA 3ADCA 3F2DA 1DD2A 4DJTA 4LY6A 4TYQA 4WXRA 4YCVA 4GNKA 2V6IA 5G3ZA 1PLLA 3U3OA 5IYCG 1ASZA 3TRFA 4BY7H 2D7DA 1KI6A 2LKDA 2NG1A 1BKBA 4DV7Q 2UXDQ 2W00A 3DZDA 5KSOA 2WP8J 2RGNC 1QZGA 2EWWA 1E22A 4LUVA 4M4SA 2FFAA 5CK5A 2NZHA 4CEIB 5KPDA 1ZNXA 1OKKA 3RN2A 3I8SA 2NTYC 1DO0A 1ZUNB 3CZQA 1JXMA 4YQFA 1XMQL 4C7OB 4EDHA 3BZCA 4FN5A 4NPHA 1WYDA 2VQFQ 5C4GB 5LMUQ 4B3TL 2O8FB 3IILA 4KLNA 3AVVA 1VQFA 4NPSA 1G7SA 1N33Q 4DCSA 2P5TB 1ASYA 3EC1A 2YV5A 4LF7Q 1XU4A 1E2VA 3OE7A 3RRNA 3GD7A 5K8UA 3TSOA 2R93H 2IXGA 2B8WA 1TTTA 4MA4A 3CCUA 4A0HA 4DLVA 3THOA 3TQFA 3U6BA 5GAEC 1CS4C 2J7PD 1VMAA 3CX7A 4LC1A 4V0NA 3L0OA 1YHBA 1KKMA 4JJKA 3VNUA 3AEZA 5FBRB 2YOGA 3RNLA 2NPIA 3ZH9B 2FXQA 3I3SR 3T1TA 2BM0A 3GTKH 2IY5B 2WHXA 4FWIB 1QVCA 4KYIB 1XTKA 1GHKA 1AE2A 2ZM6L 5JFGA 1M74A 2HYIC 1FW6A 2OZEA 5GAHC 1KAGA 3EZFA 3QY0A 1D9ZA 4BZXA 3W90A 4MKGA 1XNRQ 4Y52H 1FUKA 1ZKOA 1H9SB 4A6PA 4CDGA 3AVXA 5JEAG 2AX4A 3PUXA 4WIAA 1KK3A 3M1IA 2KI5A 2MO1A 3GLHA 1FGUA 4HLUC 4WZ6A 5EE3A 4LJ9A 3GO5A 3SS8A 1Y69U 3M3YH 4QHSA 4B3XA 1A8VA 4JC0A 2IWHA 3K53A 1XD9A 3UWKA 2AD5A 3GP8A 3I92A 3THXB 3LBHA 1I6HH 2VSXA 5C18A 4KFSA 2KCTA 3THYB 5H1YA 2WJGA 2QEXA 2LMCB 1E9EA 3H86A 1TPZA 3KKPA 4FD2A 4XVRA 3M4PA 3R9IA 3UATA 4LF9Q 4A82A 4YMTA 2JJQA 3ADBA 1G21E 2XGJA 1N0UA 3CNNA 2IXFA 2GCPA 1KDRA 2OT3B 3CO5A 4LFAL 4WZAE 4FCTA 4POAA 2QQEA 4HAVA 1KZ7B 5D3MB 4FCVA 1Z9FA 4B34A 4FWTA 1G4UR 1NMGA 2JJ1A 1C0AA 3AP3A 3OFNA 4RSGA 3V4FA 1RJ9B 1LVGA 4TMZA 2OTLA 2FPLA 1E2NA 2W2VA 3OEED 4FMCF 2PNHA 4NYIR 3O8BA 3H15A 3ER0A 1XBTA 2OXCA 4ON9A 3WP1B 3H0GG 4P75A 6Q21A 3KQLA 4E09A 4A3FH 3PSIA 4NCKA 1N6HA 1E0KA 4DCTA 2VS1A 3I56A 4DV6L 2ANBA 1W36B 2KWIA 2P6NA 3GLIE 1HZCA 3F0TA 1VDZA 3R8FA 5EE5B 1QHGA 4UQOA 2BC9A 3T1QA 3ZS9A 2RHQB 4L5BA 4X64Q 3BD9A 3RHFA 1R0ZA 3FKSD 3L2PA 4DV3L 4PSKA 2ECKA 1KKLA 4MKHA 1N25A 3ZVNA 4M9ZA 3WDNA 5EUQB 2NQ2C 4OK3A 1LV7A 4V0LA 3TH5A 5DHAA 2O5VA 1Z08A 4QM6A 2JJ8A 3IO3A 2BMEA 2J5XA 2XZLA 3KF6A 2D74A 4LHYA 3I32A 4DDTA 2GF9A 3KKQA 5LDDC 4A8JC 1YZUA 3NG1A 1CRQA 3QI2A 5IYBG 4HAUA 3RS4A 1GO3E 3K80C 4GNXC 1LS6A 1W48A 4OHYA 3RS2A 4KN7C 2V1XA 3TREA 1D8TA 1GUOA 1X3SA 4H9GA 2V6JA 1E2JA 3CLVA 1BMFA 4JVMA 1IXRA 2IYLD 2F1IA 2QF7A 3MWYW 4P73A 4V0MA 4DSTA 2BMDA 1VQAA 2FX3A 1HCZA 4DUZL 3TE6A 4ESHA 1Q12A 2F52A 3QEJA 5FL3A 4JL5A 5F98A 5JSZB 4F7WA 5JWRA 4HR7B 2ES2A 2R6CA 1IJFA 3OESA 2XNDD 2GAOA 4RMFA 1FL9A 1T8TA 2EFDB 4GMXA 1A62A 1P5ZB 3OOCA 2BV3A 1YKSA 3N70A 1PMRA 1QHYA 4MGKR 1Y3AA 2KBNA 3VR2A 2IUSA 1NTGA 2OM2A 1XMQQ 3AF4A 1TEXA 4GZYC 4LI0A 2IHEA 3SQWA 1CKNA 1S2MA 2GF0A 1XCMA 4A3JG 4OX9L 5FTKA 4ARZB 5FUWA 2D7CA 2RGCA 4DR3L 3WNCA 3EWSA 1RIFA 1CJMA 1WJJA 1OH7A 3VR4A 1FZQA 1GP2A 4DNTB 4ZCIA 2R9VA 4UKDA 1Q20A 4DB4A 5AJWA 5FBLB 1VCIA 4BBSH 1UEBA 4M1SA 1ZIPA 3RZOH 2ORVA 4U02A 1NSTA 3F2BA 2WWWA 3LVRE 2G1KA 5C0XH 2R62A 4QGGA 2OQ0A 2BJVA 5CM9C 4NCIA 3KB1A 2A69D 1FP6A 3E9IA 2VIIA 2RGNA 4IOKA 1E2DA 1IONA 1YR9A 2A6HC 5ELNA 2YC4C 4JI2L 1E0SA 3L0IB 4PANA 5FTNA 5FOUA 3O8DA 2UUBL 2WSMA 4OBEA 4LBYA 1E1OA 2PI2E 2YYZA 4LHXA 3OAAD 2Q9AA 5B64A 1COWA 4JBYA 4R9UC 4QM7A 4GN4B 3WRYC 2N42A 3MXUA 4Z8XA 3GLIB 5EP1A 3H0KA 4KJZA 3CRW1 4N0EA 4OXPA 1KNXA 3JVUA 4OHZA 3Q3JB 1TXYA 3FTQA 3W8RA 1CU1A 5KUTA 1Y1WG 4LWCA 4MDEA 4UNQA 1I6VC 5CB6A 1US8B 4DCUA 5SZKB 3TGPA 1RRCA 4LV5B 2DWPA 4O25A 2VL6A 3FKQA 1U90A 1VYVA 4YMUA 1VG8A 3AGQA 1KZGB 2K5VA 3CCLA 5C4JH 3HOYH 2QMUA 4E07A 2B6HA 2OV2A 4DR4L 4BLRA 4DR2L 3ZS8A 4Q9KA 2K33A 1K3RA 4JI3L 2BEKA 2B29A 4DEYA 3PUZA 3UE0A 2B63H 4A0FA 2IS6A 3B60A 3IO5A 4JZKA 4MITA 2IX0A 1R6BX 1T5IA 1Q90A 4LHWA 1OFTA 1XRJA 4LJAA 2YU9H 5BR8L 1NNEA 1Q1QA 2Z0MA 3PCRB 2JLSA 2WAYA 2JA1A 3DVLA 1H65A 4CW7A 1A7JA 1VQHA 3PFIA 4RKEA 4IFBA 4HLUA 4MYHA 1W7AA 1HZAA 1P73A 3F1ZA 3CCQA 3EPKA 2PQAA 4NXNL 2JGNA 3EIQA 5TVKA 3B78A 5E7JA 3AVQA 5AR1A 2IUUA 4CT5A 1ETUA 5L3SA 2HT6A 2Q3MA 2YTVA 2REBA 4AH6A 1YJNA 1Y8PB 4NU0A 3MGCA 2YTXA 5AJ3L 2OAQ1 3DOEA 4NH0A 4OI4A 5GVRA 4TMKA 2WTUA 4LYAA 4TL9A 3HOWG 2O0KA 2OLKA 4A0RA 5AUQA 1SVKA 3PUVA 2XTNA 1KK2A 4RZUA 2DNCA 2W58A 3AP2A 4IDQA 3BH7A 5LB2A 2A68D 1QVAA 4DR5Q 1R8SA 4AG5A 4B3MQ 1M34E 4G5SA 1NBMD 4M2LA 4KV9A 1N6RA 4PQYA 3AB3A 1SHZA 2ZJZA 3REFA 4KFTA 4TLBA 3S2HH 2RB4A 3BG3A 3QXSA 1G20E 4PC3A 3HOZG 1XX6A 4OL0A 4PZLA 1HTPA 3M85A 1E9SA 1KI2A 1W47A 2RAPA 3AVWA 4HATA 2UXBL 4MRNA 2OBNA 3MWLA 3U5ZB 4TYPA 4DPGA 3AVYA 4KKSA 4ZV4A 4P72A 4JCVE 4NDZA 3DZ8A 3MCAA 2EFEB 3CZPA 1ZUIA 1WXQA 4L8GA 2ZRJA 3EBEA 4LYHA 4P74A 3T06B 3JZMA 2JLUA 3J81j 1DAGA 4EUNA 1KNQA 4R2HA 3I4LA 1HQYE 3CPHA 1XWIA 3PEVA 4A8JA 4RFSA 4GNXA 4CEJA 4I1VA 1HUQA 2VP5A 2ZVQX 4OK5A 2AFIE 4P4UA 3GEEA 1YNNC 1M7BA 1R10A 1VQJA 1ZM4A 4OQXA 3I4OA 3OIUA 2D0PA 5AJYA 1IBRA 4DSUA 3VKWA 1NG9A 4TL6A 2IYVA 3S24A 2CLSA 1Z63A 1Z8FA 2XXAA 3I55A 1HQCA 3GJ0A 4R4OA 4OQLA 2W0MA 3FPAA 3FFAA 4J0QA 1GL9B 421PA 1YHNA 1N36Q 4KVGA 2A6EC 4YWKA 3LO5A 2NO6A 2MSCB 3KZ1E 4BXXG 5EZ5A 2ZANA 1W5SA 5CK4A 3UMSA 4POGA 1F6BA 1SVOA 1UKYA 3NH6A 4TWZA 4PPQA 3TR0A 3BH6A 4PSVA 3VMFA 3CC4A 4KHPQ 2I1VB 2RGBA 3B1XA 4JKYA 3M4OH 2CXXA 2ZJ2A 1GFIA 1T0HB 3N2EA 3B1YA 3CF5A 3B6EA 5IWAQ 3V4RA 4JYBA 3SJZA 1YZKA 4JBWA 2H57A 3A58B 4JLBA 3I61A 8OHMA 1OTCA 1HT1E 5J3BA 3NENA 1G6PA 4O0MA 4L5RC 4LPKA 1E2LA 1TQ6A 1YZLA 1Z47A 1IBLQ 1MH1A 4Q9LA 3SC3A 3ETLA 2QMHA 3T34A 4IOCA 4DHEA 1M6NA 2A19A 3LW7A 5IT5A 3CCJA 4DR2Q 1GOTA 2WICA 2FN4A 5EE9A 1ZD1A 2IEYA 1OV4A 2Z4RA 3KB2A 2D4HA 4X8OA 2MNAA 1MOZA 1K0RA 1G7TA 2ERYA 2RGDA 1QUQA 2FDCA 2QQ0A 4PQFA 1LF0A 3AM1A 3I2ZA 1XTDA 1F48A 2C2HA 3H94A 1KGDA 3CKLA 3MLEA 2C99A 2ZI4A 1N32L 4HLQB 2CLCX 5TY0A 2QP3A 1XNQL 2XAUA 4K46A 1KO1A 2OCAA 3ZGXA 4R4IA 1A4RA 5JBQA 1XTQA 1UEJA 2F9MA 3EASA 5FPHA 1WCMG 3HOVG 4PAQA 2NZJA 3DMNA 1A2KC 1XFAA 1AA9A 2B21A 4JLVA 4V0KA 2ZJ5A 3RS5A 3OF5A 5FTLA 2ASBA 3B13B 1CKEA 2DWQA 3TLXA 3NBXX 2WSSD 3T1YQ 4PFSA 1DCZA 3UDXA 4AKGA 2P67A 2VHTA 2JCSA 2JIZA 3LX5A 2D3WA 1ZP6A 3OHMA 2EQSA 4BBRG 1OPXA 2PBRA 3ZVMA 2WWHA 2EVBA 3FHWA 1GTVA 3SEAA 3GLFE 1W0KD 4CEJB 4R4TA 2ZIAA 1J8YF 2REOA 3VR1A 2F3TA 1YI2A 2BKUA 3GJ3A 5G41A 1X54A 4QIWE 2JEOA 4PHTA 4BFVA 2V1UA 4A3EH 1N6LA 4URWR 2B8FA 1NLZA 2WVJA 1XEFA 3U61B 1WBBA 4FINA 3UE1A 3QSYA 1KRSA 1CTQA 1IN8A 4DXAA 1MJCA 1KMHB 2IYQA 4NXML 1SXJC 2OBMA 2CCZA 1Z28A 4JOIC 3CRLC 2FGKA 4PC2A 3KTAB 1HQMC 3LAWA 3WNDA 4LF6L 3T12A 1W5TA 1XTIA 2E5LL 1E32A 4DV0L 1NMYA 3X1WA 2KA7A 3FKIG 4MQBA 4EPTA 4QNMA 3HOXH 1YJ5A 3W5OA 2YOHA 2ZE8A 3PIPA 1AKYA 2GEVA 2R65A 4LGMA 1VQKA 3ND8A 3AVOA 4RZ2A 4DNIA 3RS3A 3BERA 5B30A 4Q19A 1FL0A 4QGFA 3TIFA 3BWDD 1UE5A 1MO4A 2HJGA 5FBVB 2BDTA 3B5JA 1I4TD 1PH8A 2MMGA 1TQDA 1OXSC 3U7EB 3AF1A 2GJKA 5HTKA 3CH4B 1OIWA 3IDQA 3LY5A 5EE0A 4HSEA 4YXWA 4C2MH 4DLRA 3C4JA 2FZ4A 4M22A 4OWXB 1VHTA 3RDPA 5JJIA 4A0GA 3EG5A 1VCMA 1N6KA 4HAWA 2BMFA 3Q85A 2A3RA 2ZRBA 4Q21A 3P4XA 2GXSA 4A4IA 1P2VA 4OI2A 721PA 3GJ6A 4HIMA 4B3RL 3TAUA 2WPDD 5B2ZA 5AUOB 3RC3A 2JXMB 5AJZA 3CX8A 4QY7A 2P65A 3BH0A 3FP9A 1W4RA 3NEJA 1GNPA 1P9RA 1Z6GA 2J59A 1RIPA 1XMJA 4QHYA 3QPUA 4FMDB 1GKIA 4LV8B 1L1OB 2NVQH 2RGEA 3C5CA 3GLHE 4UNRA 1U98A 2C9YA 2QU8A 3SZRA 3NE5B 3S16H 4QJFA 2OQKA 1DAKA 1DAFA 3DM3A 2EFGA 4C30A 4D4LA 4EJSC 1CI3M 2WM9B 3CH5A 3PVSA 2JJ2A 3R7WA 1ZVQA 1EQQA 3THWA 4DUGD 2ONJA 1AM4D 1E1QA 2G77B 2ZVPX 3BFVA 1V43A 5M3MG 3IIKA 3QKTA 4QFMA 4ZDIA 3U4VA 4CEHA 5KNDA 2OCPA 1KJYA 2K32A 1O7IA 1PYSB 821PA 3GLFB 3STBD 2JE6I 3R20A 4C3IH 1G41A 3IIMA 4I7ZC 2I3BA 4TTPA 3RS0A 4DT1A 3QXCA 4CT4B 5HZHA 2J0UB 3V9PA 5JEAH 1GUAA 2FSGA 2ODBA 4A6XA 4DNRB 1KAOA 4C3HH 2H8KA 3I72A 2VLIA 4V03A 4BQSA 1YR8A 1N34L 3GJXC 3I4MG 1G5RA 2ODEA 2IK8A 2QAGB 3A1VA 4L9WA 3WXMA 2PMZE 4BY1H 5HGQA 2BA1A 5L3QB 5IRCD 1RRPA 4TQ9A 1SRUA 1CR2A 3TW4A 1DADA 4OHVA 3UANA 3NBHB 5HPYB 1XCGB 3AQ4A 4JK1C 3LBIA 4DK6C 1H8ED 4HEJA 2HHHQ 1TWHH 4UP9A 5B58C 1CSPA 2HV8A 3K9LA 3FHOA 2C77A 1J5EL 1KI1A 1XJCA 1JBKA 4JYAL 4DV5Q 3KXKA 1OHHA 2ZYUX 1VQIA 3SN6A 1VQGA 1BO6A 4F4IA 2HXSA 3QXHA 4TT3A 5TXGA 3CD6A 2HLDA 2R92G 1R9TH 2UUCL 2ZTSA 3NWJA 5C1BA 4JLOA 4PR0A 1HZBA 1X1RA 4FW9A 1OKKD 3T1HQ 1NKTA 2GRJA 3MG9A 3H0GH 4TQAA 2WAQG 3RLOA 2ATWA 1H8HA 4QBFA 4B35A 4AWXA 2HJVA 4D25A 4TSFD 4X8LA 4GI7A 2KCCA 3K0AA 4CVNA 4KKUA 2E1RA 2OE2A 2CCGA 4M53A 2ZI7A 4B6FA 5TMPA 1ZM2A 4V0ME 5DYGA 2HIVA 3P26A 3W6NA 4UY8C 2Q2IA 1BYUA 1SKYE 1WE2A 3KJHA 4TQUS 2FZLA 3PF4A 2AL7A 4K81B 1VQEA 2C5LA 1E94E 1OYYA 4JVSB 1S3GA 4V0OA 1YHQA 3L8YA 2F55A 5ELOA 2JA8G 4AY2A 1W2BA 1M1YE 5F2EA 2F43B 2AKYA 2ZJ8A 4NYMQ 3KJPA 1PH1A 4EPYA 5IYBH 2ZAMA 4LF8L 2OFXA 5IP7G 1G3QA 3NIBA 3WMEA 3GLGA 4HUTA 4IVRA 3B8HA 1RE0A 2K5HA 1M90C 2ZRCA 1HNWQ 2RH5A 3GLHB 2IXEA 1M2OB 1JALA 3D31A 1U99A 3G4SA 1VCNA 1VG9B 2L0XA 1EWHA 3QOFA 2YTYA 1MRNA 4UJ5A 3WYGA 3U7GA 1C9OA 4NZYA 4IDOA 221PA 1CRPA 1Y1VH 4QHTA 3LA6A 4QXAA 4YMWA 3TNFA 2VSFA 2WWIA 2EXDA 4DV2L 1BVSA 2Z0SA 1IXZA 3CIOA 3CW2C 4X66Q 2GZDA 2ZJOA 2ZTEA 1LABA 1JEEA 1SULA 1EFUA 1SXJA 1ONBA 4IFDG 3NEYA 4JOIA 5JCZA 4B71A 2K14A 1KSJA 5E7NA 3KDSE 4B3RQ 1HE8B 4Q7JB 3NDPA 2FFBA 2G83A 1IYUA 4AYBG 2I5HA 5EAYA 1HR0Q 4C3JH 1P60A 1TEVA 2Z43A 4Q1CA 3VHLB 2QAJA 1E1TA 4A9AA 1FQKA 4A3JH 4Q9JA 3QKRA 2JLWA 4B3FX 2NO0A 1RL2A 2E8GA 5C3EH 3NXSA 3N2IA 1W0JA 1CEEA 3QXXA 2QPAA 3ZD6A 5J4LA 4LJ5A 1HH4A 1TAGA 2X77A 3Q5DA 2KB0A 2GAAA 2ZU6A 2FJUA 4QJ3A 2P6RA 5LMNW 1L4YA 1Z22A 4GKKQ 2VW9A 1NJGA 2C04A 2B8GA 1KJWA 4P4TA 1S0UA 2XTIA 1YITA 2VQEL 1HNZL 4JI4L 2O0HA 4US2R 5FR2A 2ZRGA 1QZHA 5KU1A 5H68A 3K70B 2WWGA 5JJLA 4HLCA 2EJMA 2CJWA 1UAAA 1TWAH 1EFTA 3SI7A 2VUMG 4LFBQ 4LC0A 4EAQA 1BBUA 4WVFA 3MSXA 1NBWA 3KJEA 1R4AA 4YHHL 2VHUA 3K70D 4DIEA 1E0AA 1D2NA 1H95A 1B8AA 4Q47A 1ZU4A 1E79D 1DG3A 3AGPA 3OTOQ 2CL0X 1I4LD 3U44A 4DV1L 1OIXA 1Y1WH 5JMTA 4JV5Q 1SKYB 2XEXA 3SHFA 4C0LA 5FBQB 1LYLA 4EJSA 5BN3A 2J7KA 1NP6A 2G0NA 4JLKA 2KENA 2C03A 3B1ZA 3SYLA 4JBKA 1HYQA 5GAGC 2J0UA 3JZAA 4BZPA 3RLFA 2D62A 2HEIA 4Q1DA 4MNOA 1UM8A 2VL7A 2WOOA 2UXCQ 5C4XG 2PEYA 1QVFA 2V7QA 4HIKA 1NVWQ 1LTLA 2J0VA 2P2LA 3ZVRA 2JA6G 3S1NH 1S9HA 1VQCA 3I7FA 2PZGA 5HE9A 3BB1A 5EXSA 4LK1C 3BBPA 4ZIRA 3D4RA 1CKNB 3J7ZC 1SQ5A 2W83A 2LKCA 4L4UA 1QHXA 1WRBA 2ZR9A 4Q02A 4Y0VA 1QHHA 4DLXA 1MKHA 1VQ6A 5LMNQ 3HDTA 3ADKA 1BBWA 1G3MA 3U3RA 5HZKA 4KI0A 1B0UA 1V5WA 1XJ0A 2QGZA 1NVUQ 3A8IE 3AUXA 1E24A 1PH5A 1D9XA 5EP3A 5EQTA 4F92B 1VCOA 4NE2A 1XMIA 1IN7A 4A75A 4BLSA 1KRTA 3D0FA 2AR7A 1F5NA 3X1DA 2DUDA 1E1RD 4IXMA 3HOWH 2C8VA 1VKJA 2R2AA 1GL6A 3W6OA 4ACBA 1UDXA 1QG4A 4XWOA 1VQ9A 2AXNA 2CDNA 3BFXA 3HYTA 3LXRA 4L16A 2QA4A 2WZQA 1DO2A 4JL6A 4Z54A 2JLVA 5JLJA 1GKHA 1IJEA 2KE5A 3O47A 1XTRA 1SFOH 5C2JB 3TAHA 3CF2A 3BB4A 4HZIA 4ASUA 1K9MC 4OWWB 1YVDA 5EXPA 3MJRA 1OXUA 1VIYA 4U5XA 1HNXL 4M9XA 1E2KA 1P7CA 3BRWD 1Z3IX 1CIPA 5FFMA 2F3IA 5FLMG 1XD2A 1CR0A 3A8TA 1PA6A 3B82A 2AHOA 2RGAA 2UZIR 1PH6A 1Q57A 3SFZA 4GKJL 1TU4A 3DKVA 3HOZH 1JE5A 4WJ4A 3KQNA 3EA0A 1QZXA 3SGIA 4PAMA 1NL3A 4QNRA 3MD0A 3FWYA 1SLJA 4F91B 5KDDA 2F43A 3ZQJA 3EX7C 3KX2A 1K8AC 2HUPA 1R5OA 1YBYA 4GLXA 4IJMA 4HJ9A 3HKSA 2XZOA 5D3QA 3KUDA 2UUAL 4JJZA 3ND9A 1LB1B 3NBYC 4HJAA 2F1HA 1II0A 3I73A 2CE2X 2OCBA 1GKYA 2QE7D 2WJVA 2PCLA 2X2FA 3AKDA 2JA5G 4IDHA 4X65L 4ZKEA 1NMXA 1SMXA 1EX6A 1E2ZA 1J99A 2ZQ5A 3KFVA 4GOPC 1Z6XA 1IZ6A 3UDFA 3EWAA 4LF4Q 5FUYA 1S1MA 4F93B 2PQAB 2IYTA 4IQZA 4PO9A 2JASA 4L8JA 1G1MA 2WWYA 5L3SB 4I1OA 3U2QA 4QKQA 2N8NA 3A37A 1GD7A 4JI5L 3S2DH 1E2EA 2WJYA 5ELXA 2ODNA 4AKEA 3T1VA 3IQXA 1AE3A 5CYPA 2HCBA 3CW2A 1J2JA 2K5UA 4NCNA 1PHJA 2F4VL 2EQBA 1EESA 4BXXH 1B9MA 3CQZH 1CBUA 1JB1A 4JI0L 2VZAA 1VIAA 1LW7A 2J45A 1P9NA 2VSOA 4GLAC 1PVOA 1KY2A 3EPJA 2CNWA 3K09C 1AS0A 3TS0A 2FWRA 1TQ2A 1L7VC 2QMOA 4HB0A 4KBGA 4YDHB 4ZO4A 1U8YA 2QEQA 3QVUA 5FPTA 1TMKA 2BIFA 1QVGA 1FYCA 2G0TA 3VR6A 1S1CA 1W36D 1OLOA 1EFRA 1VQ4A 4M1KA 3J7A5 1LFDB 1WA5A 1TKWB 3U3JA 1NN1A 1XCPA 3M4YA 4R2IA 4PPFA 3N6RA 3GJ7A 1AS3A 2FEMA 4F38A 1M1KC 3FDIA 4A3IG 2R8RA 4GT1A 3X1XA 4F4JA 3G6EA 1L2FA 3G0HA 3A6PC 4YY3L 1K73C 5IYDH 2Q2TA 2R6AA 2EFCB 2DHRA 5JEDA 1Q3TA 3CXCA 2CFMA 4QGHA 1C7YA 1GITA 2UVQA 2YZ2A 3A36A 2PH1A 4JT2A 4XOIA 2JA9A 1D6JA 4FMCB 4HJ7A 2WMOB 1Z0KA 5FJ8G 1XD8A 4A8JB 4HJ5A 1KO7A 4M1MA 4RFSB 1V9PA 4GNXB 1K5DA 1KXLA 1KDPA 4DR6L 1RYHA 1HEIA 2OESA 2W6JA 4QJ4A 4XJXA 4KLZA 3ZVLA 2GK6A 2AN9A 2XTMA 3GTGH 1FTSA 3EC2A 4RD4A 1KSHA 1KI7A 3A5UA 1KDTA 4DDWA 1QBKC 2DFLA 1NIJA 1WCMH 2V8OA 4A3KH 3Q7QA 2BWJA 3O8CA 1X56A 4Q1AA 3EZ7A 2XXAB 1EUJA 2HQLA 4JI8L 1FJGL 3C5HA 5FTJA 1HZ9A 2SHKA 2Z4SA 3A4MA 4B3TQ 2GETA 2PX0A 1QJOA 1YJ9A 2OLJA 2VHCA 4B32A 1CTMA 1IN5A 4LW1A 3HYRA 1DXMA 4NYJQ 5BWMA 4BBRH 1RRFA 3S14H 5FPKA 3C8UA 2Q2UA 4YONB 3EN2A 4KITB 2IS2A 3JAMi 2N46A 1ZU5A 5LPNA 1KHTA 2WAXA 2LXJA 1VECA 3J80c 5BN4A 2GKSA 1N6OA 1XDBA 1K8RA 4BFYA 4YCUA 5M5XH 4GKJQ 2XJ4A 2W6ID 2IEZA 3GJ4A 5JECA 2ZE7A 1J7KA 5IP9H 1UE6A 2ZM6Q 1VQ7A 3I5XA 4PZ7A 2ORIA 3R9XA 2N78A 1TF7A 4NTZA 1SVLA 4W7SA 4ZCMA 2NN6G 3ADDA 4DAMA 1Q1BA 3CP0A 1G6OA 1IAQA 1KI9A 2FH5B 2PMKA 4LUZA 1EWQA 3QUSA 3KOJA 2UUAQ 3QXJA 4PHGA 2JQOA 2XSZA 1IY2A 1MO5A 4IDNA 3NELA 3FKIH 5E7MA 4B74A 2MQHA 4JI7L 4EFLA 1QHIA 1QUQB 1UJ2A 3AFPA 2BVNA 3U3MA 3U60B 2F9LA 2JATA 3LRPA 4Q1EA 2O8DA 2QRZA 4OJKA 4C0QC 5A0FA 1GL7A 1JI0A 4B33A 2GCNA 2H17A 3DDCA 3M9BA 2E2IH 2ALYB 1E2HA 2BJWA 2XNSA 5FH9A 2VP4A 3FOZA 3RRMA 2QT0A 1CLUA 3KKNA 3Q5EA 4LFAQ 3LBNA 1E9CA 4Q4AB 3VAAA 3IBGA 5M5WH 3MEFA 1N0WA 4MYUA 2VF7A 4WBSA 4CGZA 1YZ6A 1NVVQ 2NPFA 4DLZA 1FUUA 3F2CA 1KSGA 3CRRA 4KLKA 1W2GA 1X3FA 1DS6A 5CYOA 1UKEA 2C95A 3M7NA 1A82A 3FFBA 4DVGA 2GZHA 1N9WA 1JJ2A 2A78A 2XX3A 1HTWA 4KFUA 2IWRA 1Q82C 2PNRC 2GCOA 4HDQB 1Q44A 4DV6Q 2G88A 2ZT9C 2OCEA 3GFTA 4P33A 2JIZD 5E7IA 2WBLC 3P1JA 4DV3Q 2ZR7A 4Z1MD 2PL3A 5GJVC 3CCEA 4PSAA 4PPGA 2AUJD 5FUXA 3W8NA 1S4QA 1IBML 3AVPA 1Q8KA 3LLUA 2NZOA 4X62L 3TUIC 4ZKDA 2X19A 5C44H 3QG1A 2JK8A 2RMKA 3Q8DA 3HU2A 1H9JA 1AH9A 1BOFA 3GFPA 1NJFA 4LV6A 3TJZA 4LJ6A 1NRJB 2XJ9A 4LJYA 1EFHA 1HT2E 1C1YA 3PCOB 1O87A 1RFLA 2AFHE 1MR3F 1MABA 2CK3A 4XWAA 3J81c 1PH9A 5M3MH 1VQ8A 4IOMA 4YY3Q 1RRGA 3CCRA 1E2WA 1VG0B 4H44C 4BY7G 3ERSX 1Y14B 4QL5A 2ZUCA 1W4AA 3EZ6A 2ZUDA 1B7YB 4DUZQ 4QGAA 4QOSA 1LUZA 4I1SA 4R98A 3T5DA 1OFUX 3K09A 1AN0A 4KXFB 3I4MH 1PUIA 5K8IA 5F3WB 3BGWA 4LSGA 4BECA 1CXZA 3GJ5A 1IQPA 1OF1A 2ZYVX 1T91A 4OHXA 3KJGA 4A3MG 1JT8A 3ZJYC 4TYNA 5DYIA 1EGAA 5JRJA 5FL7D 3SJAA 3KFUA 1GRQA 4IFEA 2FGJA 2ANCA 4P71A 1UKVY 4P4SB 5K8TA 1XZQA 1VG1A 3CM0A 3HFZB 1G4AE 1AQYA 1TUEA 1ANKA 2ZR0A 2L5TA 4OX9Q 1OH8A 1NIPA 2PT7A 3ZQ6A 3I62A 1E9DA 4DR3Q 5CLLA 3LWUA 1GVPA 2PJZA 4IHQA 4GN5A 1BYIA 2R92H 1WFQA 3HR7A 5DI3B 4PV1C 5FI1B 1UF9A 4MGIR 1KO4A 1KO5A 3QE0A 1Z6HA 2X2EA 1YRAA 2KSQA 4PXAA 1XZPA 3GLGE 1GWNA 2AK3A 4JLJA 4TLCA 2HDNB 1KK0A 2A5DA 2J46A 4DR1L 1JR3E 521PA 1YRBA 3EAQA 1DOAA 4HAXA 2XOKA 4UPAA 2XITA 4P32A 2ZTDA 2O8BA 1WCV1 1AS2A 1X65A 2WAQE 1JPJA 4KAXA 5DHFA 1EWRA 4JI2Q 4D4MA 1G9XA 2XNDA 3K1JA 3CAMA 2UUBQ 1M7GA 3NBFA 1TUIA 3R7WB 4URXR 1OB5A 3THWB 4UJ3A 1Q1EA 4P31A 4YWMA 3RLNA 3QG5A 4KVAA 3EXAA 2Q0HA 3ULPA 2JA8H 3S1MH 2VA8A 5CIQA 1Z29A 2R7ZH 1DAIA 4A1FA 4CEHB 4JLPA 2JJ2D 2IHFA 1SXJE 1U5KA 2G3YA 3K8YA 1TX4B 5IK2A 3WY9A 4DT1B 2O8CA 3QBVA 4GP7A 5M3FH 3PO2G 4R7ZA 3RAPR 2JA7H 4LJZC 2CVFA 4XVUA 1DARA 4RD0A 5DLQC 3X1YA 1A6XA 4G5OA 1CSQA 3K8AA 3W1GA 3EW9A 2QN6A 1K6MA 1PH3A 1VPLA 4LDJA 2GA8A 4W5JA 2IS4A 1G6HA 3PXGA 2VHQA 1VF5C 5IF9A 4BFXA 4B2PA 4DR4Q 2JDID 1IBKL 2EJGC 4JI3Q 4QJ5A 1F2UB 1VQNA 3TQCA 3PGZA 3GJ8A 2D5DA 1AQUA 4PC7A 4FMBB 2WKQA 2GBLC 4IFDH 1G17A 5BR8Q 2CLDX 2PMDA 3L8ZA 3M0EA 1X8KA 3IUYA 4M1WA 1QHNA 2ZJYA 3AFQA 2MSDB 3WP0A 1FVIA 2JEAI 1JECA 5GJBA 4IFDI 3KYHC 1LY1A 5TV2A 1VQBA 4NXNQ 1AKEA 1TWFH 4L5TA 1N8RC 1DBSA 2YWEA 4DLUA 4Q4AA 4HYYA 4AYBE 1OHHD 4JS0A 5DH9A 3UWOA 4Q1BA 5AJ3Q 4LF5L 2E76C 4DR7L 3G71A 1IBMQ 2GJ8A 4JIMA 3C7KA 1HV8A 1Z0JA 1DGSA 4TYWA 2JLQA 2FSIA 3K0AB 2HF9A 4KO8A 4XSHA 3K0SA 3MWJA 2R7DA 1WP9A 2VP2A 2VTKA 4EPWA 4UP7A 3E2IA 3S1AA 2O0JA 2K52A 4GOXA 2FF7A 4GPTA 2K5NA 1Z7TA 4RKFA 2QBYA 3KXLA 1GRNA 2NMVA 1R0XA 2AD1A 5CLQA 3DOFA 1NSFA 2VUMH 1AIPA 3P4YA 4A3GG 3FMPB 4DWJA 4LHZA 2MO0A 3GLGB 3DMDA 5HKKA 1ZYRC 4POFA 3HPRA 4OKSA 2OFWA 1NMZA 2WIAA 4XD7D 3T53B 4N1AA 1K5GA 3PO3G 1IN6A 1G8HA 2UXBQ 2RGXA 3H1TA 1EX7A 1GG2A 3IRBA 4PZ6A 4BASA 2D2CC 1IL2A 4UXHA 4LBVA 1KMQA 2IHYA 4RJLA 1FOEB 1L2TA 1NN5A 3IKJA 2QTHA 4JI6L 4S35A 2YKGA 5P21A 3V00A 2BOVA 2A5FA 1GRRA 2H7VA 1T4GA 3HPQA 1PJRA 1U0JA 2OEPA 4K0KL 1PLKA 2QG6A 5KSYA 2QRNA 2CCKA 3NHBA 4CZ2A 1SXJB 1H9MA 1I94L 4JI1L 4JYCA 5C4XH 4JVLA 3KUCA 1E9BA 3D6TB 3KLWA 2JA6H 3LWNA 4TZ6A 2F7SA 1V8QA 2V3CC 2J3EA 2A2ZA 4NCHA 4NP6A 1KYIA 2EDGA 1NBMA 2F3RA 2ZSEA 1C9KA 4YMSA 3P32A 3QKRB 4W9MC 3AB9A 3ZIAA 4G3XA 1K8MA 2K7VA 5IYCH 1JJCB 3ZZUA 3MMPA 1Z83A 4IDPA 4P4SA 2QZ4A 1A0IA 5CJ2A 5E4FA 1QG2A 1TQ4A 1FNNA 3BDOA 1QVRA 3B9QA 3RRYA 3W6PA 3AYHB 1J6QA 2D0OA 1SVMA 2Y8EA 4NKRA 4EX5A 4FMDF 3SBEA 4D80A 4TYYA 4JSYA 1W0JD 2GESA 1Z0AA 5DI3A 5C0XJ 4LUOA 2PPBC 5FOTA 3B85A 2ORWA 2BE5D 2IF2A 4U7DA 3D7MA 1R5NA 2XTZA 3GMTA 3MXNB 2CJWB 1UPTA 1XJQA 3T61A 3HOYG 3WYFA 2IF0A 5JI2E 2O5JC 3TKLA 1TF5A 1XMOL 4MZ9A 3VKGA 1YU9A 2NO1A 2E2HH 1E3MA 3NEMA 2HF8A 5EP2A 2RHMA 3C41J 2E87A 4WXPA 2EVWX 5FLMH 1U81A 1KY3A 3CR7A 2NVTH 1XTSA 2PCJA 4RCYA 2UU9L 1MT0A 3AKEA 621PA 1Z6TA 3B1VA 4BGDA 3HR8A 2O52A 3WBKA 5JEEA 3U44B 2EJFC 4I99A 5J4KA 4TLEA 1NVVR 4EJSB 2E74C 3KFXA 1XEXB 4RD1A 3ZZ0A 2XZPA 3STBC 4PC6A 1U0HC 3TVDA 4ZCLA 3KXIA 4ZDKA 5LD2C 1N32Q 1YR6A 2OXRA 5ANRB 3SBDA 3MFYA 1XNQQ 2DFNA 4KU4A 5M04A 4KHZA 2GVBA 3C16C 4TTRA 4ZIRB 1LACA 2YWHA 3CPJB 4TMTA 2GN5A 5GADl 3A1TA 2ZS7A 3DM9B 1F2UA 1QHHB 2V7QD 4GDFA 4XWKA 4EPVA 5HY6A 4LFCL 1Q3HA 4FIDA 1G8PA 4NYIQ 1Y8OB 3A4LA 1P2TA 3VTKA 4EIWA 3K0EA 2Q9CA 2ID0A 4GRAA 1XP8A 4PC1A 3AF2A 4A2PA 2EW1A 1TADA 1T5LA 3LLMA 3TW8B 2A8VA 4TLAA 4N0DA 1AZTA 4LJ4A 1N5IA 2WKRA 4W5WA 1HURA 4BFWA 1T6NA 2GBLA 2XB4A 5DN6A 2ZRAA 3LW8A 1PZNA 3CNLA 4TLDA 2ATXA 1YJWA 1DELA 2C98A 5F9FA 3DL0A 1H9KA 3KLRA 3ULLA 4LUCA 5FOXA 3KQUA 2V55B 3NH9A 3CMEA 3DXJC 1R7RA 2C96A 4MGYR 3DM5A 4M1YA 1G18A 1SKQA 5KPJA 2CCJA 2CMKA 4NXMQ 1IY1A 2FE4A 1ZUHA 1NLYA 2VNUD 3OE7D 1XD2B 4WAUA 4E22A 4C0BA 1S9DA 3IFTA 4Q00A 4ASUD 2AHOB 1J8MF 3ASYA 1IW7C 1KI8A 4LF6Q 4C0AC 1CR1A 5H1SE 5G40A 2J87A 3E0EA 2E5LQ 4DV0Q 4A93G 1PH7A 3F5FA 5FLXc 4Q7KA 4X8HA 2H18A 2W0SA 3C15C 4D26A 2WSSA 3ZZTA 4M1TA 2OG2A 4A3IH 3EIEA 2A1AA 5EXTA 2QSYA 3K9HA 2ZI3A 1JR3A 5KO2A 3CX6A 4HB4A 3TUZC 2DGYA 2WB1E 1NKSA 4DV7L 2UXDL 3KKOA 1W0KA 3PITA 2BA0A 3G82C 5KHOC 3SNHA 2NVXH 2FA9A 2ZRLA 1NVXQ 3CBQA 3LD9A 4DBLC 5FJ8H 3G5UA 2IS1A 2DY1A 5KOYA 1WQ1R 1GILA 1E9RA 3AH8A 4MUBA 3L7ZC 2ZUBA 1ZMXA 1S72A 2FOLA 4JBMA 2ZRNA 4OK6A 3BU2A 3SE0A 4QC2A 3TR5A 2A7QA 4GL2A 3SYKA 3C14C 2AKWB 1M8PA 2VQFL 1XF9A 4GBMA 3IQWA 4AKHA 4KCGA 1N33L 4ME3A 2QROA 1ZM7A 4IRUB 1YZNA 4A4DA 4LF7L 1DAHA 1T3LA 3UMFA 2VYFA 4HB2A 4DLSA 4RCZA 4B47A 5CB8A 4R4QA 3ONWA 4HZUA 3E9HA 1E2FA 3LQQA 2Y0SG 1BIFA 3FPPA 2EYUA 1EXMA 2GVZC 3L2OB 1SHKA 4HAZA 1XXHA 2NGRA 1EIYB 4MYTA 1Q21A 1OFHA 1U94A 2CHGA 2QM8A 4LZZA 3A1UA 3UIEA 3L0PA 4ESVA 4G7HC 2JJ1D 3A8JE 3OFND 3NDBB 4NB3A 4LX0A 3RWOA 2WFWA 4XTCS 5JCPA 3G48A 4GZMA 4D0NA 1SVWA 3QKUA 3MAAC 1XNRL 5AUNB 1W4BA 2OFOA 4TMXA 1B70B 2O8EB 3UDGA 1JNYA 1S3SA 4B43A 3ECCA 1ELOA 1JMCA 5JWOA 2IHBA 3CUEF 4OQFA 5SZJA 1OH5A 4IJHA 2FU5C 1UBCA 4YMVA 1RVDA 2NN6H 3A74A 2J9RA 1YNXA 3FMCA 3T1OA 4LBZA 2FPMA 1P61B 3SR0A 1NMFA 1N34Q 1MJEA 4URYR 2V1CC 2WPDA 2NN6I 1SN8A 3NBZC 3QF4A 2N3SA 4LF9L 4HUQA 1S8FA 3X2SA 4WJ3M 4AI6A 1HY3A 4JT4A 3SJCA 2C9CA 1IXSB 5H8WA 1P62B 2E9SA 4WOPA 3K81C 3HWSA 2ZI6A 3DPUA 4Q4JA 2K4KA 1UBFA 3VX4A 3PEYA 4DV4L 3UXMA 5TB5A 1L0WA 4Q7LA 2PT5A 1BMFD 1K8GA 4DSOA 1XEXA 4F4CA 1U9IC 4BLPA 5KNCA 2HCJB 1VS0A 1J5EQ 2ZRMA 5AJVB 3PUYA 3A7LA 4JYAQ 4Q4HA 4TZ0A 2GVDC 4UNNA 4B6EA 4BLTA 2W2TA 4CYMA 1KC8C 3PUWA 1II8A 1T5EA 2ZRKA 4DUGA 4C2TA 2B7BA 3HP1A 1GVNB 4EPRA 3O8RA 2UUCQ 3A1WA 4ILEA 1W46A 2BM1A 1GNRA 5GVSA 1JR6A 1OYWA 4AK9A 5HR5A 1G291 3U4QB 2BCGY 2UKDA 3BK7A 3I4NG 1HPCA 1PLJA 5GJCA 2ODWA 4OONA 3KDFA 1FTNA 3PIRA 3CPEA 4PX9A 3AV0B 4RD3A 5JHGB 1TU2B 1W4CA 2HXYA 1ZCBA 2P5SA 1Z0DA 2QA5A 1IM2A 3FE2A 3VDYA 4Q48A 2JEBI 3GTJH 3CF6R 3SHWA 1SGWA 1EG7A 2GWHA 4ALPA 1LNZA 2FFQA 2FG5A 3A4NA 5BXQC 1G51A 1XJVA 4A3CG 4ZDWA 3W5JA 4Q9HA 2YOFA 5FPSA 1KHIA 2I4IA 4LWZA 1SE8A 3FMOB 2MSEB 2REXB 5GROA 1TNDA 3NVAA 3DO6A 5A5GA 4FI3C 1CULC 2OAP1 3AUYA 3HOUG 4LF8Q 2CHQA 3NKVA 2C78A 3L43A 1NN0A 2A5GA 2LWIA 4A3LG 4Z51A 4ZI2A 2ZPTX 2IW3A 4B48A 2Q3FA 5E95A 4CIDA 5J4VA 1CR4A 3LXXA 3T5GA 1U0LA 2G9NA 5KSZA 5DGXA 1ZNWA 4EFNA 1PUJA 5K36G 1GZSA 2O8DB 3WHLA 1RW4A 2XSZD 2IX1A 3ULJA 2NZ8A 3P20A 4DV2Q 1COWD 2VP9A 2IT1A 4TSFA 4D0LB 5EE1A 2DFTA 1LF5A 2YVUA 3CRQA 5L3VA 1Z06A 4A3MH 1VYTA 1ZJ6A 2AWOA 1NI3A 5IT9c 1NN3A 1PYBA 1ZNYA 2GTPA 2BBSA 3OW2A 4I81A 1RPZA 1XEWX 1Q86C 2P0EA 4X8MA 2IYWA 5J5CA 2Q2HA 1FR3A 1U8ZA 2BH8A 4KODA 3PG5A 4QRHA 4D0GA 2Q21A 1G5PA 5FUVA 2PJRA 2BDOA 2NVYH 5J40A 1DE0A 3B1WA 4DEXA 3CPFA 5CDFA 5AWFC 5CITA 3EPLA 4DB2A 2CE7A 2R6FA 5SZHB 3UMRA 3IHWA 4BFSA 2FEOA 4D4KA 2Q8IB 1YZQA 4FDBA 3IPYA 4RD2A 4RZXA 2ATVA 1MKYA 2GCOB 5KNBA 4JLDA 4TT3D 4DSNA 4DZZA 4LNQA 1OXTA 3JC66 3I5YA 2ZM5A 5KYKA 1XNJA 2ZJAA 2LCFA 2QORA 4HAYA 4GSYA 4QQBX 2IX3A 2PZEA 2VF8A 3RNUA 4Q66C 3A0JA 2DCUA 1QF9A 4YCWA 3NC1C 1NJIC 4OQMA 2VQEQ 1HNZQ 4JI4Q 2RKOA 3TMKA 2ZE6A 1KI4A 3VFDA 4GOPB 2YINC 2F1JA 2MMCA 3QJYA 2R7FA 3EARA 4XIGS 4BY1G 2QPOA 4G5QA 5HCNA 1D2MA 4EPXA 4A3BG 2VEDA 4HJ8A 1MABB 4PZYA 4Q1FA 5BYJA 4YHHQ 4OI0A 4X6AH 4C3ZA 3CMAA 1E98A 3QNUA 5IHPA 4BA1I 4GLVB 4AIIA 4H02A 4HDOB 4LCBA 2VP6A 1Y63A 4BA2I 2ZRDA 3BB3A 3MUFA 4A3DG 2DNEA
chains in the Genus database with same CATH superfamily
2PO4A 4ARSA 4M9UA 4B3GA 4BPBA 1XPUA 2R96A 2QCPX 1XDGA 3FUVA 2B25A 2ZXFA 5TT1A 5AW2A 4LBWA 1N6PA 1R4ZA 2Y1GA 3SXJA 3R5SA 4GP6A 3ZXSA 2N1BA 3GTQH 5EMKA 3KF8A 3H7IA 3IXMA 2WFMA 3GQBA 4FNGA 3A1NA 4QRDA 1GEEA 1B4DA 3HKZG 2BGIA 2Q41A 4NABA 1XPJA 4MV7A 5EUMA 1VBMA 2QW7A 4DIMA 2E0IA 3DAOA 1I7LA 2FSFA 5FAXA 5CV9A 3RUDA 3U3KA 3WZMA 3PO3H 1KRHA 1SNCA 2I1LA 3TSWA 3FGOA 4G0ZA 2Z4TA 3AL0C 4R1LA 5TSDA 1HXHA 2ZETA 3GT7A 1KJZA 2M98A 4BBJA 2E4WA 4U2GA 5KQLA 5FO0A 1J6UA 5AVXA 1Z4KA 3QPVA 4DL9A 2F4VQ 3EQ2A 3M9WA 1X19A 2OHOA 1M1UA 4X3PA 3I04M 2H1HA 3DHQA 5ELDA 1H9SA 2BKVA 1A0OA 4PYIA 4GI5A 4GOPA 1CKOA 4IUNA 4EHNA 2IBSA 3IYLW 4EGCB 4IINA 2I2XB 1DYQA 2BHRA 3ZTTA 4UOEA 2CKZB 1X86B 4B9XA 1R4PB 1NF3A 1R6DA 3UV6A 4TROA 3MTEA 2YWFA 4JXZA 4II3A 2JRLA 3L3BA 3AWDA 3DA8A 2D0OB 4ESOA 1A4XA 3QUAA 4HZGA 4HB3A 1YR7A 3FLMA 4A2QA 1CFJA 3X3NA 1OWMA 1YDFA 2R1UA 3PQ5A 1XQVA 1CQWA 1G2SA 1EYDA 4M0KA 2Q3HA 2YYYA 3GPLA 4ACAA 1JG3A 2ZYTX 2V7GA 2ORED 1F17A 1UPCA 4KE9A 4M0MA 4YT2A 2UYCA 3KP1A 1D8LA 4Y6SA 4DNQA 3SEQA 4RENA 2QLTA 4JMPA 2FWNA 1TYBE 1JAHA 5CA0A 5K8LA 3BULA 4G07A 3PCTA 4RCNA 4EBBA 1LV9A 2OYCA 3QVOA 4Q82A 1LA2A 5JSFA 3WGYA 5LDHA 3AHDA 1JIQA 5JYDA 2ECFA 3MWKA 2NYVA 3A6ZA 2OGUA 2VH5R 2IC5A 2C0PA 4Z1MA 2ZYRA 4MKFA 2ALJA 1P74A 1RXWA 3SK0A 1FPMA 3NUQA 4RWSC 1QQTA 1YHAA 4B9EA 1A2BA 1NM5C 5CA1F 2B5VA 1CA6A 5J3JA 1SXJD 3PV0A 5DFAA 1AGRA 5FPQA 1ONPA 4ERNA 1HQDA 5JZBA 5DLPA 3WLQA 1LTRD 2FEKA 1TRHA 2UZ3A 3QW2A 1ZIXA 1ICWA 5ER9A 4CHTB 3ICQB 4D98A 1I9GA 1ESMA 4NC9A 3PXDA 4ZKCB 1I36A 2CNNA 1HR0L 1X9GA 4DBLE 2CUZA 1PR0A 5HFAA 4G81A 1WUJS 2ZCJA 2EHDA 1L7AA 2G8NA 1FF9A 1E9FA 1TYAE 3GG2A 3AVTA 4FC7A 2J3IA 5DWQA 2HAEA 1KMNA 1Y7PA 3KJOA 4X0EA 2MHCA 3GXBA 2TYSB 4XCVA 3TXAA 2ZWVA 3JQBC 4RHUA 1JR2A 2HBZA 1REQB 2CWDA 3HBMA 4AJEA 4BWVA 3TEHB 1BGVA 1LI4A 5I9LA 1G63A 4MGZR 1TEZA 3S1QH 4GI1A 2I8CA 4D81A 5ALKA 3H13A 1LT3D 2UZ1A 4LJLA 3UUFA 4JI7B 4JB2A 4H0FA 4NENB 3T15A 2Z8ZA 5BWOA 3BZKA 3JQAA 2DN8A 4RANA 4EB6B 4YRDA 1ZW1A 1SWWA 1W8DA 3HN7A 5IUNC 2XDWA 3UG7A 4RM2A 3VDNB 4S2EA 2JFPA 3WMFA 1H5NA 4LF4L 2P8JA 1P44A 1K9VF 3WLIA 1EK0A 3EVGA 1P4SA 3ZWMA 1Q95A 3LX0A 3L7BA 1YI0A 3NHFA 1YKGA 3SS7X 5JO0A 3OLXA 5T4BA 1ZW6A 4LAFA 4ILWA 4BMYA 1ONNA 1D6EC 3GUUA 3O3CA 3H0GB 1TCCA 5AVVA 2QUHA 1S3OA 3GRPA 3E9NA 3FTDA 3O4GA 4YMHA 1Z2DA 1C7JA 1M1YB 5LP6B 5LXTA 1YFLA 3O8QA 2WB4A 3KQOA 5KAPA 1U9YA 4IGKA 3BGDA 2BCJQ 2ETVA 5G3ZA 1CVLA 4R3UC 2PRKA 2PKXA 4V24A 3QVMA 5K0EA 4LNHA 4YQYA 4YQFA 3BMNB 1RYMA 5LMUQ 4B3TL 1VQFA 2E18A 5LFAA 1I7NA 5B3LA 1AW7A 3NAQA 1ODLA 3TQFA 5LR6A 2A6PA 1CS4C 3BS1A 2FHTA 5TQ2B 3ZG6A 2WHXA 1B3QA 2ZM6L 1Z4IA 2G5PA 1JN0A 4WIAA 2O0MA 5C3XA 4JUCA 4GOMD 3IR6A 3THXB 3HE3A 4XLTA 1E3IA 4QLBA 5BPFA 5GTDA 5EMLA 3DBLB 3WDSA 5E1FA 4RSGA 3V4FA 2C20A 4JVZA 4F2DA 3VR5D 3H15A 2XY4A 1XBTA 2F9FA 4HMJA 5ESRA 4DCTA 2NP6A 2ZBGA 2KWIA 3O2NA 2R1ZA 2AQKA 2A9QA 2ECKA 1BD3A 4OK3A 3CSSA 1TJ3A 2XZLA 5H0IA 3L41A 3GUZA 3BL5A 4Y6PA 1EVIA 1SQ0A 2F1IA 3MWYW 3O0DA 3DHNA 4Z7NB 1PR9A 4HR7B 3QWIA 1V5GA 1IJFA 2YZMA 3OESA 2KLBA 2KBNA 2NSLA 3L1JA 4Y2PA 4EG0A 4OX9L 4DR3L 3B5EA 3VR4A 1DEOA 1PT9A 4DNTB 2WWWA 5FXMA 1E3LA 4ZYWA 5CGKA 2OQ0A 5CM9C 3UQYS 4FT2A 5FRDA 2RGNA 1IONA 2YC4C 3CKKA 5KTRA 3AIIA 3CFYA 2Q9AA 4PFJA 4JBYA 3KFLA 4C06A 5C5EA 3CQZB 1AQJA 3H0KA 4FP9A 4W1QA 3R6WA 4B6OA 2Z08A 1I6VC 3B6JA 3P52A 5C4JH 1HI9A 4E07A 3L4BC 5IJ9B 4JZKA 2PW7A 5IEJA 1ADFA 4CM1A 1EIGA 1Q90A 3VC3A 1WTOA 4NXNL 5E7JA 1VJGA 2HT6A 4AH6A 4D79A 1B50A 5AJ3L 4NH0A 4ARIA 3TBHA 2JGMA 1SVKA 3PUVA 3B6IA 4JODA 4C3OB 3PGXA 1HC7A 4NCXA 2ZDGA 1U0BB 2TSYB 4U1RA 3HOZG 1TVMA 4TYPA 4HAIA 1XT6A 1P2DA 2I99A 3E03A 1TB4A 1K28A 3T06B 2JLUA 3LC0A 1M2NA 1KNQA 4I1VA 1CF9A 5DM60 3R6GA 4HGZA 1NG9A 2IYVA 4O4HF 4J07A 5KB3A 1PEAA 3FFAA 2E2IB 4TTVA 421PA 4G4KA 4GI3A 2MSCB 4YJFA 2SECE 5B1SA 3TW6A 3B6EA 4W8OA 3ABSB 4LEIA 4JLBA 5K0ZA 5D1HA 5JPCA 3F73A 1IBLQ 1T5TA 4RELA 3B3GA 1UC9A 1FLNA 2FSVA 2C5FA 4IF4A 4X8OA 1M34B 2GPBA 1KGDA 1IK6A 3CTMA 4WASA 1DWPA 3GEMA 2OCAA 3NUZA 5JSHA 3BSWA 1Y6RA 4JNKA 2X15A 1AA9A 4Z7JA 3GP3A 2OSVA 3CN7A 1VRVA 2IZ1A 4PFSA 2F8SA 4X20A 5G41A 4QIWE 1USIA 5JROA 2J5KA 2O2DA 3QSYA 1SEBD 1CTQA 3OT1A 4NZNA 1VLMA 3GJRA 3G0GA 3X1WA 1AKYA 4MW4A 3DVSX 1JFFB 1T9GR 5B30A 2R7ZB 1FSSA 1MO4A 3CRNA 3RIGA 3U7EB 5LYJA 2DQKA 3CH4B 4DLRA 4V0SA 2FZ4A 2H85A 3RDPA 1VCMA 3KT3A 2YJZA 3LPLA 3CW9A 4G0UA 2IIBA 3S4YA 3D2AA 3FYUA 2JXMB 2IPAB 3FZYA 1LTBD 3QPUA 3LUAA 1U98A 3K73O 5DB4A 4EJSC 3DS8A 3NGLA 2CF6A 1EQQA 1E1QA 3U4VA 2HA6A 1UBUS 3ER6A 3GLFB 4C3IH 3RS0A 3UYLA 1IY9A 2FSGA 2I1WA 1G5RA 2V6FA 3SJUA 2HU7A 3UANA 1IQRA 3AWIA 1P2BA 5IT0A 2RGWA 4DK6C 1LBIA 2R00C 4DTIA 1N9GB 1AXEA 2PZAA 3LY8A 3ICWA 1XZEA 1X0XA 4OGFA 5C1BA 2AKEA 1OKKD 3HOXB 3MG9A 1D4AA 1Y0BA 2MSWA 1RXSA 4Y1GA 4M9CA 1AZPA 5FIUA 5FWYB 1FNSA 3G7SA 5JJBA 4TXMA 4E31A 4UHKA 4OIJA 4FCCA 4FGLA 1RHJA 1S5DD 5KNBD 2PJUA 3I58A 2OVBA 4BATA 5TF4A 9LDBA 2HSGA 5JCZA 4MA5A 4LE2A 4O1MA 3URMA 4GIBA 3CLRD 1JAZA 5IAAA 4WERA 3QKRA 1KIAA 5C3EH 4DR2B 3O9ZA 5MGBA 2FJUA 3VKVA 2FMCA 3SP1A 4OLFA 4XGKA 4OP1A 5ECGC 3RJZA 4RU1A 2FTKE 3KOZA 5I7VA 5JJLA 4GGPA 5JSYA 1YJCA 5C35A 5CVUA 4ETMA 2O4XA 5JCXA 2CL0X 4PX2A 1N2JA 3LKZA 2FWIA 5A6SA 3HVHA 1HK7A 1VLVA 5IODA 2VK4A 3LKVA 2FLKA 2HEIA 2VL7A 2Z2KA 3KYBA 1LBTA 3MJVA 3S1NH 1S9HA 1HTLD 6GPBA 1BG6A 2ZZKA 5HZKA 1RVV1 4HO1X 2H3HA 2AR7A 1E1RD 1UDXA 3BFXA 2L42A 3ZZ1A 2WZQA 1BN6A 4K5QA 5SV2A 2JLVA 3D6JA 5LA6B 1XTRA 2HDWA 1AHNA 1QWSA 1K9MC 6LDHA 5EXPA 1K63A 1K66A 4QTZA 1SM4A 3OZRA 3UUGA 4E15A 1T4CA 2PFKA 1D04A 1QZXA 1QRTA 2KECA 1V2HE 4PLZA 3GVHA 4FF1A 1FYDA 5LQDA 1QV7A 2W7TA 4OX9Y 3ZJ5A 2HF7A 5AKXA 3G2KA 4IMIB 3RT7A 2VUSA 4IQZA 2G9DA 2JASA 3FNHA 5L3SB 4LG1A 4DXFA 3IQXA 1PW7A 1J2RA 4MQFB 4BO0A 3DBOB 2EJWA 4HYEA 4Z0NA 1AS0A 3VH4A 2ENBA 1FUIA 1OLOA 1WA5A 3PNLA 1BD4A 1QIIA 4YRKA 3HA5A 2VPQA 3CXCA 1HHVA 5A2QL 5FJ8G 3AR5A 4RFSB 4UM9B 2D1QA 4DJJA 5B55A 3VYWA 2D0PB 1NIJA 3EEBA 1QH8B 4DV0B 1J42A 3HB7A 5FTJA 3PWSA 3QELB 4P81A 3IOYA 2IS2A 1ZU5A 1S6YA 1AMUA 3NGMA 2YNMD 4PGAA 1M73E 4NMXB 4PZ7A 3SQLA 2NN6G 1QDUA 1X7WA 3H5VA 4NDAA 3ZWNA 3DMPA 3U60B 3FGPA 4OJKA 4Q3LA 4HDSA 2VOEA 2GCGA 3H87A 3R5XA 1GO2A 5M5WH 1NVVQ 3GCDA 2HK9A 3GRRA 3QLUC 5IM5A 1HTWA 5THXA 4RA6B 1U7UA 3QJ5A 2ZBDA 3RSFA 3CXRA 2QLJA 1DUVG 3PF8A 1XMXA 3QG1A 4LV6A 2XJ9A 2UUCB 5AI4A 3TRHA 5KVCA 3EZ6A 1T24A 1J56A 1LUZA 4YJGA 4FJ0A 1V5EA 3GJ5A 2MYUA 3V3KA 1OD6A 3OKFA 4EHAA 4TYNA 3GO4A 3ULKA 2OF1A 4AUMA 1GRQA 2X0RA 1G4AE 2DGDA 5DNAA 1PYOA 1E9DA 2KSQA 4DV2B 2AK3A 2D6FA 2PS3A 4MV6A 3QFRA 2XNHA 2CD9A 2EL9A 1PZFA 1OZFA 4CEHB 2VA8A 4A1FA 2C5HA 2AW3A 3EOBI 4P3NA 3HU5A 4LJZC 1X8XA 3EW9A 4EJ6A 4W5JA 4YP7A 1G6HA 4JGGA 3UHAA 4FYIA 2WIIB 4QJ5A 2Z1CA 3A6KA 4M1WA 5CVCA 3UHPA 5L53A 4ZJYA 1QE6A 4DLUA 5IM4F 2PA3A 5ALXA 4B45A 2BFFB 4WSOA 3A0UA 1X2BA 1IBMQ 1GPNA 3L7AA 3MJ4A 4KO8A 4R16A 3AR7A 3TCKA 1QOHA 3PQFA 3NHWA 1V95A 2DMRA 3H1FA 1Y7IA 2XMQA 3ORSA 4N9QA 3RYHB 4XD7D 3RI3A 2ZB4A 3NDIA 2IHYA 2QVYX 1KRXA 3QYPA 3RHSA 2PIAA 3LO8A 1PT5A 5LIPA 1J8QA 4PINA 2H0QA 4K0KL 3PT5A 4HWRA 4HEQA 2A2ZA 4NCHA 1VHJA 2ZSEA 2F3RA 2CFSA 1C8KA 4Z4CA 1ZIDA 5E4FA 2C4UA 4QDXA 4CG3A 2D0OA 4D8WA 4R9WA 4E7PA 4B4UA 3V80A 1KE2A 1RHMA 1YIOA 4LE0A 5HJ5A 4GX2A 5K9ZA 4AYBB 4OXQA 1E5DA 1RD4A 2E2HH 1U81A 4OHMA 3AYZB 4EJ2A 2ZGVA 4AF7A 2D1YA 2EJFC 4I99A 4RCOA 2HLHA 4AMYA 2E74C 2QX4A 2XZPA 4NV3A 5KHLB 2PH7A 5ANRB 3N74A 1IVSA 5T3YA 1E1KA 2YWHA 5GADl 1AUQA 3VR6H 4C2BA 2XMZA 4P80A 4W9RA 4DIUA 4YO8A 2XD4A 1EVLA 5L45A 2XB4A 2ZRAA 3ULLA 3CU5A 1L4LA 3KQUA 3H2KA 1C4KA 1KR5A 4I1IA 3M1LA 1SNQA 4CL3A 3F5FA 5EXTA 2A1AA 4WDQA 3GU3A 4KNWA 3LUCA 1JIVA 2QB5A 2X5OA 4YJKA 3ZEAA 4WRRA 2B8JA 3ZBUA 3KVYA 3C14C 3V8VA 1ZM7A 5KTSA 2C4KA 4U8GA 4HB2A 2QRPA 1EDBA 1BIFA 3Q10A 2ZIZA 3WX0A 1SCBA 5LMCA 4Z0HO 1DUSA 1Q21A 3FI0A 4XQ0A 5BORA 4PR3A 4JROA 2P90A 4JCOA 4ZQEA 5JCPA 4B81A 4PPYA 4D0NA 4N76A 5IJZA 1JNYA 4IJHA 1B8NA 1PKXA 4CHTA 4MB0A 1S2NA 3GV6A 2ZWAA 4OQ4A 2NN6I 1FTYA 2FR0A 3CB2A 1CHQD 2C9CA 3U62A 3O74A 3HWSA 2FMMA 4DV4L 1L0WA 2HTFA 3JS5A 5BR1A 4DPKA 4H1WA 4GC9A 4ZOEA 1JR6A 1OYWA 1AZLA 3L07A 3PIRA 4AP5A 5T57A 2PRYA 1TCVA 1W4CA 1ZCBA 3WZLA 4ALPA 5FPSA 1SE8A 2FFJA 1G60A 1X1QA 2IDKA 3AUYA 1MORA 2QLLA 2I2CA 2V4UA 1NN0A 3EZNA 1U2GC 2IKQA 1YCHA 3UENA 2GGSA 1SE3A 3L79A 1T3ZA 3CZ9A 1BJKA 4BO1A 5BMVF 1QZTA 3FR8A 4A3MH 1REQA 2AWOA 1NI3A 2ZUWA 4DABA 4PTYA 1ZNYA 5GOZA 3RB8A 4RPCA 3H5IA 3BCSA 1VHDA 1ZSYA 2R61A 6REQA 2X3YA 4RZXA 5U4XA 4HVTA 4B31A 2D13A 4O02B 2QORA 3LCJA 3WISA 4GSYA 2DECA 3U09A 4GOPB 2YINC 2F1JA 4HWSA 1Q2XA 4EB6A 4NE7A 4H02A 1NPTO 1U7ZA 4Z9AA 3GTMB 3BB3A 1N78A 3TOXA 4P54A 1WOCA 3PO2H 2G82A 4OREX 4G4GA 1BA2A 3G23A 2FDRA 2L19A 4H6WA 5GADC 2WB1G 4WXMA 5ARBA 3WZ2A 1WI5A 3JZDA 3N1UA 5AI8A 1HETA 2NIPA 4OP3A 2QDBA 1G64A 3E8SA 1DOKA 3VO9A 1U3CA 4H6XA 3KQKA 4KR6A 2ZAIA 4NECA 1AKUA 2XRFA 2BEJA 1GDTA 4IIGA 2Y0PA 4QICA 5IWCA 3K20A 5LP6A 4OSPA 3MHPA 5JVG3 3TZQA 2PZUA 4Q01A 2J6HA 4TN1A 1IZYA 4KR0A 1MAVA 5A0VA 3PC2A 3BMNA 4DNXA 4D9MA 4WNYA 1N36L 1W49A 3PKIA 2TMGA 2PUBA 2ZITA 3MVEA 2P1DA 3BT7A 4MCIA 5IWAL 4X7BA 5TQ2A 1JWAB 2O2GA 1J23A 1ZM3A 1K83H 4AULA 3OPOA 3AEVA 1C80A 3URYA 4IXDA 5ALMA 2Q5EA 4FGUA 4FCWA 2OILA 4ZRNA 1Y5RA 2Q1XA 3THXA 3TQYA 2Z6KC 2JI8A 1UADA 3RABA 3DBLA 3TBFA 3OEEA 2GJ9A 2ZU0C 4ZICA 1E4VA 2XW6A 5DCWA 5M2QA 3DCYA 3TLJA 3RVNA 4CNQA 1KEPA 3PB3A 5CT6A 4OH1A 4UNIA 3E9MA 5KWSA 2VDNB 5IKXA 2QX6A 1I5EA 4UEJA 2K6GA 3EGXB 5LNK1 1BXTA 1RPJA 3QLVA 1JMYA 4HR7A 1P29A 1W94A 1A3UA 2MFIA 1WV0A 3MHTA 4FF2A 4BFCA 2YJ3A 5H7XA 2F6RA 4ER0A 4AO7A 3M6WA 1YVUA 1V1QA 1LBQA 3FDFA 3J80i 1P3JA 2VRBA 3QLTA 1E66A 2J0TD 1G21A 2EP7A 2W2OA 1TY2A 4GEGA 4PS1A 1CZNA 3MVVA 2BBWA 3NMUF 5T1IA 1VQPA 1HG0A 4ITRC 5CW1A 3HM2A 1UBHS 2BMJA 1G16A 1XZDA 3PIOA 2O23A 1EFPB 2OY0A 3KEGA 5KEEA 2ZFUA 4NL4H 2R84A 1J0AA 1FVOA 3SQMA 1CUKA 1EK1A 4G5RA 3CCSA 4MHTA 1KQ3A 3E5HA 3BYZA 1FBTA 5K6AC 2CB0A 5H5JA 1SCAA 1X14A 2P62A 1JE4A 4M60A 3OT5A 5C0XG 2ZIGA 1EXNA 3FWZA 4JFAA 2CEAA 4JJ4A 5LUAA 2J1LA 3IDOA 3GPBA 1J90A 4Y98A 3K4PA 1CJCA 5PGMA 4RJKA 5JRZA 4EG1A 2FUG6 4DMUB 1IULA 4Y7DA 2YHSA 3W9YA 1HNWL 1GAXA 3RADC 2C92A 4TXHA 3EZ9A 4O2AF 4DKXA 2GX6A 4A3LH 4TKO