1OXSC

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
352
structure length
352
Chain Sequence
b'MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 106
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
C PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxsC03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxsC02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxsC01
3GJ8A 1OFTA 5FPYA 1QHSA 2PZFA 1FPMA 4A8JC 3H1TA 5J5CA 4BLQA 4IFBA 5J4HA 4W5HA 3A8IE 5IP7G 1Y14B 3ETLA 4NMMA 4URYR 4A3KG 5TXGA 1P2VA 2ZRPA 1SKQA 1SVWA 5DNYB 3ZQ6A 2A5YB 4NPSA 4G5QA 3QKRB 1KGDA 4B3SL 1LF5A 1COWA 2WJHA 2ZRDA 3FOZA 2UXDQ 5C0XG 3UG6A 2AXPA 2ODBA 2R6DA 3AEZA 1H9SB 3OEEA 4W5WA 1L1OB 1EWHA 4DK0A 3U3OA 2KWIA 2E87A 1FMLA 4NHOA 2PNHA 1MRNA 4CGZA 4OQXA 1DO0A 2RF4A 4UQOA 1VG0B 2P6UA 3U61B 2BA0A 2ZSBA 1NVVQ 3LAWA 4X8HA 3AH8A 2GJKA 4KXFB 3SYLA 4JI2L 1C4OA 2V4ZA 2O0JA 4HLCA 1OLOA 4L5QA 3S1RH 4XD7D 1CJKC 4DT1A 3RC8A 3B13B 1DAHA 3KYHC 1DARA 2LKCA 2RGAA 2ZJPA 2Q8IB 4RCZA 5ANRB 4N1AA 3WRXC 4A2QA 5IYDG 2FFHA 3PEVA 4WA7A 3W6NA 5LB2A 1MO3A 2VP5A 4DLXA 2VH5R 3BFKA 3FP9A 5JFGA 3W5JA 1E2HA 1SMYC 1N0VC 4HIDA 1G19A 5JS8A 3T1HL 2CNWD 4XVUA 4HSEA 2LSSA 3TE6A 1DAGA 4A3LH 1U8YA 1KNXA 3VR2A 2CCGA 2G3YA 2HF9A 3DZ8A 3LNCA 1AQUA 3BDOA 1U9IC 3CMAA 5BN4A 1KO8A 2E9SA 3FMCA 3I4NG 4OHZA 4B3FX 3GTJH 3K81C 5EP1A 5DN6D 1JPJA 4AIIA 1U99A 1KMHB 1OFUX 2A8VA 4CEJB 2ZAMA 3SBDA 3TKLA 1PH5A 4M1WA 4CEHA 2Q21A 1IW7D 2F4VQ 2J45A 2OTJA 1N5KA 3F2CA 2VQFL 1UKVY 2EFGA 1CR4A 4TT3A 4Z54A 2A68D 1DG1G 1F6BA 2FSIA 1H9JA 4HI0E 4DC9A 4QHYA 4QC2A 1GO3E 2ONKA 3EQLC 1DPFA 1Y8NB 4DV6Q 3R9XA 3QUSA 3I62A 1HH2P 5FR2A 5FBQB 5L8VA 2F6RA 3CCVA 1Q21A 5H1YA 5FL3A 2HLDD 2BCJQ 2WSSA 1G51A 1M6NA 2I4IA 4OYHA 2MSDB 3AKCA 3MWYW 5HZKA 2GF0A 3SNHA 2JA8H 2MMGA 2YOHA 4QHTA 1X3GA 5JBQA 1RRFA 3CRVA 2AKWB 2ID0A 3CAMA 1EFHA 4DR6L 4H02A 1E2MA 4BRUA 4EPVA 1O3YA 3LBIA 1XD9A 1YR7A 1IM2A 1XWIA 3NBZC 4IFEA 2P6RA 1S2MA 3CH4B 5KO2A 3I7FA 1LTQA 1AS3A 3AVXA 2TMKA 3B1WA 3VR6A 1JB1A 4Q9JA 3FFBA 1GTVA 1TNDA 4BGDA 5J4LA 3KQHA 5M3MH 3VU9B 3BFXA 4I1VA 1YVCA 5DE3A 3TVTA 2JJ2D 4NTZA 2XSZD 5C44G 2ZANA 1UEJA 1R5BA 2D2CC 1EWQA 2HIVA 1V43A 2D0OA 1OYWA 1VF5C 2B7CA 5HY6A 1Z0JA 1M7BA 3K80C 2VF8A 3SZRA 3FPPA 2K5VA 5C4XH 4B3MQ 2FZLA 2NZHA 3TREA 1U8AA 2CL6X 2A7QA 4LK2A 2B8FA 4URUR 1Z63A 1E1RA 1ZM4A 4I4LA 3T5DA 3FDIA 5FL7A 1Z6XA 3MLEA 3LO5A 1VDZA 3VR4A 2XTIA 2NZOA 4G5SA 1J7KA 1Z7TA 5CLLA 1GL9B 5D3QA 5JRJA 5SZJA 2WIBA 4TLDA 5A35A 4UP7A 5H1SE 4A8JA 1Y1WH 2PJRA 2WJYA 2UZIR 2ANCA 4MITA 4QXAA 4LK1C 3UIEA 3EIEA 2QBYB 1ZU4A 4HJ7A 3CCQA 4LF8Q 2VNUD 4JBJA 1TUEA 1KJZA 2QRNA 3B9PA 1K0RA 3GLHB 1BIFA 2ZM6L 1YR8A 1N8RC 3IIMA 3NBXX 4JLPA 2FFQA 2NPFA 3K70D 3IFTA 3N6RA 1VHLA 5SZHB 3ZYCA 1CP2A 4NXML 4RVCA 2J0SA 2JJ1D 4LHXA 3M4PA 1DCZA 5HZHA 1X8KA 1KI4A 4HB4A 1E2NA 1VQNA 1YQTA 3CX8A 5K36G 2IYXA 2XITA 1Q12A 4Q4JA 5AJ3L 3UG7A 2V55B 2B8WA 1YVDA 3DZDA 4KYIB 1RRCA 5JWRA 1KK2A 4GKKL 4MDFA 1XJVA 3DKPA 2A6EC 3M4QA 4TLBA 4B3CA 3O8BA 1VG9B 1QBKC 2HCJB 2QNRA 2RGNC 1TX4B 5AUPB 4L5RC 2QENA 1I50H 3RS3A 4II7A 4DUYL 3F5FA 2J7PA 4YMVA 1LF0A 3ULLA 5IYCG 4TLAA 2GCNA 3OIYA 2DFNA 2O52A 1B9MA 2GZDA 3PQCA 4WXRA 1WI5A 3AF2A 3RZDH 4BBSH 1XP8A 4GNKA 1Q86C 2ZXUA 3NEJA 1E0KA 5GJWC 4OGQC 2XJ4A 4B44A 4DNIA 1IYUA 4TWZA 3Q7PA 1U9IA 2CHVA 2YC4C 3U4ZA 1ZUHA 3C5HA 1GILA 1KAOA 2AXNA 2JCSA 1GD7A 4OKSA 4ZKEA 1XEFA 4B2PA 3CRMA 3O47A 2WP8J 3FKQA 4HB3A 2GXUA 4IOCA 4HYYA 4NYIR 1T4GA 2JK8A 1N2CE 3PF4A 1NBMD 1WCMG 4HLQB 3S15H 4A3KH 2EFCB 4CVNA 3R20A 3QJYA 4LHZA 4GZMA 2XXAB 5E7MA 4JI1L 2UXDL 2OHFA 3CNNA 1VQFA 2J46A 1FQKA 3LA6A 4FMCF 2D62A 1ZCAA 3RRNA 1TWFH 4KHPQ 2C03A 3CCMA 5TB5A 3MJRA 3QG1A 5C0XH 1YI2A 3SEAA 2ZVQX 4ZCMA 4QGUA 1PH6A 2DCUA 2ZRNA 1JBKA 1UKEA 4G1UC 5JWOA 1HZBA 1P9WA 2WJVA 5FI0B 3KLRA 1JALA 1Z0DA 4M1OA 4ZDWA 1KL9A 4Q19A 3N70A 1R5NA 2XTMA 1OXXK 2A1AA 2PT7A 3FHTA 3MD0A 2E2HH 1IJFA 3T06B 4U5XA 2G0NA 1YR9A 1CKMA 2G88A 2G77B 3KOJA 1FFHA 1H95A 3CIOA 2H1LA 5IYDH 3ZVMA 4QJ3A 4XVQA 3CPFA 2AD5A 2DY1A 4HB0A 1VQLA 1TEXA 4IPDA 3CONA 1ZU5A 1P4SA 2ODWA 1OXSC 1VQ8A 2OM2A 2NVTH 1FP7A 2Q2HA 1IAQA 1OE0A 3EASA 3Q5DA 4MUBA 5KNBA 4JJZA 4JLAA 5F9FA 1I2MA 3QF4A 3QQ5A 2G1KA 2CFMA 4J0QA 4D4KA 4JG2A 2IY5B 4Q5IA 1YEZA 4TL6A 4D26A 5G3ZA 4R2IA 3DMNA 2C77A 4A9AA 3U4QA 1UEIA 4V0LA 3I4NH 1H8EA 2PBRA 4LJ7A 1X3SA 2OAQ1 3AM1A 1KNQA 1MO6A 2KCTA 2ZYTX 2F4VL 1KI7A 1L7VC 5FLXc 1DAKA 2PQAB 5CM8B 3N2EA 1IHUA 4FWIB 2I3BA 2CCZA 4V0MA 5EQTA 5BN5A 6Q21A 1KQSA 2F3IA 4DR5Q 2E5LQ 3AUXA 2YTVA 4L9SA 3ZVRA 4DLUA 5FLMG 3T1TA 1RC8A 4M1MA 5LDDC 2PCJA 2BVNA 4DV6L 1OIWA 2C95A 2OLKA 4OONA 4RZ2A 4OI1A 5FOXA 2G0TA 1II8A 2JAQA 1C7YA 3VR3A 4MYUA 3KJOA 2QEQA 3K0AA 4DDUA 1L0WA 2CE2X 1N0UA 4JLBA 4DAYB 1FUKA 2IL1A 3K9NA 3EIVA 1KYIA 1L8QA 4Q4LA 1DELA 1IW7C 2A5JA 4QOSA 1MIUA 4LF4Q 2OBMA 2PMKA 3U44B 2ZSFA 4CDGA 1XNJA 3O8RA 1B9NA 1GFIA 2A68C 1WOCA 1UM8A 2BH2A 1KY2A 2RGBA 4R7ZA 1FUUA 4F7WA 4D25A 1EYGA 3FHCB 1O7IA 1RFLA 2IF0A 3I4OA 3TQCA 4EPTA 1COWD 2QORA 2JQOA 1PH1A 4LF6Q 1QHGA 4OK6A 1D8TA 5D3MA 3OEED 2DB3A 3AVUA 4DV2L 4IJHA 3PF5A 1ZNXA 1J99A 2WB1G 4UKDA 2O8EA 1QUQB 5GAEC 1MR3F 1E32A 2ZRMA 3QVVA 4TL8A 3RSOA 2HYDA 2PEYA 4TZ0A 2HQLA 1R8QA 2CVHA 2Q2IA 3QXXA 3R9IA 4W9MC 2QMOA 3JVVA 1TF7A 4ZCLA 3RRMA 4EUNA 1Q8KA 1EFWA 1US8B 4BE7B 4NXNQ 1Z06A 1IY1A 1GL7A 3GJ6A 1SLJA 3C5CA 1IN5A 4DNRB 3QI2A 4NPHA 4A93G 1E6CA 1QVGA 1M1YE 4B3ML 2W00A 1P2UA 1VQCA 1JAIA 2ZS9A 4L8GA 3LX8A 3OHMA 1GUGA 4Y7NH 3UWKA 1F2UB 2OFXA 1NMFA 4TVAB 1R8SA 1RRGA 4LPKA 3SHWA 3CW2C 2Q2UA 3QG5A 2JLSA 2L5TA 4JL8A 4L5BA 4PC6A 1XD8A 5M3FG 4A3JG 2GJAA 2QN6A 2YTYA 1W44A 3NBYC 4CT5A 2V3CC 3NBHB 3G6EA 3HR7A 5L3SA 1DGSA 3P27A 3VA7A 2R7ZG 4TMKA 4QJ5A 4DDWA 5KYKA 2IYZA 4UXHA 3RHFA 2EVWX 4LF8L 2QM7A 2A78A 2WSMA 1P16A 3NC0C 1YHAA 1CRQA 1HZAA 1KK3A 3QENA 5GJVC 1SN8A 2IXGA 1U8ZA 3QPUA 1FJGQ 3RLOA 1NVVR 2IEZA 3T56B 4U02A 4A3DG 3TRZA 4TT3D 3WRYC 4BZPA 2UXBQ 4U7DA 2R93G 4YY3Q 2IYTA 4D4MA 4DVGA 2HF8A 2NVQH 4G7ZC 1FL9A 4WZBE 5AUQA 2B63G 2BA1A 5K36H 1Q0UA 2ZRAA 4Z8YA 2DN8A 4WW0A 5HCIA 4GLAC 1ANKA 4DR2Q 1O7LA 1YZQA 2WKPA 1U0JA 3DM9B 4L9WA 5GADC 4QL5A 2ZS8A 4LUCA 4PTLA 5SZIA 2YWGA 4ITRC 3M6AA 4LF9Q 1HCZA 2ASBA 4POFA 3PIOA 2RB4A 3I92A 4EJSC 4GN5A 2ZJQA 2PT5A 2WSSD 3GTQH 1TF2A 2ZJBA 4LJ5A 2E1RA 5LBIA 4UNNA 1GL6A 4E5UA 4JBXA 4M2LA 1XDBA 1FMJA 3IIJA 4IXNA 4Q1EA 3A5UA 1Z2AA 5IYCH 4IDOA 4YMWA 1J2JA 2OSBA 3IGFA 1ZD9A 3FGNA 1GHKA 1IY2A 3PCOB 4MGZR 2BWJA 4Q7LA 2P3SA 4GDFA 5ELOA 1VF7A 3I2ZA 3CZQA 3UMFA 2HYIC 4HZUB 5B30A 5BQ5A 2IS6A 4JT2A 1GDDA 4IPCA 5AJVB 1MABB 4A6XA 2ATWA 2NN6I 3TAUA 4IPHA 1XNQQ 1VIYA 2NOAA 3AQ4A 1QZGA 1TEVA 4MYTA 3BU2A 1XJ0A 2O8FA 3K0FA 5CLQA 4HAWA 4NU0A 1IBLQ 3C16C 5KDLA 1AQYA 5DI3A 1D2EA 1ONBA 3JZAA 5F3WB 1WCMH 1Z3IX 4D80A 1D6JA 4GN4B 1Z0AA 4RKEA 2WWHA 4C0HA 4PAQA 2OXRA 3MMPA 2QZ4A 5HR5A 2CWPA 4KHPL 3KQLA 2C35B 1XTRA 2GNOA 2OFWA 5FL7D 1GUAA 1OH7A 5KOYA 3B8HA 1QRAA 4EIWA 4F91B 2UUBQ 4TMZA 3D4RA 1VQ6A 3ULJA 3EC2A 5LD2B 1OXUA 2FGKA 2QU8A 1GNRA 2QQ0A 1QHHB 1KKLA 1VG1A 3QIAA 2GILA 2Z4RA 3H4MA 3I4LA 4DAMA 4GBMA 4LBVA 3ZS8A 1YZKA 3GLFA 1D7QA 2A5FA 1SXJB 3I3SR 3P1JA 1VQBA 2BBSA 1E3PA 5KNDA 1Y63A 2GK6A 1JJ2A 1GIAA 3L2PA 1NMYA 2QE7A 5CJPA 4ZPXA 2OQKA 4UNRA 1VIAA 4BY1G 2GBLA 2W2TA 4C0LA 4DIEA 3A58B 2WFWA 1A7JA 1KK1A 1RVDA 3BE4A 1DXMA 4US2R 1E2VA 5JCPA 2PJZA 4Q4HA 1JNYA 4OO1G 2PH1A 4LZZA 4DLWA 1N6RA 3G5UA 1LFDB 1P2SA 3NH6A 4TN1A 1RJ9B 3W5OA 1NNEA 2D5DA 3LBHA 1FTNA 4PC3A 5H8WA 1ZIOA 1LYLA 4DR4L 2DYKA 5CIQA 3CCJA 5GAHC 5L3VA 2I5HA 2KJQA 1J5EQ 4P33A 4KVGA 4B35A 2J7PD 5B58C 1TPZA 2QMUA 721PA 3B60A 4D4JA 3CW2A 2WAXA 2E5LL 4DR5L 1G7TA 1MOZA 1W0JD 1IXSB 1XMIA 2EWWA 4ESVA 5E4FA 5JJLA 4US1R 3H3VH 1VPLA 5FLMH 3J81c 2NO1A 5JLJA 3B5JA 4YWLA 3CNLA 4OQLA 2BM0A 4A3EG 3CF5A 4XWOA 1CXZA 1R2QA 1VKJA 3ZZ0A 3RS2A 3KUDA 4YMTA 1XXHE 2PI2A 2IT1A 1NN3A 3UDGA 2CLSA 3TRFA 3T1QA 3CM0A 4Q9HA 4HAUA 1UWVA 5TDHA 3WXMA 4C3HH 3OW2A 1P60A 1UDXA 2KBEA 4PFSA 4M53A 1ZD1A 3UKDA 4Q21A 2BBWA 5FTJA 3S1AA 3L82B 2R2AA 3PIRA 1WJJA 3U4VA 2K5NA 4LF6L 4Q00A 2CCJA 2MO0A 3CC4A 1P75A 3DEFA 2O8CB 2N78A 2Z43A 4B3GA 2VEDA 2XJ9A 5DSZA 4A0RA 4EFMA 2O8BB 2BJWA 3OFNA 3BH0A 4EJSA 3DOEA 1AZSC 3X1XA 4URVR 1XNRQ 5KSOA 3QKUA 5JJKA 4PX9A 3EZFA 4JSTA 1XZPA 1G7SA 2YNMA 3H84A 3KQUA 3C4JA 3HYRA 2XB4A 4M0LA 2ZJRA 1EK0A 4UNQA 2P0EA 1CTMA 4TSFA 621PA 3AKEA 3ERSX 4IOLA 2XTZA 3LNNA 3KKPA 3F8TA 3K09C 5KTYA 3P20A 2ZITA 3LLUA 4NYIQ 3A1SA 2D2EA 4P73A 5FI1B 4A93H 3R9WA 3EPKA 3CPWA 2KCCA 3UMRA 1G8HA 5B64A 4JI0L 1E9BA 2V7QA 3THXB 1JAHA 1K73C 1T3HA 4WOPA 2WKRA 4C2UA 4D2IA 4JYCA 1HR0Q 4MDEA 1XEXB 2GJ9A 2D0PA 4HIOA 4LW1A 1GUNA 2W2VA 3WBJA 2QI9C 2J9RA 5M3FH 4A3JH 1KAWA 2GK7A 4LBZA 1A63A 1D2NA 2F3RA 2MSEB 1C0AA 121PA 2ASEA 2REBA 2GCOB 4X8MA 2R7ZH 1T8TA 5FOTA 1JR6A 2WWWA 2MFIA 4JI6Q 4KCGA 5KUTA 1H8ED 5EAYA 2VQEQ 1R4AA 2OBNA 4FDBA 4R1JA 3F3YA 3THOA 5M5WH 4BFVA 1OB5A 4X62Q 4OX9Q 1FJGL 2AK2A 4MKHA 5FUYA 3PR1A 2YV5A 1Q7YC 2ZQ5A 1E79D 3B6EA 2UXBL 2QGNA 2J5XA 4O2LA 2XOKA 4YY3L 4IKEA 4R71A 2FNAA 4Y0VA 2GETA 2D2FA 1KO1A 2X2EA 3QXCA 4IRUB 3K0SA 2PCLA 4ACAA 2R93H 4B2LA 2YKGA 4PPQA 1OH8A 5CM9C 4S2EA 3LFUA 4DR2L 3M1IA 2B63H 4TTPA 2JA5G 4Q66C 4RZXA 3GFOA 3GFPA 3L8YA 4V0OA 2UU9Q 4LF9L 3QVUA 5EE9A 4C0KA 2YYZA 1MT0A 4KN4C 4DSTA 5IF9A 2ZTSA 4R98A 1XB2A 3FKSA 4H13C 1KSGA 1S3SA 3W3ZB 4EKDA 2W0MA 1A62A 2OCBA 2JLVA 2VA8A 4ME3A 1IBMQ 1HT1E 5CDFE 1YJNA 4NCIA 1Q22A 1E9FA 1SHKA 3RLFA 1G21E 1BKDR 2VHJA 4DR7L 3GLGB 3A6PC 5JHGB 1IBKQ 4KLZA 4X65Q 4RY2A 1EGAA 2PPBC 3SBEA 1GHJA 1CKEA 1GOTA 4X6AH 1EFTA 4PSKA 5E7JA 2HUPA 2WM9B 4TMTA 1A2KC 5C1BA 1IN4A 1K9MC 3TSWA 1XNQL 1KRTA 1W0KA 2X8AA 4LJYA 3D0FA 1PH8A 3A36A 2JDIA 3QKRA 3ADKA 4LF7Q 4RD6A 2L0XA 1BBUA 3TAHA 3EPHA 1IBLL 3N2IA 3U7FB 3MRSA 4URXR 4AKGA 3H2YA 2NQ2C 1H9SA 4JLVA 3KF8B 3GLIE 1L1OA 3V4RA 2GVAA 1RZ3A 5AR1A 4K0KQ 1KTVA 3TSOA 4CW7A 1E9DA 5C2JB 2CHQA 2CK3A 4KKUA 3ADDA 4BPBA 2OEPA 3FMIA 2UUBL 4A15A 5JECA 1CKNB 4A3FG 1HTPA 4QNMA 1XXHB 2AMCB 1VYVA 4V0KA 2AKAB 2K7VA 1Z9FA 2FJUA 2I1VB 3EZ7A 1I4DD 1HUQA 3I56A 1XJQA 1Z29A 2G6BA 5P21A 4A1FA 1FOEB 4A3GG 2EYUA 1HNXQ 1FW6A 4PZ8A 1IN7A 1CRPA 1IOZA 2O5JC 3AKDA 1YBYA 4MH0R 4DCNA 3AVWA 4L4UA 2PMZE 1GZSA 5CB8A 4EPRA 2WB1E 1G4UR 4YWKA 3L8ZA 3LY5A 5E95A 3U3JA 5C46F 4CF7A 2J0VA 1LABA 3SDZA 1BYUA 2NZ8A 2IS1A 4PC2A 4BY1H 1Z6GA 1J6QA 4IVQA 3D31A 5IRCD 4DLRA 5HCNA 1KMHA 4DZZA 1H9MA 1G3IA 2GHIA 5UKDA 1H8HA 4E09A 2QT0A 4OO1H 3WBKA 2FFAA 1VYTA 1ZM2A 1AK2A 4PQFA 4P71A 1UKYA 2WWGA 3K09A 1UADA 3GLHE 1LVGA 3Q8XB 1N33Q 3PXGA 1J5EL 2IX3A 2NO7A 1RRPA 2XZPA 4I1OA 4DK1A 1Q1EA 4QQBX 3F1ZA 3CCEA 1U2RA 3BRWD 4AIMA 3CPJB 1F5NA 3NH9A 4L5TA 1B23P 2A3RA 1XPOA 4C2TA 4RSGA 2BJVA 1A5TA 1XMQQ 1BYIA 4GLVB 3FPAA 4TYPA 3KFUA 1HR0W 2B21A 1R0WA 2FN4A 4HDCA 1MO5A 2CCKA 4ACBA 2QGQA 4KI0A 4DSNA 4JLOA 4BA1I 1X65A 4POGA 3ASZA 3SJAA 3M9BA 3TS0A 2H57A 4IW3B 4YHHQ 3I72A 1IN8A 2QY9A 3CKLA 3DM5A 1KIXA 1VQKA 4JS0A 1S96A 5M04A 4A3EH 1UBGA 4ZV4A 1NMXA 1UDWA 3QKSA 4RZUA 1OFHA 4HIMA 1Q1QA 2WAYA 1VG8A 2YWFA 2KB0A 3GMTA 2A9KA 2WBLC 1KK0A 2FSGA 1EFRA 3A1UA 1U94A 3ZVNA 4ZCIA 1OKKA 3CX6A 4B43A 2X2FA 1W36C 1S8FA 2WOOA 4C30A 4M4SA 3WYGA 4ASUA 4ARZB 3I61A 1I5FA 3VU9A 1VQDA 3A5ZB 4IFDI 2FF7A 2VTKA 3A37A 3J80c 1E7ZA 2WVJA 1NLYA 3M85A 2IS2A 1TWGH 4RD3A 1E0JA 4ZDIA 4M9ZA 1IXZA 1XNRL 3NENA 3L0OA 3ECCA 1YHBA 1P72A 3L43A 2EDGA 3NBFA 5C4GB 2ZYWX 4Q7MB 5TY0A 4WJ4A 1ZUNB 5SZKB 5JEDA 2IS4A 4AWXA 2F1MA 3IO3A 5IDVA 2OUKA 1GJXA 2ZREA 5FOWA 1E3MA 1CUKA 1W2HA 4LBWA 2NO0A 1FQJA 2J87A 4DK6C 1CJMA 1J8YF 1T3SA 4C4PA 3ZLJA 2ZI3A 3KJGA 1CIPA 1ZAKA 4BECA 4PZ6A 1SE8A 3GEEA 4LBYA 3CLVA 4P72A 4DV4Q 3HOVG 3KL4A 4N0DA 2QE7D 4L15A 1QHIA 1CSQA 3BG3A 3KJEA 4DCSA 4UPAA 3AP1A 3D7MA 3MXNB 1HR0L 2BDTA 2WWYA 1AE2A 4EQ6A 1TU2B 2QBYA 3ICQB 3L0PA 3KDFB 2K33A 2WOJA 4IFDG 1PH9A 4BFSA 1W3SA 2UZ3A 3HR8A 2AD1A 3DVLA 5JEEA 3HOUH 1N6LA 3BZCA 1ZIPA 2NO6A 2W0SA 4UP8A 2OCPA 3GLHA 4MQBA 2GDJA 3CH5A 2OQ0A 2JE6I 3TZUA 1PH3A 4JI6L 1A0IA 2HDNB 1OIXA 4FCTA 4R4OA 4OJQA 2VQEL 4GOPB 1Q82C 3PEUA 3GLIB 3B7GA 4Q4AA 1DTSA 1UE1A 4R4IA 4X62L 4JOIC 5F2EA 4BZXA 4BLTA 4Q7JB 4IDQA 3OPOA 3KB1A 4QL3A 2QEXA 1LTLA 2OZEA 1X3EA 3FHWA 2Q9AA 3KXKA 1PYSB 1KD1C 4PHGA 4H0LC 3BC1A 3AVTA 3T1VA 2Z0SA 2QRZA 1HJPA 4Q1AA 4AKIA 1CLUA 4HAVA 1GSIA 2XNDA 1DS6A 4PAOA 3BD9A 3TW4A 5ELXA 2B92A 1HQCA 4BFZA 3KF6B 1G41A 1DADA 1U98A 4JLKA 2QUZA 5KPJA 2UU9L 1CR2A 1TAGA 2N46A 1JQLB 4QY7A 1T8UA 2Z0MA 3RANA 4E07A 2JA5H 2BV3A 3CR8A 4JV5Q 4KAXA 4GS3A 4FMCB 3A1TA 1BKBA 2R7FA 3NTUA 4PAMA 4PO1A 1VCMA 1EQRA 1CTQA 5FBLB 1YKSA 3BAFA 1G6OA 1XZQA 1IBML 2Z6KC 1FNMA 3TGPA 3SI7A 1Z28A 3E2IA 1E2WA 4QGHA 2ZI9A 3DO6A 1QVFA 1TUIA 5HE9A 3SOPA 4P4SA 1XTKA 1B8AA 4LI0A 1JE5A 3W8RA 1IBKL 4X65L 1NVUQ 1ZYUA 2IYVA 3RDPA 4TYNA 1E2PA 4AKEA 3BJUA 2O8DB 3KJIA 5C4MA 1N6OA 1VQGA 3OFND 1OHHA 1NJIC 1L2TA 3RWMB 5GVSA 1U0LA 4FN5A 2XXAA 1FVIA 4HR7B 3G71A 1HURA 2ODNA 3BB3A 2JA6G 3Q72A 4PR0A 4LF5Q 4TSFD 4A0GA 2VLIA 4N0EA 4RMFA 3I4MG 3Q7QA 5JI2E 4IVPA 4DPGA 4YDSA 5FTNA 2MQHA 2ZE7A 3J7A5 4EFLA 1EX6A 3GP8A 3K9LA 3E9IA 1N36Q 4ZI3A 4GMXA 3X1YA 1TL7C 2V7QD 2NIPA 3KXLA 2R6AA 3BERA 4A3MG 3ZD6A 1SRUA 1Z2CA 1KZGB 2WWIA 3L0SA 1JJVA 2Y0SE 1TMKA 4LSGA 4HDQB 4A3FH 5IHPA 2B6HA 1UBFA 2ZJ8A 2IUUA 4HEJA 3KQKA 1DG3A 1W2GA 2A5GA 1Q46A 1QJOA 3IILA 3PUXA 1N3BA 3NE5B 3VKGA 1II9A 2R44A 1RPZA 1CJUC 4MGKR 3R8CA 1XEWX 4GNXB 3HYTA 3AF3A 3STBD 2VL6A 4A3GH 2WJGA 4MGYR 5AJWA 3ZZUA 2FXQA 3TLXA 2D7DA 2ZJ5A 4G7HC 3LRPA 3R8FA 3RS4A 4BLOA 3IQWA 3EWAA 1RIFA 1WQ1R 3RN2A 5K8UA 4NH0A 5BYKA 2QTHA 4I1SA 2XOKD 1E9SA 4B71A 1KOFA 1QZXA 4HIKA 2GWHA 3CD6A 4AC9A 2XEXA 5EZ6B 5LMNW 4GP6A 4QGGA 1CF4A 3OZXA 4KKSA 4HJAA 2JIZA 2H18A 3QPWA 2H16A 1VQJA 5IP7H 2GESA 2WV9A 3NHBA 2PQAA 4M1SA 3NDBB 1ZM9A 2A69D 2JLQA 4HUTA 2N42A 4IVRA 1YJ9A 3HOYG 1R0YA 1JR3E 4FW9A 3AFPA 3FKSD 3JVUA 5JMTA 1EFCA 2AFHE 1QHYA 4G3XA 4B48A 1HE1C 4XWAA 2L15A 2J3EA 1YHQA 1D9ZA 1XRJA 4LJ9A 4A8JB 5TMPA 2JLXA 1KIMA 3NWJA 2DHRA 3OIVA 3KFXA 3IUYA 2N1BA 3A4LA 3TUJC 1Z0IA 2JA1A 4DUGD 5LD2C 1E9AA 3T5GA 1EG7A 2MMCA 4LFCQ 4YHHL 1T0HB 4B6FA 1HZCA 1ZM7A 3U44A 5KDDA 3UWOA 4KBGA 2VSXA 1LV7A 2EQBA 5BWMA 4BLPA 1G3MA 2P6NA 3KKNA 4PSVA 2CXXA 2PZGA 4A2WA 1G6PA 4QKQA 4JOIA 2WJIA 4QBGB 5H70A 3T61A 4RCNA 1W0KD 1ESMA 2AWNA 2K4KA 3AP2A 4PV1C 1Z8FA 2F43B 2FPLA 2AHOB 2JDID 3EA5A 4JIMA 5KPDA 1SULA 4IOKA 4H9GA 5EE1A 2VW9A 4K8OA 1KHIA 2GEDA 1KI8A 1AS0A 2UUCQ 4Q4JB 2J0QA 1GUOA 4OWWB 2VUMG 2JJ8A 1QUQA 4Q01A 4LV8B 2R6FA 4JVSB 2RGEA 2QROA 2BCGY 2QL6A 4AYXA 2CK3D 2DR3A 4EJSB 4HJ8A 2YOFA 4AQYQ 1OSNA 5EE5B 3W6PA 421PA 3DXJC 4Q18A 3NVAA 5KSPA 4NYJQ 1US8A 1KSJA 1EUJA 4ZIRB 3U60B 1KDOA 5DHFA 3GJ7A 3VQTA 5C3EG 3H15A 2WWFA 4PPNA 2FA9A 2B3GA 4PXAA 4A6PA 3IDQA 2ZUDA 4DLSA 4KITB 2ZAOA 3U7GA 2Z6KA 1F2UA 1MH1A 4RD4A 1DAEA 1E9EA 2DBYA 2K75A 1G1MA 1PUJA 2A5DA 2KHIA 4E22A 4I7ZC 2AK3A 4AK9A 3GO5A 4DV4L 2P2LA 4BLSA 1BVSA 2KA7A 1T91A 1DAIA 3HOWG 1HE8B 3LLMA 1AN0A 4NB3A 3HOVH 5F98A 1Z47A 4TKOB 1HZ9A 4PZYA 2OO7A 3CWQA 1O78A 4V03A 5A4JA 2A6HD 3TH5A 2BKEA 5M5XH 1NSFA 2FMXA 4F92B 3KFVA 1F3OA 1H65A 1KI6B 3CUEF 2A30A 3ZQJA 3HPRA 1U0HC 2WIAA 5DLQE 1E2JA 1NL3A 1H8HD 4FI3C 1P62B 1XMVA 1SXJE 1ZD8A 4ABYA 4D0GA 4LUVA 4MTNA 2VQSA 3CMEA 3HPQA 4BLRA 3I5YA 4H1UA 3H86A 1VQAA 4XJXA 5LMUQ 2QA5A 5EUQB 4TQ9A 3F2BA 1HYQA 3IPXA 1E22A 1X1RA 5EZ5A 1VQ4A 3ND9A 3W3AA 3K8YA 4MGIR 1G7RA 1U5KA 5ELNA 2GBLC 2OG2A 4UJ3A 4ZDJA 5FTLA 2QG6A 4NDZA 1P7CA 3AV0B 3GJ4A 1Z07A 2QAGB 3QE0A 4C3JH 1GP2A 3VFDA 3BJIC 1K3RA 3JZMA 3MGCA 2QPTA 3KX2A 3SJZA 4AYTA 3A0JA 1E2KA 5EJEA 4LJZC 1HPCA 1E4VA 5C44H 1R10A 3KB2A 2V6IA 3SN6A 3AF4A 4ZO4A 2WHXA 4TMWA 1B70B 2EFEB 3LX5A 4RFSB 1OV4A 4WZ6A 1JJGA 2WZQA 4B73A 4QBIA 4JI3Q 3WP0A 4EFNA 1FX0B 1EFRD 4M8NE 2VHUA 3VKHA 3SFZA 1Y69U 4HZUA 3EWSA 1OKKD 5FR1A 4TYYA 5JSZB 1XCPA 5A0FA 3LV8A 1MABA 4ASUD 3AVYA 4FIDA 1SZPA 1CR0A 1KY3A 4ZI2A 2R92G 2EFDB 1JI0A 3ZH9B 5CB6A 2GVDC 8OHMA 4RD2A 2Q3MA 2CBZA 2EW1A 3PUWA 4QIWE 2O0KA 3DL0A 1LM0A 1AJEA 2HJGA 2R9VA 1HA3A 2MO1A 3CRRA 3LW7A 4P4UA 1TWHH 1W2BA 1IONA 4D0LB 4L16A 2PLRA 1EWRA 1BBWA 4DV0Q 4LF5L 2ZSEA 2FSHA 4NBSA 4ON9A 1AS2A 2BHRA 2GEVA 2JA6H 1OF1A 2BEKA 2Q2TA 3FYHA 3U2QA 3ZZTA 4DDTA 1HEIA 1W7AA 2QP4A 4ERNA 4BY7G 2PZEA 1N36L 3I4MH 1BH2A 4N3NA 4F4JA 4X66Q 2AUKA 1NVXQ 3LD9A 3Q9LA 1D5CA 3J7ZC 4FD2A 1QHHA 4K81B 4NCKA 4HLUC 1Q1BA 2PMDA 3OEHA 4LHYA 4PQYA 5G53C 1PVOA 3PSIA 4PSAA 2YVUA 4ZKDA 1ONLA 2ZYUX 2HXYA 1X6OA 1SXJA 3QBTA 2IWHA 4B3BA 4BZQA 2YZ2A 5HPYB 2UUAQ 1BMFA 3Q3JB 3QKTA 4S35A 2K52A 2K5HA 4A3IG 4M9QA 1XFAA 3WY9A 4KV9A 3E0EA 4K46A 4NCNA 3A7AB 3GPLA 4LOAA 2HT6A 4KFTA 4JVMA 1G8FA 2FFBA 2V1XA 4QGFA 1E2GA 5D3MB 3DLLA 1UPTA 2ZSDA 2JLYA 1S9HA 1BO6A 2MSCB 4DLZA 3C41J 2BMDA 5J4YA 1KAGA 2VO1A 4HJ5A 4MUAA 4MRPA 4UP9A 2IF2A 2DGYA 3JAMc 2PLFA 1JT8A 1T5LA 3T53B 4IDNA 1UEBA 1M7GA 5TVKA 3PVSA 2AN9A 1RJ9A 1NF3A 2XNDD 4LHVA 3G82C 4MRVA 4MKIA 1XU4A 2ZIAA 2IXFA 4URZR 4WXPA 2KBNA 3J81k 2IHFA 2ZEJA 4MRNA 1S1MA 1WFQA 1E2EA 3P32A 1X8JA 2J1LA 3OE7A 4A82A 1R0ZA 1K8GA 2R6CA 3DKVA 3STBC 2DPXA 2Z5FA 3GQBA 3OW7A 4LJ4A 5DIFA 4B47A 5K8TA 1N34Q 4TTQA 3SGIA 4A75A 3CZPA 2ZRBA 3HOYH 1E1RD 4A3BG 3B82A 2C04A 3LVRE 3TIFA 2FX3A 3P26A 3FE2A 1XPRA 1YZNA 4KFSA 1TXYA 4HUQB 1NIPA 3SR0A 1VHTA 1GRNA 2IK8A 4HATA 3R7WB 3SYNA 3T34A 1NY6A 4XTRA 3THYB 3TQFA 1KI1A 1VQHA 1P2TA 1WDTA 2UKDA 5AUNB 1A8VA 3UXMA 1VCIA 4IEEA 4OI4A 4AY2A 4LFCL 3J81i 2LWIA 2RHSB 4JBKA 2NN6G 1NY4A 1ZC3A 4QM6A 4DNTB 2ZT9C 2HJVA 2NPIA 4LJ8A 2Q9BA 1YJWA 2A69C 3HWSA 4JI8Q 1UFQA 3BIFA 3M0EA 1OHHD 2GJSA 2JA9A 4LYFA 1P9RA 2VHCA 3AGPA 2NMVA 1NI3A 2C98A 2REOA 1F48A 4OWXB 3SQWA 5BXQC 2XX3A 2IYQA 4BXXG 4UY8C 1AA9A 2UUCL 1JEEA 1GWNA 2IYYA 3BH6A 3CPEA 2Q3HA 4R9UC 3GLGE 2O8BA 1GKHA 821PA 4WJ3M 2VUMH 3HU1A 4BEBA 4PQRA 3B6YA 2F9MA 4PO8A 1OXVA 1XTIA 1A2BA 1VECA 1ZCBA 1I94Q 2ERXA 2IBMA 3CXCA 2VBCA 4KN7C 2YU9H 4B33A 3GEIA 2JEOA 5LPNA 4W5JA 4GFDA 3WWVA 2MNAA 2V9PA 3IBGA 4HAXA 4MA4A 3T1YQ 5JJIA 2W58A 1VQMA 1I4LD 3VX4A 4G5GA 1HQMC 1J8MF 1N5JA 1PH4A 2UXCQ 1W5SA 3CPHA 4Q1FA 4QGAA 5C3EH 4RD0A 5CK4A 2ZTDA 4NZYA 2YOGA 1VYUA 4DSOA 2VP9A 2Z83A 1L1OC 3THXA 1X55A 4IJLA 3WNCA 1TADA 1W36D 1G8YA 1XEXA 3UANA 1NE3A 1NJFA 3RN5A 5IE8A 1CBUA 2RGXA 1IXRA 1ZINA 4GRAA 4Q1CA 3F0TA 2KCMA 4WZAE 2HXSA 1OJLA 3HOWH 5A5GA 2JASA 4UJ5A 2GCOA 2VL7A 4CZ2A 2ZRFA 1OYYA 1R6BX 3U5ZB 4LF4L 1RE0A 4JT4A 2CMKA 4B6EA 4PZZA 1CI3M 1T3LA 2JIZD 2ZJYA 4B3XA 4P0TA 2H5EA 1E1TA 4G01B 1MRSA 4IHQA 2JLZA 2ZVPX 2WAQG 4Y52H 1OH6A 2OILA 1EWIA 1W46A 1YE8A 2N49A 1X9NA 3AGQA 2XGTA 2K32A 1SMXA 4HLUA 5JZVA 3KQNA 1E2FA 1WA5A 5E3HA 3NDPA 1L4UA 3GTOH 1JXOA 1KMQA 2EJMA 2A6HC 5IT5A 5J4VA 1NBME 1IN6A 2YHSA 2QT1A 3HOZG 1S40A 1AIPA 1B7YB 1Q57A 4H44C 2OTLA 2ERYA 3U4QB 2QAJA 4NXNL 3CF6R 3QEOA 2FDCA 3THWB 3K0EA 1SVOA 3C7KA 3WHLA 5IYBG 5EP4A 4BEJA 3T1HQ 4DK3C 2NTYC 4PC7A 2VRWA 4AYWA 1XTSA 3B78A 4OXPA 2O5IC 3LQQA 2WJJA 4V0NA 4YMSA 2VSOA 4JI3L 4EDHA 1WF3A 2IWRA 3LVQE 4RG1A 4TL7A 1GUTA 3NG1A 3S1QH 3RABA 4BQSA 3L2OB 1FP6A 2N8NA 2IYSA 5HKKA 1IBRA 2EFHB 2BEJA 2OXCA 5KSZA 1F60A 3G4SA 1NVWQ 2XAUA 3WNDA 5JEAJ 2JJ1A 2NO9A 3KUCA 3MSXA 3PFIA 2RHQB 4IFDJ 1N6HA 2JA7G 3CB4A 4P3YA 2ONJA 5KSYA 3K0XA 1XCGB 3WMEA 3D6TB 1JXMA 3KTAB 1XD2B 2ZUCA 2XZOA 4LNQA 4P32A 2R92H 3OF5A 1I6HH 2EJGC 5M5YH 2AX4A 2VHTA 4AURA 3I5XA 3BFVA 4URWR 2GEUA 3FTQA 4DV0L 1P3JA 4JBMA 3BB1A 4XOIA 3MAAC 1N5LA 4D82A 2KBFA 3X1DA 4JCVE 1SVKA 1RYHA 3A7LA 4A3DH 4A0HA 1S0UA 2FEMA 1N5IA 3K0CA 3QNUA 4LWZA 5FOVA 2HT1A 5C18A 3M4YA 1CKNA 1X1SA 2GAOA 2PX3A 3HOXG 1YZUA 4X66L 3A4MA 2F9LA 4DV3Q 4BY7H 1NJGA 1XXHA 2X77A 4FCWA 4UNSA 3X2SA 4WIAA 4D81A 1H9KA 3Q85A 3QXHA 4YDHB 4ESHA 1AZTA 1SQ5A 2EQSA 2ATVA 1WMSA 2ZI7A 1EOVA 2F1JA 2RGCA 1UAAA 3AUYA 4JLJA 3NEYA 2UUAL 1GG2A 1W5TA 1OT3A 3RRYA 2C9YA 4GMDA 2IYWA 4M1YA 3RLNA 2EIFA 5M3MG 1VQPA 1G5RA 4CIDA 5AUOB 3S1AB 4A3IH 4Z8XA 3HGBA 3A8KE 2N3SA 2NVYH 4YCVA 1G9XA 4FINA 5HTKA 5CYPA 3EZ2A 4FMDF 2F3TA 3FMOB 4JBWA 1GM5A 4NYJR 4R2HA 1M74A 4HAZA 3K53A 4QJFA 1OXTA 3PO3G 2HV8A 2CLCX 4XH9B 4DHEA 3M4OH 1QDEA 3AFQA 2WPDA 1NG1A 3CX7A 2QA4A 3K70B 2NG1A 5TARA 3S2DH 4GZYC 2E2JH 1F2TB 1KI9A 1S3GA 4DB2A 2ZSAA 5EXSA 3GD7A 2RGDA 1SR3A 1UE5A 4R4QA 3OIWA 3T12A 3FFAA 3PJRA 4TMXA 1Q1ZA 1OFIA 3RVBA 3ASYA 4JVNA 2VP6A 4DDVA 2OESA 5CK5A 4DXAA 3FMPB 4AKHA 2G1JA 3I1FA 3T15A 1C1YA 1N34L 5JI3E 3AVPA 3VR5A 1NLFA 3BGWA 1P9NA 1ZVQA 4G5RA 5TV2A 3H0GG 1K8MA 3UE0A 4A3BH 1RYFA 2Q6TA 3MEFA 1Q20A 3A1WA 4ILEA 1ZNYA 3SHFA 2HIXA 1AKEA 5L3RA 1E2QA 4JZKA 2W6JA 2KI5A 2OCEA 2F52A 2QTFA 4HB2A 4LYJA 3C15C 3AB9A 1VCOA 4LV5B 1GVPA 1E2LA 4JI8L 3UE1A 2NN6H 5IWAQ 4RKFA 3IRBA 2LCFA 1U81A 2LMCB 4RCYA 4KBFA 1LS1A 4IPGA 2YTXA 1X86B 4LCBA 4C7OB 4GNXC 4ARZA 4EPXA 1VCNA 4RJLA 4YLGA 1W4BA 2QPOA 3GFTA 5DISB 4BXXH 2O0HA 1L2FA 1L4YA 1N6NA 3KJHA 3E70C 3QF7A 4QJ4A 4XSHA 2J59A 2CJWB 3KKQA 4LC1A 3B1XA 5FFMA 1PHJA 1C9OA 2GXAA 2K14A 4CEJA 4UNPA 1I94L 2ZYVX 5C0XI 1GAJA 3J80i 2J41A 3OEHD 3IHLA 4WAUA 4LUOA 2GN5A 3IPYA 2LKDA 2Q3FA 3T1YL 4JL6A 2QMHA 1SXJD 5CDFA 1HT2E 1SKYE 1AM4D 4Q9LA 2UXCL 1BMFD 1E9CA 3K1JA 1Q90A 1PA6A 4OI0A 2DWOA 5FPKA 3K7UC 1TU3A 1XX6A 3CQZH 3HU3A 1MJCA 4YONB 3HKSA 1DAMA 5BW8A 4EX5A 3AYHB 1AGRA 1DD2A 2VS1A 2CDNA 1YNNC 3KDFA 4JLDA 3GEHA 3ZJYC 3KZ1E 3OIUA 4A36A 4DEYA 2ZRHA 2RCNA 4PG3A 3IEUA 4DEXA 2QSYA 2QMEA 2V54A 2ZJ2A 3MWKA 2ZJAA 3SU8A 4GLXA 2V4DA 4JI1Q 4GOPA 1YIJA 3GLIA 1YITA 4YWMA 4APVA 1A82A 2J0UB 4IDPA 4CEIB 4M9XA 3W8NA 3MWJA 3E5HA 4TL9A 4GOXA 1WP9A 3OE7D 2FZ4A 3NHAA 4Q1DA 2PEZA 3T51B 4U00A 3PUZA 4Q9IA 3VHXA 1RIPA 2DUDA 2ODEA 3AP3A 2ZE5A 3RNLA 2K50A 1IYVA 2X1VA 2H92A 4HDOB 4CT4B 4PMWA 3CCSA 4MZ9A 5J3BA 2FG5A 1KI3A 2FEOA 3KF6A 4Q1BA 3LWNA 3RS5A 5L3QB 1BS1A 5FUXA 5LMNQ 3EARA 1G4AE 1JQJC 3CWZA 2BMFA 1WB9A 1PMRA 4JL5A 3HOZH 2E76C 1CJVC 2GXSA 4YXWA 2ECKA 3VDYA 2WWXA 4NCHA 3WYAA 5DYGA 3BWDD 1DAFA 3AB3A 4KLNA 3OTOQ 4R4CA 4DIDA 1UF9A 1G7CA 1SVMA 5B57C 5IYBH 1YNJC 1ZMXA 3HJNA 3UMSA 4X8OA 3CF2A 1DEKA 4IQZA 5JEAG 4DUZQ 1NY5A 1S3OA 1G16A 2RAPA 4LDJA 3PEWA 2VHQA 2O8DA 3WYFA 4KLKA 4JJKA 3TUIC 2CHGA 1WXQA 3CRKC 3W5IA 4A92A 1D8LA 1JMCA 1XMSA 3KJPA 4LUZA 4P74A 3GJXC 2BE5C 4DB4A 1ZM3A 4B76A 3NC1C 2JA7H 2H8KA 3NEMA 3REGA 4EPYA 4UXIA 3QPVA 1TQ4A 4OX9L 1E1OA 2X19A 1GKIA 1VMAA 2ZR0A 5JS7A 1WE2A 3EIHA 4DR1Q 3DHWC 1Q81C 3HDTA 1KKMA 2QSZA 3GTLH 1W48A 2QM8A 2RHDA 1R5OA 5EP2A 1M7HA 2ZU0C 4AG6A 4BASA 4A76A 4A4DA 1GVNB 3LQRA 4DT1B 3TW8B 3VNUA 4DV3L 2KHJA 2QAGC 1KJWA 3HOXH 2IYRA 4QFMA 3PO2G 1Z6HA 2OV2A 2ZM5A 2BKUA 4GT1A 1ZNZA 1PH7A 3QKSB 1UJ2A 4IO9A 1KHTA 1KZ7B 4HAYA 3TK1A 4D6PA 2K5UA 4LFBQ 3E9HA 4OL0A 3W6OA 2G83A 1G291 3AVQA 2CE7A 4GNXA 2R7DA 3FKIG 2BM1A 4DV2Q 3U7EB 1XF9A 3KLWA 4NE2A 3GJ3A 1N9WA 4KFRA 2GF9A 4HLDA 4OI2A 3T1OA 5JWHA 1ZYRC 3S16H 3A8TA 3BBPA 4C3ZA 4Z1MD 4BRWA 4B3RQ 1C9KA 2EJFC 2ZPTX 1G3UA 2C9OA 4ALPA 4TQAA 4TQUS 3EA0A 3BB4A 3PO3H 4DV5Q 1N32Q 2BOVA 3MFYA 4GKJQ 4CEHB 3BS4A 1N6IA 4LF7L 1KO7A 1QF9A 1SKYB 3B1VA 3W9YA 1YJ5A 5HE8A 4PC1A 2FOLA 4LX0A 4BFTA 1KO5A 5CJ2A 4RZ3A 4MYCA 4TMVA 4K0KL 3BOSA 2YC2C 2EU8A 1K6MA 1YHNA 3PENA 4IOJA 2QTVB 2ALYB 2AFIE 3QXJA 5KU1A 4EQ6B 2IUSA 4JI5Q 3ZJYA 1FGUA 4C0QC 1PV4A 3UATA 3EW9A 1VQEA 4A3CG 1AGPA 4PHTA 5EXPA 3H0GH 1E9RA 4WBSA 4BUJA 5FBRB 2GJ8A 3K8AA 5HKKD 1HNZQ 3TNFA 2J7KA 3MG9A 2GKSA 2F1RA 3SJBA 1T9HA 1QHNA 4O0MA 3U3MA 2GCPA 2WKQA 4JKYA 3VTKA 2XGJA 2C9CA 3SE0A 2F43A 4Q4AB 1DVRA 2AHOA 4BFYA 3U50C 1G17A 5IWAL 4GOJA 1HNXL 3ER0A 2WAQE 3RRZA 4JI7Q 5GROA 4LPSA 3FHOA 1Y8OB 1K8RA 1JJ7A 2GVBA 1E24A 1HY3A 5CYOA 4I99A 3OYYA 5IK2A 3GTKH 2IYLD 1Z0FA 1BDOA 1KSHA 3DMDA 3WDNA 4P4TA 1Y8PB 4V02A 2GRJA 2HHHQ 1UKZA 3MCAA 2DWPA 4ZIRA 2ZUBA 4KSBA 2ZR7A 5J47A 3ADBA 1E69A 1Z5ZA 3GJ5A 4QRHA 4JI4Q 2YINC 1W0JA 4DLYA 4PO9A 1N33L 1KDTA 5GADl 1WBBA 3TS2A 1ETUA 4JYAQ 3MXUA 4V0ME 1PFSA 1G18A 1Z22A 2IA5A 4PHFA 4PZLA 2DFKB 5FPHA 3G48A 4NONA 4C0AC 3TVDA 4P4SB 1YZTA 4EPWA 2FPMA 2ZI6A 2VY3A 1XMQL 1CR1A 1W4AA 1CSPA 4B3TQ 1I4TD 1JJCB 1PUIA 2V8OA 3MWLA 1D9XA 2B8GA 1KI6A 1NN1A 3P4XA 1EIFA 2KE5A 2WPDD 5GVRA 3QEJA 3ZIAA 4PZ7A 5GJCA 3RWOA 3KKMA 5DLQC 4QM7A 3U9SA 1NSTA 2P67A 3VKWA 1CKOA 1M8PA 1ZW6A 4PPGA 3ZD7A 1SXJC 1V5WA 2WMNB 4IOMA 4TTRA 4DJTA 4XSGA 2E2IH 4DCVA 1VQ7A 5KDOA 2ANBA 2ZTEA 3EXAA 3AKYA 5K8IA 2RH5A 4JK1C 2E74C 2CL7X 3C14C 4M22A 4L8JA 1P8LA 4X64Q 3P4YA 4IEIA 3HKZG 1GNPA 1HQYE 3GJ0A 4QHSA 4G7OC 1X3FA 5HGQA 1UBEA 2QAGA 3I8SA 3LWUA 4FXPA 3ICEA 5FJ8G 4XWKA 2OCAA 1SROA 2JLWA 1Y1VG 3RS0A 5LMNL 4HJ9A 1Z83A 2QPAA 1E1QA 3UDXA 3OAAA 5FUWA 3TQYA 5G40A 5AJZA 3VAAA 4G0NA 3FMFA 3H3VI 2W6JD 4C9BA 4AH6A 1YNXA 1QVAA 1CFMA 2HEIA 1I6VC 4NKRA 2ORVA 2DFTA 1PLLA 3LDAA 4RFSA 1W36B 2XTNA 1T5EA 3PUYA 1PH2A 5KHOC 1FZQA 1HTWA 1FX0A 3OTOL 3BZKA 1OB2A 4DV7Q 2IHYA 3L7ZC 4QBFA 5CIWA 2IC5A 1P73A 1XJCA 5JSZA 3RS7A 1CU1A 4CYMA 2OT3B 3PIPA 4DUZL 4FCVA 4OQFA 2JEBI 2LXKA 1S72A 3GTMH 4DR4Q 5G41A 1EXMA 2BC9A 2XB2A 5JEAH 2GVZC 5BR8Q 4AYBG 4NL4H 5EXTA 4IFDH 5IP9G 5EP3A 3M3YH 2BH8A 5EXXA 3NKVA 4XVRA 3TR0A 4IDHA 1E79A 5H68A 4DCUA 1JR3A 1AE3A 1PZNA 4Q02A 4NCJA 1K83H 2Z6VA 4KYUA 5IT9c 5E7NA 2OAP1 3EZ6A 2AR7A 4O2RA 2IHEA 2B29A 2JATA 1IZ6A 3BH7A 1UE6A 1XMOQ 1NKTA 2ZRGA 1A6XA 4DR1L 4QG7A 3CC7A 3RSLA 3IHWA 1B0UA 3EBEA 1YZLA 3CF0A 5FOUA 5FTMA 3VNVA 2V6JA 4DLTA 2H17A 3LBNA 3A74A 1E2ZA 1CS4C 1G6HA 3EIQA 3BXZA 5EUMA 4NYMR 3SFVA 221PA 2VPPA 1DOAA 4OK3A 1NRJB 3B85A 3Q8DA 3RC3A 4GN3B 4JV5L 3U7HB 3PO2H 1LNZA 1S1CA 2C78A 2VYFA 2ZE6A 4MKFA 4LFBL 2G9NA 3WNBA 3FB4A 4B75A 2QP9X 2EWVA 3RNUA 4CRWB 3OOCA 2BBTA 1LUZA 1ASZA 1FNNA 1GKUB 4Q47A 2ES2A 3PV0A 1QZHA 1VS0A 4DKAC 2BIFA 3TMKA 1H9RA 4JKIA 2D06A 4MYHA 3T35A 3FKIH 2RGNA 3QF4B 4JC0A 4B32A 4BFUA 3NELA 2PCFB 3AQQA 2ATXA 2IEYA 2JGNA 2YWHA 3WHKA 5JRZA 1E98A 4B3RL 4BBRG 2CEAA 4QNRA 3W34A 1K5DA 4B3DA 4BWYA 1IXRC 1PJRA 3O8DA 2F7SA 2B8TA 4DWJA 4DV5L 4O3MA 1Y3AA 2W2XA 2OCYC 1N32L 3WMGA 3JAMi 4GKJL 1ZJ6A 1JECA 1VQIA 2JLRA 1PYBA 1UBCA 4KMUC 1Q3HA 2C99A 2ZRKA 3B1ZA 1M1KC 1N6KA 2GTPA 4Q48A 4LFAQ 1LS6A 1MKYA 4TYQA 4YXWD 1PLJA 4JI0Q 2RHMA 3HU2A 3EPLA 2LXJA 4DLVA 1P61B 1W4CA 2IXEA 1KJYA 2W6IA 3KXIA 3UPUA 1FYCA 4JLNA 1KI2A 4LJAA 2P5SA 4MNOA 5EE3A 1G3RA 1JPNA 3TUZC 4HUQA 2R6GA 2FPKA 1II8B 3R7WA 3LW8A 4MRRA 3THYA 2REXB 2OWOA 1G8PA 2QGZA 4OBEA 4TLEA 4JI5L 2ZR9A 3A1VA 3K0AB 3LH5A 3QXSA 4LGMA 4R4TA 4KODA 1MV5A 4US0R 2H5XA 1CEEA 1ZBDA 1TQ2A 3AEVA 3TJZA 1IJEA 2WTUA 1CJTC 4A3MH 2FWRA 3EC1A 1HNZL 5FTKA 4A3CH 3EN2A 4M1TA 4F4IA 2E75C 3GLFE 3HFZB 2OE2A 3KKOA 1SVLA 4KU4A 1ELOA 1VQ9A 3A4NA 2ZRJA 3Q5EA 3CRW1 4FMBB 3VMFA 1QG4A 1E2IA 4JI7L 1NKSA 1VTKA 3NXSA 1KDPA 3TSZA 2OFOA 2A19A 1TKWB 1S9DA 1NTGA 2GZAA 2JEAI 3FWYA 4JYBA 5FPTA 2O8EB 3ZDQA 1JB7A 4KO8A 2I5MX 1GUSA 3F2DA 2VIIA 3REFA 1NMZA 1D2MA 1TWCH 4DV1Q 1KSFX 4JBYA 1QHXA 2OLJA 2Q0HA 3X1WA 3K70C 2RKOA 1PLKA 1E0AA 2HHHL 1V9PA 1ZUIA 1BOFA 4I1UA 4P31A 2EVBA 5K8LA 1E96A 1YZ6A 2ZS7A 4F4CA 4JI4L 2D7CA 1V8QA 1KO4A 1DE0A 1TF5A 3X1ZA 4JYAL 5CITA 1I3QH 2Q9CA 4LYHA 3TBKA 4TZ6A 4DR7Q 5C4JH 3GTPH 4XTCS 2ZU6A 1Z6AA 5EE0A 4XD7A 3IBYA 1G20E 1M90C 1Q3TA 2OBLA 3SYKA 5L3SB 1ODFA 1LB1B 4B3TL 3K0CC 4KVAA 2F55A 4Q9KA 2F1IA 3TR5A 4P75A 1XBTA 1NN5A 2P5TB 3B1YA 1W1WA 2FGJA 521PA 4O2DA 2O5VA 3KDSE 2B7BA 4DRZA 3J81j 1OTCA 2ZRLA 1TU4A 3GTGH 1XCMA 2PI2E 5J4KA 2AUJD 2AWOA 1ZRHA 3U6KA 2CNWA 4JVLA 4X8LA 4C0SA 2DFLA 4Z1MA 3LXXA 4LWCA 1QG2A 3C8UA 2QP3A 4PPFA 3EZ9A 1HNWQ 2CWAA 4OO1I 2DWQA 1VQ5A 3RYTC 5DN6A 2NVXH 1NG9A 2C5LA 3PG5A 1OIVA 2FU5C 2O8CA 4X64L 3AF0A 5B2ZA 2A2ZA 3I55A 2Y8EA 4IXMA 1IL2A 4C3IH 4AQYL 3LXRA 2IW3A 5BYJA 2ZJZA 1TTTA 1GRQA 3N5CA 4C2MH 1ZNWA 5FJ8H 4DBLC 3QOFA 3THWA 1Z0KA 1Y1VH 3GDEA 1NLZA 2F1HA 1E0SA 3S24A 5AJYA 1QVRA 4GI7A 4YCWA 1X6VA 2ORIA 5DO9A 3TEHB 4RD1A 4DR3Q 2FH5B 4OQNA 4J15A 5JCZA 2HLDA 4RFVA 4DV7L 1Z6TA 4Q03A 2YWEA 2GZHA 4AG5A 4LV6A 1NIJA 4Q7KA 2Z4SA 5G3YA 4GOKA 3IO5A 1TQDA 2RGGA 1JEDA 5BN3A 3D8BA 5IK2D 4Z51A 4FWTA 4AD8A 1KDRA 1LACA 4YCUA 3ZGXA 4BA2I 3IQXA 3RR5A 2CLDX 5DHAA 2GAAA 2IUTA 2ORWA 4DKXA 3S17H 3G0HA 5BR8L 4B3SQ 3PCRB 3UK6A 2CKZB 1XD2A 3K0FB 3KTAA 2H7VA 4BFXA 2O8FB 1AKYA 3EAQA 5DI3B 2IHBA 2ZE8A 3CRQA 2SHKA 4GL2A 5IP9H 1KRSA 1UE7A 1AH9A 4FMDB 3RAPR 3U58A 2ZETA 1M34E 5C0XJ 5LMUL 1P6XA 3ZVLA 2I0QA 1ESNA 1OPXA 1XMJA 2JJ2A 3DDCA 2XSZA 1YU9A 1XMOL 4JLMA 4ZDKA 5DYIA 1QVCA 4OQMA 4JI2Q 3UDIA 4M9SA 3W1BA 3I32A 4OHVA 3RZOH 2CL0X 4LRWA 2QF7A 1E94E 3D3QA 4C0BA 1J70A 1G8GA 3FVQA 1T6NA 4B34A 2VP4A 3GCGA 3H94A 2E8GA 1TWAH 5LB4A 3MJHA 2Y0SG 3SC3A 4A2PA 3GLFB 2VSFA 1P5ZB 2EYQA 4F38A 3U3RA 4C0JA 1FL0A 2NGRA 2PL3A 5FBVB 5IY0A 4TYWA 2BE5D 2DNEA 1GNQA 4A3LG 3VHLB 3ZIAD 2FV8A 4PHHA 1E2DA 3LGJA 2KENA 1WBDA 1N0WA 1TQ6A 1E4YA 1YRAA 2CQOA 4EQ5A 1HH4A 2ZI5A 3BORA 3GLGA 1WRBA 4G5OA 3VX3A 5GAGC 3B9QA 1NMGA 4I81A 4Q4HB 5FBWB 3A8JE 4LJ6A 3W90A 2BDOA 1G5TA 1X8LA 2BMEA 4LHWA 3CP0A 4GP7A 1W47A 1F2TA 4D0NA 3DOFA 3ONWA 4KFUA 3CCUA 1IYJB 4DSUA 1LW7A 2VQFQ 4IJMA 3U3KA 4BBRH 4BFWA 3AVVA 3CBQA 2C96A 2V1CC 1GRRA 3AVOA 3S1NH 3EG5A 4NP6A 1E1QD 2V1UA 1MKHA 3OAAD 5KNCA 5DI9A 4F93B 1U90A 4GOPC 4LFAL 1N25A 4W7SA 1E99A 2BMJA 2PX0A 3CO5A 3SJCA 4LY6A 4TLCA 4AI6A 2WICA 4OHYA 3M7NA 4A0FA 1M2OB 4KSCA 2IX0A 2JA8G 3HOUG 4JSYA 4YC7A 1XTQA 2GXQA 1DO2A 2VP0A 1A1VA 3ND8A 1X56A 2VF7A 3B2EA 1NN0A 1G3QA 1EIYB 1ZKOA 1CULC 2R8RA 1KC8C 2D3WA 2VP2A 4OHWA 4MKGA 3V9PA 3VR1A 1Z08A 2BBOA 3CCLA 4DR6Q 1VQOA 3AF1A 1K8AC 3S1MH 3OESA 3QY0A 2I5LX 4GZLA 4PANA 5DH9A 4E03A 2ZRCA 1OH5A 4O0AA 1V1QA 1SHZA 4QBHA 3CC2A 4HZIA 3SQXA 5DGXA 3DPUA 1ZC4A 5FPSA 3IIKA 1S4QA 2I1QA 1JR3D 3L0IB 2FSFA 4C7OA 2HCBA 2CW0C 1R0XA 4M1KA 3HKZE 1NP6A 5AJXA 1GKYA 3H0KA 2VZAA 1SGWA 3PGZA 1NBMA 2ZTCA 1O87A 2CJWA 1X54A 1SVIA 2XNSA 2IYUA 3QBVA 5AK0A 5FUVA 2JJQA 4DV1L 2ZI4A 5C4XG 3HP1A 4EAQA 2DNCA 4OK5A 3EPJA 2EXDA 1WYDA 1II0A 5AWFC 5E7IA 3UDFA 4A4IA 3S14H 1EFUA 2P65A 2D4HA 5F9HA 1FR3A 1OW3B 4JMPA 1SVSA 5FH9A 4WVFA 4L5SA 3V4FA 4OWTB 4H1VA 4LYAA 1RKBA 3E1SA 1Q44A 1Y1WG 2CVFA 4LC0A 4Y0AA 2PNRC 2GA8A 2C2HA 2FE4A 4OJKA 3IEVA 1T5IA 3ADCA 4DUGA 4KJZA 1SFOH 1XEWY 2ZROA 5FOSA 1R7RA 3K7AH 2WMOB 3PITA 3I73A 3QSYA 2A6ED 3W1GA 2JXMB 4IOAA 1ZP6A 1IQPA 1NBWA 3I8XA 4AYBE 3K9HA 1A4RA 2ZM6Q 1DBSA 5JHHB 3CNOA 4KHZA 3S2HH 1YRBA 1T0JB 1K8OA 1RL2A 1G5PA 2ZRIA 4DCTA 4YMUA 4YQFA 1WCV1 4NXMQ 3WMFA 2JLUA 1I2DA 5GQOA 1RW4A 3BK7A 4B2IA 2J0UA 4CEIA 2D74A 2RMKA 2R62A 3WP1B 3EX7C 2AL7A 2ZJOA 4NYMQ 2KSQA 4GSYA 1EESA 1K5GA 5AJ3Q 1HNWL 3K9GA 4GKKQ 1MO4A 2UVQA 1FTSA 1HV8A 1KXLA 2QQEA 2W83A 1YR6A 4O25A 2C8VA 2W6ID 2YJTD 1YZGA 2R65A 3SS8A 4D4LA 5L3QA 4KKTA 3PEYA 1W49A 2NZJA 4DUYQ 1MJEA 4MRSA 1N6PA 1W4RA 4B74A 1IY0A 3DM3A 1XTDA 3ULPA 2IX1A 4BBSG 3CR7A 4POAA 1J90A 3CRLC 3U6BA 5GJBA 2AKYA 3IKJA 4M21A 3V00A 1XPUA 4GPTA 2XZLA 3PUVA 3MUFA 3CCRA 4XIGS 1EX7A 1R9TH 1G64A 1Z6YA 3NIBA 1LY1A 5J40A 1EQQA 3JC66 1XTJA 1ASYA 1GITA 3O8CA 4UXJA 4DR3L 4OHXA 3ZS9A
chains in the Genus database with same CATH superfamily
3C1TA 4GP9A 1RF2D 4ZN6A 3QU9A 3T0IA 4X7PA 1IKMA 2PKEA 4JCOA 3DLIA 4RVDA 3FPFA 3MK31 4M86A 1YQUA 5KEEA 3AH8A 4KXFB 4NZZA 2V4ZA 4M36A 3G23A 1CJKC 2IDMA 3WRXC 2Q8IB 5IYDG 2CHUA 1MO3A 2E6KA 1KAHA 4G1BA 3BFKA 3TDMA 1KC1A 1BE0A 2G07A 1B26A 5BNTA 1U8YA 3DZ8A 4UAIA 1CF2O 2G9UA 3KJXA 5FJIA 4KP7A 3AHDA 1IW7D 2F4VQ 3K2BA 2VQFL 5DLEA 1Z5VA 3GNTA 2NTEA 4RAUC 1H9JA 2VBFA 2GEJA 4DV6Q 5I5GA 1L9KA 5KYVA 2JA8H 3TG2A 5I9NA 4H02A 3CG0A 2R7AA 3LBIA 4XJVA 5E1MA 1PP4A 1SKUA 1LTQA 2IDZA 1HETA 2TMKA 4NULA 2HIMA 2EOTA 5HMMA 3RYHB 4CKWA 4WLOA 2D2CC 1QYRA 4MVJP 2X6LA 3K80C 4B3MQ 3TREA 4KMMA 1BA2A 4NXNB 1EXVA 3AXSA 4EA7A 4OLAA 4JVZA 2BM8A 4ENVA 1SVNA 3OBBA 3CISA 4HJ7A 1H9BA 4P82A 3EODA 5CURA 3K70D 1H2EA 3BX1A 1QE5A 4O63O 1K88A 1L5ZA 2JJ1D 4DPMA 5K36G 2IYXA 2DRIA 2B8WA 1DX4A 1Y1QA 5I8PA 1VG9B 3CG4A 3WWEA 1I50H 3WRVA 2BF4A 1IU9A 1Q86C 2UDPA 2Z8ZA 2ZWMA 1NXTA 3O13A 3GC6A 1TZCA 4L27A 4DA2A 2FUEA 2V7XA 2VHZA 2WP8J 4WY2A 5AYVA 4AS1A 3IUQA 5EJMA 3G8YA 3KZCA 3CNNA 3LA6A 5T6MA 2EYHA 3NWPA 2CXTA 3F9RA 2WHEA 3KLRA 4P2BA 3VO1A 1KL9A 3MXPA 4PVCA 2F9FA 4FEYA 4B8YA 3O2JA 3KT8A 4UBMA 4BB6A 1GXSA 2B5VA 1PZKD 1VRWA 1XXGA 2IY5B 2B1GA 3OQMA 5D7NA 1GQ2A 4RULA 3MT9A 4LJ7A 4BMOB 1LKZA 2V7GA 3OKAA 4Z86A 2I3BA 2GNAA 4MQFB 3WL5A 1OT5A 5AVKA 1RC8A 2W2OA 3I5MA 1SMKA 2VQDA 4QVKA 3LLVA 3D8GA 4BNVA 5ER6A 4XWWA 3PC3A 4R7ZA 2XLCA 1CJCA 1O7IA 1OROA 1U3DA 4BO4A 2JQOA 4OK6A 3RSFA 4QDOA 3QLJA 4ZOLA 6YASA 2K04A 2CY0A 1TM4E 2QMOA 3D3NA 3UN1A 4L78A 4HVCA 2Z30A 3B7WA 1WCIA 3QI2A 4A93G 5CUQA 3MMSA 3GTJB 4IUTA 4IWNA 3WGHA 4CQLA 2V3CC 3NBYC 1L4KA 1XZDA 1TZJA 3VOTA 1DC5A 2R7ZG 2O3TA 1CLEA 2WQZA 5BMVA 3HZHA 4EYOA 4TRNA 4P7KA 1L4MA 1QFSA 1P6UA 4WZBE 2WYUA 3DZJA 3QOXA 4GLAC 1CP3A 1O7LA 1GCOA 4MHEA 4ITRC 1QB5D 2VUUA 3WJAA 1TF2A 2FZWA 3LF2A 4JBXA 4YO8A 2WR8A 3M5PA 5FEMA 2OZLA 1LBTA 2XAAA 5BQ5A 3DOHA 4LGYA 1XF1A 1U28C 3LX0A 4NPAA 4LF7B 2HSWA 2CWPA 1JG7A 1TUBA 4KV6A 1H42A 1HFGA 2FMIA 1G8ZD 2YS6A 2I2FA 3EGXA 1E6KA 3OZGA 1EVJA 3MVEA 2H54A 2A9PA 4BV2A 1CETA 5K8CA 4LZPA 2WYHA 2XIJA 3G2HA 5ISMA 5DTRA 2ZDHA 1NQWA 3W5OA 4ZA2A 4PC3A 4DR4L 5LLSA 1K3BC 1XR3A 4DSZA 1Z73A 3PPIA 4RA6A 1JT9A 1JEQA 5JJLA 1GLVA 1I2ZA 5L7WA 3H5RA 4ZOLF 4EEXA 2ZYHA 1YJBA 2QJOA 2F0LA 2FAXA 3DXYA 4KQEA 3CM0A 3G9TA 5JG7A 2DPMA 2DUJA 1NXSA 3TMEA 4Q21A 1PYGA 3L1UA 1YDWA 4MUIA 2ATIA 1EVZA 5DSZA 3TNDA 4J7UA 1XV5A 4PX9A 3H84A 1BXGB 5IGFA 2XTZA 3AESA 2ZITA 3E48A 2E6UX 4F4HA 5BMVF 3I4NB 1Y7LA 3W4IA 1WTPA 2R79A 3HJRA 1KPGA 2GJ9A 1TI7A 4OHUA 1A63A 2JAHA 5LDHA 3U7IA 3AFGA 5EAYA 5ALRA 4BFVA 3PR1A 2UXBL 3DA8A 3Q8KA 1G8MA 4IKEA 1QOZA 1FQWA 1YR1A 1MTZA 2J9YB 5CM9C 3O82A 2LY7A 1M0EA 1NJSA 2YV2A 4H2DA 1H6CA 3SM3A 1EUZA 4ZAWA 1U7WA 3NJ8A 4ZRDA 2JLVA 4R1MA 5EHIA 1E9FA 2EBUA 4KLZA 1GHJA 2BFPA 3D64A 3IDOA 4MWZA 4FNAA 3RTDA 1GGKA 1WEHA 3TSOA 2YXNA 1XZCA 3N1UA 1TMOA 1JDBB 4QNMA 4MUHA 4AICA 2FJUA 1HLDA 2R1VB 2JIOA 1HNXQ 1IN7A 3AKDA 5BSRA 1JHXA 1LVHA 2P9BA 5IRCD 3L02A 3B1FA 3CZMA 4DJFC 4MXDA 2FFAA 1RKUA 3UCXA 1RPAA 4KOEC 1OXMA 4UTZA 4KGZA 1DWPA 4KPUB 1P74A 1VMKA 3V34A 1JEAA 3SY8A 4DSNA 1EY6A 1X65A 3SJAA 1CNFA 2R6HA 4IW3B 3HSYA 4U5QA 3LQ1A 2XCOA 3DWFA 5IKXA 5DMXA 2AFVA 2FSGA 1F8UA 2BELA 2IZ5A 3F73A 3PYLA 3GAMA 2Q8QA 5AT1A 3L43A 3L0OA 3OIFA 2PAAA 4UNIA 2ZXEA 2K6AA 2PFSA 3PHHA 2FOIA 5AVJA 2AW5A 3RRXA 3O21A 3CWCA 5C5DA 5JVG3 1X1DA 3QFRA 4ZCQA 4XGIA 2W4QA 4HADA 1ECJA 3VJRA 2C0PA 4Q4AA 1LT3D 3QKIA 2WABA 2RGWA 4M76B 2CUTA 3KB1A 3R3UA 1LTLA 1X3EA 4MCAA 1I9GA 4MICA 2G5GX 4BFZA 1HYBA 1G41A 4X00A 4YJHB 2UU9L 1QP4A 6AT1A 2FMUA 3PP8A 1Q84A 4ZI2A 3JQGB 4RXMA 2V7TA 2C8KA 4IO1A 3VPFA 3PE4A 1VQGA 2ERCA 4G25A 4QQKA 1EFLA 2XGGA 3RVJA 2XXAA 4OU5A 2PWYA 1YZ3A 2BISA 1SK9A 3ZWNA 1Y9JA 2O7VA 4EFLA 1N36Q 3IUJA 4KH1A 3M6VA 2F0HA 4JUIA 2R00C 3CVUA 4QAJA 3V8VA 1D04A 5FWXA 3NE5B 4BWGB 4KVZA 3R7AA 3OWOA 3QJ5A 5LN1A 1OY1A 3GNSA 2ZJ5A 4CCYA 1VBMA 5JNWA 4I4NA 4B71A 2PT6A 5IJXA 2JIZA 2H18A 1C3OB 1A2TA 4OMFG 4FHFA 1BR9A 3QYJA 4XYQA 3JVUA 2AFHE 4ENTA 1W5AA 3ZWKA 3EDQA 2JA1A 5FHRA 5KDDA 2EQBA 3BWCA 1G6PA 4JOIA 1QV6A 3FWNA 1Y1PA 3BQNB 2KVMA 3CJTA 3PQ8A 2VUMG 2JJ8A 4AYXA 1G0OA 3T5CA 1JTEA 1JRLA 3U60B 4NNOA 3ZWDA 2FN9A 5CFNA 3GCZA 4C5CA 4Q3CA 1DAEA 3H1EA 3QVXA 3ESCA 3VSDA 1AY0A 4NB3A 5HKOA 1QKKA 1FVXA 1F3OA 2MOKA 2A30A 1ZRNA 4GLFA 4LDQA 2IOFK 1FNCA 4BLRA 3H86A 4XJXA 3LK6A 3F2BA 2I7TA 4NDZA 1KBQA 4QATA 3WDSA 1K3RA 3MA0A 1FNBA 2F3QA 1XKQA 4XKJA 3KB2A 3ZHUA 2WHXA 5DNUA 5IEBA 3HSKA 2IEGA 1VJ5A 2DFDA 3F97A 3L6RA 1B0PA 2Q0XA 3H7AA 4R84A 3NSWA 1NQOA 2CBZA 3PUWA 4D0LB 4LF5L 2DWCA 1OF1A 4OXQA 2ZAYA 3FYDA 2IP1A 2ROQA 3DZKA 1JDSA 5LOVB 3O1JC 4S35A 1BGXT 3NPAA 4DR6B 4JFAA 4KV9A 3DLAA 3TBIB 2BGWA 1MFPA 3F1KA 3GPLA 4JVMA 4UAJA 5REQA 4FOSA 4MGEA 2LRHA 3C41J 4HJ5A 3NVMB 3SSOA 2FR8C 2YFQA 1GSOA 1R15A 2YJ6A 3TW0A 1GPUA 2ZIAA 1VOTA 2K5DA 4G86A 3PXDA 3UAXA 1C1HA 1D6SA 2XYPA 2FFRA 2GM9A 2CZQA 3UGKA 1P1KA 3BDIA 2EJUA 1TXYA 3BMCB 1JQKA 1VHTA 3BMQB 2X8LA 1KI1A 1VCIA 4LFCL 1ZC3A 1JG3A 1GARA 4OXKA 4LJ8A 5TS2A 4JI8Q 1UJ5A 3H8VA 4OHOA 2NMVA 2GK4A 3DHNA 4ETMA 3AR6A 5AK5A 1JEEA 2O8BA 5KYWA 3OLYA 5FORA 4B75A 3LK7A 5DLYA 1VECA 4H3KB 1YDMA 2V5VA 4H7EA 4OQZA 2W58A 1U3TA 3GZTB 1HQMC 1SHTX 3DOCA 3NQTA 1QANA 2FUG1 2D8AA 3PQFA 3F0TA 5TGZA 4AMYA 1Z4JA 1VMPA 3QX8A 4ZMSA 3UWDA 5EAIA 1IRIA 5IXYA 4E6IA 4CKEA 1ZGZA 2EJTA 1FYXA 3CF6R 4Q3AA 3K0EA 5IYBG 4TTVA 2VRWA 1XTSA 3V4OA 3DHYA 4TL7A 1GUTA 3S1QH 3DXFA 3GRPA 3RABA 2QTZA 3MRTA 3EUFA 1IBRA 3AF5A 5KSZA 3G4SA 2XAUA 2JJ1A 2W8ZA 5JC8A 4P32A 4WCVA 3OF5A 2EJGC 2AX4A 2VHTA 1FFYA 2VHXA 3LYUA 1LPPA 1C8CA 4D82A 1OU4A 2I9PA 1LT6D 3IVXA 1NJGA 4FCWA 4EF6A 1PKXA 2EKBA 1AZTA 1FDRA 1LK7A 2C9YA 4GMDA 2EIFA 1O57A 2NYUA 1FMFA 4IMIB 2CNKA 3AYZB 3WAJA 1CG6A 4BY9E 3P9PA 3FLMA 3LWDA 3PJDA 1O97D 4MULA 2NN3C 3X3HA 4BAUA 1OWLA 4QFBA 5CK5A 3U4IA 3I2JA 1BHJA 1HDIA 1Z2PX 3WAKA 3F6BX 4G5RA 4ZI7B 4NQRA 1Q20A 3BCRA 1TD1A 3G6KA 2ZCVA 1E5XA 3ROTA 2F52A 1GVPA 1I8TA 4HNAA 1QIFA 4D8WA 4LCBA 5LYYA 4ARZA 3WICA 2QZSA 4X60A 3KELA 4H18A 1E6LA 3E70C 5C0OE 4WBNB 3OLCX 4RTOA 1LPNA 4C3UA 5CDFA 1RQRA 4FGKA 3GUCA 2DWOA 1FUIA 1ZXTA 3LGAA 3KZ1E 3HOYB 1KYXA 4GXQA 2D1RA 1QC5B 3W8NA 1Z18A 2FZ4A 4Q1DA 4EEZA 2KQ3A 3OC0A 1UL1X 3CCSA 1DBQA 1KI3A 5L9AA 3KF6A 1LU9A 5H9WA 3WHPA 1PMRA 1D1TA 3GXBA 4NCHA 3WYAA 4N9WA 4IIJB 3HJNA 3KSMA 1MG0A 3C7TA 3FZGA 3PEWA 3GPCA 3WYFA 3S0JA 3CRKC 2VR1A 1NVMB 1MFZA 1ZONA 3QA3E 4HR7A 2H8KA 4RH0A 3WS7A 1S2IA 5ARBA 2QS9A 1GZ5A 1O58A 1YF3A 2KHJA 1YD7A 2QAGC 3WFZA 3IQFA 1W25A 1YCDA 4GM4A 1KZ7B 2K5UA 3RFCA 5LZ9A 1YCHA 1RBYA 1YKFA 2I5PO 4NE2A 5A04A 1FJ2A 1GZDA 1OZHA 4TQAA 4KNVA 1RTKA 4AM8A 5ALQA 2PUFA 3WLPA 1E5VA 1I5RA 5J5AA 1LV8A 1YJ5A 2VQ6A 4L4ZA 2ALYB 2G6TA 2FSSA 4AMVA 2HSDA 2I7CA 4UZFA 1T9HA 3U3MA 5DV9A 2AHOA 1RJTA 1HNXL 1ICIA 3L0DA 1B6TA 2IHJA 1RODA 1P2DA 4FQ5A 2D0OB 2NVYB 3WTBA 2G9QA 5H0IA 1M0WA 3V8NA 4Z5XA 5GADl 1WBBA 3TS2A 2WU1A 3S8MA 1YZTA 2FPMA 4RLQA 2NM0A 1EIFA 2RK6A 1M8PA 4A10A 1ILEA 1VJGA 2OCLA 3AFIA 2E74C 2CL7X 3K96A 2HV9A 5HGQA 1ISIA 3GZNA 1G5QA 5H83A 4QOFA 2ORVA 4QLOA 3OTQA 3UH1A 2PFGA 5EIBD 4P7BA 2IHYA 4F5ZA 2PZBA 2IC5A 4HG2A 1O8BA 5EI5A 3QMVA 4LG1A 5G41A 2PD3A 1EXMA 2PYKA 5IP9G 3I12A 4J9VA 1PDOA 4FZ5A 4Q02A 3KEQA 2HLPA 2HQBA 2FPIB 3NDIA 4HGPA 1YFKA 4BUZA 3LOPA 4PG7A 2XDQB 2NSDA 1HFKA 4NYMR 5EJAA 4HCJA 1HQDA 1C30B 2VT6A 2VYFA 3LGXA 2BBTA 3Q10A 3PIO3 3TMKA 1DXYA 2D06A 4BJ3A 1UT5A 4BJ1A 2ATXA 4RIGA 4PCLA 1GQQA 5C4ZA 3P45A 3WMGA 4ZVUA 2P2YA 5E6UA 1ZRSA 5BN5B 3OCUA 4MLZA 3L3OC 1F2DA 2G28A 3QLUC 3VR0A 1YCFA 1ADGA 3OFVA 2FPKA 2PZKA 3R6WA 4CUJA 2H5XA 1T2EA 2D54A 1MOSA 1Z8NA 3L46A 4M1TA 4R8MA 1F8FA 2H2FA 4RCVA 1AA6A 1RR6A 3BG5A 1E7MA 1WSWA 5G3LF 4JT8A 3MHPA 2JEAI 3FWYA 3REFA 2YQ4A 3RSZA 1R4MB 3P0RA 1KSFX 3F4LA 3IA7A 4ZCRA 2QQFA 4DMRA 3VYTB 4IQGA 2CHEA 1D4ZA 2GTIA 3EW7A 3COYA 4PXSA 2ILVA 2P5TB 3W7AA 1CNMA 4R9WA 4KACA 3KDSE 5DAUA 2ZM6B 1ZRHA 5FO8B 1AF7A 4XX0B 1SCUB 1K6JA 4X8LA 1B0AA 3LXXA 5KBYA 1QTNA 4LWCA 3HC7A 3EZ9A 3OCVA 4M6WA 1BVHA 3LXRA 1TTTA 4C2MH 3RJZA 4CLOB 1Y1VH 3ZWWA 2F1HA 4FX2A 1E0SA 3KPWA 4UDUC 4MEAA 1T9GR 5KKNB 3CJQA 4RD1A 3B7PA 4DR3Q 4S05A 1G60A 3AHIA 1Z6TA 1LTID 4QQRA 4S0XA 1LACA 3G0IA 2MUYA 4R2LA 1B3QA 1WHSA 1U0SY 1QCDA 2QLBA 3QKWA 5JDIC 1KWKA 3U58A 3G88A 3PRJA 3L0BA 1KHHA 4N5LA 3I32A 4OHVA 3IAFA 1R8XA 4B6SA 3L8DA 1W73A 1TWAH 2EYQA 4EDFA 3OQHA 1RXSA 3TEFA 4PHHA 4WXYB 1BJTA 5FBWB 1NMGA 1GPJA 1PGOA 1F2TA 1W47A 3GGPA 4TRMA 5E4WC 2XD4A 2VLBA 3ESBA 4F93B 4GOPC 2BMJA 2PNJA 3EDYA 2CUNA 1BX3A 5ECYA 4RVGA 3HOUG 1T0PA 1X56A 3UMRA 2R8RA 2WHPA 3UAYA 2J0TD 1VQOA 2OC9A 1SEBD 5FBZA 2PPVA 4RE5A 4QBHA 3SQXA 3O4HA 3T9CA 1U2DA 2NU7B 4Z4FA 4C6HA 4F96A 5G4KB 1GKYA 1PR2A 1O87A 1PAUA 1ODJA 3RVSA 2D4HA 5KHLB 1R6DA 5FH9A 5F1OA 5ILGA 3VVLA 2K03A 4RSRA 3W0LB 3SHVA 1PKEA 1SU7A 2GPBA 4MQ5A 3PITA 1V3QE 4ODGA 4G2NA 3QK7A 3S2HH 5TJHA 4NXMQ 2BFAA 2I87A 2HA4A 3LYAA 4KLAA 1JSXA 2C8VA 2UYOA 2DULA 1S01A 5IDYA 4Y18A 4GF5A 3SS8A 3I2IA 1W49A 3AHCA 4B74A 3DM3A 2RSLA 1DEOA 3U6BA 4XIGS 2DJ5A 1R9TH 3ZS9A 1FDSA 3OJFA 2PUTA 3S3TA 1ZS9A 4A8JC 3D8HA 2NUBA 1P2VA 3FYCA 3AW9A 2B61A 3WZMA 1G66A 1E64A 3V9AA 4V190 1CB7A 4YRFA 1NJ8A 4A5SA 4KEAA 3SYLA 4REQB 4L5QA 4F45A 4D4KA 4F06A 4M55A 5JFGA 3OZAA 1EK6A 3JAME 4MHTA 2NACA 1KNXA 2VXYA 4DDWA 5BN4A 3IKTA 4M1WA 1UKVY 4L2IB 4OUDB 4QWWA 1Y3DE 3PX7A 3DQQA 4MCHA 4K6OA 3ND5A 1HH2P 1FLNA 2R61A 5FBQB 3CCVA 5H1YA 1WXEA 5FCDA 2PAFA 3ZGYA 1XQ9A 1Y9ZA 4N7MA 1BG6A 3W5HA 3CAMA 4AZ0A 1RCFA 1A4UA 5M3MH 2PV0A 5DE3A 3KVVA 1S7CA 4NTZA 2QL5A 2Q49A 4MA5A 4H17A 5BRJA 2CL6X 1Q0PA 3PF8A 4EO9A 1KFKB 1X1BA 3H18A 4L6TB 2XBLA 4D74A 4MYSA 2FDXA 2Z57A 1QR2A 5L95A 5F76A 4I2VA 4CMEA 2HJWA 4R40A 1AGXA 3HXOA 1CF9A 1YVDA 3ZKAA 4X9XA 4ME6A 5A3SA 3M4QA 5AUPB 3D1JA 3RS3A 4YMVA 3QBDA 4H3SA 1E7WA 2Q3JA 3RZDH 3QLTA 4DNIA 4TWZA 4PN7A 1WTWA 3JWHA 4ABNA 1GILA 1KAOA 3PXBA 2JCSA 1CB0A 1XTTA 3CRMA 3E9ZA 4EYKA 4IOCA 1FSSA 3S15H 4PLGA 1A27A 2C3PA 2EFCB 5J2TA 3FR7A 1QZTA 1TWFH 1QO7A 3FJOA 2ZRNA 5ECWA 1EFID 2LFNA 1F4PA 2WE7A 1H2ZA 3WKBA 1R5NA 1K7FB 2PT7A 3KC2A 4HNQA 2A5LA 5L45A 4MGHA 2DY1A 4Q5IA 1K6XA 1YEZA 4ZGBA 3DMNA 1UEIA 3PJFA 1U8XX 2VRCD 2F59A 1NYQA 3PQEA 2ZYTX 1EEHA 1KJNA 3F6RA 2QYOA 1SHU