1OXSC

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 106
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
C PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxsC03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxsC02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxsC01
1YBYA 1X8KA 3BH7A 4P3YA 1SHZA 1U90A 1KDRA 4P4UA 4P32A 1VQMA 1LYLA 4Q5IA 3CW2C 1PA6A 1X8JA 3H0GH 3GTGH 1F48A 1ZM2A 2JA6H 2B6HA 2HCBA 2O0KA 2X2FA 3FB4A 2IYQA 4J0QA 5C4MA 5KUTA 3EG5A 5KDDA 4DNRB 1LV7A 4M1OA 4Y0AA 4HIOA 1IONA 4B47A 3I3SR 3DXJC 4H13C 2Z4SA 1Q20A 1NL3A 2E2JH 4KYUA 4BFYA 2JEOA 1I6HH 2EFCB 3GCGA 4DUGA 4DT1B 3GTQH 4KHZA 3ICQB 4I1VA 4KMUC 3NHAA 2NO7A 3F2BA 1N34Q 4AYBE 2FA9A 2P3SA 4IRUB 1E9FA 1ZNZA 3T1OA 1GFIA 4EFMA 3EZFA 4X65L 4RKEA 1DG3A 2ATVA 1O7IA 3CC2A 4NONA 2WJGA 1AS2A 3FFBA 2CL7X 3LX5A 3KL4A 3B1VA 1OFTA 221PA 1CXZA 3S15H 2EFHB 2ZSDA 3A4LA 3IBYA 2WJIA 2D62A 1HURA 2V1CC 4IDQA 4QG7A 3FHCB 4JCVE 4TMXA 2E76C 1GUSA 4DUZL 1XEXA 3LVRE 4MQBA 3ZIAA 3KQKA 1BDOA 2RHQB 1YVDA 2P5TB 5G41A 2ZRPA 4TLBA 1IYVA 2ES2A 4PX9A 4PFSA 2IHBA 3SFZA 4S35A 2AUKA 3SBEA 2QEXA 1G6OA 4CEJA 1NN5A 1JEEA 2YU9H 4KFSA 3QKRA 4DDWA 3F2CA 2QZ4A 3NH9A 2ODNA 4GN5A 2EYUA 4QNMA 1NMXA 3CR8A 4IKEA 3KKQA 2J7KA 5TDHA 1PFSA 4G5QA 1RKBA 4B35A 1IYJB 1VHTA 1XEFA 4IFDI 2R9VA 2CK3D 1H8EA 1Z9FA 1XEWY 2XTMA 4E5UA 4DR6Q 1H95A 2A6ED 3K8AA 1G3MA 4XVQA 2RMKA 4L5QA 1T3HA 1TWCH 3WP0A 3DZDA 5F3WB 1N25A 5FBVB 2B63G 2ATXA 1DXMA 4BLOA 5CIWA 2OQKA 2IYWA 1Z0AA 1P2TA 3JVUA 2XAUA 1UDXA 3HU3A 4RD3A 4C7OA 4XH9B 4C3ZA 4DDUA 1BIFA 1GKYA 1NF3A 5JRJA 1TQ2A 4L15A 2PMZE 3F2DA 3GQBA 3RLOA 3CC4A 1NN1A 4E22A 3TREA 2ZAMA 1LACA 1H9KA 1MABA 1XD9A 1ZCAA 3FMIA 1O7LA 4I1UA 5C2JB 1WI5A 1CKNA 1XPRA 2WOJA 4URUR 1QDEA 2AHOB 3CPFA 1JEDA 1P7CA 1H9SA 1GTVA 5JJLA 2O5IC 4HIDA 4OX9L 3EC2A 1FUUA 3Q5EA 5TY0A 3I8SA 3QE0A 3KJOA 1HH2P 3EPLA 3D4RA 3SYKA 3T34A 4YMTA 821PA 2PQAA 2BBTA 4M9ZA 2QY9A 5H1SE 3AF0A 1D9XA 4L9WA 2VBCA 3AQQA 4D4MA 1KK2A 5TXGA 1V9PA 3ULJA 3WYFA 5KDOA 2QA4A 4X66L 4QHTA 4LPKA 5EE9A 2OTJA 2WVJA 3EAQA 1U9IA 3DVLA 2QAJA 2JLQA 4LHVA 3OAAA 2P67A 4TQ9A 2BA0A 4JYBA 2D0PA 4I1SA 1J8MF 4DIDA 2V6JA 1YJ5A 4EPYA 4A3GG 4NB3A 4A8JB 3U58A 1B23P 4KLNA 5C4GB 3S17H 3W1GA 2X1VA 2CK3A 2ODEA 4KJZA 1PUIA 4DLRA 2ZRDA 4HEJA 3SS8A 5J4LA 1A1VA 3QPWA 5GJCA 1QVRA 1NJFA 3VKGA 2AXNA 3RR5A 2FE4A 5C0XI 1R0ZA 2VP5A 3ZVMA 3TRFA 1SE8A 2LXKA 1GVNB 2HYDA 2PBRA 1PLJA 2UZ3A 2AR7A 2BM1A 4LDJA 2EJGC 4R2IA 4LF6L 5E3HA 2F9LA 3AUXA 1J6QA 2KA7A 1RYHA 2VH5R 3CF2A 4LF5L 1BO6A 4TL9A 1KRTA 1M1KC 4ZDIA 4MDEA 2D7CA 1E24A 1WQ1R 1VQDA 5E4FA 5K8IA 1KI8A 3GLGB 5KPDA 4OWTB 1XD2A 4L16A 5CB6A 2HIXA 4LUVA 2J3EA 1XMQQ 1GL6A 4F91B 4NKRA 2E2HH 1ZM7A 3GMTA 2JGNA 3QKSB 4WZ6A 1OH6A 5M5XH 3W3AA 3AVQA 3ULPA 4K0KL 5CM8B 4DCSA 1E1RD 2PNRC 3I2ZA 1UKVY 2OCYC 2JJ2D 2VP9A 2V54A 4DLXA 4GOPA 4RZ3A 3WRXC 2IS2A 4PC2A 4LUZA 3I56A 1TX4B 1S4QA 5CK4A 5HPYB 1EFTA 4Q01A 4QGGA 3CF5A 1G6HA 3WRYC 2WICA 4LNQA 2VP0A 4FD2A 1NBME 4LJ7A 1E69A 4EFNA 1CR2A 2C8VA 1KJWA 1SVSA 4MGZR 4HSEA 3ZZUA 1UM8A 3I4NH 4JI5L 2O8BA 4JLNA 3PEWA 1VF5C 4YONB 3EX7C 1YR8A 4C0JA 3WDNA 1RW4A 3FDIA 1JB1A 3KZ1E 1X56A 5GVSA 3W8NA 3CRLC 3UK6A 2L5TA 2GEVA 4TTPA 3K70D 3JC66 2A78A 2N49A 2WWGA 4PHGA 2ZS9A 2D2FA 1IBKL 4C4PA 4EPWA 5F98A 1N32Q 2B92A 3EQLC 3MFYA 2GWHA 4IO9A 4DKAC 4GKJQ 2RGBA 2ZYWX 4P72A 1N6KA 4GLAC 2NO9A 3LA6A 1E0KA 3W6PA 5JZVA 4EJSB 2VQSA 5FPHA 2WAQG 1GOTA 4TWZA 5EAYA 1KSGA 3TK1A 2KCMA 4W7SA 3GJ3A 1GUGA 1KXLA 2IF2A 3LW7A 1P62B 2WKPA 1FNNA 1TTTA 1M74A 3PG5A 3QVVA 4AYXA 1L1OB 5JI3E 1K8AC 1CTMA 5IYCH 1W4BA 2QAGA 1XNJA 4FMCB 1EX7A 2IX1A 1G64A 4TSFD 4H02A 1CP2A 4OK6A 3X1YA 1GVPA 1JR6A 4GKKQ 2BJWA 4KN4C 1JPJA 2C99A 3U60B 2O8CA 4MGIR 4TVAB 1XZQA 3IKJA 2CCKA 4WOPA 1CSPA 2FMXA 4XVRA 4P4SB 4YWMA 5E7IA 4XWKA 4TYNA 2MSDB 3T1YQ 1HR0Q 2FPKA 4RD6A 3ZQJA 2JJ2A 3U50C 2GBLC 1ZU5A 2R7ZH 3TQFA 1HE8B 3KFXA 3A7LA 3KFVA 1VQJA 1N5LA 5KSZA 3THXB 4B3SL 2FEMA 1N6OA 4U02A 2H92A 3A1TA 4JZKA 2ZJRA 1AH9A 5BW8A 1EYGA 1AE3A 1XTIA 4UPAA 4WAUA 1GKUB 1VYUA 3BB1A 5ELNA 3TE6A 4PHHA 3V4FA 3ICEA 4LJ4A 3KQLA 4JL5A 4B2IA 4BASA 3OEED 4JI0Q 4LY6A 4YWKA 1Q8KA 1KK1A 4JLAA 1RRGA 1ZVQA 1IY2A 4NBSA 1EWIA 2A6HC 5B64A 2ORWA 3CO5A 4CT4B 1COWA 1SZPA 4OK3A 4X8LA 5CDFE 3VX4A 2JATA 5EE3A 4BPBA 1FFHA 1NMFA 3S2DH 5EZ6B 3H4MA 1AKYA 2FFBA 2BC9A 2ZI7A 3SNHA 2ZXUA 1O87A 3OTOL 3JVVA 4EIWA 2FFQA 2QE7D 4B32A 1VQ4A 2YNMA 4DV3Q 1G1MA 3Q7PA 3R7WA 3VU9A 1E79D 3TLXA 4RD1A 1DO2A 1G19A 4B43A 3DM3A 1II9A 1L2TA 3KXKA 4OKSA 1PH8A 3KDFA 2ZE6A 3O8DA 4GI7A 1V5WA 5TMPA 4BEBA 1IJEA 1DD2A 4TQUS 1E1OA 2XGJA 2O8FB 3KUDA 1UAAA 4P0TA 4TSFA 2QTHA 2QQEA 2G1JA 4NHOA 4B3CA 4UXJA 4TLEA 5DH9A 1E9CA 4LF7L 3D3QA 2C98A 1II8B 2Z6KC 1TADA 2VHCA 1VG1A 4CRWB 2DB3A 2ZRCA 4ESHA 4CF7A 3HOVG 2AKAB 4QL3A 1KI6B 2DFTA 2NOAA 1RC8A 3AVUA 4OHYA 3CMEA 1TEXA 1WRBA 4DLWA 4KSBA 2R7DA 1KOFA 3IHLA 4KKSA 1FVIA 2ZSEA 4KVGA 4TTQA 4OI1A 4BZXA 3FPAA 3UMSA 3W5JA 1UPTA 3IRBA 1DG1G 1QHYA 1TL7C 2D2EA 4OQNA 4TL6A 4ASUD 3TSWA 4BFSA 3OEEA 2OXCA 4AY2A 1Q3TA 1G4AE 1TF2A 1XBTA 4JI2L 2CQOA 2V6IA 2ZPTX 1A8VA 4HAVA 4WW0A 4A6XA 5DHAA 2KE5A 2R8RA 3EWAA 3C8UA 2P65A 1E2WA 4BA1I 1N0UA 3PSIA 4JLDA 2PNHA 3B60A 3VDYA 4G7ZC 3H84A 2GZAA 1EIYB 3PEUA 4W5WA 2Q2HA 2LCFA 3UIEA 1ZAKA 1ZD8A 2BCGY 4YQFA 1E2JA 3NBHB 4GNKA 3H15A 2Z0SA 5FOTA 2RGGA 3HPRA 2WM9B 1GUOA 3RS0A 3FMCA 4V0NA 4QJFA 1ZNWA 1ZC4A 5IK2A 1Y8OB 5AJ3Q 1QVAA 1WCMG 5EXSA 5FFMA 3LDAA 1R5BA 5IHPA 3T1HQ 1P3JA 4BBSG 3T5DA 4GZMA 2WHXA 3CCEA 5FTJA 2WB1G 4Q1EA 4TN1A 1HQMC 1JAHA 2CW0C 1QF9A 4LFBL 3TGPA 4M1MA 4ZKEA 3ZZ0A 1R0XA 1G7TA 5IYDG 3T1QA 2NO1A 1HZCA 1TU3A 4LF8Q 2A5JA 1Z6HA 3MD0A 1HZ9A 3CH5A 2CL0X 1D6JA 4CGZA 4LFCL 3G48A 1Z6XA 4OYHA 3AVVA 3ZDQA 3U3JA 4A76A 1FJGL 4Q7MB 2IYRA 3NXSA 1W2HA 1M90C 2KCCA 3W6OA 2KI5A 1ZIPA 2OWOA 1VQGA 3C14C 3THOA 4BLSA 4MYCA 1WFQA 5FR1A 3IBGA 4KCGA 2IYSA 3HOZG 4BLTA 4EPXA 2CWAA 1YHBA 3TUJC 5JBQA 1GNRA 5JEAG 3H3VH 4PPQA 4BXXH 1KIMA 4A93G 2DN8A 4G7HC 1OYYA 2CE7A 2WMNB 3B1ZA 2YYZA 2Y0SG 1GP2A 4P74A 2OBMA 2JA8H 3W9YA 2H5EA 5E7JA 4IHQA 4AKHA 1NMGA 1YR7A 1E9DA 3QKUA 1CF4A 4QGFA 4YLGA 1H8HD 4EPVA 2DPXA 4ZDWA 3A36A 4DCUA 1SXJA 2CL6X 1P5ZB 3AKCA 4E07A 5M3MH 1CRQA 4ZV4A 5KSYA 4JLJA 3CXCA 4HB2A 4D25A 2JA5H 2ZITA 2VP4A 4LWCA 1I94L 4BY7H 1R0WA 4ERNA 3A4NA 1US8B 1NY4A 1WP9A 3U44B 1DEKA 1U2RA 4GFDA 1Z22A 3BJIC 3D31A 1XF9A 1ZW6A 5HZKA 5LD2B 1F2UB 2GXUA 4TMKA 3K70C 2JJ1D 2ZETA 1X3SA 4IDHA 2Y8EA 4DR7Q 4A3CG 4M4SA 1I2MA 3T1TA 2QM8A 3UMRA 2F43A 5IYBG 4P33A 1WMSA 4V0ME 1SVLA 1XJCA 2RGCA 3U4VA 4JSYA 4UJ3A 4P73A 1XNQL 4LJYA 1T3SA 4YMVA 2FJUA 3J81k 1VQOA 4PAOA 1BKDR 2O0JA 1PZNA 1GWNA 2REXB 2NN6H 4RG1A 3L0IB 3LWNA 4DV1Q 2QUZA 1T0JB 1CULC 4JI1L 2ODWA 1VQ7A 4HUQA 4LI0A 2XTZA 4LHZA 2AD1A 3RRYA 3TKLA 3K09C 3VKWA 5E95A 5HE8A 4XVUA 2XOKA 4UY8C 5FL3A 4HJ8A 1IN5A 1X86B 2KWIA 3P4XA 1XTRA 2HXSA 1PH5A 1P9NA 1VQPA 1KZGB 4G5GA 1V1QA 4RCZA 4DR2L 3UG6A 2BH8A 4ZPXA 2YTVA 3FMFA 1OV4A 3E9HA 2RHSB 4B3MQ 1GNQA 4HJ5A 3SR0A 1J5EQ 3PEVA 3RS2A 1ZUHA 2BE5D 1AGRA 2FV8A 2QGZA 3L2OB 3KJEA 3I55A 2PPBC 3QIAA 4JYAL 2B7CA 1YJNA 3AF3A 4KITB 3Q72A 5JI2E 1CR4A 3M7NA 1LB1B 2GTPA 4DSOA 2UXCQ 4IOCA 1Q3HA 4BE7B 3A58B 3SGIA 3KKNA 2ALYB 1XMOL 1XEWX 3B13B 2IYLD 2WTUA 3ZS9A 2N46A 1IN6A 4LSGA 5FH9A 1Z63A 5JS7A 5FPTA 1YNJC 2E75C 3GJ5A 4IPGA 1LF0A 4URZR 1VCMA 1Q0UA 2JJ1A 4DR4L 1CJTC 2X2EA 3SI7A 2CHVA 4DK3C 1KAWA 2WWXA 2XJ9A 3OIUA 5FJ8G 2GNOA 4MGYR 1DELA 3UDXA 1UE5A 2O52A 1TF5A 4RMFA 2P6NA 1Z47A 2VQEL 4JVSB 4RSGA 4A2QA 4BY1H 4JI6Q 2HT6A 2VO1A 2WJJA 3LY5A 4H1UA 1E2LA 4DXAA 1QHHB 3M4OH 2GXQA 4WJ4A 1NVVR 1Z6AA 2BMFA 2HLDD 4DV5L 5GADC 1OTCA 2F1RA 3M9BA 3G0HA 1WE2A 1J8YF 4US2R 4EX5A 2PJZA 3DKVA 1HR0W 1A63A 2ZVPX 3GEEA 4DV4Q 1KI4A 3S1AB 1XD2B 2F7SA 4R7ZA 3I92A 1OSNA 2Q9AA 2IWHA 1KNQA 1HYQA 3GLFA 2I1VB 1VQBA 2ZYVX 4EFLA 3ZD6A 2IYUA 2QF7A 1XNRQ 1U99A 3CW2A 1EG7A 2WWWA 3S24A 1IYUA 3WY9A 3STBC 5G3YA 1RFLA 4D4LA 5CJPA 3MSXA 4HLQB 5BR8Q 4OGQC 2ANCA 3U61B 521PA 3C5HA 4MYTA 2NVXH 1HCZA 1RRFA 4JOIC 4QNRA 1G7CA 4C30A 1ZUIA 2ZI5A 3KLRA 4B76A 4DCVA 3TQCA 1N36Q 3MEFA 4QJ4A 1KD1C 3I8XA 1GUAA 4WVFA 3IDQA 2Y0SE 3LRPA 2I1QA 3K0AA 3JZMA 3MGCA 4MRSA 1FX0A 4IXMA 2PX3A 4OO1G 1V43A 3K0FA 4BFUA 4IDPA 1ZM4A 4X62L 5B30A 2C96A 2QPAA 4BGDA 2IY5B 5EP3A 3C41J 2C35B 4NXNL 4EDHA 4WA7A 2QGNA 4QBIA 3OFND 4GN4B 2BA1A 4DV7Q 4DSUA 4A3LG 4ZI3A 1IQPA 3B5JA 1IXRC 3FHOA 4A3FG 1EQQA 4TLCA 3CZPA 4MKIA 3TUIC 3I4MG 2C78A 4R4TA 1Z0JA 3BZKA 3OOCA 1VQKA 3FTQA 4MGKR 2OQ0A 4IPHA 3M4PA 3CCLA 3B1YA 2HLDA 1UEBA 1Y1VG 3GTLH 2V7QD 4Q66C 1J70A 4JKIA 2QPTA 2BBOA 2GJSA 1B7YB 1CR0A 3FKIH 2AMCB 2F1HA 1KY3A 2JLWA 1AE2A 3LGJA 4A3EG 1TMKA 3BORA 1BH2A 1G3UA 1CKOA 2VYFA 4C0BA 4PV1C 3HYTA 1F6BA 2AK3A 2MMGA 3LBIA 3VR3A 3MCAA 3W8RA 2N8NA 3KLWA 1X9NA 1OE0A 3BU2A 1TQ4A 1UBFA 2V8OA 1YZQA 4URWR 3I4OA 1G5PA 3I5XA 1Y14B 3IQXA 4MRRA 1Y1WH 4QBFA 3T51B 5SZKB 1EESA 5L3SB 2R6FA 2JLZA 5C44G 1KIXA 1OIWA 4A92A 4IOAA 2G6BA 3BWDD 4JT2A 421PA 4KVAA 1A82A 4C0KA 5UKDA 3QF7A 5IF9A 2DR3A 1PV4A 4A93H 1W0KD 4A15A 4DSNA 2IXFA 3BBPA 4LHYA 4QBHA 5H70A 1E2GA 4QKQA 1X54A 3EIVA 1K8RA 4B3GA 2IEZA 3G71A 4YHHL 1J99A 3T35A 5CB8A 2FDCA 4HJ9A 1YJ9A 3Q9LA 2VF7A 4I7ZC 4DV2L 2YWGA 4QM6A 4X65Q 4WZAE 1YI2A 3G5UA 3V4RA 4AKEA 3FKQA 3KFUA 4FXPA 4MUBA 4QM7A 4A8JC 1G291 3OFNA 2EXDA 4HAWA 4A3BG 2FU5C 3U6KA 3HOXH 1P9WA 1SVIA 2GK7A 2VRWA 4MRNA 2VPPA 2B8WA 1EWRA 3HPQA 3U4QB 3THYA 1DPFA 1KDOA 3GLGE 2GF9A 2A1AA 1RJ9B 3ZD7A 3U7FB 1Y69U 4R4IA 4OQMA 4M9XA 1BMFD 3V9PA 4A3MH 3MWLA 4PZ8A 4KKTA 3NEYA 1LM0A 1JJ7A 3KDFB 4IJLA 1PVOA 5LMUL 3EIQA 4DIEA 4DAYB 1BS1A 2V7QA 1N3BA 2VP2A 3HYRA 4FINA 3E2IA 1W5TA 1VQ6A 3QPVA 1E32A 4A3JG 2EVBA 2ZU6A 2BM0A 5BN5A 3BC1A 1AQUA 5FPKA 1L2FA 1IBRA 5HKKA 3TEHB 3R9IA 2J0SA 1U5KA 5FBQB 4R4CA 2QP4A 3SOPA 5C3EH 1QVGA 4Z8YA 2BCJQ 3KF6A 1OHHD 3BE4A 3X1ZA 2L15A 3WBJA 2ONKA 1HZAA 4MKGA 4B3XA 2R6DA 4ARZA 1W2BA 1Q1EA 2HXYA 1A4RA 2NQ2C 4PC6A 3EN2A 2QBYB 3IPXA 2GJ8A 2DBYA 1CBUA 3PF4A 1W0KA 2OO7A 5K8LA 2K7VA 4DNIA 4BRWA 2PX0A 1E96A 3GFPA 3B1XA 4X8MA 3QF4A 5LMNL 4DEYA 5JMTA 3VR2A 3EPKA 2HIVA 3ADKA 3LBNA 4OX9Q 2H18A 4O0MA 1HY3A 2KSQA 1AA9A 1E2KA 1E7ZA 2BE5C 1YVCA 2A5GA 3UMFA 4DVGA 3TR0A 4KN7C 4Q4HB 5IDVA 5EXTA 3ETLA 4QHSA 5C4XH 2H17A 3K8YA 4AQYL 5DLQE 1FMLA 3RVBA 621PA 2PT5A 4A82A 4DV6L 2WFWA 5BYJA 1R10A 1TEVA 4BZQA 2WZQA 1YZGA 1A6XA 4EJSC 1ZMXA 4F4IA 2PT7A 4DR1L 4JL6A 4X66Q 4L5SA 2CMKA 1VQNA 2VIIA 2A6HD 4LBYA 4PO1A 5M04A 3FOZA 5FLMG 3KXLA 4JVNA 1BMFA 4LJ5A 4AIMA 4KFRA 4U5XA 4M9SA 3SN6A 2R92G 1Z5ZA 1L1OC 2FZLA 1K5DA 1OXVA 2G0TA 2ZR9A 4DDVA 3K9HA 1QHSA 1G7SA 4IJHA 1YKSA 1YR6A 2XTNA 3CCJA 3NC0C 4UNSA 4YMWA 1QHXA 1GIAA 4CDGA 3OIWA 4LK2A 3PCRB 4CT5A 2NMVA 1FP6A 3D8BA 3CNOA 4MKFA 5LB2A 4FMDB 3MG9A 1L8QA 2Q9CA 1CKMA 2J5XA 2RGNC 2F3TA 3KF8B 3RRZA 3OPOA 2WP8J 5EQTA 2OAP1 4C2TA 3OW2A 4A6PA 3R8FA 2CBZA 4ABYA 2A5FA 4TMZA 2JXMB 1TUIA 1OHHA 3Q5DA 3EXAA 2MQHA 4Q1BA 2ZYUX 1CUKA 1OXSC 4LF6Q 3DZ8A 4RVCA 2Q2TA 2I4IA 2FG5A 2VHJA 4KAXA 4XSHA 4LF5Q 4UNQA 4V0OA 1NY5A 3QKTA 3TSOA 4AKIA 5JSZA 1FOEB 1T5EA 1SULA 1N6NA 1XTDA 1XCMA 3RWMB 1DGSA 3WP1B 3VQTA 3WYAA 4A75A 1AS0A 4C2UA 5F9HA 3AKYA 1OLOA 4GS3A 3G4SA 1LFDB 4K0KQ 3H3VI 2OCBA 2GBLA 4KI0A 2UUAQ 1FQKA 3K9LA 4NL4H 1W1WA 2EW1A 2XXAB 1I2DA 1MJCA 3CCMA 5J3BA 2XITA 1SXJB 1K9MC 4EQ6B 1IBLL 4IFEA 3REFA 3K0CC 2F1JA 4JI5Q 1T8TA 1Z07A 4OO1H 2RGDA 2ZANA 3RN5A 3QOFA 2IWRA 3EARA 3UDFA 3KUCA 4B3DA 1VHLA 3PQCA 2HYIC 1EFHA 2JLXA 2D5DA 2C03A 1DBSA 4BBRG 2QT0A 3CCRA 1VQ9A 3LBHA 4AURA 4A3LH 2RH5A 4Y52H 2A30A 2IF0A 3PUZA 4A3FH 5K36H 2F43B 4GT1A 3UXMA 1IBKQ 4CIDA 1KHTA 3FP9A 3B6EA 1QBKC 4KBGA 3PO2G 2IHFA 4OHVA 4NCJA 3BS4A 5L3QB 4DSTA 3LXXA 2XEXA 1B0UA 3CRMA 2IYVA 3FVQA 1S1CA 1FYCA 3K53A 4WXPA 2YZ2A 4D81A 2J45A 4CEIB 3SJCA 1GILA 5D3MA 2UXBL 2R93H 1E94E 4TZ0A 4IOKA 1TXYA 2LKCA 2YINC 4LBZA 3B7GA 2ZAOA 1VMAA 2GESA 4Q4LA 4OONA 4A3EH 2UUCL 4C3JH 2NN6I 2BEKA 1Z2AA 2B7BA 2GILA 1M34E 4NYMQ 5JJIA 1F2TB 3RANA 1P75A 4PXAA 4D0GA 3HKZE 4PQYA 1TAGA 3RZDH 1TWAH 1E1TA 4IOMA 3QJYA 1WA5A 5HY6A 5EUMA 1KI2A 4IEIA 5GADl 1A7JA 4DZZA 2BBSA 5CJ2A 1ONBA 2HJGA 2OEPA 3B85A 3DM5A 3EASA 2WJYA 4M53A 5SZHB 1GD7A 3GLIA 3THWA 2HF8A 3BOSA 3LLUA 2RB4A 2NVQH 4NYIQ 3Q8DA 3CRW1 5DO9A 1XZPA 2AN9A 2ZEJA 1L7VC 4G1UC 1UWVA 2MSEB 1S96A 1S8FA 1N9WA 4B3SQ 3O8RA 5CYOA 1HH4A 5H68A 1NG1A 4YXWD 4R4OA 1AK2A 3CH4B 3KOJA 2PH1A 2QMEA 4W5JA 4B44A 4OJKA 5K8TA 1VF7A 5IWAQ 1ZYUA 1DTSA 1A62A 4A4DA 1H9JA 1X3EA 2I5MX 2I5LX 1E2MA 1GG2A 1BBWA 2Q21A 2NVYH 2WKRA 2AK2A 4JLVA 1GITA 4APVA 2PLFA 3AKEA 1SHKA 1ZRHA 1QUQB 1S40A 4IW3B 4XD7D 2UU9L 5M5WH 1N5JA 5J5CA 3N70A 4DR5L 4FIDA 2O8DB 4GP6A 4HLCA 3EWSA 2ONJA 1G8YA 1FR3A 3FWYA 1OXXK 3OTOQ 3AEZA 3QG5A 4PC1A 1KAGA 2J87A 4V02A 3K0SA 3WYGA 2FSIA 3NIBA 2AWOA 1NVWQ 2YOHA 3CQZH 3DLLA 1C7YA 2ECKA 5JCZA 3DHWC 1Y63A 2FPMA 3TMKA 4DRZA 1GHKA 2W00A 1K8OA 3KDSE 3PCOB 2EDGA 2J9RA 5JCPA 2HEIA 2UXDL 4LC0A 2EU8A 1SKYE 1ZUNB 2FX3A 3KTAA 1NMZA 2CLSA 3AF4A 1YRBA 2A5DA 2CDNA 1FQJA 3H94A 2VUMH 4RD0A 4Y0VA 2JLUA 2OT3B 4RZUA 4B3FX 1XRJA 4Z8XA 4Z54A 2RF4A 5IK2D 4LF7Q 2QEQA 3QEOA 1NSTA 1AQYA 4DLYA 4L5RC 3AVPA 1P72A 3HOYG 5A35A 1VQEA 1N6HA 1DAEA 1ZD9A 4JBYA 2RKOA 4AWXA 4F7WA 1NN0A 4OQFA 1FL0A 3B82A 3IO5A 4Z1MD 2IYZA 3AEVA 2EFEB 3GTKH 2FZ4A 2BOVA 4LV5B 5CLQA 4HZIA 3ADCA 4MRPA 4C0QC 1G8FA 4KO8A 1X3FA 2IX3A 1K8GA 4B34A 1PHJA 1XTKA 2REOA 4QY7A 4YXWA 1CRPA 1QG2A 1PJRA 4RZXA 5AJXA 1FX0B 4C3IH 3TW4A 2HQLA 1E1RA 5KO2A 5EE5B 4JI7L 2ZJAA 5EUQB 3CONA 5LD2C 1Z08A 1DAMA 1SR3A 4DBLC 3AYHB 4JI2Q 2KBFA 2QORA 1VQ5A 1GSIA 3AVYA 4Q4AA 4TMVA 1BVSA 1GKIA 1TNDA 2B21A 1DCZA 2VA8A 4NPHA 4LF4L 4DLZA 2XB2A 5HTKA 1MR3F 1W2GA 4Q1DA 4XD7A 4MDFA 3QNUA 2A68D 4URYR 2QROA 1PH1A 3NBZC 3Q7QA 4RCNA 1VCOA 3A8TA 3IIJA 4HZUB 4LC1A 1XMSA 4UNNA 5C0XG 2O8EB 1W4AA 4BUJA 5KNBA 1D2EA 2G88A 2K52A 1UEIA 1VQHA 1IY0A 3L43A 2NPFA 1PH2A 3W34A 2OAQ1 1JB7A 4MUAA 3T56B 1YNNC 3U7EB 1Z0KA 2KCTA 4U00A 3U7GA 2QNRA 3SE0A 1SKQA 2G3YA 5GJWC 5TVKA 2V9PA 2BHRA 3PV0A 1HNZL 1T4GA 4LFAL 2OFXA 2FOLA 4PPFA 5HGQA 3W90A 3KB2A 4D82A 4LFBQ 1U0LA 4OWWB 1XJ0A 3DEFA 5GJBA 3AVTA 1ZM9A 5C4JH 1WBDA 3HOWG 2GJAA 3PIRA 4PPNA 4Q7KA 3KKPA 4RFVA 2YV5A 2R2AA 1M1YE 1OFUX 2CJWB 1R5OA 4G0NA 2LSSA 4LFCQ 5GQOA 1T5LA 3UG7A 2WSSD 2K75A 2FPLA 2ZREA 2EFDB 1FJGQ 4A0FA 4W9MC 4NPSA 1UBGA 5ELOA 2OLKA 3VR5A 1KKLA 3K09A 3LX8A 4MYUA 2JEAI 2IK8A 2F6RA 3C15C 3CZQA 3M4QA 2B63H 3ECCA 3EZ9A 4QBGB 1U9IC 3GTMH 2DY1A 2OUKA 1QHIA 2JLSA 2YOGA 4JJKA 1EUJA 2QI9C 5G40A 3CLVA 3STBD 4DDTA 1I4DD 2NTYC 4TL7A 2BMJA 3UANA 1JR3D 3AQ4A 3RS5A 1N6IA 2FSGA 1E9RA 1P16A 3WXMA 2OTLA 5AJVB 2RCNA 4ITRC 4L8JA 2IL1A 3HJNA 2JDID 5IP7G 3NBFA 4F4JA 3MRSA 1P73A 3PF5A 5BQ5A 4MYHA 2K5NA 1MO3A 721PA 2XX3A 2YC4C 1KK3A 2ZTSA 4ACAA 3UPUA 2MNAA 4A3KG 5F9FA 1KMHA 2VEDA 3U9SA 1XPOA 2ZUCA 1RVDA 4TQAA 3VMFA 4Q1CA 1EWQA 3KKMA 4CEHA 4UXHA 1I94Q 1R7RA 3LFUA 2GZHA 2OILA 3QPUA 2JLYA 1P9RA 2JIZD 3BIFA 3GJXC 1ZBDA 2OSBA 4YDSA 4HDCA 3CPEA 2C04A 3OIYA 5DGXA 3PUYA 4RFSA 3ND8A 3QBVA 4Q4JB 1PH6A 4BWYA 2N78A 2D4HA 5FTKA 1DOAA 1NLYA 3C16C 3R8CA 3L82B 2QE7A 4N1AA 3KB1A 4O2DA 5GAEC 2GN5A 2F4VL 1ZM3A 2J0UB 1G21E 1GKHA 2XNDD 4GRAA 3AVWA 3RZOH 1E79A 2WIBA 1XNQQ 1E9BA 4A3GH 4HATA 6Q21A 1OIXA 3AB9A 3KF6B 1R4AA 1VCIA 4X6AH 1NMYA 1ZP6A 2WWHA 3KJGA 3KJIA 1ASZA 3K80C 1X1SA 3V00A 5FUVA 3VR4A 1C0AA 4JC0A 2FWRA 2WSSA 4NYJQ 3O8CA 5DI3A 3DL0A 2WAQE 4JI4L 4Y7NH 1RE0A 4OHWA 2ZI6A 5FI0B 4G5RA 5BXQC 4PZ7A 3TW8B 4PQFA 3W1BA 1K6MA 4DT1A 4NCNA 4RD4A 3A4MA 4ACBA 3RRNA 1UBEA 2UVQA 2A69C 5IP9G 1F5NA 1MV5A 4M1YA 1HEIA 1MO5A 5A0FA 4AYTA 4M1TA 2OZEA 1IJFA 5F2EA 4B3TL 1GM5A 1XMIA 2E9SA 5EE1A 4BZPA 4DR2Q 4Q00A 4A3IG 1W36B 1Q21A 2BDOA 2YTXA 1RRPA 2BDTA 4POGA 4II7A 4JOIA 3PEYA 5KSOA 5HE9A 2F9MA 3J7A5 1XJQA 4AK9A 2EJFC 3AFQA 1E2NA 4JYAQ 4B3RL 4C0AC 2BMEA 4ASUA 2E5LL 1LS1A 2RGAA 2RGXA 5CIQA 1Z0IA 4G01B 1YU9A 2ERXA 1R5NA 2FEOA 3B9PA 1XMOQ 1S0UA 3CCVA 1EFWA 1I6VC 4OXPA 1YZNA 2VHQA 1FUKA 3FPPA 2E87A 4D0LB 2D7DA 4LUOA 1KO4A 1HT2E 4C2MH 3PO3G 1SKYB 2J1LA 1NJIC 2JIZA 5AJYA 4DV0L 2R6AA 2GCOA 1XEXB 5ANRB 3X1XA 1NKSA 4FWTA 4R4QA 2ANBA 3J81j 3CRKC 2XZOA 3JAMi 4KHPL 2WKQA 1OKKD 3AFPA 3NBXX 4D2IA 4GNXA 2FSFA 2VSFA 3ZQ6A 3ND9A 1E2HA 3SDZA 4DCTA 4CEJB 1QZHA 2VQEQ 1QHNA 1ANKA 3QKRB 2HHHL 2W6JD 4PZYA 4YMSA 2MO1A 4V0KA 3CCSA 2K32A 2DCUA 4B33A 2RHMA 5EJEA 1NIPA 5EE0A 4DV5Q 3OESA 4GN3B 1HV8A 3GJ4A 3NBYC 2D74A 5D3QA 2PI2A 2OXRA 3QSYA 1AJEA 1N33L 4JBWA 2VNUD 2IC5A 4EUNA 2OCPA 1M7GA 2QRZA 1E2VA 1PH4A 4C3HH 2ZRIA 1E3PA 3FGNA 2ZJPA 2D2CC 3QXCA 4P31A 1Z06A 2X77A 3TBKA 5M5YH 3BB3A 4OJQA 2K5VA 3OHMA 3QBTA 1S9DA 4L4UA 1ZINA 3PIPA 2IA5A 4JLMA 2FXQA 3ONWA 1NLFA 2AHOA 4D80A 4QJ3A 2IXGA 2J46A 1UKEA 4K81B 3PUXA 3HOYH 3T15A 2OESA 1G18A 1AS3A 1D2MA 1NVUQ 2IUSA 1SLJA 2XB4A 3PFIA 4KFUA 4OHXA 4RZ2A 4XWOA 4C7OB 1DVRA 2BJVA 4JYCA 1RRCA 4XIGS 2QMHA 4NMMA 1FTSA 4D26A 1JI0A 1MABB 2A8VA 3PENA 1MH1A 1G8HA 3IO3A 3QI2A 4LV8B 1CKNB 4Q48A 2E8GA 2R65A 3G82C 1W49A 2ZSFA 2KBNA 3NWJA 1H9SB 2E2IH 4GMXA 3DDCA 5A4JA 1XMJA 2H57A 5GVRA 3A74A 2D06A 5DHFA 1KJZA 5BN3A 1GHJA 1L4YA 4PANA 2CNWD 2PQAB 1DAKA 3P20A 3S1RH 4OO1I 1C9KA 4JT4A 5AR1A 3WNCA 5CLLA 4ZDKA 2OHFA 2OCAA 4X62Q 4DR3L 4ESVA 4E09A 4A8JA 4MZ9A 4NXNQ 2ZRGA 5IE8A 2JA7G 4TMWA 3CD6A 2A68C 1H8HA 3QXHA 1E2EA 3TJZA 2ZTCA 1L0WA 1MT0A 2ZJ8A 2IW3A 3A1WA 3IQWA 3QXSA 4J15A 1ODFA 4FW9A 4B3BA 2XTIA 5IT9c 1II0A 2PMDA 1OKKA 4FMBB 3AVOA 5DYGA 5JFGA 1CS4C 2LKDA 1JJVA 2ZRKA 2JA1A 3NC1C 2ZJBA 2HJVA 4MRVA 4QQBX 1CIPA 5KNDA 1XP8A 2C5LA 5HR5A 3E9IA 3H0GG 4JBMA 4LV6A 4US1R 2JA6G 4AG5A 3F0TA 3R9XA 1XCGB 1AIPA 2I0QA 4HAZA 1B9NA 4KKUA 2EVWX 3IILA 4XWAA 2Z43A 3CX8A 2QRNA 4IVQA 4XTCS 2FN4A 3LAWA 5M3FG 4US0R 1EQRA 4NU0A 3HOWH 3QKSA 1NRJB 2Z4RA 1DADA 3RNUA 1OW3B 3TVDA 2PCJA 1S9HA 1W5SA 3NENA 1R8QA 2WB1E 2FSHA 2NZHA 3DKPA 3L8YA 1UF9A 3LLMA 4H0LC 3D6TB 3D0FA 3W3ZB 2ZM6L 4G5OA 3NEMA 4YWLA 4A9AA 3RAPR 2ORIA 2A7QA 2GVAA 4DUYL 3HU1A 3C4JA 4L8GA 2FFHA 3RS3A 3GLHA 2ZRLA 3CP0A 3HOVH 4TLDA 1KJYA 3GJ8A 2ZJQA 4JKYA 4G3XA 4GOPB 1AZTA 3RSOA 2BWJA 2CVFA 3DPUA 4LWZA 3BB4A 1IY1A 5FI1B 1T9HA 4YHHQ 2CNWA 1WXQA 4HIKA 3T12A 2ZRAA 2QTFA 4DV2Q 3CWQA 1BBUA 3S1QH 1I4LD 4JJZA 3IEVA 2O8BB 2H1LA 1DAHA 3X1DA 2GA8A 3CAMA 3GD7A 1NTGA 4A2WA 1D8LA 3P1JA 3UKDA 1QJOA 3QG1A 2PMKA 2CEAA 3GJ0A 3LXRA 4EJSA 1FPMA 3ULLA 4O2RA 4FWIB 1XTSA 1ZIOA 3NKVA 1Z6YA 5DE3A 3FYHA 2ZI9A 3M6AA 4HB3A 1CEEA 3U4ZA 2ZJYA 3E0EA 5BWMA 1KQSA 3NH6A 5JJKA 1L1OA 4BQSA 3RS7A 5C46F 4JBXA 1T91A 1R8SA 4PHTA 3MJHA 5LMUQ 4R98A 1YQTA 5CYPA 1XXHA 4GOXA 4RKFA 2R6GA 2IHEA 1N2CE 1QRAA 3MWJA 1SXJE 1NI3A 1UBCA 1WCMH 3PXGA 4B2LA 3AGPA 2HDNB 2B8GA 2RGNA 3BGWA 5J4YA 4P4SA 1Q22A 4BBSH 2AD5A 4A0GA 2P0EA 1OJLA 1G3QA 2QAGB 1E99A 3CCQA 2QMOA 1VPLA 4M9QA 5DYIA 5FBRB 3OE7D 1QG4A 4DWJA 1ZKOA 4CYMA 4Q7JB 2D3WA 1SVOA 2O0HA 3THXA 1Z2CA 3GTOH 1KAOA 1SFOH 1EFUA 2PZEA 4IDNA 4UXIA 5IYDH 2UUBL 5L8VA 2QSZA 2O8CB 4QC2A 2QN6A 1G20E 1MOZA 5IP9H 4NXML 2PZGA 2ZU0C 2O5JC 3BDOA 3DOEA 1SN8A 3TR5A 4B6FA 1NNEA 1P61B 3IPYA 4KXFB 4A3IH 3EW9A 1KRSA 2DFKB 3PUWA 1P6XA 2CLCX 3T53B 1LF5A 2NO0A 2ZS7A 3EC1A 3LH5A 3M0EA 3OF5A 5LMNQ 2QT1A 3HDTA 5J40A 4ZI2A 1UEJA 1KSFX 3F3YA 1KSHA 1WBBA 3HOZH 4I99A 5JEAH 1CJVC 3SZRA 1TKWB 1RYFA 2AUJD 4K8OA 4AQYQ 3UDGA 1NG9A 3K0CA 3NDBB 1JALA 3MAAC 2PZFA 4DV6Q 4LCBA 4AG6A 5JLJA 1JAIA 4NCIA 4O2LA 3UATA 1JJCB 2C9OA 4DR1Q 1P60A 2Q3MA 4Q9KA 3CCUA 4YDHB 1Q82C 3CNLA 1DAIA 4F93B 1W4CA 1GUTA 2ODBA 4GZLA 3RNLA 4JLBA 1K5GA 2ZT9C 1MRSA 2BEJA 1HZBA 1XD8A 4KODA 1KGDA 4LJ6A 1WF3A 3K81C 4NCHA 2O8FA 4P71A 5FUXA 5EP4A 3SHFA 4LUCA 1IBML 3WBKA 3UDIA 1MO6A 4DUZQ 4R2HA 4OQXA 3MXUA 2R7FA 4AH6A 3RS4A 1IOZA 3J81i 3R7WB 2YOFA 3VU9B 1II8A 1KO5A 1FW6A 1RPZA 4UJ5A 3J81c 1NBMD 3SFVA 4WBSA 4A3CH 1BOFA 1E0JA 4B2PA 2VHUA 4BRUA 2K5HA 2RHDA 3MUFA 1AGPA 4GOJA 5IYBH 4FMCF 1SVMA 4M21A 1KI6A 3HR8A 2PLRA 2W0MA 3OE7A 5A5GA 2QG6A 1P8LA 4POFA 4V0LA 4HUTA 3LVQE 4XSGA 3KQNA 4ZCLA 4FCTA 5FOWA 1GO3E 2F1MA 3HFZB 4N0EA 2F3RA 3I4NG 2GK6A 2A9KA 3VNVA 4LYJA 2GVBA 1VQAA 2OCEA 1GL9B 3REGA 1Y8PB 1OH7A 1G7RA 4QHYA 2DNCA 4M1SA 2WSMA 1YR9A 1TUEA 5EP2A 1E2FA 3QXJA 4MITA 3VKHA 1OT3A 1PYBA 1M7BA 1XJVA 5CK5A 3BG3A 4H44C 3K7UC 1HNXL 4JBJA 4ZIRA 1GUNA 2FNAA 1ZJ6A 3ZIAD 1R2QA 5FOVA 5TARA 3ADDA 4JI8L 4A2PA 1Y3AA 1SGWA 1Z29A 5CITA 3I32A 2AKWB 4LJ9A 5G3ZA 1KMHB 2CLDX 2IS1A 1IBLQ 1VQFA 2W2VA 1QHGA 3S1MH 1SRUA 3GLFE 1OB2A 3DMDA 3GLHE 1IZ6A 3BK7A 4CVNA 4P75A 2QPOA 3IGFA 4OQLA 1B9MA 3E1SA 2JA7H 4D4JA 5AUNB 3GPLA 2K33A 4RFSB 2E74C 2NIPA 1N0WA 1ZU4A 2MSCB 2K14A 2GVDC 2KHJA 1HNWL 1LTQA 2QENA 4LOAA 1TWFH 3ZJYC 2PCLA 1C4OA 1MKHA 4TL8A 4JIMA 2Q9BA 2VTKA 4XJXA 1I50H 2VLIA 4L5TA 4YY3L 1VQLA 2ASBA 1U81A 1X3GA 1NBMA 2K5UA 3QY0A 5EP1A 4PZZA 2IHYA 4Q9JA 3TVTA 3WMGA 4S2EA 5DLQC 5DSZA 5FJ8H 1NP6A 1OPXA 2GDJA 2UXBQ 2OV2A 3BFXA 2IUUA 2R7ZG 5DI3B 1N6PA 2WIAA 1R9TH 5M3FH 3EBEA 1SMXA 1GNPA 2GXSA 2QP3A 1CJUC 3P32A 2VL6A 2UUCQ 1KK0A 2ZSBA 1DE0A 1KDTA 5FUWA 4PG3A 4JI3L 2F3IA 1GRQA 2C77A 2VQFL 1E4YA 1XXHE 5TV2A 2CHGA 4N3NA 2Z0MA 4HB0A 2BVNA 4DLSA 1U0HC 1SMYC 1N8RC 3B8HA 5H1YA 3RRMA 1IL2A 1N6RA 1K73C 4DAMA 1K0RA 4X8HA 4DCNA 2CKZB 3O47A 2A5YB 4Q7LA 1KKMA 3MLEA 2R62A 4PMWA 4JVMA 1Q7YC 1LW7A 4JK1C 3WNDA 3SYLA 4MKHA 4LF9L 4TMTA 1LS6A 1NE3A 2J0QA 5IY0A 3ZVLA 2D0OA 3CF0A 4KYIB 2B8FA 3TQYA 4JV5L 1E2QA 1C9OA 1FL9A 1JQLB 3OEHD 4FCWA 3ZVRA 4C0SA 5JECA 3FHTA 3MXNB 1N0VC 1OFIA 4OL0A 1US8A 3U44A 1CLUA 1UKZA 1D2NA 2V1XA 4PC3A 4FDBA 5HCNA 4DEXA 1F2UA 2Q0HA 3T1VA 5B58C 2KENA 4DLUA 4X64L 4A3DG 2JLRA 3NDPA 3NE5B 4GBMA 1A2KC 2GCOB 1WJJA 1IN8A 4M1WA 4B48A 4PSVA 4HLUC 4YC7A 5FTLA 1Z28A 2BMDA 3M4YA 2UU9Q 1U8ZA 1VCNA 2WJHA 1J7KA 4BFVA 2ZM5A 4FI3C 3C7KA 4YCWA 4GNXB 4DR5Q 1XTQA 2H16A 4XTRA 4LYAA 1Q12A 3A6PC 3RABA 4MNOA 4Q1FA 4A0RA 4DK1A 1VQCA 1VKJA 4JG2A 2YJTD 4UP8A 3BD9A 3IHWA 5JEDA 4RJLA 2KBEA 3K9NA 2HUPA 4Q21A 5L3RA 1CKEA 4GSYA 3F5FA 2DWPA 1AM4D 2A19A 4HDOB 1RZ3A 3I4MH 3UE1A 2B8TA 3A37A 1KC8C 1ZCBA 3BRWD 1XPUA 1XX6A 1L4UA 4ZDJA 3GEIA 2ZSAA 1ELOA 1Z6GA 2UXDQ 1W48A 2NZ8A 1MJEA 2JASA 2X8AA 3CX6A 1Y1VH 1GDDA 5CDFA 4N0DA 2JA9A 3SJZA 1MIUA 2ZJOA 1A0IA 2BKUA 1Q1BA 4ILEA 1P4SA 3ZS8A 1E3MA 1IN7A 3QQ5A 4DLTA 1R6BX 1X55A 4D0NA 3WMFA 5SZJA 3FMOB 3AB3A 4HUQB 3Q3JB 1Z3IX 1N34L 3W5OA 1TF7A 2ASEA 4DNTB 1U98A 2YWFA 3I4LA 4FCVA 5AUPB 2Z5FA 5AK0A 4NP6A 2IXEA 2Z6KA 2A69D 4I81A 1MRNA 3LV8A 5C44H 2CCZA 4DKXA 2Q3FA 4JLOA 1S72A 3OEHA 1E9AA 5KOYA 3CPJB 1O78A 2ZRHA 2FFAA 3NHBA 2C95A 3K0EA 1HTWA 3A1UA 4JI7Q 2N1BA 3CUEF 4O0AA 1KYIA 3MJRA 3VTKA 5JEAJ 1VECA 1YE8A 4AYWA 2V3CC 1Q81C 4QGAA 2NVTH 3RLFA 4NZYA 3BFVA 4B74A 3IFTA 1LABA 4LF4Q 3SYNA 2SHKA 8OHMA 3PJRA 2ZUBA 2IT1A 3I1FA 1R0YA 4HAXA 2IX0A 1XB2A 1N6LA 2WWIA 2F55A 3GDEA 4UQOA 3W5IA 3GFOA 1QHHA 4IXNA 1TU2B 4TKOB 1T6NA 3BAFA 5TB5A 1P2VA 1ZC3A 1E9EA 1OB5A 4LHXA 4WZBE 2Q2IA 4A3BH 4GMDA 4IFDG 4KBFA 1Z0FA 3RSLA 1M8PA 4DR6L 1G4UR 2GEDA 4LZZA 4M0LA 3LQQA 2MMCA 4EAQA 2L0XA 3F8TA 5JHGB 3S1AA 4ZO4A 2F1IA 1B8AA 2IBMA 4QOSA 4GP7A 3A8JE 3TAHA 1JXOA 1IN4A 1HNZQ 4PO8A 4RD2A 4LFAQ 2G9NA 2J59A 3RYTC 3H2YA 5KYKA 2UUAL 1ESNA 3I72A 1GJXA 4BXXG 1X6VA 2GHIA 2ZIAA 5DIFA 1PUJA 2GJKA 5EZ5A 3GJ7A 1OFHA 1W36C 3AF1A 3KXIA 2JA8G 1G51A 4A3JH 3Q8XB 1TQDA 3L0PA 1KI1A 2GCNA 1HE1C 5LMNW 2OLJA 3GJ6A 1A2BA 4B71A 1FNMA 2JCSA 5FTMA 1N5KA 2V4DA 1Q57A 3HOUG 3OZXA 4D4KA 3GLHB 3GLFB 4KLZA 2G77B 4PQRA 2QMUA 3KQHA 2WWYA 3DM9B 5M3MG 2IYYA 2ZYTX 3NG1A 5J4VA 2YC2C 3EZ7A 2O5VA 3BJUA 4IEEA 1COWD 3K9GA 2JA5G 2PJRA 2ZTEA 4BY7G 3U7HB 1M6NA 1VIYA 1E1QD 2W6ID 4Q02A 4I1OA 3TS2A 1G6PA 1U94A 4PPGA 4MTNA 1PH7A 4UNPA 1KTVA 1FP7A 3F1ZA 3CIOA 2VSOA 3TRZA 5KNCA 1G8PA 4OI2A 2JEBI 1J2JA 2WOOA 3K0AB 4ZCMA 2VSXA 3A8KE 3O8BA 5FL7D 4TYWA 2NZOA 3K0FB 3LD9A 2WWFA 5FTNA 1UE7A 3AM1A 4AI6A 5SZIA 3DO6A 4HAUA 1Z6TA 1PLLA 4IPDA 3EA5A 4URXR 2ZRFA 4UKDA 3IIMA 4C9BA 3KX2A 3SC3A 3S2HH 3QXXA 1KO7A 2LWIA 2NN6G 2HCJB 5IRCD 2J7PD 2ZROA 5E7NA 1XXHB 4F4CA 3PIOA 2CCGA 2EIFA 1ZNYA 2FGKA 3HWSA 5FLMH 4IFBA 3KJHA 1YZLA 4G5SA 2R92H 2DYKA 4GLVB 5FLXc 2F4VQ 1NKTA 1ETUA 1DS6A 2WAYA 4EPRA 1DAFA 5LBIA 2ZRMA 1XDBA 5L3SA 2JK8A 1E2PA 1GRNA 1T0HB 1XCPA 2A2ZA 2TMKA 4NH0A 4KSCA 4R1JA 4R71A 1PLKA 2I5HA 2EFGA 3MWKA 1HPCA 1XMQL 3ER0A 4PO9A 3VHLB 4GL2A 3RC3A 4TTRA 3S14H 4DJTA 1IW7D 2ZJ2A 4KV9A 4NYMR 1HT1E 2JAQA 4JI4Q 4F92B 1KDPA 3I5YA 5IWAL 2VZAA 1KY2A 2GXAA 5JRZA 4Q1AA 2VW9A 1E2ZA 3TAUA 5JS8A 1B70B 2AWNA 3GTPH 2XXAA 3LNCA 5DISB 3GO5A 1YZUA 3E5HA 3HGBA 2QP9X 4QJ5A 1E4VA 3BERA 5EXXA 1S3OA 2H8KA 2PEZA 3AP1A 1YHQA 4B3TQ 4OHZA 4QXAA 1E1QA 2W6IA 2VY3A 5GAHC 3PVSA 4NYIR 3UE0A 4V0MA 4AC9A 2W2TA 3HP1A 4L9SA 1W4RA 4C0LA 5AUQA 2QTVB 4Z1MA 4M22A 2DUDA 2K4KA 4YCUA 1YZTA 5AUOB 1V8QA 5G53C 2K50A 3U4QA 3VNUA 3ASYA 3T5GA 3PITA 2B29A 3AP2A 1RJ9A 4B3RQ 2GEUA 1LY1A 1PMRA 5FL7A 4B73A 5KHOC 2E5LQ 3AKDA 4DK6C 4BY1G 1O3YA 4HIMA 2RAPA 3ZGXA 3B1WA 3B78A 3EPHA 4A3DH 1KSJA 1XMVA 1N32L 3VR6A 1OXTA 1VDZA 4PSKA 4OBEA 1D9ZA 4GKJL 2B3GA 1SVKA 3BFKA 2CVHA 3GLIE 1HUQA 2I3BA 1KNXA 2OG2A 2OFOA 4LBVA 4HJ7A 4BEJA 4PC7A 3CMAA 4DV0Q 2J7PA 3THYB 1MO4A 3RN2A 3WHLA 2A6EC 2DWOA 4LK1C 5JWHA 4WXRA 3ERSX 1JECA 5FOXA 4KHPQ 4YMUA 2MO0A 1KI9A 3CKLA 4BBRH 4OI4A 3GP8A 4ME3A 2F52A 4AKGA 2GAAA 3LW8A 4R9UC 2AL7A 4LW1A 2QSYA 3RWOA 1VG9B 2HHHQ 1E98A 1WDTA 2GF0A 4H1VA 3SBDA 2JJQA 2ZJZA 4GKKL 4Q47A 2JE6I 4HJAA 3PO2H 3CRRA 2BBWA 1SROA 3LO5A 2VF8A 3E70C 4HI0E 5FBLB 1AKEA 3EA0A 4F38A 1N33Q 3WMEA 4TYYA 2YTYA 4IQZA 1H65A 1G3RA 4JLKA 2PL3A 2QBYA 2Z6VA 5DN6D 2CHQA 3T1YL 1HR0L 1YHNA 2CE2X 2KHIA 2ZRBA 3OW7A 2W0SA 1BKBA 4PAMA 4WIAA 3SJAA 3W6NA 1LTLA 4GOPC 3UWOA 3ZLJA 4GZYC 3S1NH 1JXMA 4Q19A 1WB9A 2E1RA 2R44A 4TLAA 2C9CA 4PAQA 4TZ6A 4HB4A 5AJZA 2GETA 4ARZB 4ZIRB 3LNNA 4Q4HA 4DLVA 4JI1Q 1QZGA 4IVRA 5IT5A 5L3VA 2P5SA 1SXJD 4JI0L 1Z0DA 1UFQA 4O25A 1VG8A 4AIIA 2DGYA 3NELA 1KZ7B 1X1RA 1D7QA 2OM2A 5FPSA 4ZKDA 3HR7A 2BKEA 4PZLA 3U3RA 3QF4B 5BYKA 3CM0A 1JR3A 1QVCA 3B9QA 4NDZA 2ZR7A 4Z51A 2JLVA 3MMPA 3DOFA 1YZKA 2ZI4A 2JDIA 3P4YA 1VYTA 3DMNA 3G6EA 5AWFC 4DR3Q 2AXPA 1TQ6A 4M1KA 4D6PA 1EGAA 3HU2A 1YNXA 3FKIG 3PGZA 2EJMA 1VQIA 4DV3L 4I4LA 4L5BA 5C1BA 2R6CA 3PUVA 4HR7B 1S3GA 2BV3A 2VS1A 2WPDD 2XZPA 1NVVQ 4LYHA 1LUZA 5GJVC 5KDLA 3I62A 1LVGA 4BLRA 1EFCA 1E6CA 3K7AH 2P2LA 4HYYA 1BYUA 4IFDH 1DARA 2P6UA 3JZAA 2QAGC 1KL9A 2CFMA 2QQ0A 2DFNA 1EFRD 2A3RA 2W83A 3WWVA 1Y1WG 3TIFA 3WHKA 1RL2A 2HV8A 2G1KA 4K46A 5E7MA 5P21A 4AD8A 4M8NE 3CX7A 4DR4Q 4NTZA 2XOKD 1YHAA 1IXRA 1PYSB 2YKGA 3BH6A 1U0JA 4H9GA 3JAMc 1IXZA 1E2DA 1ESMA 3AVXA 1E0AA 2W2XA 3M85A 1Z7TA 5DN6A 2XNDA 3RHFA 4QFMA 2V55B 4IVPA 5FR2A 1VS0A 4GDFA 2ID0A 1JMCA 2C2HA 3QVUA 4QGHA 1OH8A 4IPCA 3EPJA 3X1WA 1GL7A 1Y8NB 3TS0A 4PR0A 5GAGC 3UWKA 3A7AB 4LGMA 2CWPA 3HOUH 1FTNA 1G8GA 1BYIA 2EYQA 3I73A 2ZE5A 2FF7A 1YRAA 1E22A 5JSZB 2ZM6Q 4JVLA 4EQ6A 4EPTA 3A5ZB 4B75A 3TUZC 1P2SA 3HOXG 4DUYQ 3QEJA 3KYHC 1Z83A 1VTKA 2XGTA 2V4ZA 4GOKA 4JS0A 5KU1A 4IOLA 2MFIA 5DI9A 2DNEA 2JQOA 4A3MG 1T3LA 4RCYA 1W3SA 1NN3A 2WMOB 1HTPA 2XSZD 2IEYA 4W5HA 3SHWA 1X65A 1CJMA 1EK0A 1Q46A 4C0HA 4ALPA 1G5RA 2GKSA 1EOVA 4URVR 1WOCA 1TU4A 1G41A 1ZNXA 2UKDA 5HKKD 4G7OC 5AJ3L 2AKYA 2WPDA 3SJBA 4B6EA 1KO1A 1I3QH 3IIKA 3T1HL 4CEIA 1YEZA 4KU4A 4OK5A 1K83H 3B2EA 3TH5A 1UJ2A 3U2QA 3BH0A 3RC8A 3SQXA 1NVXQ 1X8LA 3PR1A 1JJ2A 1EFRA 3T06B 5C3EG 3CBQA 2EQBA 3HKSA 2LMCB 1X6OA 2Z83A 2RGEA 3CF6R 2QL6A 4CW7A 5C0XH 4LF8L 3QENA 2QM7A 1DAGA 1F2TA 3OIVA 2YWHA 4QRHA 1UE1A 2DFLA 4WJ3M 2ZRNA 3N5CA 1F60A 4RY2A 1SVWA 1ZD1A 2P6RA 3KJPA 4FMDF 2VP6A 4ON9A 2PCFB 2NO6A 5D3MB 1E9SA 2W6JA 1KHIA 3J7ZC 3CPWA 4ZCIA 5JWOA 1LNZA 1K8MA 4LJZC 3BZCA 1M7HA 1T8UA 5JWRA 1CJKC 5JHHB 5C18A 2J41A 1N5IA 1NSFA 4BLQA 3VA7A 4GPTA 1VIAA 4QIWE 3P26A 1JPNA 2ZI3A 1UE6A 4NYJR 3GLGA 3GFTA 4Q18A 2XZLA 4JMPA 1IW7C 1OF1A 3K0XA 2UUBQ 5C4XG 1QZXA 1EWHA 1DO0A 2IUTA 3WNBA 121PA 2BIFA 2UZIR 1H9MA 3FE2A 3FKSD 4NXMQ 3H1TA 3K1JA 2N3SA 3EIHA 4PHFA 2ORVA 5J4HA 4A4IA 3X2SA 1A5TA 2ZE7A 5BN4A 1ASYA 1NY6A 4LJ8A 3ZZTA 3GLIB 3THWB 1I5FA 4NE2A 4PTLA 1EXMA 1G3IA 2WV9A 2ZE8A 1G16A 3P27A 3A5UA 4LPSA 1UDWA 4BECA 2IYXA 3AH8A 3AGQA 5KSPA 2ZUDA 1QUQA 2QGQA 2GAOA 2NZJA 2XSZA 5EXPA 2AFHE 1EIFA 1CU1A 2FGJA 2IS4A 2EQSA 3SQWA 2O8DA 1HA3A 2REBA 2LXJA 3FFAA 4LRWA 5FOUA 4BFXA 1D8TA 2VL7A 3LWUA 2AFIE 2GRJA 1M2OB 2N42A 3M1IA 2Q3HA 4LYFA 5AJWA 1OYWA 4Q9HA 3A1VA 3U3OA 5FBWB 3L2PA 4DK0A 4OI0A 3ASZA 4DR7L 5IP7H 1JNYA 1RIPA 3OYYA 4DC9A 4TYPA 3CB4A 3ZYCA 1SQ5A 4V03A 1ZYRC 4DPGA 4TT3D 5J4KA 1JR3E 4LBWA 4O3MA 3I7FA 4MA4A 4BFZA 4A3KH 3MWYW 2Q2UA 1W44A 1CI3M 1HJPA 2ATWA 1W46A 2CCJA 4KLKA 2WAXA 2Q6TA 3CNNA 4XOIA 2OE2A 3ZJYA 1W7AA 1IBMQ 1H9RA 1T5IA 1GAJA 1OXUA 2NPIA 3C5CA 4DV1L 1Q1QA 1VG0B 1WCV1 5KTYA 4DB4A 4JBKA 3H86A 1GRRA 1YITA 1RIFA 3CR7A 3TZUA 1G5TA 1P2UA 2XNSA 4X8OA 1KO8A 1IHUA 3N2EA 2NG1A 1G17A 2HF9A 4U7DA 1YJWA 2W58A 4UNRA 3BXZA 3T61A 3L7ZC 5GROA 4QGUA 1NJGA 5DNYB 3KTAB 1D5CA 4A36A 3D7MA 2ZR0A 3B6YA 1Q86C 4A0HA 1KI3A 2PEYA 4B3ML 1OIVA 3EZ2A 3FKSA 1J5EL 1E0SA 4AYBG 2IYTA 1YZ6A 2V1UA 3CPHA 2KB0A 1VQ8A 1S3SA 2YVUA 5B57C 4DB2A 3N2IA 5FPYA 3A1SA 1IXSB 2WJVA 1XTJA 2JJ8A 4LX0A 4KFTA 2BH2A 2UXCL 1CTQA 3NTUA 3L0SA 1W0JD 3Q85A 3VR1A 1JE5A 1SXJC 2IS6A 2PI2E 2CXXA 4NCKA 4IDOA 1HNXQ 3LQRA 1E2IA 4Q9LA 5FUYA 5K36G 4GNXC 3GEHA 1S1MA 4JI8Q 4OWXB 4P4TA 5JEEA 4HZUA 1FGUA 2O8EA 4UP7A 1QVFA 4POAA 3L0OA 3SU8A 3ADBA 4Q4AB 1PH3A 3R20A 4FN5A 2YHSA 1KMQA 2EWWA 4Q9IA 1TPZA 1HQCA 1UKYA 2R93G 5HZHA 3ZVNA 2AX4A 2GZDA 4TT3A 4HLDA 4HLUA 4PSAA 3AP3A 4JI6L 1NLZA 3A8IE 5HCIA 2NGRA 3EIEA 2HT1A 5H8WA 4IJMA 1WYDA 4JL8A 2ZVQX 1HNWQ 3RLNA 5B2ZA 4IFDJ 3KQUA 1IM2A 4TYQA 3U5ZB 3N6RA 3PO3H 1AN0A 2C9YA 4Q03A 5LDDC 1U8AA 5FOSA 4BLPA 3I61A 3K70B 3H0KA 4BA2I 2QU8A 1TWHH 4DV4L 1Q1ZA 2XJ4A 2CJWA 4YY3Q 3IUYA 5LPNA 5L3QA 1FMJA 1MKYA 3SEAA 2G0NA 2GJ9A 2WBLC 1HQYE 4LHWA 3S16H 3J80i 1C1YA 1FZQA 1CR1A 3TSZA 1JBKA 1IAQA 2QA5A 3J80c 1XNRL 3EZ6A 2Q8IB 1VYVA 2G83A 4HDQB 4LJAA 2KJQA 3TNFA 1Z8FA 3CC7A 1F3OA 1XWIA 3IEUA 5J47A 4HAYA 2OBLA 4M2LA 1TWGH 5BR8L 4JI3Q 3CWZA 2VQFQ 3GTJH 3AUYA 3U3KA 2EWVA 2DWQA 2OBNA 3M3YH 3AF2A 1W36D 4IOJA 1N36L 3U3MA 1NBWA 2DHRA 4DHEA 3QUSA 4DUGD 4EKDA 3CRVA 4PZ6A 1I4TD 1GZSA 1S2MA 1W0JA 1AZSC 5LB4A 4CZ2A 1JJGA 3FMPB 1Q90A 2ZRJA 5K8UA 4LF9Q 2ZS8A 1UADA 3CRQA 4BFWA 4JV5Q 4MH0R 1JQJC 1EX6A 3VX3A 3VHXA 4BFTA 3OAAD 1U8YA 2ZTDA 1G9XA 5CM9C 4JLPA 4DV7L 2H7VA 2J0VA 1XFAA 2GCPA 2OFWA 3L8ZA 1K3RA 2YWEA 3A0JA 4X64Q 4Q4JA 3NEJA 1W47A 1PH9A 2H5XA 3NVAA 3VFDA 5KPJA 3VAAA 5ELXA 4A1FA 4GLXA 1OH5A 2VHTA 1J90A 2ZQ5A 4JSTA 1ONLA 3KKOA 2J0UA 4CEHB 3HKZG 4YCVA 2GVZC 4EQ5A 2VUMG 3ZH9B 3U6BA 2ZJ5A 1XU4A 3RDPA 1CSQA 4UP9A 1CFMA 2ERYA 3AV0B 3R9WA 2FH5B 4E03A 3FHWA 1NIJA 1JT8A 5IYCG 1H8ED 4QL5A 1KI7A 2X19A 5C0XJ 1Q44A 1YIJA
chains in the Genus database with same CATH superfamily
4FI3F 3ESCA 2DJFC 1KDRA 1BD4A 3IJRA 2JFYA 2O0KA 1F48A 3TDQA 2AEEA 5ERXA 1IONA 2B1JA 4ND5A 2HRBA 2E2JH 4WBNB 4AXXA 4F85A 4ZAZA 3NHAA 3Q88A 2X13A 4FS3A 2XAAA 1TVEA 2E6KA 5T8KA 4EFMA 4N3AA 1DIGA 2WJGA 1NYQA 2RBMA 4EK9A 3S15H 3BL6A 2V1CC 2Q3BA 3QPAA 2KHZA 1ZI8A 3GJYA 4FNAA 5LP6F 3OOEA 3PGMA 1DSSG 3LUAA 3H4IA 5FADA 1VHTA 1XEFA 4RA9B 3CR3C 3H7IA 4RHTA 3TXAA 4MUXA 3SSOA 1CUIA 1WY7A 5F51A 1MNQA 1M1NA 2IZOA 4ER7A 2AHOB 3ZCVA 4QAQA 3OH8A 2CUZA 2XWQA 1XLWA 1PJBA 2XMGA 2D8AA 3ULJA 1PYDA 3JYHA 5EE9A 2WVJA 3EAQA 3IAEA 3FD8A 1DO8A 1HT3A 5EKIA 1V9SA 2HKIA 4CKEA 4ZGBA 3NQIA 3U58A 1KEKA 3S17H 3W1GA 1SUWA 4KJZA 2JA6B 4GGMX 2NUPB 3RR5A 5C0XI 2NTEA 1I6HB 2C3MA 1M1KC 1CP3A 4FVTA 2HREA 3FPSA 2HIXA 1MJ5A 4ADSG 1YHZA 4EHFA 4CV1A 4GOND 1QE5A 4Q01A 1E69A 1H2HA 4CM8B 3ZZUA 2IP1A 1IWOA 4YONB 1T2EA 2UYQA 4GMFA 4N54A 1NW9B 1JJFA 1IBKL 2C0PA 1EZ1A 3AFIA 4FBMA 2HNKA 3OPMA 4P72A 3LA6A 1QVZA 2WYOA 1NUTA 5F2DA 1P62B 3QVVA 1WMFA 3ET4A 1Z5VA 2C8KA 4DWOA 4TSFD 4AYBB 1WWKA 3BWCA 5ELFA 4XVRA 2MSDB 5CPBA 4D9KA 1VQJA 3RJ9A 4ZARA 3TE7A 2ZJRA 5ELNA 4BASA 1I3KA 4LY6A 5A4DA 1RXEA 1SZPA 4N12A 3S2DH 2FFBA 4CIXA 2BC9A 3OECA 4M7RA 1TAQA 5HS4A 2CMFA 5HF5A 4WEOA 1K0SA 1IVYA 2PQEA 2ZE6A 4KR3A 4TQUS 2EG5A 5MN5A 4TTTS 1WDLA 3F7MA 3BQNB 3D3QA 5DBGA 4MCAA 3P0FA 3ZWMA 5E1MA 2BZ1A 5ALWA 3AVUA 3I9V6 4M8IA 3GMDA 2FMKA 2ZSEA 4H16A 3UC5A 3OEEA 1TF2A 4A6XA 4W82A 5IM4F 3EWAA 3UV6A 3COYA 3PSIA 5SICE 4B0OA 3PEUA 2Q2HA 3D3WB 3BMXA 2F0HA 1PRTB 4YASA 3FMCA 4R7GA 1ZNWA 1U8XX 1NLMA 1N3YA 2YXPX 3HH8A 2WVHA 5AXDA 3T5DA 1OT5A 2P1DA 3LNTA 2WZBA 1SQSA 5C3XA 3PD1A 2CW0C 1E8NA 2CD9A 1R0XA 5IYDG 1PJZA 4GLFA 4HMPA 2JK0A 3UGQA 1HZ9A 1EGVB 3G48A 1KJIA 4BB6A 1V7ZA 1W2HA 2PBLA 2KCCA 2VF2A 2P78A 4IIBA 2WFAA 2ISQA 1TKCA 1Z13A 2YXEA 3QU4A 1DPGA 3RK1A 2DN8A 4MV0A 2YYZA 3PGKA 3ZGOA 2FPRA 4AKHA 3RJZA 4YV2A 2PKYX 3SZGA 3LBAA 4DCUA 1P5ZB 1H3EA 5KTNA 2PXHA 1G6Q1 4RTRA 3SXUA 2PA3A 1NY4A 1ITZA 3KSUA 3T1TA 1G20A 2JI6A 5TQ0A 1ZH2A 3O6VA 3U4VA 2WB4A 1RWQA 1XNQL 5KNCH 2Q62A 2FJUA 1PZNA 1A5AB 3R40A 2NZVG 3P2JA 4RNDB 4JC5A 3JYNA 4IIXA 5EBCA 1OGIA 3H18A 4O2AF 1OAOA 2PXCA 4FNOA 1KH1A 4TV9A 3ZBQA 3R5XA 2XDWA 4Z4GA 3PYMA 1E66A 5AKKA 3A4IA 1T24A 1R12A 3DTTA 1NAIA 2WTUA 3NWPA 4TTAA 2E75C 1VCMA 2Q27A 4M88A 4ZEVA 1DIBA 1QFMA 3L1JA 1UE5A 2EARA 4G4IA 1Y3FE 5GADC 4D42A 1KETA 4J1NA 5G0UA 5HKLA 1YQUA 2OQVA 5FKJA 4WVLA 3D7KA 3CW2A 1EG7A 2JFGA 4F97A 4O6VA 3JAML 2G5CA 4P22A 1FK8A 4MYTA 1XRLA 1HCZA 3ZW8A 5LQKA 1RD9D 1QH1A 4E2FA 4H1TA 4LZNA 3W4JA 4HVTA 4GN4B 3PFGA 2H9IA 1QHEA 4A3FG 4YP1A 3EIFA 3E4CA 1JVSA 1GGKA 4YCLA 2OQ0A 3V48A 3CCLA 5DCYA 5L6MB 3PRHA 2QRLA 3OA2A 3UFXA 1BCPB 2F1HA 1AE2A 3FVRA 3L0DA 3LLCA 2CFCA 1C9MA 1EESA 1A9TA 3CX3A 2E1PA 2NSDA 3EDYA 2C9ZA 2F0JA 1DKQA 4A15A 2X4DA 4AUMA 2DM6A 3AETB 4QO8A 2VF7A 4OXKA 2QYOA 4QB4A 2C5GA 4HEQA 3KFUA 1H5QA 3WICA 4HEA6 1JR2A 4A3BG 2B8WA 1TD9A 3VZDA 3IERA 1Y69U 5BSTA 3OICA 2WHPB 1DKOA 3T5PA 3HYRA 4KBYA 1XZDA 3BC1A 3HWWA 5AYVA 3SOPA 3KF6A 4E30A 4QTUB 1VGQA 1CBUA 1STOA 1DBVO 5AW8A 3VR2A 2HHHB 1S7GA 2EOTA 2BE5C 3UMFA 2PQ2A 3TR0A 2B34A 5DLQE 3ENQA 3AL0C 4NK4A 4EJSC 1T9BA 4G5XA 2GAIA 3T41A 3LO8A 5IG2A 1K5DA 5IVIA 4UNSA 3T7KA 4YMWA 4JI1B 2Q8PA 4DCMA 3HZZA 1PR4A 3RRZA 2F0MA 4FONA 2WILA 2O54A 4ABYA 1RWPA 1EUYA 2WQZA 2A0KA 2VHJA 4L9RA 5ABPA 2XTAA 3L7NA 1K08A 1HA6A 5CMLA 2XXAB 3RKSA 5DX8A 4ZUIA 4WLVA 1QBGA 4XWYA 3VKFA 3OFVA 2QV0A 2HYIC 1VQ9A 2A30A 2F43B 4DW8A 4C22A 3WK5A 1KHTA 5BURA 4ZQCB 4BDTA 4D81A 1NVAA 1TXYA 3VXKA 2UUCL 5AW3A 4JWKA 2XKKA 4OMUA 5B4UA 3ZZMA 2OCDA 3WKAA 5EUMA 2RCYA 5C1IA 3GLIA 4OEMB 1T3TA 5DO9A 1KJJA 2I2WA 1SKMA 4MJ7A 5CYOA 3R3ZA 3INNA 3CH4B 2FX5A 3HFRA 1U7XA 1ZSNA 5FQOA 2A6PA 3AR9A 3D3NA 1U4MA 1Z0UA 1PK8A 1FR3A 1KAGA 3CLSD 2XTJA 3BMCB 1PJAA 3DVQX 3KSZO 3LHFA 1CZUA 5AM3A 4Z8XA 1L4HA 4FFSA 5A35A 2EJWA 3QPCA 1GN9A 3HVJA 3FYUB 3MMZA 3QLJA 3HG7A 5DXAA 2QI9F 5EUQB 1U8FO 3NYIA 1GKIA 4EO7A 2XMSA 3EFOB 3EDOA 3NM5A 3NBZC 2JHFA 3N8NA 1VCOA 5IUJC 4HZUB 3TJRA 3W5CA 2QNRA 4X20A 4JBLA 5F1OA 2P9YA 4BBAA 1ZM9A 5C4JH 4PF1A 2R2AA 4RVHA 2LSSA 2B2CA 3M34A 3VC7A 2QJOA 5M29A 3MTBA 3T9BA 3LMKA 2ZAYA 3CLVA 3OQOA 3AQ4A 4JITA 1ODLA 4FU0A 2Q5FA 4HMQA 1C2TA 2ZTSA 3FDTA 3NYWA 4BKMA 3QPUA 3UWDA 2QD5A 2FW6A 3QBVA 4Q4JB 4BWYA 5JSQA 5EWJB 3GDHA 3M5WA 5BUZA 4O2DA 1G21E 2FEKA 2OV6A 3HZXA 4RVUA 2B39A 4PCAA 3JVEA 1NMYA 1SD5A 3K80C 5C8YA 5FUVA 1TIKA 1RE0A 5H3LA 4UDNA 3VDMA 4QYWA 3A25A 4KY7A 1UBEA 1H2WA 4CM4B 3EGVA 2A69C 1J20A 1QCYA 2Z5VA 5LMCA 5JZSA 2J9YB 3QVTA 1Q3LA 3ZHQA 4EBFA 5HE9A 2ZWVA 1EA7A 4B3RL 2ZT5A 2E5LL 4B4UA 4D0LB 1KO4A 1UBOS 3HKDA 3RYHB 3K5MA 1D2BA 3SZUA 2I6FA 4CEJB 2GAJA 1GARA 3K9CA 1S89A 1MV8A 5JANA 4R8KA 1J2TA 3RAEC 1E2VA 5CORA 1PH4A 4JP3A 3GT0A 2G06A 2FXQA 4C7OB 4NMMA 1XHFA 3GUUA 5E1FA 2PTGA 10MHA 3RHTA 3IT2A 3RR2A 2E2IH 4W9NA 2ZB8A 2BFCA 1SIBE 4CG0A 4D79A 4HX5A 4LNUB 2AYZA 3DFKA 3ASUA 4FNMA 3CD6A 3QXHA 4B3BA 3FCUB 4D4HA 1WXHA 4QQBX 1MJGA 4DG5A 3E9IA 1GQOA 4US1R 3H9CA 2OHVA 3SPXA 3DEAA 2RKWA 2P3OA 1UZLA 1K7SN 4QEZA 1QH8B 3VH3A 4DPKA 2VYQA 1R8QA 4PLWA 4RFBA 3W78A 1RJGA 2XVZA 5I9TA 5T67A 1XDWA 3HOVH 5J2UA 2BRUA 4HIKA 4DTIA 1TCVA 1FP2A 3GJ0A 4FS8A 3LXRA 4PSDA 3GNLA 4JH0A 5LQUA 3B89A 2JH3A 3DEIA 3TMYA 3CT4A 4P2CB 4X45A 1UUFA 3H99A 4IIJF 3OX1A 4G41A 2X0NA 3E9ZA 3E9QA 2PE5A 4JXJA 4Y2PA 4BO8A 1B23P 2QAGB 2Z5GA 5MFZA 3HXLA 4Q7JB 3RUPA 2Y6UA 4GKJB 4ZYXA 2Q50A 3S1RB 4C04A 2GZ2A 1RHUA 3DOJA 3EW9A 2B5OA 5DRYA 2VYVD 4YAJA 4DQLA 1ULAA 1RYFA 3ZWPA 3UDGA 2PZFA 4LCBA 1B2TA 4AG6A 5CVVA 1UJCA 4YDHB 5JU6A 3BF7A 4H7IA 2L0CA 4NCHA 1REQB 4B87A 4IQ0A 1IOZA 3JPYA 3ELDA 4A3CH 4B9EA 5IYBH 2JIOA 2V5VA 4ZCLA 4XASA 4K6CA 1JDBB 1U9ZA 3HFZB 2YL2A 3SK5A 1TUBA 1KZHA 1Y8PB 2QN8A 1P0IA 3IUQA 3U3ZA 3CMMA 3MJDA 1SC3A 4FR0A 2C57A 4JBJA 3Q4GA 1R2QA 1SGWA 3I32A 5G3ZA 1X1CA 3CO0S 3D4NA 3EGIA 1OLSB 3BK7A 2AMJA 1C7FA 1B9MA 1XYYA 3GPLA 3DWGA 5K0GA 1JZTA 3NHYA 3UY4A 4YY3L 4INJA 5FJ8H 5KNDH 4JR0A 2PQ6A 4F4FA 4D8UA 3V55A 2B8JA 5FUWA 2ET6A 2JAHA 4RPHA 2NZUG 3B8HA 3GL9A 3IE0A 1NVTA 1L7XA 1FYFA 3SCZA 3UAVA 3RQSA 1O5TA 1MG0A 4U9IS 1D6EC 2AI1A 1QV9A 3UJ3X 4XFJA 4MVJH 2YXNA 3U44A 1WR8A 4NOLA 2GCOB 1IN8A 2CJFA 2BMDA 3C7KA 4BIIA 1MVOA 3ZE1B 3BXHA 4IUNA 2C2OA 5H3CA 2MIIA 1TAHA 4O5OA 1CKEA 3F5FA 2DWPA 3PI6A 3UE1A 5I7AA 4C05A 1L4UA 1W34A 2GMWA 2ST1A 3IFSA 3S1SA 1P4SA 4DLTA 2FVYA 4OJNA 4Y1FA 1IH8A 2O7SA 3IXLA 1K8ZB 2PMBA 4NP6A 5KYWB 5DTMA 1SCIA 3CPJB 3X2FA 3K0EA 3OOJA 3RVMA 4OXIA 1ZGCA 3KRTA 1SOUA 1SNMA 3G17A 1XB2A 3ZV3A 6PFKA 4KBFA 1Z0FA 2PD4A 3LQQA 1NMSA 5TEWA 4QYIB 2B83A 1TMYA 3U4HA 1AGNA 1PJTA 3UKOA 3AF1A 1RMQA 5LYJA 1OFVA 2OLJA 4D4KA 4LS3A 3OZXA 5COBA 4LNAA 4K9RA 2G77B 1JWBB 4RIIA 3OOYA 4QPCA 4Q02A 4OUDA 2DFPA 4EM6A 4O2BA 2WFLB 2YWXA 4YJHB 3L1HA 1UE7A 3O0TA 3DO6A 5LN1A 1IRXA 1EE1A 1H2BA 2L4NA 4XWGA 3IYLW 4GOMD 5HF6A 5AW4A 2FF5A 1NKTA 4YJKA 4NV1A 4RJKA 1XDBA 1UC4B 3PHIA 1UK6A 3MWKA 3G23A 2ZTHA 1VSBA 4BWFB 4NYMR 2JAQA 5CD9A 3I5YA 2GXAA 4TROA 5DMXA 4X1OA 3E5HA 3B1FA 4DUPA 3BERA 3GIWA 4H7HA 3N2GB 3UE0A 5LXTA 3EMKA 1YQGA 4IJ5A 3WGYA 2EHDA 3PITA 1GY8A 1O2DA 1PMRA 3FCEA 3BWEA 4MR9B 3KV3O 4K7JA 3ABOB 4QDOA 2J7PA 4BEWA 5HRCA 5D5QA 1EFLA 1D1SA 2HHHQ 1E98A 3F9RA 1IC6A 3MUNA 1W1IA 1WQ3A 2AUNA 2XUHA 5CNKA 1N1GA 4TYYA 1G3RA 3DFZA 2PGJA 5DN6D 3U7IA 4B6JA 1WBJB 4ZI7B 4MQFB 4MPRA 4JK3A 4JI1Q 4HV4A 1JEOA 3PGJA 4PZLA 2WK1A 3S2HB 3KXPA 1SZDA 3NCHA 4NDZA 3H5VA 1O80A 2BTQA 4ZVQA 4J2OA 2EP5A 3FKIG 2EX4A 3KFLA 1CUZA 5I7OA 1DARA 2CHEA 1VE3A 2A1TS 5WRFA 3R7AA 2DWCA 3N8HA 2VAPA 1X3QA 1M76A 4H1HA 5GAGC 4Y9RA 1J1IA 2HB6A 4ZTBA 1H2XA 3QVJA 1OLUB 1Z83A 2ZCUA 1SMKA 3N59A 3D2LA 1FUIA 2Z6AA 4LF6B 4PRZA 1H0HA 4ALPA 4LQ4A 2YNMC 1D2AA 3N7AA 4KU4A 4J0GA 1EYZA 1HWYA 2Z83A 5C0XH 4V0BA 1SK9A 2GHRA 3ZE6A 4WZAA 3CPWA 5IC5A 5I7RA 2D13A 3QYJA 1NSFA 3EXHB 4ZOLF 1G42A 1OQAA 3FVVA 1QIFA 4KXQA 3WNBA 3ZZTA 3LIIA 2OK7A 3H2HA 4FF3A 2W7TA 2NZJA 4YQYA 4IRXA 3FPCA 3SJUA 4LRWA 3M1IA 4NMWA 1SBBB 1OYWA 3L2PA 2VXWA 4JUBA 1M5UA 3CB4A 4R1UA 3VR6H 5KOHB 2DPMA 5CDYA 3DWQA 2E18A 3T5AA 1T5IA 5HUJA 2IIPA 3OPQA 5F64A 1WCV1 5F7JA 3RIHA 1RIFA 3MAQA 4MVXA 4JBIA 1RXUA 3TNYA 2E49A 3L7ZC 1UDAA 3U26A 1BCSA 1D5CA 4I5DA 4A0HA 4C1NI 4DMMA 3S70A 3I37X 3D0RA 2I78A 3CUTA 1IXSB 4GH5A 2JJ8A 4D0RA 2CZQA 3OUUA 4GNXC 3GEHA 5D5HA 1I3MA 4LF7B 3OOSA 4Y98A 2IIVA 3ZDDA 2ZXPA 3P0JA 2R93G 3BTVA 1AB5A 3S5UA 2TSSA 2C7PA 2HDWA 4IFDJ 4I1IA 3N6RA 4Q03A 4UUPA 4RGQA 4X95A 2FW9A 1MMFB 5FWYB 4R8LA 5EG5A 1DTWB 3W6ZA 2K04A 2QA5A 3EZ6A 3FTFA 2UVPB 4P38A 3QVSA 4W5TA 2AYYA 2WU0A 3H2BA 5LR6A 1G98A 1S2MA 1LTTD 2GZSA 1EEHA 5LB4A 1F4VA 1JJGA 2SCUB 1BWSA 4CQJA 2ZS8A 4NJEA 1JQJC 4NEQA 1Q1AA 2VN8A 5CM9C 4JB3A 1M34A 4YGYA 4IUQA 3NEJA 1UBRS 3NBHA 1SOVA 2C4HA 3HA3A 3FSGD 2EL9A 5D87A 2QB5A 3HL4A 1RRVA 4UP9A 1NIJA 1V8OA 3VHRA 3H6GA 4ZVRA 5GGXA 2ZXRA 3DNMA 1LYLA 1D5MC 2B6HA 3SF8A 2AFHB 1KDAA 3FSJX 5CYFA 4B85A 1UEXC 5JOBA 3MM4A 4FHFA 5DLDA 3MHPA 1RC1A 3CZ9A 3IBYA 2AG0A 5M2QA 1CUWA 2X86A 5I9PA 4EMSA 3RVQA 3F2CA 2EYUA 3S16B 4H4EA 5AJTA 4IF6A 2JFOA 1Z4QA 3IUBA 1QLHA 3AUAA 4G9EA 3C3CA 3KZNA 4I1PA 3QNMA 3USCS 1RD4A 2OQKA 2IYWA 5DP1A 5JCXA 4DFDA 1ZCAA 4TUYB 2BLNA 1CKNA 4GXRA 3CEJA 4I7AA 2BBTA 4DV5B 2AC4A 4QOHA 1PEAA 4N0QA 4RKWA 1KK2A 3WYFA 4R8IA 3C6KA 1EX9A 2CWDA 1NUSA 1R6TA 3RGGA 1KY5A 2D0PA 1W9MA 3MUOA 5F23A 1Z0ZA 4ER3A 4FB4A 2AUTA 3K73O 4WESA 4M99A 2H4YA 3GNSA 3UBMA 4HEJA 2C5CA 1U0SY 2X0DA 4MI3A 1D0VA 1PW7A 1CQZA 1R0ZA 3TRFA 2XRSD 2PBRA 2FSVC 3KOMA 2WYHA 1E62A 4HNHA 4OWTB 2C3PA 4ENQA 4XYLA 1KR2A 4YAFA 4XJTA 1NWCA 3RVPA 4IQ8A 3U9LA 1UP6A 3PEWA 5B1HA 3G02A 2J6HA 3MOSA 2A3NA 3PNSA 3QX7A 2Y1WA 4RXTA 4EFDA 3FPLA 4EENA 4GKJQ 2RGBA 1CR6A 4UEWA 2H07A 4W7SA 2R68A 2WKPA 1TTTA 3OZCA 1W88B 1O6ZA 3OPVA 2C99A 4Q3EA 4TVAB 3A32A 4EG4A 3DE3X 5HGJA 3ZQJA 1TJ5A 1RQLA 4ZAFA 5E2AA 4BVFA 2XE4A 1AH9A 3DBRA 4IG9A 4OREX 4WAUA 4LJ4A 4JL5A 2HQEA 5F5XA 5EJ4A 4CT4B 4II2A 4Y6QA 1NYLA 3S99A 4UDYX 1PFYA 1Y1TA 1EUCB 1AKYA 1NA5A 1O0SA 3OZDA 1JJIA 2PUCA 4UHVA 1E3LA 4XQJA 1T9AA 2WIIB 1Y6JA 4OB7A 5JCJD 4PGGA 2XGJA 1W4LA 5M5XB 5ALRA 3KHSA 4B3CA 2IEBA 1A2TA 1B73A 1E2UA 1EVEA 4OJYA 1RC8A 5C81A 1WZIA 1WRBA 4RFLA 3SM3A 4OHYA 4TTQA 5ELBA 1UPTA 4IUPA 1XRRA