1OXSC

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 106
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
C PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxsC03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxsC02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxsC01
2G77B 3LBIA 1L2TA 4EKDA 4RMFA 1XJ0A 1X65A 2YC2C 2J3EA 4URUR 5DHFA 2GCPA 4B3CA 1WJJA 1CR0A 2WMOB 2YOFA 3VR6A 4RZ2A 3J80i 1KAWA 4BECA 1IN5A 2Q9BA 1RRCA 1LACA 1QHHA 3CZQA 2L0XA 4C7OB 1QDEA 4M1TA 2GBLA 2IWRA 2O8FA 3ADCA 1J8MF 4DT1A 3HYTA 3IKJA 1E2PA 2UUCQ 4LYAA 5HKKA 3OZXA 1ZMXA 1YZNA 1PFSA 1VQEA 1X3EA 3NBHB 2VQFL 2P65A 1N6PA 5FUXA 3C15C 4ZV4A 3BZKA 4KFUA 4S2EA 3QF4B 1L8QA 1N3BA 2DPXA 2K4KA 1L2FA 2AN9A 3CCSA 3QBTA 4YC7A 2XZLA 2AL7A 3K7AH 2OILA 4F4CA 4PZ6A 3MEFA 4NU0A 4RD1A 3VMFA 1ETUA 3MJHA 3U58A 4RD3A 3K1JA 1P2VA 1JJGA 4HB4A 1XEWY 3VKHA 3R8FA 4ARZA 1VS0A 3EIHA 3UE0A 4BLOA 1G20E 2GKSA 4PO9A 4JBJA 2CKZB 1AGRA 2WWFA 3BWDD 2AUJD 4G7OC 5A4JA 4C3IH 1HNZQ 2EIFA 3Q5EA 3U4QA 4M1OA 1EQRA 4DV3L 2UU9Q 2G3YA 5AUNB 1Q22A 2ZI5A 2VY3A 3DHWC 4ARZB 5CJPA 4EPRA 2VP2A 1M7GA 3WBJA 3ND8A 1Y14B 1IN4A 5E7NA 3GLFE 2GJ9A 2LKCA 1AS0A 2R44A 2NO6A 2O8FB 1GO3E 2E5LL 2A9KA 2ASEA 2GETA 2O8CA 1W36D 3U3KA 2WV9A 2IUUA 3DM3A 5EP2A 4W7SA 1EG7A 1DCZA 3T12A 1VG9B 3I4MG 2QZ4A 3MG9A 2FWRA 4GNKA 3T61A 3R9WA 4LF7Q 1DGSA 1AN0A 3THXA 2A68C 3VR4A 2J7PA 4A8JB 3CX7A 5M3FG 4EDHA 1EWRA 2JLQA 2I0QA 3PV0A 1XD2B 2H18A 3T1HL 1PHJA 4BLTA 5A35A 3IFTA 4JI2Q 4C3HH 4DR7L 3AVXA 3RLNA 4URYR 1ZM9A 2XZPA 3F2DA 4APVA 2C5LA 3R7WA 3H2YA 1M6NA 2BBTA 4BBSG 4QXAA 1OHHD 1NLYA 2V54A 2XTNA 3AKEA 3BERA 4A0FA 4DCVA 1LY1A 2ZTSA 3KFXA 1HT2E 2Q0HA 2AKYA 1ZCBA 4GRAA 3UDIA 3LWUA 4JYCA 4Q01A 4DV5Q 4Q1CA 4TLDA 3HU1A 1LTLA 2BC9A 4A3DG 3R20A 3OW2A 1Q90A 1GWNA 1XTRA 4YXWD 4JG2A 4GOPA 1NKTA 1VIYA 5E7IA 2ZITA 1Z6YA 4H02A 1WCMG 1E2HA 2XOKD 4JLVA 2J7PD 2K14A 4TQUS 1A82A 4V0ME 2GWHA 1XWIA 4L4UA 3BH6A 1L1OC 2AD5A 1OXUA 1VQCA 3PIOA 1J70A 2NVTH 2ZI7A 4EFMA 2ATWA 4H1UA 1UKVY 1FGUA 3BC1A 4Z54A 3GLIE 3GLFB 3KJIA 2A5JA 2KHJA 3AFQA 1VQHA 1X8KA 4HAUA 3WYFA 3WBKA 4BRUA 1T8UA 3BBPA 1TF2A 4N3NA 4YWKA 3EN2A 2IT1A 3CC7A 2VUMH 4GI7A 4NH0A 2BCJQ 1N5KA 1V1QA 2QP3A 5JJLA 2EJGC 3RS3A 1QHXA 1SVKA 221PA 1UFQA 4K8OA 3WYGA 5CLLA 2DGYA 3MXNB 1II8B 3GDEA 5LMNW 4Q1BA 4ALPA 1TQ4A 3AP3A 3OIUA 4DCNA 5TB5A 5M3MH 3S24A 3ZJYC 1Q3TA 3BJIC 2ZRBA 2R9VA 3B85A 2YJTD 1AS3A 4JI3Q 1OFUX 2ZRIA 2ZRAA 3FVQA 1KKLA 5EQTA 3T34A 1P73A 3U4QB 1YR9A 1KXLA 4HZUB 4XD7D 5JI3E 1IN7A 1HH4A 4LHWA 2XOKA 4NYJR 3REGA 3GJ6A 3T5GA 1HT1E 1Z6XA 2XEXA 4OHXA 3A6PC 2MSDB 4LPSA 3HOUG 4GZYC 1UWVA 4PC6A 2JASA 3U44B 4MZ9A 2QQEA 1FL0A 1DAKA 2CK3A 4KN7C 2P2LA 3SR0A 3SN6A 4LF8L 1W2BA 1BS1A 2QSYA 1KOFA 1CKMA 3W1GA 3G71A 1TF7A 1H9SB 4GS3A 2F9LA 5IP7G 3TS0A 1GL6A 1U81A 3PUVA 1Z8FA 2EW1A 4GZLA 2ERXA 1GJXA 4I1SA 3TH5A 2JAQA 4GN3B 4D6PA 3J7ZC 3EA0A 4DNIA 3QVVA 2A6HD 1N6NA 2ZE7A 4MITA 1HR0W 3OHMA 4DR5Q 1R5BA 3MAAC 1DAEA 3HDTA 4P31A 5J40A 4CT5A 3O8RA 3DMDA 2BKUA 3NEJA 1B23P 1RC8A 2ATVA 2PH1A 5CK4A 1Z2CA 1CEEA 5C0XH 1Q1BA 4QHYA 1Q20A 2BJVA 4TTRA 2A5GA 3AB3A 4DV3Q 4A3FG 2VTKA 5EZ5A 3I72A 4O2RA 3EBEA 1W5SA 4YDSA 3X1ZA 1TEXA 2FX3A 4JS0A 3JVUA 4XSHA 4DVGA 4Q4JA 1ZD9A 4XD7A 1Q1QA 2ZRNA 2EQBA 3K9LA 3GLGB 1E2LA 5LD2C 1W0KD 5G3ZA 1XEWX 5JECA 1E2QA 1HNWQ 2GA8A 3MUFA 4NCJA 5FBWB 1UBCA 1XPRA 2RAPA 2WVJA 3WHLA 4DCUA 1ONBA 2RB4A 4W5JA 4Z51A 3CCUA 3K8YA 4LUOA 3CMEA 2PNRC 4DKAC 1VYTA 5AJ3L 1NKSA 2F1MA 4D4MA 1W5TA 3GP8A 4ASUA 3I62A 4BLRA 2MQHA 4JVSB 4P4SB 1K9MC 4YY3Q 4AI6A 2CBZA 4C7OA 1ZKOA 3CRQA 1XZPA 1TWFH 4NBSA 2NGRA 4IW3B 4WXPA 2NPFA 4KCGA 1VQBA 2E2HH 1DVRA 1SMXA 2PLFA 3CB4A 3KB1A 4ZIRA 3MXUA 2F3RA 1UEJA 2R92G 4UPAA 3ZGXA 4LX0A 5EUQB 1H9JA 1DADA 4URWR 2D3WA 1LNZA 5FLMH 4DC9A 2QT0A 2GCOA 5J4LA 2ZSBA 1XPUA 1G3QA 1GRQA 1W4CA 4TLCA 1PYSB 3HOZH 3J81k 2R7DA 4FINA 2V8OA 1HR0L 1J7KA 1EOVA 1Y8NB 1X9NA 1BMFA 1JR3D 1TL7C 1V5WA 2A7QA 2AHOA 2BV3A 2GVDC 2QU8A 2QUZA 1DAMA 2XAUA 3AKYA 2ZRFA 5C4XG 2EWVA 2MSEB 2OAP1 3EZFA 3K0CC 1CTQA 4DR6L 3CF6R 4Z8XA 2QBYB 1HR0Q 3LW8A 1LFDB 2ZVQX 2IHFA 2R7ZH 1YU9A 1E1QA 1OFHA 5DISB 3G5UA 4LHYA 4R9UC 4HDOB 5FOVA 4RSGA 2I3BA 2ZAMA 3PEVA 2IHBA 1VQJA 1KJWA 4B2LA 4HUTA 4IEIA 4JLKA 1HTWA 4RFSB 3RRZA 4JI3L 4F93B 2OZEA 2FV8A 2O0KA 4ASUD 2W83A 3MSXA 1FNNA 4M0LA 4BBSH 4PX9A 3SNHA 2A8VA 3ASYA 2VSOA 1HZBA 3B82A 2IYVA 3HGBA 4G5SA 1NMYA 2JEBI 3CR7A 5IK2D 4UNQA 3HOXG 3GTOH 1AS2A 4YY3L 1G9XA 4HSEA 2ZETA 2HYIC 4DPGA 5K36G 4HIKA 2JE6I 1X6VA 4CEIB 4M8NE 4C3ZA 1XMQL 4V0OA 4IOJA 1YJ9A 2DFLA 1XMOQ 4TTQA 2QY9A 2K5HA 2P6UA 2ZVPX 2RCNA 1Z3IX 2VL7A 4TL6A 4R2IA 1SN8A 3KJHA 4PC1A 1E0KA 1CKNA 3TKLA 2O5IC 3U4ZA 2NMVA 3CRW1 5F9HA 1GRNA 4URXR 3RNLA 2Y8EA 3VHXA 3JC66 1N6IA 1N36L 1VG0B 2YV5A 2QI9C 3WY9A 4J0QA 3FMCA 4UJ5A 1PH9A 5FR1A 3CZPA 5TY0A 2YYZA 5IE8A 1HYQA 4U00A 4C0AC 4BPBA 5JBQA 4LYHA 3QUSA 3M4OH 3E2IA 4PO1A 2I5MX 1G21E 2ZYUX 5LBIA 2QM7A 1GRRA 2NOAA 4RD4A 3U7EB 1KC8C 1IXZA 2CHVA 1F3OA 1G16A 4XVQA 3PEWA 1Z08A 1LF5A 1E1OA 2ZRPA 2O8BA 4ZI2A 4A3LH 4B6EA 5JWOA 2KB0A 1YHQA 2BOVA 4DCTA 5JS7A 3LH5A 1WBDA 3MFYA 4LHXA 4IFDH 3UDXA 4ESVA 1TXYA 3ZIAA 4DV6Q 3GFTA 4X8OA 4ABYA 1PH3A 5J4HA 4E07A 621PA 1ZNYA 2CLSA 1SHKA 3SOPA 2Q2UA 4CEHA 4LHVA 3RS0A 2JJ2A 4A76A 1EYGA 2OQ0A 5K36H 2D7CA 3NDBB 2QAGA 4GP7A 5JCPA 2JLWA 2N1BA 3H94A 4KKTA 3A1SA 4PC7A 2UUBQ 3AFPA 4IOAA 2WJGA 1UE1A 1IM2A 3DVLA 2A19A 2LWIA 1P75A 3QVUA 2DB3A 1MH1A 4R2HA 1DG3A 4XVRA 1E4VA 2C8VA 3L43A 4NDZA 1MO6A 2UXDQ 2EYUA 2O0HA 1P2UA 5BWMA 4OI1A 3HPRA 4JYAQ 5C3EG 3ULLA 1T4GA 4PHFA 2OESA 3PJRA 3ZS8A 4R4TA 3RRNA 4DIDA 1QVFA 2WJHA 3GJ3A 1KJYA 4P3YA 1XJCA 2JJ2D 4LF4Q 2LMCB 1SXJD 2GJ8A 3IEVA 1DOAA 1DXMA 2AK2A 2VEDA 4O2LA 2FSFA 1ELOA 2NTYC 2IYSA 3PENA 4GZMA 4YMSA 2Z6KC 3I5YA 4MH0R 2JLRA 5FTJA 3SBEA 3SC3A 2B63G 2RGNA 4DLXA 2ATXA 4IPCA 3KJOA 4WXRA 5IRCD 1U9IC 4CVNA 1VIAA 3FFBA 2GXUA 3GLHE 2JDID 3NEYA 5EUMA 2L15A 4KODA 2OBLA 1II9A 5TVKA 3U9SA 2HT1A 2C9YA 2RGGA 4R71A 3PUYA 3QG1A 5C0XI 1R6BX 2VZAA 3NH6A 3CCJA 3OFND 2UXBQ 3TAHA 4LUCA 4GNXB 4TQ9A 5FPTA 3WP0A 2I4IA 3SJZA 1IBLQ 2GZAA 2QRZA 4KBFA 4TMKA 5JHHB 3PEYA 4TMXA 5TMPA 4A2PA 1UKEA 1WBBA 1GP2A 1RRPA 2R8RA 4B3GA 1ZM2A 1AGPA 2PBRA 4V0NA 3WMEA 3K09A 4B47A 1NBMD 2P6RA 1A1VA 1NLZA 4DDVA 2OFOA 1AKYA 3TSZA 2OLKA 3LY5A 2JLSA 2QA4A 2ZRKA 3EC1A 4LFBQ 4YCVA 2QMUA 3VA7A 2DFKB 1E2VA 1TNDA 2WWXA 2WWHA 4GOPB 2GZHA 4CW7A 1CKNB 3ASZA 5FR2A 3FP9A 4BBRG 3U6BA 1OJLA 3TJZA 5ELXA 2OLJA 3TAUA 4DV1L 1P7CA 4A3DH 2HCBA 1S3GA 2A78A 4HZIA 2WHXA 5D3QA 3UDGA 2ZM6L 2VSXA 4Q9KA 1WXQA 5EZ6B 1UADA 1GZSA 4TYWA 2BEKA 3I1FA 1GUTA 3I92A 4QC2A 3RWOA 2WB1E 1ODFA 4DLVA 3ULJA 3D3QA 4E03A 2C98A 5HKKD 4LF8Q 2FSIA 1BBWA 2ZRLA 3QXJA 2VHTA 4UJ3A 4DV2L 2ZTEA 1KD1C 1CR2A 2VHQA 3CPJB 4HLUA 4JBXA 3EX7C 1CSPA 2H92A 2IF2A 3IILA 4JLNA 1CR4A 5IP7H 1IYVA 1PUIA 2GEDA 1XFAA 1YE8A 5FUVA 4A92A 1JQJC 1AZTA 3Q72A 4BFVA 1DAIA 4EPYA 4WVFA 1OKKA 1IXRA 2GVAA 3LRPA 2DN8A 1B0UA 4DR5L 2K7VA 1VECA 1FNMA 2C03A 3KLRA 4LY6A 2JLXA 2VUMG 1HNXQ 4MKIA 4A2QA 1SGWA 5GAEC 1YRBA 3CNOA 3A74A 4QOSA 4YXWA 1FPMA 1I2DA 2D2EA 5GJCA 4MYUA 5LB2A 3TQYA 1VCMA 2QSZA 3EAQA 3F1ZA 5C0XG 2R6GA 1JI0A 3MMPA 5FI0B 1FQKA 3CWQA 5KPJA 3RS5A 2QP9X 2ASBA 2BBWA 3LNCA 2N46A 4B3TQ 2C35B 4RKFA 2VSFA 1TMKA 1SKYB 1E9EA 1VF5C 3S1AB 1CKEA 2IUTA 4BFWA 2YKGA 2XX3A 3RWMB 5SZKB 2CL6X 2AKWB 1XP8A 1VTKA 5B64A 1TWGH 3QEOA 1R0YA 1SVLA 4DUZQ 3VR1A 1J8YF 1S3SA 4XJXA 4JL6A 1NN3A 3L82B 1IXSB 2YINC 3O8BA 1FTNA 2PZGA 3K9GA 1S96A 2HJVA 4IDHA 4Q4AA 1NJIC 2Z83A 1D6JA 2VHUA 2FU5C 1DTSA 1OPXA 2HIXA 4EIWA 3UDFA 1PLJA 4C9BA 1O7IA 2UUAL 4JVLA 1K8OA 3Q7PA 1YJ5A 2JA8H 1WB9A 1KDRA 3K0CA 5KSPA 4QIWE 1KY2A 3TUIC 4A3CG 2CE7A 1K5DA 3LQRA 1Z0FA 4W9MC 4GBMA 1KRTA 4GKJL 3A4MA 3T1VA 4ZDKA 3ND9A 2KHIA 2OTJA 4XTCS 4L8GA 4V0MA 1KI8A 5TARA 2NQ2C 2A5DA 4B3RL 2JEOA 3KF6A 3KDSE 4WZ6A 2F4VL 4MA4A 3EPHA 3J81i 3RNUA 2OT3B 1Z47A 2HF9A 721PA 2BH8A 3DKVA 2N49A 1XMVA 4L15A 4FXPA 3FWYA 4NKRA 4HIOA 4UP8A 5C4XH 5KDLA 1CSQA 1XB2A 1ZINA 3CM0A 2FDCA 4ZKDA 2V4DA 2CFMA 4OHVA 4BUJA 3RS2A 2PJRA 1W0JD 2CW0C 3B9QA 3P1JA 3GEIA 4DV7L 4B3ML 2IX1A 1IJFA 4HLDA 4IOMA 3MWKA 4TZ6A 1GKUB 4ON9A 3K9HA 1WQ1R 4C0KA 5JCZA 3CD6A 1T3LA 1U8YA 3H4MA 1H9RA 4KU4A 3RSLA 3QI2A 4KYUA 1SVMA 3WHKA 3B7GA 1G6PA 1UBGA 5AJXA 5KDOA 2Z0MA 4X66Q 1RIFA 4ACBA 1KMHA 2WIAA 4AYWA 2W2TA 3CPFA 4V0KA 1JXOA 1GHKA 1VQ8A 1F60A 3HP1A 3HYRA 1OSNA 5JI2E 4LJ8A 4R98A 3B5JA 4U5XA 4ZIRB 3U7FB 5LMUL 3UATA 2RGNC 4IDNA 4A36A 5C3EH 1CRPA 2F1IA 4JI5L 3GQBA 3OYYA 1W44A 2WOJA 4GT1A 2KCTA 3M4QA 1XTKA 2JA5H 1IXRC 4ZCLA 4QM6A 3NDPA 2IHEA 1FP7A 3PG5A 2GVBA 5GJBA 4AKIA 4IVQA 3PITA 2ZS8A 3AF1A 3QIAA 4QBHA 1P9WA 3BFKA 5JRZA 421PA 4ILEA 4X6AH 2R6CA 4JL5A 4DK0A 2F6RA 1OXVA 1VQLA 1UDWA 4QY7A 4YMWA 5E7JA 3U3MA 3RRMA 4LUZA 4BGDA 1SXJC 2GILA 1JPJA 4DIEA 3Q7QA 4NTZA 4GL2A 4EJSA 4OQXA 1GFIA 2ZROA 4AQYQ 2ZJYA 4FMCB 1Z07A 4C2UA 1O3YA 3U7GA 4IFBA 5CJ2A 1NVUQ 1MO4A 4PPGA 4DJTA 1D9ZA 1ZD8A 4BRWA 1N5JA 2GF9A 2LXKA 3NIBA 2O8EB 1AQUA 2GN5A 1AKEA 4KAXA 3KL4A 3DL0A 1W2GA 5BR8L 1HURA 3U44A 1ZBDA 2OTLA 1N32Q 3ZVRA 3IQWA 5E95A 4JC0A 1GG2A 2WJVA 4MRNA 5CYPA 2IS2A 4TWZA 1OIWA 2CXXA 3GEEA 1E9DA 3UK6A 3UMFA 2R7FA 2CDNA 2VL6A 4IKEA 4F4JA 3PF4A 2CNWD 1W36B 1SROA 4YDHB 3GJ8A 3IQXA 2GJAA 3FKSA 2GXAA 4LNQA 4RJLA 3ER0A 4F7WA 1IY0A 1P2TA 1R8QA 2HV8A 5FJ8H 2JA7H 3UWKA 1T0JB 5JRJA 4D82A 3NKVA 2Y0SE 4BY7H 4QM7A 5GJWC 3I61A 2WKPA 3UIEA 3ZVNA 1KI9A 3QKUA 3EPKA 2HXSA 2OAQ1 2RHQB 4DUYL 5KO2A 4GP6A 5H1SE 4P72A 4OK5A 4QL5A 4JI0L 2O8EA 5FL7D 3CCLA 4UXIA 2B8FA 1U94A 5FPSA 1E0SA 3GTGH 3HOYG 1XXHE 1CKOA 1ZIOA 4H9GA 2DUDA 3WYAA 1E2EA 2Q2TA 1YHBA 3C5CA 1TAGA 4JLJA 4PAMA 4PQRA 3T1HQ 2CJWA 4AIIA 2WMNB 4GFDA 2CCGA 3S1NH 1O78A 3W6OA 2J5XA 1W36C 2FJUA 4M9XA 2VW9A 4ITRC 1KZGB 3AEZA 4GMXA 2EJFC 3RN5A 1OFIA 1QHGA 1W0KA 2AFHE 2BCGY 2PNHA 2BM1A 3M1IA 3QF4A 4LJ9A 4C2TA 1JJ7A 1W3SA 1H8HD 2D74A 4W5WA 4NYIR 3FHOA 4LRWA 4M1SA 1VMAA 3QE0A 5DYGA 5JS8A 5KSYA 5KNDA 4JI7L 5EXTA 4LZZA 1XPOA 1XEFA 2FXQA 4XTRA 3WMGA 1EX6A 3E0EA 4M9ZA 2IYUA 3STBC 1OT3A 3EZ9A 3ZLJA 1G6OA 4JI2L 2DFTA 1UF9A 2DYKA 1HV8A 2ORIA 3B9PA 4JZKA 1PVOA 5JHGB 3N2EA 3M7NA 3EWAA 4LF9Q 4D0NA 1HNXL 1R0XA 4F91B 3NVAA 2XXAA 2QNRA 3HR7A 2ZAOA 1E1QD 3S1RH 4BA1I 3IPXA 3W5IA 1IJEA 4L8JA 1WCMH 4O25A 1FFHA 3U3JA 1VCNA 1KYIA 1H8HA 4M21A 2KI5A 3V4FA 3HR8A 1HE1C 4LGMA 2GJSA 1E2KA 3NBYC 4CIDA 4ZKEA 1CU1A 4OO1I 5LMNL 3W6PA 3KQHA 1QJOA 2ODEA 2BE5D 1WF3A 2XGJA 4HLCA 2HEIA 2IX3A 3VR3A 3VQTA 2FPLA 3TMKA 1VKJA 3J7A5 2Z6KA 2RHMA 2ZRGA 4ACAA 3GTKH 2ZANA 3U3OA 1Y3AA 1QHIA 3EW9A 4FMDF 2CMKA 2QTVB 5CB6A 3EPLA 5CYOA 3KTAA 3KJPA 4WBSA 4A3MG 3AQ4A 2W6IA 4JI4L 3CNLA 4D26A 3WMFA 2GESA 4P74A 4Z8YA 3U2QA 1COWA 2PCFB 3S17H 2AD1A 1II0A 5D3MA 2WPDA 4AYXA 5FH9A 5M04A 3S16H 3QY0A 1E2GA 3A1UA 2VLIA 4RFVA 2GK7A 1S9HA 3ZD7A 2YWHA 1TPZA 2FPMA 3SJAA 1NI3A 4AURA 1ASZA 3PUWA 2ZE8A 1N25A 5FOTA 2CLDX 2P0EA 2KA7A 1EWIA 3SU8A 2JJ1A 4L16A 2GXSA 1E2NA 4FWIB 2BKEA 3K70D 4KI0A 2UUBL 1KAOA 3AP1A 1TWHH 3TK1A 1W2HA 1CLUA 1KJZA 4BFTA 1SULA 3TW4A 4U7DA 4XIGS 3OW7A 1P8LA 3BH0A 1KHIA 3ZH9B 1OXXK 521PA 3G82C 1A7JA 4MKGA 4NPSA 3T1OA 2J0QA 3I73A 4PZLA 3CWZA 1KO5A 2OXCA 4Q4HA 1HZ9A 4HIMA 5DGXA 5FI1B 3VTKA 3M6AA 1TEVA 2QENA 2DFNA 2JIZD 3NH9A 1NIPA 1T8TA 2BM0A 2H1LA 3IUYA 1MRSA 3O47A 4PSKA 4B3XA 2C78A 5FPKA 1S1MA 4DNRB 1R4AA 3CKLA 4UP7A 3CRMA 2RGDA 4JLPA 1CJKC 2I1QA 3RYTC 5IYCH 2V6JA 3MWYW 3CC2A 2G9NA 4TT3A 1RL2A 2F43A 3GMTA 3QPUA 5H70A 3I4LA 3PUXA 2FEMA 1G3RA 3WXMA 3K70B 2WSMA 1OIVA 1VYVA 4PPFA 2WJIA 2ODNA 1ZW6A 2QAGC 4D0GA 1NNEA 2BMJA 2CEAA 1SMYC 2J0UB 1W4AA 1HH2P 2ZS9A 4WOPA 1KI6B 2O8DA 1KKMA 1G8YA 2NO7A 3HU2A 4V03A 3AV0B 5KNBA 2E9SA 1X3SA 4LYJA 4Q1DA 4HUQB 5DHAA 4MRVA 5F2EA 2A6EC 1J2JA 3T5DA 5KPDA 2YTYA 2J45A 2QTFA 5F3WB 2AK3A 1Y1VG 2K5NA 1MABA 3ZZTA 1NN1A 4AD8A 4D2IA 2ZJ5A 4F92B 1CIPA 2JLVA 1YBYA 1M74A 3D0FA 5C46F 2VQEQ 1IZ6A 1B8AA 2BDTA 3L0SA 4I1VA 4M2LA 2XB4A 3ZDQA 4TMVA 3FHTA 4A3BG 4UNPA 4I99A 4LWZA 4OQLA 3N70A 2VQEL 3EZ6A 1F2TA 3V4RA 1IQPA 4DR3L 2MO1A 3NTUA 1ZD1A 4BZPA 4MDFA 4TQAA 5LMNQ 4LUVA 1N34Q 1RKBA 1KK2A 4DLWA 2WBLC 3BU2A 3TIFA 4H13C 2JATA 1IL2A 1RYFA 4WW0A 4DLSA 3MLEA 3LA6A 3KQKA 1N34L 5HZHA 3NHAA 3AP2A 5IP9G 2IEZA 5KU1A 4LK1C 1ONLA 3RLFA 3ADKA 1NBMA 5BN4A 5L3VA 3THWB 1PMRA 2AXPA 5C4GB 1ZC3A 3U61B 2EXDA 2PT7A 3GTQH 4P0TA 3KQLA 1EIYB 4DV4Q 1MIUA 1WA5A 1HEIA 3K09C 2KBNA 4LF6Q 4BFUA 2JA6G 5HR5A 4DR4L 1R2QA 2HIVA 3AF4A 1H9MA 1VF7A 1N36Q 1XRJA 2Z43A 2RKOA 3GJ0A 4PHTA 1RIPA 3OIYA 1XDBA 4TTPA 2V1UA 3I4OA 2ES2A 2DY1A 2IYQA 2I1VB 4HR7B 4P33A 1GITA 5J4KA 1IN8A 3W3ZB 1EESA 1G17A 2ONJA 1NY6A 2BVNA 4DR7Q 4FI3C 4Z1MA 4JOIA 4Q4JB 3CRLC 2PT5A 4DV7Q 4B3MQ 1C7YA 1KMQA 3PQCA 4MKFA 4YQFA 3B13B 1E24A 1XCPA 4JSTA 4YMVA 2R93H 3HOXH 5BQ5A 2IHYA 4JLAA 4C30A 1QUQA 1L0WA 1RVDA 3ICQB 3I32A 1T3SA 2OCAA 5JJKA 1S4QA 4OI0A 1EWHA 4LV6A 5FL3A 3TSWA 3CMAA 2IYTA 1OKKD 1EUJA 1C1YA 1NVXQ 4HB3A 4L9WA 2ZJZA 2J7KA 2KBEA 3CPWA 4MRSA 3CF5A 1OW3B 2REOA 3WNBA 4ESHA 1Z29A 2Y0SG 4PZYA 2WWGA 5AUQA 4C0QC 4JI4Q 3UG6A 5IT5A 2PMDA 2UKDA 2Z5FA 5FFMA 3L2PA 5GAHC 5KSOA 3W3AA 1X1SA 2W00A 1OYYA 5JSZA 1LUZA 2RGEA 1B7YB 4YWLA 1NSTA 2OCYC 3AVOA 1F48A 1LV7A 1VG1A 1G41A 1KHTA 3FMIA 4BFYA 1A6XA 2H5XA 2QMHA 2QROA 1ZYRC 1Q1EA 1W0JA 3BB1A 4KBGA 4RZXA 1Y1WG 1N6HA 4TMZA 2VQFQ 1D5CA 4A3MH 1TQDA 4TSFA 3UANA 3FPPA 1GD7A 2A69C 4IFDJ 3SYLA 2OBNA 1QHSA 4KKSA 3GFPA 3JAMi 1FP6A 2QL6A 2R65A 5DI3B 3S1AA 3WNCA 3FE2A 2LSSA 4I1UA 3A4LA 2BBSA 3HKZG 3SI7A 2PEZA 1CULC 1XMSA 1YHAA 2DNCA 2W58A 4OWWB 1YZKA 1YVDA 1EFTA 4XWAA 1KGDA 3QJYA 4JI8Q 1E2IA 3PO3H 4MDEA 3BZCA 1XTJA 1H9KA 1J90A 2RF4A 1HUQA 3BB4A 1J6QA 2YWGA 2A6HC 4I7ZC 3C4JA 3K0FB 3NBXX 4Q03A 4Q4LA 2YC4C 3HPQA 4B6FA 4TSFD 3VAAA 4B3SQ 4LFAL 2ZTCA 1XMJA 3B2EA 5AUPB 4CGZA 4I4LA 3T1QA 4IOLA 2BDOA 4O3MA 1ZVQA 4HJ5A 2GCNA 4IJLA 2QMEA 4DK6C 1XU4A 3ZZUA 3BIFA 3GLGE 4X65L 1JQLB 3LGJA 1KI6A 3NG1A 4LDJA 2B8TA 1X8LA 1A63A 2E1RA 1N33L 2WAYA 1M34E 3LDAA 4ZPXA 4Y52H 3OPOA 3QKRA 3R9IA 5P21A 1ZCAA 1T5IA 1SFOH 4HEJA 2ZJPA 4LF9L 4L9SA 4YLGA 1K8MA 5EE0A 4FWTA 4DV2Q 1R7RA 1SVWA 4TKOB 2C95A 3T1YQ 4HLUC 2FMXA 3DKPA 4DCSA 4BXXG 4RFSA 3VNVA 3T06B 1UKZA 2ZYWX 4HI0E 1KRSA 2P5SA 1T6NA 5EXPA 4G3XA 1TWCH 4DUYQ 4OONA 1I94L 4I81A 1Z5ZA 1EFWA 4G5GA 4GPTA 3LQQA 4DLRA 1NJFA 3OAAA 4LJAA 5HZKA 4GNXC 1QZGA 3F0TA 4YMTA 2NZJA 4C0BA 1EWQA 1W46A 3RLOA 2A6ED 4F38A 2EDGA 2ALYB 1Z2AA 2QBYA 3CH5A 5C44G 4EQ5A 3AQQA 4UQOA 1D2EA 1YZUA 1OFTA 1SKQA 2B7BA 2DWPA 1QBKC 1TKWB 3ZVLA 4A3JG 4KFRA 3VU9A 2QAGB 1NY5A 1Q3HA 4HJAA 3AUYA 2H7VA 1LS1A 1VHLA 1G1MA 4MKHA 1KI4A 1NG9A 1GUGA 3VX3A 3J81c 1FTSA 2Q3MA 2H8KA 4HAWA 4KFSA 2IL1A 4C3JH 3KXKA 4B3BA 1W1WA 3WWVA 4LFAQ 4B3SL 1U98A 1JMCA 5J4VA 3SFZA 2PZEA 5K8IA 1XMIA 2ZJQA 2EVWX 3FMOB 3TGPA 1N6RA 3E5HA 5FTMA 1L1OB 2HHHQ 1XNJA 2GEVA 4MGZR 2ZEJA 4L5QA 5J47A 3Q8XB 4ZDWA 4OBEA 4DUGA 2VP5A 4QNMA 4QJ4A 2OM2A 3T53B 1X86B 3HOVG 1JXMA 4YONB 1GILA 2NO9A 2FFAA 1XBTA 2A30A 3K0EA 2JLUA 1MO5A 1JE5A 3VNUA 4FMBB 4JBYA 2IF0A 3EIEA 2V6IA 3THWA 4N1AA 1XJQA 1Q7YC 2RGXA 1H8EA 3W1BA 1JJ2A 4JI0Q 4PZ8A 1YJNA 2K5VA 1KTVA 1CJUC 1AH9A 3IDQA 4HB2A 2PLRA 2X2FA 3IEUA 5FOSA 4AG5A 2X2EA 1DAHA 2ANBA 1BOFA 4DNTB 2XSZD 4DHEA 4LFBL 3CO5A 4GMDA 1YITA 1YVCA 3KF6B 4OGQC 4J15A 1DE0A 1NMXA 1QHHB 1E9RA 1ZM3A 3ZQJA 3DLLA 1WCV1 3BB3A 3PO2H 3FKSD 2JQOA 1Z63A 4DAYB 5C0XJ 2Q3HA 2PCLA 2ZUDA 4ZO4A 4DLYA 1E9SA 2GCOB 2IYYA 3G48A 3TVDA 3GCGA 2D0PA 3KF8B 4BA2I 4GN4B 4M9QA 4Q9LA 5LB4A 1K83H 3CCEA 5H68A 3VHLB 1E2WA 1GUSA 3QBVA 4DEXA 2NVYH 4X8HA 2AXNA 5L3QB 1ZU5A 2X19A 3THYA 4NXNL 2DHRA 2EFHB 3CLVA 4HDQB 4NCIA 3UXMA 2OO7A 2J0SA 3HU3A 1R9TH 1E9FA 5AJYA 1E7ZA 2FOLA 1YR8A 2N3SA 4DV6L 1TWAH 5JEAJ 4DR3Q 3K53A 1L7VC 2VYFA 2BIFA 4N0EA 2VHCA 4NHOA 4KSBA 4P32A 1KI2A 3WRYC 4CDGA 3EARA 5FOXA 4B48A 3THYB 3EC2A 4IPDA 1F5NA 1AM4D 4YMUA 1PLLA 3RANA 3IIKA 1VQFA 4A8JA 1YZ6A 1KO1A 1A8VA 5B30A 4LOAA 2C9OA 2NO0A 2NPIA 1XD9A 1A4RA 1N5LA 2X8AA 3THOA 3BDOA 2B3GA 3SYKA 1VQ7A 4OK6A 4MRRA 4HJ9A 4B3RQ 4DLZA 4PQFA 1XCMA 2K52A 2UXDL 1J5EL 2F3TA 4JCVE 1GUOA 3KLWA 4DSOA 2GZDA 4IDQA 1FJGL 3TS2A 3AM1A 4TYQA 3OEED 2EJMA 2FE4A 3FKQA 4TYYA 2J41A 4PSVA 1FMJA 5IF9A 1KIXA 1RRGA 5HY6A 1FL9A 1B9NA 3MWLA 4LC0A 2IS1A 1L1OA 1KQSA 1SR3A 1VYUA 2PL3A 4IDPA 4TMTA 3TZUA 4P75A 2VP0A 4O2DA 5C4MA 1A62A 2Z4RA 1Y1WH 1XNRQ 2N8NA 1I4DD 2KWIA 3GO5A 3QEJA 2YTXA 4A6PA 4LV8B 1KK1A 1P5ZB 3BFXA 3E70C 4V02A 4UXHA 1E0AA 3KXLA 4UY8C 4OQNA 3GLFA 2RGAA 1Z0JA 2QPTA 4X66L 3G0HA 3RZOH 1ZUIA 4A93H 4A3IG 4EFLA 4OHYA 4H0LC 3D6TB 3PIRA 4DSNA 2QEXA 3H0GG 4RD6A 4L5SA 1NP6A 4AQYL 3F8TA 3LLMA 3ADBA 1E99A 3OOCA 1KDPA 4OHZA 3IO5A 3WNDA 5E3HA 1HJPA 1GVPA 2D0OA 4I1OA 3WP1B 2AWNA 1DS6A 1N0VC 4NXMQ 5KSZA 1PH4A 3VR2A 2QPAA 3IBYA 1PJRA 2Q9AA 3RS4A 4FIDA 4JMPA 4PC2A 2R93G 1Z22A 2HQLA 1G5TA 4OK3A 1HQYE 2EU8A 2F1HA 4RZ3A 4TYPA 1U99A 4CZ2A 1C9KA 3EWSA 5IYCG 3X1WA 4EFNA 2ZI4A 4OJQA 2ZJAA 2CLCX 2IUSA 4HAVA 4A0GA 3IO3A 4LBYA 4UNNA 3I56A 1KSHA 4G01B 1U8ZA 2JDIA 4RZUA 3A7AB 2WFWA 2O5JC 4QJ5A 4WZAE 1Z6TA 2WAXA 3ETLA 1UPTA 2QAJA 2ORWA 3DMNA 2ODBA 3IPYA 2B8GA 2CE2X 3TBKA 1P9RA 1WE2A 3R9XA 1LTQA 1Q82C 4A3GH 1I4TD 4R7ZA 2WKQA 1X3GA 4U02A 2A1AA 3A1TA 3DOFA 1JEEA 3AVTA 3AYHB 2ZRMA 4XOIA 4UP9A 1NN0A 4JJKA 2FFHA 4GKJQ 2IXFA 2XXAB 4OWXB 1ZJ6A 5C18A 2ZS7A 2PQAA 4TYNA 3BFVA 4WZBE 3TR0A 1E1RD 3PVSA 4QBGB 1FQJA 4D81A 1PA6A 3PR1A 3FDIA 3NEMA 5FPHA 2ZJBA 1NRJB 3AVPA 3GJXC 4JT2A 1L4YA 3B8HA 4KVGA 3QXSA 2O8BB 4OX9L 1OB2A 1TX4B 4NONA 3B1VA 3H86A 3RS7A 4P4SA 1GL9B 3LBNA 3KDFA 1XXHA 4B74A 3BJUA 1KDTA 1AZSC 1ASYA 1IAQA 1XTIA 1R5NA 5BYJA 4TT3D 3U50C 1GL7A 3GEHA 4P4TA 3CX8A 2FN4A 4X62L 3RABA 1T0HB 4F4IA 1KSJA 3FYHA 1PH1A 3A8IE 3GLGA 3ZVMA 4C0JA 1EFCA 3ZJYA 1PH5A 1E1RA 3NC0C 4KMUC 2I5LX 3KQUA 4BY7G 4WA7A 2ONKA 5IWAQ 3UG7A 2EFGA 4DT1B 1YQTA 2ZSEA 3ECCA 5FBLB 2EFCB 3CH4B 4QGGA 4BZXA 1ZNWA 2ZU0C 3CPHA 3LV8A 1Q81C 4POAA 4PAQA 3I8SA 1XMQQ 1AE2A 3X1XA 1G19A 3K8AA 5GADC 1ZP6A 3EQLC 2O8CB 5JWHA 1Z06A 4AH6A 2E5LQ 1W4RA 2OSBA 3CBQA 4PFSA 1Q44A 2WIBA 3QKSA 4EUNA 4TZ0A 1JAHA 4Q7JB 3DM5A 3GJ5A 1TQ2A 3MGCA 5TV2A 2IS6A 1ANKA 2VP9A 4QGHA 3BE4A 4LPKA 4OXPA 1QG2A 5CDFE 4BY1H 1LB1B 4US0R 1S9DA 2J1LA 4A3KG 1SRUA 1RJ9B 4IXNA 5J5CA 3TLXA 3I4NG 1RPZA 3R7WB 1XTQA 2RMKA 2VP6A 3WRXC 2PCJA 3B6YA 4DBLC 3HKZE 4NXNQ 4IPGA 1ZNZA 2FH5B 4LFCL 4A3EH 1AA9A 1X8JA 2UXCQ 1HA3A 4MGKR 2IY5B 1P4SA 4Q4AB 3TR5A 4YCUA 4LFCQ 2BWJA 2OQKA 5GROA 3TUZC 4Q9JA 3VKGA 3OFNA 4A75A 3QQ5A 4XSGA 4NB3A 5LDDC 4A82A 3GPLA 3O8DA 1E9AA 5GVSA 1SVOA 4KHPQ 1ZUHA 1KK3A 4QNRA 3KOJA 2J9RA 1UAAA 2DWOA 3CUEF 2BEJA 6Q21A 3AVVA 1U0JA 1MRNA 4Y0AA 3ULPA 4A3EG 2J46A 3A8TA 2V4ZA 3DM9B 1E2ZA 3GTLH 2BHRA 4TL9A 3KX2A 1I6HH 1Q1ZA 4Q1FA 4WAUA 3T1YL 4DDTA 2N42A 1X55A 2EWWA 1I50H 1OH7A 2G0TA 2D7DA 4LJ5A 2BJWA 2ZR0A 2KJQA 4IJMA 2HLDD 4K0KL 4A9AA 5L8VA 4G7HC 3GLIB 2ZQ5A 2WZQA 2R62A 4RCZA 4M1WA 2FF7A 4Y0VA 4EJSC 2JCSA 1YI2A 2F7SA 4PHHA 1Q86C 1MV5A 2IC5A 5AJZA 4LHZA 1E2DA 5UKDA 1LS6A 5FBRB 2ODWA 1OTCA 4A3KH 1S2MA 1OF1A 4PZ7A 1UEIA 1NBWA 2WJYA 3CW2A 3GTMH 1G5PA 2QP4A 1G7RA 3MJRA 4OWTB 4JI1L 3A5UA 2VHJA 5FBQB 5SZIA 4BFSA 4PANA 4JJZA 2FSHA 4A3LG 1FOEB 1WRBA 3KKOA 4OHWA 1E2FA 2UZ3A 4PXAA 1K6MA 1CFMA 2YNMA 3BS4A 3F3YA 2PPBC 3H0GH 3Q9LA 5GAGC 3K0AB 3BG3A 4GSYA 3U4VA 5CM9C 1NSFA 4ZCMA 2QF7A 2ZSDA 4EQ6A 1MJEA 2EYQA 1FYCA 1CR1A 1MABB 4K46A 4M53A 4JKYA 3T35A 2GDJA 1L4UA 1JR6A 3I4MH 4G5RA 4DZZA 2Q8IB 1C0AA 2V55B 3F5FA 2C9CA 4A4IA 1EFRD 1Y69U 4DR1L 4BLPA 5M3FH 4URZR 4R4CA 2K33A 1GKHA 2HHHL 1S0UA 1UJ2A 2BMDA 3OAAD 4FCWA 3GLIA 2GBLC 2VQSA 2AX4A 1PH6A 5JEAG 2JLZA 3ONWA 4MQBA 3RSOA 1Z6GA 4PPNA 1OV4A 1KI7A 1KSFX 4KXFB 3L0PA 2KCMA 1N6OA 3QF7A 3I3SR 1YR6A 5L3SB 4A2WA 3U5ZB 3GJ7A 4FMCF 4YWMA 4JIMA 5DH9A 4O0MA 4BLQA 4PC3A 2GAOA 5G40A 1B70B 3A4NA 1S1CA 1E1TA 4EAQA 3CQZH 2VF8A 3BXZA 1EFRA 1UE7A 1Z0IA 2PX0A 5M5XH 5TXGA 1VQKA 3H15A 1QZXA 1MR3F 1S72A 4KHZA 1UEBA 2HXYA 1G3MA 1ZYUA 1GOTA 4QGUA 5SZHB 2WSSD 1NMFA 2RH5A 4DAMA 4X64L 4PG3A 2R6DA 2H17A 4IOCA 1YR7A 2VA8A 2QRNA 2V1XA 3KTAB 3KKNA 3OE7A 4TL8A 1CJVC 3FOZA 1VCIA 4A3GG 3PSIA 4JLDA 5DI3A 3U60B 5HTKA 4B2IA 4Q48A 4DXAA 3KDFB 1XXHB 4UKDA 1VHTA 4Q1AA 1K8GA 2W0MA 3ZZ0A 2AWOA 1VQNA 3AF2A 2JEAI 2Q6TA 3FHCB 4H1VA 1J99A 3A1WA 3A5ZB 5KYKA 1FR3A 4OO1G 5G53C 1C4OA 1DEKA 3FTQA 3WDNA 1JECA 5DNYB 4MGIR 2LXJA 3UKDA 4DSUA 4C0LA 2R7ZG 4M1YA 3QXCA 1GKIA 1YNNC 4KV9A 4LW1A 2CJWB 1Q0UA 2J0UA 3M85A 1Z0DA 3JZAA 4BASA 5HPYB 1Y8PB 3I5XA 3L0OA 2D2FA 1E2JA 2QTHA 1Z83A 4ZCIA 4JV5L 1Q46A 3W5OA 4BQSA 4AYTA 4DKXA 3U7HB 4TLAA 1R10A 1JAIA 3BOSA 1M7HA 2L5TA 4LF5Q 5ELOA 3MCAA 4B3TL 1QVAA 2IXEA 4XWKA 2Q2IA 4MUAA 4QHSA 2GEUA 3C8UA 3T51B 3D4RA 1RFLA 3FMFA 3L8ZA 4M22A 3TVTA 4LF5L 5JJIA 2XTZA 5JSZB 4AY2A 5GQOA 2QPOA 3W34A 2Q9CA 1KNQA 1K3RA 2X77A 2B92A 5IYDH 5CK5A 1N5IA 3Q85A 4FW9A 5KUTA 1X3FA 1VQOA 1LABA 2QGQA 4R4IA 5AJWA 5J4YA 3PUZA 1YJWA 3KYHC 1QZHA 1D8TA 2AR7A 3OE7D 4D4KA 1X6OA 2ZE6A 5B57C 2HDNB 1M1YE 2ZSFA 2E8GA 2AFIE 1CJTC 3LX5A 1OE0A 2IW3A 3RRYA 2B63H 4R1JA 5C44H 3VR5A 2CK3D 5KNCA 3BGWA 4DUGD 3FHWA 3BK7A 4MUBA 5M5WH 4BWYA 3IRBA 1G7CA 1MKYA 2FFBA 3K0XA 1MT0A 1NVWQ 1HNWL 1KDOA 1PLKA 1SHZA 2YOHA 4M1KA 3DXJC 2AKAB 5EP1A 1D2MA 1FW6A 3NE5B 3MRSA 5FLXc 2BMFA 3L2OB 1KNXA 4Q4HB 2YVUA 1F2TB 1H8ED 4TMWA 1E96A 3SHWA 4ZDJA 3TSOA 5KDDA 5BR8Q 3EASA 5DN6D 1P16A 1E9BA 4DR2L 3I4NH 2OUKA 4DR1Q 3LVQE 4JT4A 5CIWA 3OESA 1PUJA 1I5FA 3UE1A 5AJVB 5J3BA 1KO4A 4XH9B 4FD2A 2HUPA 1Y8OB 1JT8A 2DR3A 3KUDA 2HYDA 5FBVB 1IYUA 2I5HA 1TU3A 1VPLA 3SJCA 5IT9c 5H1YA 1AE3A 5DYIA 3HOWG 2FNAA 1QVRA 4LBWA 2ZI6A 4OI4A 3K0SA 2PQAB 3K0AA 1GDDA 4O0AA 4R4QA 4KITB 1SQ5A 2FA9A 1JPNA 1MOZA 4BEBA 3A7LA 4A15A 2D06A 1MJCA 4TVAB 4DV5L 2Q2HA 3DPUA 3NWJA 3LFUA 4EPXA 1OH8A 3J81j 3SHFA 3SQWA 3S2HH 2G6BA 2WJJA 2ID0A 2OEPA 1US8A 4QG7A 1BKBA 2QQ0A 4JI5Q 4BBRH 1PH2A 4GLXA 4DK3C 1JR3A 3A37A 3NHBA 2ZRDA 4E22A 4A93G 3AKDA 1G4UR 4K0KQ 5AJ3Q 3JAMc 1G7TA 2XTIA 2WWWA 5AUOB 2WP8J 3LBHA 3LLUA 4IXMA 2JA6H 3ERSX 1P61B 2J0VA 4BFXA 4IQZA 2J87A 2D2CC 1D9XA 1FX0A 5AR1A 3SE0A 1VQPA 1R0ZA 4GDFA 3L8YA 3IHLA 5KOYA 3QXXA 3AEVA 5E4FA 4KYIB 2FZ4A 4US1R 3HOZG 5DN6A 1RW4A 2RGBA 5CDFA 2ZYVX 3AKCA 1T3HA 3PCOB 4M4SA 5ANRB 3TE6A 4XVUA 3T56B 4DR6Q 1FMLA 1NVVQ 4KSCA 4DWJA 3HJNA 1E69A 1U0HC 3TQCA 2ZXUA 3NC1C 2KCCA 2J59A 3REFA 3KJEA 1A0IA 2PI2A 3LWNA 4LYFA 1VQ9A 4B44A 4JI7Q 4BE7B 4MYCA 4V0LA 1IBLL 4AWXA 3W9YA 4JLOA 2JLYA 3Q3JB 5TDHA 3CCQA 2VRWA 2O5VA 4JI1Q 1M2OB 5KTYA 1GSIA 3NXSA 2P67A 3W8NA 1CTMA 3RN2A 2A2ZA 2R6FA 4PV1C 3I55A 1Z6AA 3AB9A 4HYYA 5BXQC 2QGZA 4GLAC 3DDCA 2CL7X 1OH5A 4K81B 1N32L 1QRAA 4Q9HA 4OL0A 3ZYCA 2EFEB 2VH5R 3OEHD 4NYMR 4AKEA 1GNQA 5CITA 2GXQA 4RD2A 1HZAA 2F9MA 1BKDR 4IFDI 1KK0A 2E76C 2UZIR 4II7A 1RE0A 1FVIA 4M9SA 4D4JA 1QHYA 3SQXA 5H8WA 2NN6H 4PSAA 1YZLA 1DAGA 3QKSB 2ZRHA 3V9PA 4LK2A 2NVQH 1Z7TA 3AF0A 1S3OA 1VQ6A 3NBFA 4NYJQ 121PA 3NENA 4LF7L 4Q7LA 1O7LA 1IOZA 2WPDD 1ZAKA 3CIOA 1VDZA 1I2MA 3JZMA 3QENA 4B34A 5EAYA 3SDZA 2QN6A 3GLHB 5FTLA 4RKEA 2E75C 2H57A 2ECKA 2KE5A 4FCVA 1KSGA 1Q57A 4DRZA 2NG1A 1G51A 4Y7NH 1P6XA 5FTKA 2WTUA 1FJGQ 3CRRA 2NN6G 4B75A 3CR8A 2BH2A 4PZZA 3NBZC 3M4PA 5BN3A 3M0EA 4AYBG 1BYIA 2PEYA 4FDBA 4BFZA 4GOKA 1LYLA 1K8RA 2QE7D 1PZNA 3X1DA 1JALA 4JLMA 4D80A 1JR3E 2AHOB 1W47A 1E6CA 2W6JD 1PYBA 2WICA 5C4JH 3DO6A 4CRWB 1E3MA 1BYUA 4LI0A 2IXGA 1P9NA 1K8AC 3U3RA 1UE5A 2QMOA 2E2IH 2XJ4A 3UMSA 2R6AA 1M7BA 3H1TA 3I8XA 5EE5B 1VQGA 3LX8A 1KL9A 4UNSA 4PTLA 3KQNA 2JJ8A 5IY0A 3M9BA 4LWCA 3B1YA 3LAWA 4KFTA 1FUKA 1CJMA 2RHSB 4QGAA 2A5YB 3P4YA 4HIDA 2Q3FA 2QG6A 5B58C 3IIMA 4BXXH 3EZ2A 1G8GA 3KZ1E 5GVRA 1US8B 4YCWA 1X54A 5ELNA 3STBD 1LF0A 3MD0A 4G1UC 1HNZL 1GKYA 3AGPA 4JI6L 4IPHA 4PR0A 4B3DA 1NN5A 3PFIA 1XNRL 1SXJA 1NG1A 1M1KC 1DG1G 2XNDA 3AUXA 3K0FA 2A68D 2V3CC 4L5RC 3BD9A 1W7AA 3QG5A 2KENA 1NVVR 3SEAA 3B1XA 1FUUA 2EVBA 1NTGA 1GUAA 1NF3A 3CW2C 2VP4A 1N0UA 3TNFA 4B32A 4Z1MD 2B7CA 4DR2Q 3EA5A 1ZNXA 2JJQA 2ZRCA 1BIFA 2F52A 5G3YA 3TRFA 2W2XA 4GOPC 3PEUA 4CEJA 5AWFC 2EQSA 2OV2A 4A0RA 2OFXA 1GAJA 2XJ9A 3CPEA 3BAFA 3AH8A 1II8A 3EIQA 2UUCL 4JOIC 1T9HA 1IBML 2IYLD 3KKMA 4GKKL 3AVYA 4PO8A 4OX9Q 1F2UB 5EE9A 1DPFA 2K32A 4FMDB 5IWAL 1E22A 2CCJA 1T5LA 2XZOA 1Z6HA 4OI2A 1DAFA 1P72A 5L3QA 1KMHB 2ORVA 2V7QA 1IN6A 4E5UA 1IHUA 3DZDA 1XX6A 5GJVC 3OTOL 3GD7A 2DNEA 2OE2A 4X62Q 2QA5A 3C16C 4LCBA 2ERYA 4Q47A 2IYZA 3G6EA 2WAQE 3W8RA 1QG4A 4B33A 1WI5A 1N8RC 3UWOA 1IYJB 2F1RA 4KKUA 4IHQA 1UE6A 1D8LA 2C77A 1SLJA 3CC4A 3IHWA 1QUQB 4G7ZC 3FPAA 1GHJA 4WIAA 3T15A 4ZDIA 2MFIA 2IK8A 3RC8A 1HQCA 4HJ7A 2TMKA 3KKQA 3K70C 1JB7A 1GNPA 4DSTA 1H9SA 2JA1A 3A0JA 2QEQA 2NVXH 1NIJA 1RRFA 3KFVA 2KSQA 3EZ7A 3QPWA 4LJ7A 4MYHA 4MNOA 2JA7G 2GJKA 2WWIA 3N2IA 4TLEA 1U90A 1N2CE 3G4SA 1KO8A 2H16A 3AVWA 2F43B 3FGNA 4QKQA 1F2UA 1G3UA 1GTVA 2RGCA 5C2JB 4G5QA 3KJGA 2ZJ8A 2EFDB 3RDPA 4OQMA 3KKPA 1OB5A 2YTVA 3I2ZA 1KY3A 3VFDA 4YHHL 3TRZA 1SVIA 2NZOA 5L3SA 2ZJ2A 4IFEA 4QGFA 2BA0A 1NY4A 1VQIA 2OG2A 3OIVA 2IWHA 2WOOA 4CEIA 4QL3A 3H0KA 1XJVA 3P32A 1U0LA 1IBKQ 2QM8A 4US2R 1IW7D 2CL0X 4CF7A 5CLQA 2HLDA 4JKIA 3FMPB 3HFZB 1EXMA 1HPCA 1VQ5A 2DWQA 2FZLA 3IIJA 2A5FA 2G88A 3QKTA 4QJFA 2W0SA 1ESNA 4HATA 5IDVA 4BLSA 2CVFA 4X65Q 2C99A 4XWOA 2F3IA 2GHIA 2GVZC 2OCPA 2WM9B 2LCFA 3VX4A 1GIAA 5JMTA 2Z4SA 2WSSA 3AF3A 4Q9IA 1G5RA 3P27A 3JVVA 1V8QA 1WMSA 5DIFA 1PV4A 4DB4A 2B8WA 2REBA 1XNQQ 3A8KE 2B29A 1QVGA 2HF8A 3BORA 3W90A 4PMWA 2V1CC 1T5EA 2NO1A 1QF9A 3THXB 4JBWA 1JJCB 1ZRHA 4C2MH 4UNRA 3GJ4A 1QHNA 3DZ8A 5IK2A 3W5JA 1NBME 5FJ8G 4OQFA 1E0JA 5LD2B 2YOGA 3HWSA 2E87A 3B60A 3S14H 8OHMA 1GUNA 2ZSAA 2WAQG 1T91A 2ZM6Q 2ZT9C 4X8MA 4KHPL 3LO5A 1ZU4A 1OLOA 2PI2E 2ZI3A 5FOWA 4AKHA 1DBSA 2E74C 3CRVA 1B9MA 1D7QA 3T1TA 1MO3A 2XNSA 5AK0A 1BVSA 2CHQA 2K5UA 4HZUA 4RD0A 2ANCA 2WWYA 4H44C 1RYHA 5EJEA 4QBFA 3IBGA 4A6XA 3CF0A 3SS8A 5EP3A 2ZRJA 2ZU6A 5JFGA 1YEZA 1DARA 1N6KA 1V9PA 4QJ3A 4ERNA 2WB1G 3QNUA 2K50A 1A2KC 1W4BA 4A0HA 4JSYA 2QGNA 2NZ8A 4E09A 4IJHA 2UXBL 4A3IH 3CONA 2NIPA 2LKDA 5LPNA 3ICEA 3C7KA 4B35A 2E2JH 1Z0KA 3DEFA 1UM8A 2YWEA 4A3JH 1E98A 1HQMC 2G83A 3E1SA 4TL7A 2NN6I 1F6BA 3GTJH 4DEYA 5C1BA 4PAOA 4WJ3M 5JEAH 1NLFA 2Q21A 2X1VA 1E32A 5JLJA 2O0JA 3BH7A 2IYRA 4HB0A 1YIJA 4Q1EA 3FFAA 3RC3A 5FUWA 3PIPA 4B76A 4EX5A 4OKSA 4RCYA 3AVUA 3Q5DA 4KVAA 1WYDA 4HAXA 5DO9A 1BO6A 1Y63A 3R8CA 3VU9B 2YHSA 3J80c 3ZD6A 1AJEA 2HCJB 4NCKA 4A1FA 4GOJA 2O52A 3HOUH 1P2SA 2ZPTX 4QBIA 2O8DB 2MMGA 3LXRA 1I94Q 4P71A 4JLBA 5K8UA 1DELA 3HOVH 2FEOA 4BZQA 1JBKA 4BY1G 3QOFA 1OHHA 2UU9L 2C04A 4WJ4A 3RR5A 4AIMA 2IS4A 2YWFA 5LMUQ 1WP9A 3P4XA 2CQOA 2UXCL 3S1QH 2MNAA 2FPKA 2C2HA 1V43A 1NMGA 1JNYA 5HE8A 3D7MA 4B71A 4EPVA 3O8CA 3KB2A 4OO1H 3LNNA 3F2BA 1PH7A 3CP0A 4KLZA 5FPYA 4DDWA 4ME3A 1YZGA 3LW7A 4M1MA 3KXIA 5A0FA 2PZFA 4AG6A 4NYIQ 1Y1VH 3B78A 4X8LA 3LVRE 4Q00A 1FZQA 3ADDA 1G3IA 3H3VH 2DCUA 2GAAA 4Q5IA 3SYNA 4IO9A 1SKYE 1Z9FA 1XEXA 1U9IA 3RZDH 2GTPA 4LJYA 3K80C 1DO2A 3DOEA 4FCTA 4A3BH 3D8BA 2G1KA 4KLNA 4OJKA 2D62A 1EK0A 1D2NA 5EE3A 1WFQA 1ZM4A 1G291 4A8JC 2OCBA 1N6LA 2UVQA 3PGZA 1NJGA 1XZQA 3QKRB 1XD2A 4JI8L 4LBVA 1E3PA 2JA9A 2Z0SA 1IBMQ 1K5GA 1G4AE 4EPTA 4KJZA 5K8LA 2PMKA 1CS4C 3P26A 1X1RA 4LF4L 2IBMA 4DDUA 4DUZL 1CRQA 2MSCB 2R2AA 4LJ6A 5CIQA 5CB8A 4AKGA 2CNWA 2VS1A 5M3MG 2OCEA 3M3YH 1G6HA 2ZREA 2FG5A 1ZM7A 3QPVA 4NP6A 4PHGA 1CP2A 5FOUA 3CCVA 1EGAA 2VF7A 4L5BA 5F98A 2OXRA 4GN5A 1SXJB 3TW8B 4RVCA 4DV0L 4LJ4A 1TTTA 1OXSC 2IX0A 1XNQL 2UUAQ 3HOWH 1N33Q 4Q66C 5D3MB 2OFWA 3SZRA 4AK9A 1HTPA 4MRPA 4IEEA 4AYBE 5EE1A 1CI3M 1E9CA 2FGJA 3CX6A 3PO2G 1KAGA 3FB4A 1EIFA 2WKRA 4HDCA 4JK1C 2F55A 2IA5A 2VO1A 3AGQA 1G7SA 1ESMA 1XCGB 5IP9H 1QVCA 1LVGA 2XSZA 4JL8A 1OIXA 1UKYA 2YU9H 2HJGA 3CNNA 3L0IB 4N0DA 3PXGA 3EPJA 821PA 2P6NA 2H5EA 1YNXA 3PO3G 1YRAA 1R5OA 3A8JE 4LF6L 2CHGA 1C9OA 2K75A 2BBOA 1Q12A 1TQ6A 1W48A 1BMFD 5DSZA 4X64Q 3OEHA 5DI9A 1HE8B 4NCHA 5EP4A 2ZI9A 1IW7C 3FKIG 2CWPA 3GTPH 4C4PA 1G64A 1A5TA 1BBUA 3D31A 1NE3A 4RCNA 3TEHB 4POGA 5G41A 4YHHQ 2N78A 4LBZA 4GLVB 1OH6A 2FSGA 5BN5A 3AVQA 4IVPA 3A36A 1IBRA 1LM0A 3TREA 1E2MA 3PCRB 5FUYA 3UPUA 1N0WA 2D5DA 2BE5C 1M90C 1KI1A 2F1JA 5HCIA 3V00A 1Z0AA 5HE9A 5JEDA 4PPQA 4HUQA 3UMRA 1YZTA 2W2VA 5DLQC 1EFUA 4KO8A 4DLUA 1TU4A 3M4YA 2ZUCA 3RVBA 2MO0A 4W5HA 1GM5A 3LD9A 5GADl 2P3SA 4JI6Q 1M8PA 1NL3A 2DBYA 4IOKA 4IDOA 3RHFA 4EJSB 4EPWA 2ZE5A 1DO0A 2REXB 4JVMA 1LW7A 4NE2A 4OYHA 3GLHA 4S35A 3SBDA 2VIIA 4C0SA 4QQBX 1G8PA 2GRJA 2OBMA 1U2RA 1XTDA 1COWD 1YZQA 2ZJOA 1S40A 4LC1A 4NMMA 3SFVA 1TF5A 5HGQA 4UXJA 5A5GA 2RHDA 2ZTDA 2PMZE 2CWAA 4NZYA 2KBFA 2JA8G 4GNXA 3P20A 1EQQA 1IY1A 3OEEA 2V9PA 4G5OA 1O87A 2ZIAA 5IYBG 1OXTA 1P60A 4Q7KA 1GNRA 1Q8KA 2IEYA 4C0HA 4ZI3A 4RG1A 1AQYA 4JYBA 1KI3A 4QFMA 5IHPA 1SE8A 4DK1A 1U5KA 4HAZA 3CF2A 2AUKA 1AIPA 4POFA 4KLKA 2JJ1D 3K81C 3FKIH 3EG5A 4Q19A 3H3VI 5FLMG 4GKKQ 2G1JA 1VQDA 1A2BA 4Q7MB 1UBFA 2Z6VA 1WOCA 2G0NA 2FGKA 4LSGA 1KIMA 4CYMA 2ZR9A 2VNUD 4KN4C 1KO7A 1XD8A 4B3FX 1VQAA 2BMEA 3LXXA 3C41J 4CEJB 2ZYTX 4NL4H 2B21A 1G8HA 1TUIA 1HY3A 4JYAL 3B1WA 2CCKA 4IVRA 1VQ4A 2XITA 1J5EQ 4JBKA 4QHTA 4R4OA 2XB2A 1CF4A 1X56A 1E79D 2A69D 3N6RA 1NMZA 2OHFA 1EX7A 4Q21A 2GF0A 1JB1A 4NCNA 4P73A 2JA5G 1JJVA 3C5HA 4AC9A 1R8SA 1I4LD 2NZHA 3CCMA 1R0WA 1TU2B 1CUKA 1SVSA 4Q02A 3QSYA 4MYTA 4L5TA 4MTNA 3I7FA 2W6JA 1PH8A 1WDTA 4B73A 1XMOL 3U6KA 1TUEA 5F9FA 2XTMA 3CXCA 4DR4Q 2A3RA 4LJZC 2JK8A 4CEHB 4DB2A 3S15H 4DV4L 3ZIAD 1YNJC 1SXJE 1ZUNB 1JEDA 4NPHA 2ZJRA 5IYBH 4MGYR 5E7MA 5BW8A 3PF5A 1E79A 3N5CA 2JIZA 1U8AA 4A3CH 3MWJA 4IFDG 3EXAA 4LV5B 3GFOA 5DE3A 2C96A 1Q21A 3NELA 3S2DH 1G8FA 1RZ3A 2QT1A 3KFUA 2QE7A 5EXXA 2JXMB 3A58B 1XEXB 4IRUB 3CCRA 1W49A 2ZR7A 1H65A 5M5YH 2GK6A 1E94E 3KUCA 4P4UA 5BYKA 5JEEA 3E9HA 1IY2A 4B2PA 1K0RA 1VCOA 1Z28A 4EQ6B 4B43A 1K73C 3S1MH 2XNDD 3CRKC 2IYXA 3X1YA 1BH2A 1IBKL 2GNOA 1KZ7B 1MKHA 5EXSA 3OTOQ 3IGFA 1N9WA 2AMCB 3W6NA 2B6HA 3Q8DA 4PQYA 1OYWA 3B1ZA 1H95A 3TQFA 2P5TB 5DLQE 1G18A 5KHOC 4D0LB 2F4VQ 2VBCA 3H84A 3X2SA 2W6ID 2JGNA 4DLTA 4GOXA 3E9IA 4RY2A 1P3JA 2MMCA 2QORA 3K9NA 4QRHA 5FL7A 3OIWA 4FN5A 5L3RA 4JV5Q 1P62B 3ZS9A 3TUJC 4URVR 4G0NA 4NXML 1GVNB 2SHKA 1DD2A 1VQMA 3F2CA 4D25A 3SJBA 1SZPA 3BRWD 5JWRA 3C14C 2XGTA 1CXZA 1UDXA 2PX3A 2R92H 3SGIA 4BEJA 1I6VC 2CVHA 2FFQA 1RJ9A 3CAMA 3B6EA 2ZM5A 4JBMA 1E4YA 1YHNA 2IYWA 3QXHA 3VKWA 5JZVA 5B2ZA 3L7ZC 2PJZA 4DV1Q 4NYMQ 3VDYA 3EIVA 4HAYA 1HCZA 1S8FA 1AK2A 2V7QD 4JVNA 3OF5A 2D4HA 4TN1A 5FTNA 4D4LA 3RAPR 4Q18A 2CCZA 5SZJA 5HCNA 1ZIPA 5IYDG 3HKSA 2OWOA 1CBUA 1IONA 4TLBA 1VG8A 1UBEA 3A1VA 1BDOA 2ZUBA 4CT4B 1XTSA 1XF9A 4A4DA 4HLQB 2BA1A 1ZC4A 2YZ2A 5K8TA 5CM8B 2HT6A 1HZCA 3K7UC 3HOYH 1I3QH 1FX0B 4A3FH 1TADA 1YKSA 3ZQ6A 4DV0Q 1EFHA 4HJ8A 2VPPA
chains in the Genus database with same CATH superfamily
3LBIA 1L2TA 4ZCTA 3M1YA 3ILXA 5REQA 1NSYA 2IUEA 2HMTA 2QJRA 1ZJJA 2XYGA 3E9EA 2YOFA 3BGDA 2WVAA 4O63O 2O7SA 6AT1A 3IMFA 5GMOA 7REQA 1KRXA 3A9UA 4IFTA 1KAWA 1ENPA 3GJQA 4EB6A 4YN3A 5KOHB 1QHHA 3CZQA 2L0XA 3HJUA 4CMAA 4C4SA 4F3TA 3E2PA 5JXWA 4ICIA 2ZZMA 5CEJA 5FI5A 4CIWA 3IKJA 4EZIA 3SDBA 3QPAA 4L8FA 2UUCQ 1IEXA 1KYVA 2BP7A 2HDOA 4GYYA 2JHGA 4DDMA 3A6ZA 3NIFB 5FUXA 1EBFA 1GUZA 1N6PA 2O7QA 3BD8A 3HDVA 3BZKA 3QF4B 1QB8A 2GN9A 5HRUA 1KE2A 1P1RA 2A9RA 2DPXA 4BQPA 4MXDA 3NI2A 1OI2A 2AN9A 4U7WA 2AL7A 1KRWA 5K3OA 5BOSA 5DW3A 3VMFA 4F86A 3GPBA 3ZH2A 1J9GA 4HB4A 1XEWY 2OQIA 3R8FA 1FMTA 2OHIA 4O1MA 3AMUA 1SXPA 3EIHA 4KN5A 2PRYA 2CVZA 3CEPB 2GKSA 4BLOA 4UQLA 4JBJA 2CKZB 2WWFA 3BWDD 4E21A 5A4JA 1EB8A 1ODLA 1HNZQ 3P7JA 2EIFA 2FUCA 5CV7A 2CXOA 4DV3L 2V98A 2UU9Q 5L7YA 3R6GA 2G3YA 4HDNA 4YAIA 1FRZA 2ZI5A 4ZCRA 3P9SA 3WLIA 3T7RA 2G63A 3BGOS 1V16A 5DEHA 3OIFA 4L75A 2NO6A 5DEIA 1GO3E 2A9KA 2ASEA 3URKA 1IVNA 1COZA 4X54A 1QP4A 5GV7A 1JB3A 3UJ6A 3H8JA 3QU5A 5BWBA 4JT8A 4W7SA 4B33A 4BBRB 3J81L 1VG9B 2QZ4A 3D9QX 4S2UA 4R1LA 3TI7A 1BSVA 4LF7Q 2J6HA 3W9UA 1AN0A 3R9WA 1Z73A 1ECGA 1X42A 1U8FO 1UXGA 1XAHA 5TPWB 1TZ2A 5TT1A 4HTFA 3LYUA 4NAUA 4EDHA 5JPCA 1CZKA 2WUDA 2H18A 3A56A 4ZGBA 1QGZA 5A35A 1SE4A 1ZM9A 2XZPA 3F2DA 3FG9A 4ZJUA 2ZCJA 2IQIA 2BBTA 2NM0A 4QFCA 2XTNA 3AKEA 4MQ4A 1EAMA 2QX7A 4BVLA 4DCVA 2BI4A 2LIPA 2AKYA 4D6XA 3UDIA 1PJZA 2E4AA 4IH4A 1D5WA 1DJNA 4YROA 3IJ5A 1LTLA 4N0MA 5CAEA 3OW2A 1Q90A 3SK5A 1WW8A 4AVYA 5K0SA 4NU5A 1XTRA 4YXWD 4JG2A 2XODA 4FOOA 4E5NA 1NKTA 3MVEA 4NG4A 4W8GA 1E2HA 4JLVA 4FP5D 4IHJB 2K14A 1ZR2A 3M6XA 1ZOSA 3O3OB 3OO0A 4KOAA 2GWHA 2PX5A 2JGMA 2W6PA 2LXNA 1FF9A 3BH6A 1L1OC 3NTQA 5G0VA 1HPLA 1X38A 1OXUA 2PFKA 3A25A 5FQNA 3ROXA 5JSFA 4G07A 4J0CA 2NVTH 1LPMA 1P2GA 2ATWA 4G1MB 4H1UA 1UKVY 1N2OA 3DBHB 4LZLA 5ALOA 4UBKA 5A2GA 3GLIE 3GW8A 3GLFB 4RKBA 2HIAA 2NAPA 5H16A 3LLVA 5JDIA 3JV7A 1LI4A 1DLJA 1P9LA 2KHJA 1JDPA 2A5JA 3F97A 3MVVA 4HAUA 1YVEI 4DU9A 4X61A 4LSZA 3WYFA 3ZK7A 4F4UA 1E5VA 1TF2A 5B1EA 4FONA 4GI7A 3CSSA 4PLHA 4Y0NA 4XPIB 3WYNA 3JWHA 3KVVA 1V1QA 2R7AA 5AXDA 2C84A 3C8HA 3WKEA 1YD7A 4LISA 1KXZA 4X66B 2ACEA 5DHSA 4NCBA 2RH8A 3G0IA 4HXFB 4Q1BA 3OTWA 3MGKA 5E1BA 5HJ7A 2B63B 1HBJA 5BRNA 3WLJA 2CNBA 1UNSA 2XVMA 4L8YA 3ZJYC 1N1DA 1TY0A 1Q3TA 4JC4A 3CR3C 3VGJA 4X44A 2C4WA 2WYUA 3REQA 4B45A 1YQUA 2NYVA 1P73A 1ODKA 5JO9A 1FFGA 3MGGA 4TN5A 3ZYYX 5AHWA 1IN7A 1HH4A 2ZTUA 4NU8X 1GUDA 3GDFA 3U80A 3NHJA 4MWZA 4DTIA 4OVKA 2XOKA 1Q0ZA 4P7JA 1ND5A 1DRUA 3REGA 1RDPD 1PF7E 3O1LA 3ZDZB 1HT1E 1Z6XA 2XUIA 1FZTA 1ZGHA 3TEJA 4KN9S 2JVIA 2MSDB 3IEPA 4J0JA 4LK3A 5CA0B 3A6PC 3HOUG 1UWVA 3U44B 2VK1A 2P4EA 2CK3A 5EEGA 5TC4A 4KN7C 1AF4A 3UUFA 4QUJA 5JAOA 4I9HA 3SN6A 1K6IA 2DUNA 2O6LA 2RGWA 5AJTA 5EJAA 3NQ41 3T4PA 5I8ZA 4NI5A 1G8MA 1MZVA 2QSYA 3MW8A 3X44A 4Q3EA 1FBNA 3G71A 4CLRB 4GXTA 5IP7G 1AUVA 1GL6A 3IDSA 3PUVA 4M55A 4YNBA 2ERXA 1VJGA 3CPSA 5L51A 2HPHA 4GN3B 3QVVA 4DNIA 3UW3A 2M00A 1D1KA 1N6NA 3RVNA 4DXFA 1ZEJA 1HR0W 3MSCA 3U7IA 4F97A 5KYWA 2YZMA 3VV2A 1DAEA 2H7CA 4YJKA 5J40A 4CT5A 1WAMA 4TRNA 3O8RA 4IZ8A 1Z45A 2G09A 2VAVA 3NEJA 4FBGA 5CK4A 3RFCA 3I2KA 3NPPA 2CLKB 4JEIA 4LQDA 3JQFC 2QNIA 1SBBB 5EZ5A 3I72A 1NU6A 3GRZA 5ALLA 3EF1A 3KKZA 4FE4A 4EF4A 4JS0A 1RP7A 1CIJA 1OU4A 4YIKA 3HXQA 4P86A 2RVLA 5BWCA 1M2JA 2ZLBA 1Z4OA 5KZMB 3NXWA 3R3YA 5M5XB 1HNWQ 3MUFA 3CHBD 1ZK0A 3EG9B 4Q37A 3EAGA 2HZBA 2WVJA 5K03A 1ONBA 2RB4A 4W5JA 1YGPA 5F2DA 2WC1A 1K6EA 4RXMA 3CURA 4LUOA 3JD2A 1DKLA 1IEWA 1K75A 3CMEA 1PT9A 3KHTA 4AKSA 4DKAC 2EARA 5AJ3L 2O2HA 2F1MA 3E9NA 1Y9ZA 1W5TA 3IIIA 1JICA 4AI6A 2J0EA 5C7LO 4FHZA 2CBZA 4UUBA 4C7OA 1E18A 3SK4A 2WI8A 3CRQA 1TM4E 1XZPA 3C97A 4JGGA 3I9KA 1DCKA 3A31A 5B7NA 1BGXT 2DUUA 4GXNA 1NQ5A 2CEKA 2AW3A 1DVRA 1SMXA 1DBVO 3EFOB 1OLXB 2O7RA 5HA5A 4QLBA 4F8YA 5ELXA 5IDXA 3E3AA 1QRTA 2IE8A 5EUQB 1I01A 1H9JA 4PYJA 1GG5A 1KP3A 5CR9A 4FGUA 4DC9A 1V6SA 2WF5A 5KNDD 4DUZB 4BXOB 4MVCA 2QT0A 1CHQD 4PIMA 2A59A 5J4LA 5DLDA 4CHGA 1ZN2A 3GMDA 4FEGA 4B9XA 3HOZH 3DAFA 4AUEA 1BE0A 3QELB 3J81k 1TGVA 1BQQT 1EOVA 2GASA 2GVDC 2PYIA 3QEOA 3TNDA 4YS6A 3X2EA 4CKXA 2YZKA 2R6ZA 1SPXA 2X0JA 3FTPA 1DLIA 5C4XG 2D5CA 4L7VA 1GGNA 1SHUX 3DCNA 1CTQA 4EHIA 4BMNA 4YUAA 5K6RA 3LW8A 4N39A 2RAFA 2ZVQX 2PPVA 1YU9A 2R7ZH 2Y1DA 1OFHA 5DISB 4QVGA 3G5UA 4ML3A 4RSGA 2ZAMA 3NT2A 3FNIA 2IHBA 1KJWA 5ISRA 3AFNA 3H2KA 5HIKA 1ULTA 1CCWA 3NT4A 2RHOA 3C6ZA 2WSYB 2CBGA 4QAJA 3RRZA 1B16A 5KHLB 3JSAA 4F93B 2FV8A 2O0KA 4F1KA 4AXBA 4ASUD 2CH4W 3WKDA 5LJIA 1V45E 3MSXA 4M0LA 4BBSH 2WG0A 4FKBA 4PX9A 4ARIA 1TMYA 2HMUA 2Q5EA 2VSOA 3WGQA 5A9SB 2PKCA 1J8VA 3CR7A 3MQFA 5DWQA 3DQPA 4IIGA 2KQ3A 3GTOH 3L7YA 4JX8A 3ZR4B 4UU8A 1J5EB 1QFXA 3LSTA 4QREA 2BHNA 3PDHA 2ZJFA 1XMQL 4V0OA 3OCVA 1XMOQ 1PZHA 4LKRA 2QZZA 3R24A 1LPNA 2GBGA 3I9FA 3LXUX 4X3KA 2COEA 2VL7A 4A3EB 4TL6A 1A15A 3TKLA 1E0KA 3WSVA 4E13A 1V47A 1JEYB 2AC7A 2K2QB 4BQEA 3TL3A 5KYYB 4J1MA 2OECA 4KKVA 4CETA 3V42A 3ZWPA 3K35A 2Y8EA 4B85A 2QI9C 5EZYA 3WKCA 1WXDA 4EL0A 3OTIA 4QU8A 4UJ5A 1PH9A 4BIIA 4BPBA 5E0KB 1HYQA 3KT8A 4U00A 1SXGA 3OQBA 3L06A 2VDKB 1SCAA 1G4HA 1Y3DE 2CXSA 2K7ZA 1ODTC 3JWPA 1QQAA 5CA1F 2Q8RE 1GD1O 1I3LA 3E2IA 2VK8A 3WRWA 5M5BA 1YTUA 1BA3A 3GGOA 3X0DA 5I48A 2N47A 2FVYA 4BNHA 1I0ZA 1A5BB 2NOAA 1NWCA 3BCUA 4EGAA 4EMTA 1IXZA 1F3OA 3R3VA 2CSUA 1RQXA 1TIPA 3OD1A 4CNBA 1OX5A 1LF5A 4AMVA 1I5RA 4YGXB 2FG7C 4Q3OA 2O8BA 2BFNA 4GLFA 3HWX1 1KPHA 3AIIA 3AM4A 4K88A 5DYNA 1YMUA 4J16A 4BPRA 4G0PA 3JARA 4RIHA 4HN7A 2BOVA 2B4TO 5GV8A 2OVBA 3NNSA 2O50A 3MFYA 5K6AC 1KC1A 5LR6A 4N41A 5AKZA 4BVBA 3KZOA 4ZALA 3WGZA 1XAIA 3H7AA 1RYEA 4X8OA 1GVHA 1TWCB 1USIA 2GN6A 4E07A 2CLSA 1O95C 3TS1A 5LWHA 4OX9B 3UJ8A 4XAQA 5JCPA 2IP2A 1M5RA 1I6WA 1TCVA 5KTOA 3AERA 3WGNA 3D81A 1ZI6A 3ROTA 1ONPA 2M6KA 2IU6A 2WJGA 4Z53A 5G3LD 6GPBA 2ZGVA 4OELB 3CNBA 5IAKA 2NNWB 3QVUA 4IBOA 2SECE 2C8VA 3RR2A 1MO6A 1MIOA 3DKRA 3F6BX 5LQMA 1EY4A 2UXDQ 2EYUA 1OTXA 1P2UA 1Y1KE 2BUCA 1IM5A 3ER6A 1VE7A 3HLTA 4K9PA 5C3EG 1WEHA 2O8VA 3OMLA 3FCEA 3HMKA 2BR4A 5CHYA 2AFIA 2KLBA 2EGHA 3F5SA 4J1QA 4P7FA 3TLBA 1T6XA 3TRJA 4CDMA 5GIOE 2IH4A 3L49A 4RTKA 2CLIB 1C30A 1T2AA 2OOKA 4I6EA 2GJ8A 1GQQA 1LJUA 2WYIA 5FWYA 1EVEA 3EOBI 4ZEWA 1T0IA 1DXMA 3T94A 1GY8A 4GZMA 3PENA 1AXGA 3HGQA 4LY9A 3K94A 5K0LA 3SC3A 4DLXA 5C32A 3KUKA 1PZKD 4IPCA 2ATXA 4QUGA 4RA9A 1CRWG 3RT1A 1A95A 2Z9BA 3V97A 4DGSA 2IGTA 3QX8A 1WTWA 5DYYA 3ZWKA 2QZSA 1N5RA 1II9A 3U9SA 3ILSA 2RGGA 5BOVA 3OFSA 3PUYA 2VZAA 4UCXA 1QOHA 1S5BD 1BHJA 3OJWA 2K01A 2UXBQ 5JMWA 3UMYA 4KL8S 4TXJA 5ELEA 5IVPA 3MCWA 1FXWA 1XRPA 3IYLW 1N57A 1QFZA 2BF7A 4TMKA 4D45A 4JJ4A 3PEYA 4TMXA 3TFQA 3C39A 5TMPA 5HEKA 2FMFA 3FUWA 2R8RA 1EY7A 2D1SA 3QZUA 3SR3A 3WMEA 4D8YA 4B3GA 1NBMD 2RHHA 2H1WA 1NLZA 4LE0A 5A4FS 1A1VA 2OFOA 3CXRA 4M98A 3TSZA 3HG9A 5I8PA 2QA4A 1ZSNA 3NQIA 1ES9A 4I50F 4MK4A 4EB0A 4IZHA 2BSXA 3BJRA 2WWHA 3ZI0A 1E2VA 2WWXA 4TM8A 3PC7A 1R18A 1BEUB 4GZ6A 3GRPA 5L3ZA 3G8YA 5B7GA 4NE9A 1TT2A 2XQGA 1VIMA 1IUKA 2I6TA 4XB2A 4P1ZA 1HSOA 5FR2A 1K7SN 2OLJA 3SM3A 2HCBA 1S3GA 4FLFA 3OX3A 4HGZA 5JNWA 1PFWA 1WXQA 4WKPA 1GZSA 1UM9B 3ETNA 3JRNA 2G5CA 4RSMA 5FOXA 1GUTA 3AEUB 3I92A 4XJVA 2DHEA 3V1TC 2ZWIA 5LQUA 3ZGZA 4KVZA 4GWGA 4YUYA 5JNUA 3PYLA 5B6IA 4YPOA 3WLOA 2C98A 1GZ7A 2PXAA 4WLNA 2FDXA 2YQZA 2ZTEA 1DTWB 3PF8A 1KD1C 1CR2A 3CPJB 4E70A 4B6PA 4ZYZA 2UVPA 1Z4NA 4LE1A 2IF2A 1S4ZA 2JAWA 5IP7H 1LVHA 1PUIA 2GEDA 5LMCA 2BFBA 1ZUWA 3HYLA 1AZTA 1VMDA 2BSAA 2VNKA 1QH0A 3B51X 4IMPA 4OGGA 3D8UA 4EPYA 1P7WA 1IXRA 3LRPA 2YVAA 1CZUA 1T29A 3SEZA 2OWEA 5BT8A 4JQZA 2RGYA 4XFDA 2JLXA 1HNXQ 5DB4A 3O13A 1SGWA 2W2NA 4AJJA 5DULA 3RHTA 3RUZA 4YXWA 2CLLB 3RSZA 5HM8A 4BP9A 4Z0NA 2PWBA 1VCMA 2BT4A 3EAQA 3F1ZA 2AI1A 2R6GA 2P9TA 1YVPA 1NBAA 1FQKA 3CWQA 3IKVA 1MHWC 1AGNA 2P35A 5IIFA 4C76A 3H1PA 1X1CA 4B6GA 3LNCA 4B3TQ 1J6UA 1ECJA 2D1TA 1GZDA 3C7AA 1E9EA 1GTJ1 4WJLA 4LIPD 3S8EA 3ZU3A 1VZ3A 4BFWA 3RWMB 4UTVA 5ISMA 1NW9B 2ZWVA 1DKPA 1XP8A 1VTKA 2Z3WA 4MVJP 1VYHA 1J8YF 1BMTA 1EGVB 1NN3A 3L82B 1WG8A 3O74A 3OQVA 4JL6A 4WKCA 3STHA 4B46A 4YV2A 5L40A 1DOZA 4B2YA 4EM6A 1IDN1 3NHHA 2Z83A 3HCOA 3H9UA 1NPDA 1DWQA 1LBSA 2FU5C 3DBRB 3TPFA 1OPXA 3IELA 3UDFA 3A55A 1J22A 4Q0MA 3QHQA 3L04A 4R3UC 3G5AA 2H85A 2JA8H 4Q0FA 2KPOA 1R37A 4JELA 2IU4A 3PRYA 1DRVA 3I6MA 4QOFA 2NU7A 1TJPB 3A3KA 3DBLB 2OTJA 4XTCS 3NASA 5EQDA 3TZEA 5KJ1A 5A3JA 5E3IA 2FP4B 4RF5A 4BFCA 3KF6A 4WZ6A 3IR6A 1N5MA 3T9AA 3LKDA 3RS8A 1M1XB 1T3ZA 3RNUA 4OQYA 3I04M 4N01A 4RHFA 1Z47A 2HF9A 2ID9A 5AJHA 5FXMA 3RH0A 1CFZA 4UU0A 1U65A 1XMVA 4L15A 2PUWA 5C4XH 2WT8A 1WTHA 1CSQA 1G8KA 1X7YA 1XB2A 1KF0A 1ZINA 1ZWKA 2FDCA 1W0JD 5DBHX 4CMCA 3BIWA 1YXMA 2EJWA 1OI4A 2NPOA 4IOMA 1K66A 3IV6A 3RTGA 1Z4KA 1Y5RA 2TMDA 3U4DA 3DFMA 3FYTA 4BEVA 4C0KA 1NI5A 1T3LA 1U8YA 1SQSA 3ICVA 3WR5A 5EJ9A 3L8HA 4RCOA 2QGFA 3ZCXA 1AKQA 3GEPA 3RBZA 2PGJA 3BD6A 2VRBA 5ICSA 4GI5A 2Z0MA 4X66Q 2WIAA 1L4BA 4MJ3A 4V0KA 5LQDA 4FGKA 3LCUA 4XWWA 1TJ3A 1NF9A 4BL5A 5KVSA 3R3OA 1EE2A 4IVNA 4R98A 5JQGF 1U2QA 4U5XA 1P5RA 2YJZA 4LECA 1HMPA 3R0XA 4DREA 2RGNC 4IDNA 3N8KA 4A36A 3IA2A 2DAPA 2F1IA 3GG9A 3TIXB 3OYYA 1YCGA 1W44A 2G9UA 3B3QA 1RCUA 3DEZA 3I64A 3NDIA 2V6BA 4EHNA 5KNCD 2PUTA 1P4JA 4ZCLA 4QM6A 4H3VA 3CKIB 2EKDA 3PG5A 1Y6JA 4G5YA 4AKIA 2VZLA 1UBHS 4QBHA 3BFKA 421PA 4EUSA 4G57A 4DK0A 3QX7A 3W77A 2EKBA 1CUHA 4MWGA 3RRMA 4L5AA 5CGKA 4BGDA 2BGRA 3G13A 1JPJA 5A7HA 4IYRA 3I4MB 4NTZA 4E5SA 2SDFA 4F3KA 4OQXA 1LBEA 4FYVA 3OCJA 3NHMA 5ECGC 2ZROA 1J25A 2JFBA 3RUFA 5I7EA 1O3YA 3U7GA 4IFBA 4OXNA 3JCZA 1BN6A 4O3FA 1MO4A 4DJTA 5IM4A 2AZTA 3KQMA 1ZD8A 3GTGB 1N5JA 1CUSA 2LXKA 3Q6NA 3OZCA 2H4HA 3SBXA 3Q8KA 4D9KA 1OD6A 2ID8A 1T5SA 2ATIA 2PJUA 4YI3A 3U44A 1LQTA 1RPNA 3UJCA 4LZAA 2R00A 1N32Q 4NZPA 4P3OA 4P81A 3WTBA 3HL0A 3IQWA 3RASA 2B2YC 5IT0A 1LTAD 1TS3A 1YFKA 4JC0A 3KQOA 4HNGA 5CYPA 4ZOLA 4MRNA 3DEYX 2ZB4A 4TWIA 2HPZA 1E2BA 3LKVA 3UK6A 2R7FA 3T3PB 3ZY4A 2VL6A 4IKEA 4JW0A 4ZVTA 1O95D 3BCSA 3S29A 3QQPA 4IJ5A 4E3ZA 4ZFNA 1AQLA 1PFGA 2R84A 4J2HA 4MX8A 3ID6C 4WQMA 3VU0A 5K0EA 2O7NA 3IQXA 2GJAA 3T3HA 5J3JA 1QPBA 3HKCB 4F7WA 3WBFA 4WFJA 1GEGA 1ICWA 4JOQA 4DV1B 2HJRA 1T0JB 1INLA 2VA9A