1OXTA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 95
structure length 352
sequence length 352
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxtA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxtA01
1HURA 4LCBA 3QOFA 1PLJA 1N6RA 1P16A 3KFUA 2PZEA 1R2QA 3VTKA 1JR6A 5DE3A 2IUUA 3EIQA 2Q21A 2ZS9A 2JQOA 2RGCA 2WKRA 1FUKA 4G5RA 2FOLA 3OF5A 2E8GA 4JBMA 2AUJD 2W00A 2ZPTX 3KZ1E 3NDPA 1UE5A 4DNRB 3QQ5A 1N6KA 4JLDA 4PQYA 3CZQA 4Q4JB 2FU5C 4CZ2A 8OHMA 2FMXA 1GFIA 5C44G 1UF9A 1GRQA 1F6BA 4TMKA 4IRUB 4JK1C 4C4PA 621PA 1X9NA 1CXZA 2FPLA 3W5IA 1OFUX 3QY0A 3GJ8A 3B9PA 3S24A 1XMQL 2AMCB 2CLCX 3T06B 2GXSA 4A1FA 4V0MA 4CYMA 4B3RQ 3F2DA 1X86B 3CNOA 2YTXA 4YCVA 1EK0A 4DUGD 3TRZA 3IHWA 4GZYC 5HZHA 5FR1A 2LXKA 4URWR 3K80C 4GNXB 3GTLH 1CU1A 1R7RA 1JECA 1BIFA 4QNMA 2BH8A 2ZTCA 3K7UC 1C7YA 1AS0A 3FB4A 5LPNA 3C14C 4M1MA 4B3GA 3NG1A 2CWPA 2GJKA 3RNLA 1ZU4A 5J4VA 2EW1A 4YY3L 5J4KA 1RVDA 3AKCA 3QKRB 4Q1AA 4DR4Q 4RCYA 1YITA 1WB9A 4QKQA 1E6CA 1A1VA 1OLOA 3TMKA 4UP9A 3I5YA 1V1QA 2V6IA 2AWNA 1A2KC 1VS0A 2QP4A 3F5FA 5FOXA 3ZVRA 4B3SL 3TKLA 4DLVA 4HJAA 4Q9LA 4GDFA 5H1SE 5JEAJ 1HNZQ 1UBFA 2F4VQ 3TE6A 1R8SA 4AYBG 4Q00A 4IEIA 1IN8A 5IYCH 4JL5A 1D8LA 1ZM3A 2KB0A 3Q5EA 3C15C 4OQMA 3SYLA 3IKJA 2KSQA 5GJVC 4EPRA 1Z3IX 3C4JA 4FWTA 1X8JA 2QM8A 2XTIA 4RZ2A 4US1R 4UXIA 2PH1A 1XZQA 3E5HA 1XD2B 2CCGA 2H17A 4LF6L 1F48A 4BLRA 3AP1A 1HJPA 4TL8A 2QGZA 3HKSA 4DV6L 1TTTA 1FNMA 1RYFA 1ONBA 1PH9A 3HU3A 4NCHA 4PZ8A 2AD1A 1NIJA 2YOGA 2WJGA 2PPBC 4O25A 1X8KA 3MJRA 4H02A 1MABB 1OFIA 2FX3A 3B7GA 3NIBA 2WP8J 2CBZA 4HJ7A 5FTNA 1XNQL 3HOZG 1VQ7A 4HUTA 1TX4B 2LXJA 3O8RA 4QM7A 4A93H 3W3ZB 1NVVQ 1ZIPA 3VNUA 3MXNB 2MNAA 1X3FA 5JCPA 3KKMA 4GLXA 1N6LA 3GJ5A 3S1MH 1UM8A 2A68D 2IHEA 4K81B 3ERSX 2CLSA 2O8CB 2ZYVX 4GOPB 4DR5Q 2ZI6A 3TVTA 4YXWD 3S14H 4TYWA 4RFSA 1NN3A 2BBTA 1BKBA 1KIMA 4B3TL 1YZNA 5EP3A 2XB2A 1V43A 2R7DA 2BBSA 2R93G 4GFDA 4DIDA 1G5PA 4ZI3A 5IT5A 1CR4A 1KNXA 3LNCA 2A6EC 3LY5A 4V03A 2HLDA 4IJHA 1MKYA 4V02A 2QSYA 3V9PA 2WBLC 3FFBA 1M74A 4JV5L 1CJKC 4LPKA 4RD4A 1L1OB 2A69C 4JI5L 1WDTA 2Q2UA 5IWAQ 2A5GA 1P60A 4DUYQ 4JLBA 5DLQE 3HOXH 2A1AA 3KDSE 4DK0A 4HAYA 4F92B 4IW3B 2ZSAA 2GJ9A 3CRVA 2VP2A 2ZR7A 1S1CA 3LWNA 2H57A 1J99A 2FFQA 5DHAA 3F2CA 2CJWB 2ZVQX 3D3QA 1E2HA 3W8NA 1U0JA 5BN5A 3PSIA 2C9YA 1YJ5A 4DT1B 2FEOA 5CDFE 2V3CC 4KAXA 1NBME 4QL3A 2R6AA 1AQUA 2JEOA 2PX0A 3MSXA 4I1VA 2W6JD 2E2HH 5JEDA 3ZH9B 2RGBA 3W6OA 1H65A 4JI7Q 2WJIA 4XH9B 5A35A 1N34L 4KHPL 1E9SA 3EZFA 4NH0A 1NP6A 1GHKA 3M4QA 5K8UA 1BO6A 1IN6A 2PEYA 2OFWA 5IP9H 3GTKH 4BWYA 6Q21A 3THOA 2G83A 2IYQA 1Z0IA 4FD2A 3IO5A 1ZRHA 4CT5A 4A93G 4AKGA 1VQHA 1VYTA 2QEXA 1EXMA 4HLDA 5KSZA 1KRSA 1GNRA 3AF0A 2QE7A 3BC1A 1JR3A 1AH9A 4NB3A 1NN0A 2CDNA 2D0PA 3A0JA 1E2EA 1YR7A 3A7AB 2DBYA 3EZ2A 3MAAC 3QKSB 1O7IA 3KJHA 2JA5G 5DHFA 4IQZA 1DXMA 5KUTA 1W4AA 2IHYA 2FPKA 3U61B 3CC4A 2ZYWX 3CNLA 4LBZA 3K0XA 5K8LA 2HYIC 1VQMA 4KVGA 5SZJA 5JHHB 3TS0A 2F9LA 4LJYA 2A68C 4G7ZC 2BMDA 2ZRDA 2BHRA 1DELA 4ZDWA 1HR0L 4A92A 4F7WA 4HLCA 1CR0A 4RD3A 3WBJA 1WBDA 5F2EA 3VR6A 1B9NA 2QORA 3IEUA 3B1YA 3U3OA 3WRXC 1P2UA 1HNZL 2JXMB 4LJZC 3HKZG 1D2EA 4KVAA 4DK1A 2JA1A 5CK4A 4V0LA 1GUAA 1OH5A 4DV3L 4B2PA 4EFNA 4BPBA 4DWJA 5FBVB 4DV2L 1W0KA 4TL6A 3SEAA 3CR8A 2QF7A 2XTNA 1SHZA 2F1MA 4BE7B 2YTVA 4DV0Q 4XTRA 4GKKL 1Z0FA 1CKNA 1U0LA 3G48A 5FPHA 5FLMG 4DJTA 1J5EL 5J3BA 1XCGB 3MGCA 4XJXA 2O5IC 3I62A 4MYUA 1S40A 2EJGC 2VSFA 3EW9A 2BJWA 3ASZA 5KU1A 2NN6H 2WKPA 4JKYA 4HB0A 1N5JA 3U3MA 2CK3D 1RRPA 4U7DA 3BH7A 1FQJA 1RZ3A 3UG7A 3OEHD 1R9TH 1ELOA 1OPXA 3LFUA 3CCRA 2ERYA 1QZHA 1G4AE 3GJ4A 1KY2A 3CPJB 3GFPA 4QQBX 4MUAA 3H3VI 3NH9A 1F2UB 4WAUA 1VQJA 3GFOA 1OXVA 3QKTA 2JJQA 1LNZA 4FINA 2ZJ2A 5EQTA 1GVPA 4LF7L 4B74A 1D9XA 2IUTA 5ANRB 1EFWA 3B13B 3MWJA 2ZJRA 4KSBA 2C04A 4JI2L 1N0WA 4B2LA 4P33A 1KI1A 3WWVA 2ZRHA 3L8YA 2VQSA 1U0HC 2GAOA 4EJSB 4P4SA 1E96A 2FGJA 4EX5A 3PF5A 1C9KA 1E2WA 2O0JA 2B92A 4L5SA 3CCSA 4JSTA 1RE0A 2PLRA 4L16A 2ZANA 2OV2A 3M85A 1KMHA 2OAP1 5DH9A 3GLHE 3PIRA 4DVGA 1KXLA 3OPOA 3SYKA 5FTKA 3ICQB 5KPJA 2MQHA 3CMEA 3QBTA 3N5CA 1M7BA 2IW3A 4X62L 2ORVA 2QTHA 1N34Q 3AP2A 3NBFA 3GLFE 3GLHA 2W2VA 5FOSA 2OFOA 2SHKA 1Y8NB 4EUNA 4ASUA 4DV7Q 3F8TA 3PUVA 1XMIA 3ADKA 4GNXA 1QHYA 3Q7QA 1IQPA 1EGAA 2GILA 1SVKA 3TQFA 4AYXA 4OQFA 4QHSA 3SU8A 3TREA 3BH6A 1AJEA 4C2MH 1M90C 3C8UA 1W7AA 1GG2A 4A3MH 1VQKA 1M1KC 2CXXA 4LYFA 5TY0A 3CC7A 3P20A 1VDZA 4P73A 4DK3C 5IYBG 2R93H 4DCTA 1NKTA 4DCNA 5A5GA 3A8IE 3RLNA 3CXCA 5AUOB 2A78A 2GCPA 3K70D 3A8KE 2HHHQ 1N32Q 1SXJD 3CZPA 3H3VH 4AD8A 3KLRA 1FGUA 2A5JA 2HYDA 1JNYA 4C0LA 3VA7A 4XWAA 2ATWA 3I56A 1CS4C 4CEHA 1EWRA 2IYTA 3REFA 4DLWA 1M8PA 2QBYB 5C4XG 2NN6I 1GDDA 3WMGA 4L9WA 3LV8A 4RKEA 5KYKA 4LUCA 2NVYH 3GCGA 5JMTA 2NPIA 5KNBA 2N46A 3EIVA 1SVOA 2P3SA 3K1JA 4Z54A 4IOLA 3BB1A 3BIFA 1VQBA 4LF5Q 1NMXA 1Q57A 4IDNA 4KBGA 2I1VB 4D80A 3SE0A 1GP2A 4IOAA 2WM9B 3GJXC 1S3SA 2C03A 2ONKA 1KNQA 2VHCA 3QJYA 2GKSA 5A0FA 1YBYA 3LW7A 2Z43A 1KK1A 1DBSA 1TNDA 4I99A 1WMSA 2ZJOA 3RDPA 2FA9A 4Q1BA 1BDOA 3CCEA 4DNIA 3LW8A 3RAPR 2Y0SE 5CLLA 3PF4A 2D06A 1Z07A 3J7ZC 2CHGA 2ZRIA 3CPEA 5IRCD 2UU9L 1E2IA 2XZLA 2AK2A 2QUZA 2QROA 3U3JA 5GADl 1JR3E 4HI0E 1CJTC 1P8LA 3QENA 1E2PA 1SQ5A 2FSFA 2GCNA 3ULLA 1A2BA 3T53B 3W1BA 1AS2A 1IJEA 4GN4B 1T5IA 2WJVA 5IYCG 3AV0B 3CH4B 3MLEA 3K81C 2P0EA 4BBSH 3I32A 4B2IA 4JCVE 3D8BA 4CEIA 1NLYA 3AF3A 4GI7A 4HLQB 3VQTA 3U44A 4B3BA 3A36A 3KOJA 4LFBL 4EIWA 2E74C 1QG4A 1OXSC 5F9FA 3T1OA 1C4OA 3SHFA 2IX1A 1ZNXA 5CJPA 4US0R 2DNEA 4N0DA 4WZAE 1I2DA 1V9PA 4Q9IA 1BH2A 1X3SA 4QGGA 1U81A 2A69D 1RYHA 1DEKA 2ANBA 3EC1A 1VIYA 2CFMA 3OIVA 4C30A 2ZU6A 3AGQA 4XD7A 1TL7C 4MGZR 4U02A 5DI3A 1Z9FA 2DPXA 2PI2A 4LV8B 5JWOA 3B60A 5LB2A 1ETUA 2WAQG 1JALA 2IYUA 1NMFA 5DISB 1Y1VH 3E9IA 4DHEA 3ZQ6A 2IBMA 2C95A 3BERA 2GEDA 4QXAA 2H18A 1DOAA 2MSDB 1AE2A 3UWOA 4PG3A 1TEVA 1D2NA 4KMUC 3TIFA 2Q2TA 4G01B 1V8QA 2Q8IB 4BLPA 3DM5A 3HOUH 4LBWA 5H8WA 1KSJA 2C9CA 1P9RA 3THWB 4JBYA 4DLUA 5JRJA 3OIYA 1JJ2A 2IS2A 3CX8A 2A6HC 1YR6A 2W83A 3LXRA 3SJBA 4DLXA 3QPVA 1OJLA 2G77B 3P32A 4UPAA 2AN9A 1G8GA 4PPQA 1C9OA 1M1YE 1ZUIA 4BFSA 5E3HA 3NC0C 5AUNB 1XMOQ 4EKDA 2RB4A 1W1WA 2GXQA 3G4SA 3CRLC 1IN4A 4D4KA 3HPQA 4MUBA 4F4JA 4DR1L 3BWDD 3QIAA 4IDOA 5EE5B 1CSPA 5K8TA 2XNDD 4ZIRB 4JI3Q 3VU9A 2I5MX 5DYIA 1BMFA 4KKUA 1SMXA 4K8OA 3B82A 4NYIQ 2FSHA 5HKKD 3TSOA 2WOJA 3K8AA 4QGUA 1WQ1R 3FPAA 4LSGA 5AJZA 4C3JH 3GLGE 4GN5A 2ZETA 3RSLA 4HJ9A 4OO1H 2GEUA 5M04A 4JIMA 1ZNZA 1KC8C 2VP9A 4UNPA 1R0XA 2DFKB 2OZEA 2IL1A 3CF2A 1HQMC 3TQCA 2ZRNA 1DCZA 3IRBA 1KO5A 4APVA 2N42A 4KLNA 4Q9KA 2YWHA 1QBKC 3NENA 2GZAA 2Y0SG 1RIFA 5C0XI 2G0TA 1VYUA 3R20A 3UATA 4NCIA 2ZRCA 4KBFA 5FL7A 3ZS8A 1CSQA 1DG1G 2EFHB 5E7MA 5HCIA 1R5BA 4OQLA 4C0AC 4FMDF 2UUAQ 3J7A5 4PPGA 4LI0A 2ZQ5A 1YVCA 3QSYA 1M7HA 4C3HH 1KI6B 1ZUHA 1YJ9A 3QF7A 3FKIH 3P1JA 2UZIR 3ICEA 2Q3MA 4JSYA 3TQYA 1Q0UA 1XNQQ 1G6OA 2RKOA 1RJ9B 3LQRA 4G5GA 1XPRA 1M2OB 4CDGA 1KOFA 2OLKA 2WB1E 1MOZA 4N1AA 1VQEA 1QUQB 3PO3G 2NZJA 1F3OA 2VL7A 3B8HA 2JLZA 4JLAA 1IXRA 3T51B 4AYBE 5LB4A 4BBSG 4DR2Q 4HEJA 4DC9A 1BYIA 3HOZH 4RD2A 1UAAA 3FMCA 4YMTA 1AZSC 4LHYA 1ZVQA 2J0VA 4B3SQ 1PH6A 3E0EA 1EG7A 1QHGA 1OKKA 2N1BA 4QOSA 4LK2A 2QAGB 1C0AA 1NY4A 1QVCA 3LX8A 1JB1A 4POGA 4TTRA 5LMUQ 2O5JC 4CEJA 5TMPA 2WZQA 4A0FA 1E9BA 4YWLA 1G7RA 3D4RA 5A4JA 1G20E 4O3MA 3R7WB 4KKSA 1LM0A 2O0KA 3UXMA 4TVAB 2QM7A 2P5TB 1DADA 4P4UA 2WIBA 2WMNB 5CIWA 2JAQA 3BU2A 4BFZA 1Y1WG 2JLRA 3VDYA 4TSFA 4PHTA 1FP7A 4TT3A 3ZGXA 1ZC4A 4YXWA 2F1HA 1N6NA 2GVZC 3EIHA 2UXCQ 1SKYE 2VEDA 4A2QA 1CLUA 2QAJA 3GLGB 3A8TA 2XJ9A 5L8VA 3KTAB 3LQQA 3I4MH 3WNBA 4Q4LA 2NG1A 4L5RC 3KJOA 1UEIA 2DWOA 2ZS7A 4Q19A 2OXRA 4A82A 4JKIA 3BJIC 4R4QA 2HQLA 2OESA 2VH5R 1DG3A 3AVOA 1R5NA 4NHOA 3UDXA 4DKAC 2OTJA 1UFQA 4G7HC 2R44A 4BY1H 5GAEC 2G3YA 3PEWA 4DNTB 3PV0A 1MO3A 4ZDKA 4RJLA 1H9JA 4HR7B 2KBEA 2V8OA 4FW9A 4CEHB 2A7QA 4D0GA 2QBYA 1W5TA 1ZJ6A 1II9A 2EIFA 2ZE5A 1GSIA 2JA7G 1GKUB 1XU4A 2UU9Q 4IKEA 1P2TA 3BD9A 4OO1G 4A3GH 1SMYC 3OHMA 1Z6GA 1I4LD 5C4GB 2ODNA 5CYOA 1KKLA 4EPXA 3QXXA 4RMFA 3F2BA 3G6EA 3UG6A 2VO1A 3S1QH 3WNCA 3A1TA 1XP8A 1XDBA 1ZNWA 2OQ0A 2EFCB 5JJIA 4WIAA 2Q9AA 1XJCA 4PSVA 2WWIA 2ZI9A 3UE0A 2HJGA 2JDID 2OBNA 3C5CA 5EZ5A 3W9YA 3U6KA 1K6MA 2GVDC 1WF3A 3H94A 1KYIA 3PR1A 4GSYA 1NSTA 4DRZA 4JL6A 4Y52H 4URVR 2YNMA 1E9AA 1PH7A 1NG1A 1XCPA 2UVQA 2VP4A 3FKQA 1DAEA 4IEEA 4A3KH 4HB4A 4Q4JA 2H92A 4URUR 1S3GA 1WP9A 3I92A 3N70A 4IVRA 3CCMA 4OK6A 4JI4Q 1A82A 1KO8A 2BDTA 1JBKA 2LSSA 4CF7A 3OAAA 4PV1C 1KMQA 4JC0A 2XJ4A 5IWAL 2O8EA 3FHOA 4DCSA 1NVUQ 4CIDA 2ORWA 3TJZA 1G5TA 2BMFA 4QBFA 2BOVA 4Q48A 4XD7D 2H1LA 5KHOC 3N6RA 1G51A 4EDHA 2P65A 4IOCA 3L7ZC 4ZPXA 4M1YA 3B6YA 2QL6A 1UADA 5DGXA 1FYCA 1GTVA 3ZJYA 1I94Q 4JL8A 2OTLA 1E1QA 2BKUA 3FGNA 4MKGA 4JI4L 1HZBA 4A3EH 4B33A 1IW7D 3A7LA 5C0XH 1JQLB 1S8FA 3T5DA 1PUIA 3D6TB 1G8FA 1VQ9A 1EWHA 1Q1ZA 3FHTA 2YWEA 1GKHA 4LF9L 1SXJC 2IF2A 4A2PA 1VQ4A 4MKFA 4OYHA 2IX3A 3NHBA 5FL3A 4E22A 4LF4Q 2KI5A 1W0KD 2J1LA 1W4RA 4BFXA 4OI1A 1KAOA 1S72A 1F60A 3KL4A 1VG0B 3HWSA 3SHWA 3DEFA 4KITB 5IHPA 2CHVA 1GZSA 1XMSA 4G5OA 2AFIE 3K0CA 3NDBB 4I1SA 1KI2A 2A6HD 3KJEA 3MWKA 3TLXA 4RZUA 1TXYA 2F55A 1VG1A 4DV6Q 2ZE8A 3Q85A 1J90A 2EWWA 4TMWA 2WICA 4MYCA 1MRSA 1Y8OB 5IYDG 2C98A 3TW4A 2O8CA 3FVQA 4OQXA 5JBQA 3BFXA 2LCFA 2LKCA 1ZM9A 1VPLA 1HQCA 2PMKA 1OFTA 2HT6A 2W0SA 4D82A 1G19A 3L2OB 4ZIRA 3GTPH 4YHHQ 1PH4A 1MABA 2EJMA 2F4VL 3CF0A 2IXGA 5H70A 1OXUA 2W6ID 4GNXC 2OSBA 4WA7A 1XTJA 4EPYA 3I4MG 4PXAA 1LUZA 1A7JA 4DBLC 2O5VA 1N8RC 2PI2E 3EZ9A 2VS1A 1U99A 3KQNA 1KIXA 2BV3A 3EARA 1Q1BA 1DS6A 1P2SA 2C9OA 1S96A 2RGGA 1T0HB 1G3UA 2P6UA 3NXSA 2P2LA 4TTQA 2Z4SA 1R0YA 1U94A 3KJPA 3U4ZA 1FUUA 1Q20A 3A4MA 1A63A 4BLSA 4H0LC 1US8B 1XD8A 4OHWA 2ASBA 5JRZA 1ASZA 1IN5A 1QJOA 1IONA 1Q1QA 1OF1A 5AJ3L 3JVVA 1B23P 1HT2E 1VYVA 2HXSA 2Y8EA 2FE4A 4TSFD 1DO2A 4H44C 4HZUA 1TF2A 1ZD9A 2IYVA 4UP7A 1AQYA 1IBKL 2R7ZH 3B1VA 3Q9LA 4B43A 3J80i 2ZRJA 2ZUCA 4D4JA 2B8FA 1N33Q 1Q1EA 3JZAA 3K0SA 3DL0A 4KCGA 5F3WB 1D5CA 2IYXA 4NXNQ 3A1VA 5LMUL 4DR2L 4KO8A 5M3FG 1SHKA 4BA1I 4B3RL 4OHZA 1GUOA 1M7GA 1G7CA 1OW3B 2B8TA 2JASA 3P4YA 4O0MA 1K73C 1KDTA 3FMOB 2Z5FA 2WTUA 1E4YA 3KXIA 5IYBH 1GUGA 1P62B 3NEYA 4X6AH 4Q47A 3EBEA 4Q5IA 1W0JA 2I5LX 2ZE6A 2QT0A 2R6DA 3SJZA 1XMVA 5KSPA 4E5UA 1L4UA 3NWJA 3IILA 1QHIA 4KJZA 4MITA 5DN6D 2MSEB 1GHJA 4HB3A 1WBBA 2WB1G 2QAGA 3JAMc 3A74A 1KO1A 2JJ1D 2E2JH 3MMPA 4LV6A 2WWXA 4MKHA 4W7SA 4IDHA 1PZNA 3CRQA 3SJAA 2GZHA 2OUKA 1D7QA 3REGA 4F38A 5KDDA 3K70C 4R1JA 2WSSA 1YRBA 3QKRA 5DI9A 1Z6TA 1K5GA 3K8YA 3X1DA 2BE5C 1C1YA 1KDRA 1YHBA 2AKAB 4K0KQ 4PSAA 2R62A 2ZRGA 3U4QB 1JPJA 4LY6A 1N3BA 2XZOA 3IBYA 4DUYL 3T1TA 4R2HA 5AJXA 5HY6A 4DIEA 5M5WH 2XSZD 4PPNA 4KHPQ 4YWKA 2F43A 3PENA 4LYJA 4ZCMA 4CEJB 4NDZA 3EIEA 1E69A 1G18A 4JI1L 4DAMA 1FMLA 4TLBA 2OG2A 2BA0A 2REXB 2KWIA 1JAIA 4PC1A 1ESMA 3ZS9A 2WWYA 2EDGA 3PEUA 1XCMA 1P9NA 1UE1A 1E2VA 1VCMA 2Q9CA 4IFDG 2JA6G 5B64A 5KO2A 4B32A 1I5FA 3PFIA 3FHWA 4J15A 4QHYA 4DR5L 2FFHA 1US8A 1YZUA 3OOCA 3B85A 5TVKA 4EFMA 2IT1A 1VG9B 4LK1C 2D0OA 4NYJR 1S3OA 1N25A 1Z83A 2RGNC 2VP5A 2NGRA 4IVPA 1CJVC 3TUIC 4ILEA 3TUJC 3W6PA 3SJCA 4A36A 1H9KA 3U50C 3AKDA 1KQSA 4GKJL 3CAMA 1VECA 5CM8B 2C77A 4BQSA 1CKNB 2JLVA 3AVWA 1R6BX 3EQLC 2QPAA 1WRBA 3IDQA 3Q7PA 4C0HA 4Q01A 3ND8A 1DE0A 4PPFA 1J6QA 2CVHA 2D2EA 1XPOA 2WFWA 4OHXA 5J40A 3O8CA 2NO1A 5K8IA 1E1RA 1BKDR 1WFQA 3FP9A 1HNXQ 4DEXA 2GXAA 1KJZA 3ZJYC 4MYHA 3M3YH 1LB1B 1QHXA 2IS6A 3ZZTA 4LZZA 4GMDA 4FWIB 3KQKA 4UQOA 3VHXA 1LS1A 3MEFA 3RS4A 3QVVA 4QJFA 2GJ8A 1K8OA 1JE5A 4NXMQ 1E0KA 2BWJA 2IYSA 3BORA 3CPHA 3UIEA 3RC8A 1G8HA 4CVNA 2DGYA 2VSOA 4O2RA 1XPUA 4H13C 4H1VA 1T3LA 5FBLB 2E76C 1E79D 1KI7A 1HYQA 2BIFA 2IEZA 2B29A 2RHQB 2JLSA 2Q9BA 2ZI3A 3PEVA 3R8CA 2E1RA 2BH2A 1SLJA 3LA6A 1DD2A 4NL4H 1YEZA 1QVRA 1QDEA 2DHRA 3AKEA 1JJ7A 4P4SB 3P27A 1EFCA 4EQ6B 2P6NA 2ZSFA 5AJ3Q 4A6XA 3U7GA 4WJ3M 1PA6A 2EXDA 4R4IA 4TTPA 1E9EA 1BS1A 3HDTA 1IBKQ 3CRW1 2VUMG 2K14A 3L0IB 3CPWA 1ZIOA 1L1OC 2BVNA 2J0UB 2ZRFA 4FMCB 4MRRA 4OHVA 3CCJA 1NMYA 1GO3E 2J5XA 4TLCA 1FX0A 1WYDA 2ECKA 2I1QA 1NI3A 3BB4A 4LHXA 1QZXA 4D4LA 5FPSA 2BA1A 1YNNC 1KK2A 3A58B 4Y7NH 1D6JA 3CRRA 3CX7A 2VTKA 4JLNA 4YMWA 3WYGA 3DO6A 1XXHB 2RGEA 3UDGA 3R8FA 4R9UC 3DDCA 4DEYA 4TLDA 3BZCA 3E9HA 4DT1A 3AVTA 3LO5A 1JPNA 4QBHA 2PCFB 4LYHA 1TQDA 1PMRA 1X6VA 2GZDA 2J7PD 1N6IA 4LFBQ 3NBZC 3OE7D 1PYSB 3HJNA 3QE0A 4QRHA 3T1QA 4UNNA 2WWGA 4GN3B 3T34A 1UKZA 3B2EA 3I8SA 1A6XA 4HATA 2ZJBA 2ZRBA 2QMOA 4P4TA 4NXML 2FH5B 3VX4A 2GXUA 3G71A 3RC3A 3RN5A 2ZVPX 4HYYA 1ZNYA 1Z2CA 3BGWA 4F91B 2WKQA 4MGYR 3MWYW 1EWIA 4JJZA 1YHQA 1X55A 3H86A 4JBXA 3VKGA 3ECCA 1I6VC 2CMKA 5M3MG 1Q86C 3ULPA 1ESNA 3RABA 3RS3A 5FOTA 2ZM6Q 3NEMA 2UUCL 5DN6A 4U00A 3GLFA 2OE2A 2ZM5A 3U7FB 5BXQC 5J47A 2K50A 2UXBL 1XMQQ 5HR5A 1VHTA 4YDHB 3JVUA 1KAGA 1HPCA 2AUKA 4C3IH 4DLRA 5HGQA 2FV8A 3EPKA 4IFBA 3NHAA 4NTZA 4ARZA 2O8BB 4C0SA 3PIOA 3RZOH 1G6HA 3EPHA 3ND9A 3NELA 2JEBI 4I7ZC 4RG1A 3HR7A 4MRVA 3X1XA 3I5XA 1Z6HA 4IDQA 3PEYA 2J7KA 3U7EB 3T1VA 1AS3A 3CUEF 1RRFA 3FKSD 4BFVA 2EVWX 4WVFA 3O8DA 1MJEA 3LGJA 5JWHA 2CW0C 5JI3E 4X66L 2AKYA 2XX3A 5KPDA 4M21A 1Q12A 3W6NA 3L8ZA 1Z0KA 3M9BA 1P72A 2OFXA 1TU3A 4CEIB 4LDJA 5E7NA 3DMDA 3IBGA 1E2KA 3PO2H 1Z29A 2F3RA 2RGDA 5J4HA 4MDFA 5DO9A 4TZ6A 3FMIA 4JV5Q 4HZUB 2K5UA 3LBIA 1F2UA 2D62A 4P0TA 2JLYA 2GBLA 2VQFQ 1XFAA 4IJLA 4AG5A 1RIPA 3VAAA 1IYUA 2JIZD 1IY2A 1CIPA 4C7OB 4NYMR 4JI8L 5E7IA 4DV7L 4XSGA 4JI1Q 3W3AA 4DKXA 1K9MC 1W2GA 1Q21A 1E0AA 1DAKA 2JCSA 4PC6A 1CP2A 2WWHA 4OKSA 2CKZB 1G3IA 4EJSA 3K9NA 5GADC 2ES2A 5C2JB 4PX9A 4AURA 3T5GA 2E5LQ 4LFCL 1NN5A 1XTIA 1TQ6A 3RLFA 2R8RA 4TYYA 1W47A 1Z6AA 2ZT9C 2B63H 4A76A 3EA5A 2FWRA 4BZXA 2ZEJA 5LMNL 4O0AA 1QHHA 2B6HA 5B30A 3I72A 2I0QA 2PMDA 3QKUA 5H68A 4A3LG 2KHIA 4WZ6A 4IPHA 3Q8XB 4TMTA 3HOVG 4JI2Q 4G0NA 1X1RA 2YWFA 4XSHA 2KCTA 1XB2A 2QRZA 1VQCA 2JA7H 721PA 3QXHA 2GNOA 1ZD1A 4EPVA 1QHSA 3BB3A 2PJRA 4XWOA 4JS0A 1XTQA 4DCVA 3UANA 1N33L 3RRZA 1OFHA 4JBKA 1PLKA 1TMKA 4CT4B 2IF0A 1CJUC 1P9WA 2OILA 1HE8B 4ARZB 1X3EA 3I1FA 3KUDA 1JJVA 1KSFX 3ZLJA 4ZDJA 1LV7A 1I50H 3IO3A 1FTNA 3BXZA 1S9HA 5FOUA 4DDTA 3GTJH 2CEAA 4KLZA 2DY1A 2G88A 1NBWA 2ZYTX 2G6BA 2Z0MA 4GP7A 1SXJE 3BJUA 1SXJA 4PHHA 2NO0A 5SZHB 2W0MA 3K53A 1EYGA 1YKSA 4M9QA 5FFMA 3U4QA 2Z6VA 1GD7A 5CJ2A 1YI2A 1F5NA 4MZ9A 2PX3A 2QI9C 4P75A 2ZRKA 1CR2A 2V7QD 2FZ4A 4GLVB 5FLMH 2DCUA 1E99A 3PIPA 2WMOB 4DR6L 3N2IA 2V1CC 4X65L 2YWGA 5IDVA 3AFQA 4Q4HB 4UJ5A 4BUJA 3AVVA 4HIKA 4MTNA 1EWQA 4DR6Q 3CRMA 2NZHA 1VCNA 2EQBA 1J5EQ 2H5EA 4ZV4A 221PA 2AKWB 2UXDQ 1GILA 1ZAKA 1YNJC 1KO7A 2EU8A 2QQ0A 1EFRA 1HH4A 1Z2AA 5K36G 3WNDA 5JFGA 1VMAA 2QG6A 4O2LA 2F6RA 4DV2Q 2LKDA 1W0JD 2CL7X 2QQEA 1SVMA 1BVSA 1Y1WH 2TMKA 2K32A 4OJQA 1N36L 2IK8A 2ZTSA 1E3PA 5C3EH 3MD0A 5EP2A 5IK2D 4DB2A 4DAYB 4Q21A 2F3IA 2QENA 4C0JA 1Q81C 4IHQA 4MYTA 4E09A 3GTQH 4ME3A 3NBHB 4IFEA 4JJKA 4PZ6A 5FBQB 4QJ4A 2OCEA 2GRJA 1PH5A 1TUIA 2RMKA 4TYQA 3C41J 4GBMA 4GOJA 1U8ZA 4HLUA 3SOPA 1OT3A 4B44A 4Z51A 3DM3A 1Y69U 3OEED 2AL7A 1W4BA 4GZMA 3PUXA 3SI7A 4DSTA 2K5NA 2Z0SA 3KJGA 1IL2A 1IXRC 2J3EA 3H15A 2A5DA 1OHHA 1GRRA 4A0RA 2PCLA 3CONA 5IP9G 4YLGA 1IW7C 3AYHB 4M22A 2V1UA 1NG9A 1FPMA 3GLIB 4OL0A 5IY0A 4C2TA 4DV4Q 2YU9H 1YZLA 2V1XA 2ZROA 4HDOB 1QVGA 3RLOA 3LXXA 5B58C 4RY2A 2HF8A 2A6ED 1P75A 1E4VA 3ZZ0A 4XVUA 1Z06A 2XTZA 2VF7A 2ZI4A 4NONA 4LF9Q 5FTJA 3EPLA 4HIMA 1YZGA 3GQBA 2REBA 1SXJB 4A3EG 1HE1C 1IN7A 1XEFA 2PZFA 1NTGA 4A4DA 3I4NG 2XXAA 3GEHA 3KQUA 2AD5A 4P3YA 4EPTA 5BR8L 4EQ6A 3PXGA 5C4XH 1OV4A 2RGAA 2NMVA 1LS6A 5DI3B 4BFYA 2Z4RA 2JEAI 1Q8KA 2N49A 1A4RA 3AUYA 3C16C 3M6AA 3KXKA 1NJIC 4LC0A 4QJ3A 1N9WA 5BR8Q 2ZR9A 4URXR 5FTLA 1S2MA 2NZ8A 3K0AB 5KTYA 3SYNA 1G4UR 3MWLA 5GAHC 1H8HD 2I4IA 3BAFA 1CRPA 3GPLA 3KTAA 3KUCA 2K33A 3HOYG 3KX2A 4QGHA 1QVFA 1NIPA 1HTPA 2N78A 2JATA 3DPUA 1XEWY 3LX5A 2BMJA 4OI0A 1UKVY 3CCUA 5JS7A 4AQYL 5BN3A 4PAQA 4OWXB 3GLFB 3LLUA 3ZQJA 3DZDA 1IBMQ 3I7FA 3CLVA 1DAGA 1N0UA 1Z08A 2GVBA 2WJHA 2OLJA 3CWQA 1EIYB 1X6OA 5SZKB 3LBHA 1K5DA 2W58A 1I4DD 1XJ0A 3KDFA 2RHMA 1SR3A 2C78A 4G1UC 5AK0A 5KOYA 1P7CA 3MRSA 4JLOA 4KI0A 4HJ8A 4A3FG 3NBYC 4URYR 5FBRB 2O8FB 4Q9HA 1TEXA 4M9SA 2OEPA 1Y14B 4DR3L 3AGPA 5BW8A 1G8YA 2VNUD 4YWMA 1R4AA 2BBWA 2W2TA 3FKSA 1K8AC 4I1OA 2NN6G 3TEHB 4MA4A 2H5XA 4GOPA 4BY7G 2E87A 2ODWA 1F2TB 4JYAQ 3DOEA 3TZUA 2GVAA 5IT9c 5TXGA 2IWHA 1H8EA 2FSIA 1ZM4A 3BDOA 5M5XH 1N36Q 4M8NE 821PA 5FJ8H 3CNNA 4IVQA 4NCJA 1N5KA 1Q44A 2EFEB 4BY1G 3OFND 1OXTA 4Z8XA 5E7JA 5LD2B 2O8BA 2ZUBA 1RC8A 1UJ2A 2XTMA 2ONJA 3PQCA 3QBVA 4U5XA 1K3RA 1UEBA 3CH5A 4WXRA 1ONLA 2UZ3A 3TVDA 1KJYA 1Q3TA 3CCVA 2DFLA 3EXAA 2JA8G 1EX7A 1YVDA 4RVCA 2O8EB 1AK2A 1SZPA 3FMFA 5TDHA 2GCOA 3A4LA 3CRKC 4A75A 3EA0A 3CQZH 4POFA 1SVIA 4LJ8A 3HP1A 3ZYCA 4AC9A 1YHAA 1N5LA 1NY6A 3UDIA 5FOVA 2QP3A 4WXPA 4AY2A 4A8JA 2R9VA 1IJFA 4B73A 3AVUA 4ON9A 3QUSA 4HAXA 2V6JA 4PO9A 2B63G 1B8AA 3RRMA 1XX6A 1WCMG 5IP7H 2PBRA 3FOZA 1M6NA 3W8RA 1RJ9A 1T4GA 2IC5A 4W9MC 1MV5A 4HDQB 4RD6A 3CIOA 4TMVA 3AVPA 5DYGA 1IBRA 1Z22A 1HTWA 1GKIA 2J87A 1HR0Q 3HOVH 4QGAA 3RRYA 4B47A 1G8PA 3THXB 1K8MA 3CBQA 3RWOA 2QA5A 3ZIAA 4OWTB 4LOAA 1LABA 4DR3Q 1WCV1 2OT3B 3B1WA 1W36B 2JJ1A 3QVUA 4XOIA 4PZZA 3CD6A 4PQRA 2V54A 3J81c 2ZJ8A 2GAAA 2PL3A 4LHWA 2IUSA 4PANA 1OH8A 4LWZA 3C7KA 5FL7D 3THYA 2FSGA 5UKDA 4A3KG 1UBEA 4WZBE 5F9HA 4ALPA 2J7PA 1KDOA 2YKGA 1UBCA 4A0HA 2B7CA 2W6JA 3UKDA 1QUQA 2IYZA 4AG6A 1TQ4A 1R0WA 3IGFA 4EFLA 1CTMA 2ORIA 2I5HA 2NQ2C 3U3RA 3FYHA 3SFZA 1E2DA 1JAHA 2OCPA 2WAYA 4RD0A 4LW1A 4F4CA 4AK9A 5C18A 3VR5A 1AKYA 1SKYB 4A3DH 2KJQA 3AUXA 3NTUA 4HAZA 3VKWA 1LTLA 1VQ5A 2JJ2D 1IBLQ 1JMCA 1VQGA 4LX0A 4B48A 2JLWA 4DLZA 2XNSA 5H1YA 4QIWE 2YINC 1HZ9A 3A5ZB 2CL0X 1E0JA 1NKSA 3RZDH 1PYBA 3HOYH 1XTSA 2ZITA 3DZ8A 4RFVA 1DVRA 2K52A 1G3MA 2QMEA 2VZAA 2WAQE 1KRTA 3FFAA 4Q9JA 1OB2A 1YJNA 4GMXA 3CP0A 1LVGA 2ZRPA 1J7KA 2ERXA 2UKDA 3KJIA 4HZIA 5IE8A 1GKYA 1GIAA 2ZREA 2RGNA 1U9IC 5FOWA 2CWAA 3EPJA 4QNRA 4IDPA 1OB5A 3TUZC 2GJSA 3ULJA 3CC2A 2IWRA 5HE9A 1E79A 2Z6KA 2V9PA 3OYYA 2BMEA 4DDWA 5BYKA 4L9SA 2RGXA 2RH5A 4FN5A 5FI0B 3VHLB 3WYFA 4Q4HA 1VQNA 3B1XA 3LRPA 3GLGA 4NZYA 4PFSA 3OZXA 2C5LA 1E9CA 4N0EA 4L4UA 1OYYA 4JVNA 4XWKA 2MO1A 4MDEA 5HKKA 4L8GA 2FPMA 2WSMA 1ZD8A 1KJWA 2IYWA 2IS4A 1XMOL 2DYKA 2BCGY 1MH1A 2ZJ5A 1E0SA 4JMPA 3VR2A 1UE7A 3Q8DA 1NVVR 2A9KA 4TMXA 2QZ4A 5K36H 4IPDA 5EE3A 3K09A 3KFXA 3CCQA 4YQFA 2OO7A 4HAVA 2A5YB 3THXA 2A5FA 1I6HH 3F0TA 4KODA 4N3NA 5DSZA 1XWIA 2JA9A 1XD9A 5CK5A 4OXPA 3GMTA 1Z6YA 4I81A 3T61A 5FPTA 3SFVA 2GBLC 4D81A 1JEDA 2W2XA 4AIMA 2ZJPA 4R4CA 3BFKA 5JEAG 1HV8A 1XEXB 3L43A 3Q72A 4MGIR 1TAGA 2FNAA 1KMHB 2CK3A 4X8HA 1XNRQ 4MRNA 4EAQA 1E1RD 1UDXA 4LV5B 2R2AA 2VPPA 1Y1VG 2NO6A 3IHLA 3S2HH 1FJGQ 3T12A 3E1SA 1R5OA 1K83H 1L4YA 2F1RA 4KFUA 3ZVMA 1ZMXA 4RD1A 4PO8A 2DFTA 2BJVA 1U8YA 2C99A 4TWZA 3PO3H 1CULC 4Q7LA 5C4JH 1OYWA 4BLQA 4QM6A 2RHDA 4GKKQ 1KD1C 4JLVA 2R6CA 2ZJZA 3TK1A 1NN1A 1SVSA 3B6EA 4UJ3A 1IY0A 5C1BA 3H4MA 3GLIE 2G1KA 2VUMH 4OJKA 3MG9A 1BBWA 2F43B 2QU8A 1LY1A 1B7YB 1M34E 3T35A 1WI5A 4LFAQ 4C0BA 2AHOA 4NCKA 4AKIA 2ANCA 2P67A 1MRNA 4LBYA 1D9ZA 4LC1A 2EYQA 2PMZE 4A3CH 5FUVA 1CTQA 1E2FA 1TWFH 3WRYC 1VQ8A 3L0PA 4R2IA 2J0QA 1MJCA 1YRAA 1QZGA 1CRQA 2P5SA 5EE0A 5HPYB 2FFAA 2VHUA 1J8YF 3GJ6A 3M1IA 1W49A 4DZZA 1Z63A 2HEIA 3AB3A 4AI6A 2B3GA 1XMJA 3S2DH 3H2YA 4Q7JB 5JLJA 4KSCA 2A2ZA 2GF0A 3K0AA 4BGDA 5LMNW 5J5CA 2OAQ1 3AQ4A 4Q1EA 4ZCIA 2GETA 2UUBQ 2O8FA 1AIPA 4PC3A 3KF6B 3FMPB 3KKOA 3I73A 4JVSB 3OEEA 2QE7D 1XNJA 4AYTA 3GTOH 3T56B 1KI9A 4NCNA 5BYJA 4NYIR 3M7NA 3OW2A 3GTMH 5GJWC 1G21E 2D4HA 1DPFA 4BBRH 2QSZA 4BECA 1VQAA 3F1ZA 1ANKA 3A1UA 3TGPA 1VQOA 2NVXH 1II8B 3GEEA 2ZJQA 2G0NA 3EZ6A 1TWCH 4JT2A 4BRWA 2CHQA 1NVXQ 1PFSA 1ZYRC 2VL6A 1CBUA 1Y63A 5KNDA 2BEJA 2EFDB 3OIUA 1SKQA 3E2IA 4LJ7A 2DB3A 1E7ZA 1OIVA 4TT3D 1HNXL 1W4CA 3WDNA 4UNRA 2NVQH 1U9IA 1Z28A 1W36D 1ASYA 4HUQB 2WWWA 1O87A 1UKEA 4A3LH 2WAXA 2D2FA 1KHTA 1XJQA 3IIMA 3CO5A 5BN4A 3TR0A 4Q03A 4A3FH 5EZ6B 5JEEA 1W2HA 2I3BA 5FLXc 4HJ5A 4LF8L 2FFBA 1Y3AA 1P4SA 4MRSA 2NO7A 2YZ2A 1Q46A 3TW8B 4AH6A 3D0FA 4LF4L 4LPSA 1KI8A 3I8XA 5HTKA 1Z0JA 2KCCA 2R6FA 4W5WA 2VQFL 4GOPC 1EFTA 1YR8A 4KN4C 1E2JA 3GJ7A 5DLQC 5HE8A 4D4MA 4GKJQ 3QEOA 2F1JA 3OESA 1XBTA 4HDCA 1Z47A 1N32L 2HHHL 3U4VA 1UPTA 1V5WA 1ZC3A 2JIZA 2PNHA 2WIAA 2ZI7A 1E98A 4QGFA 4A3IG 1ZUNB 2AHOB 1OKKD 1PJRA 1HCZA 2J9RA 4BASA 5D3MA 5EXTA 1RW4A 2ATXA 2R7FA 1X3GA 2QA4A 4BA2I 4LYAA 2X1VA 3RRNA 1HQYE 1HEIA 1UBGA 1XJVA 2O8DA 4IPCA 2O0HA 4HIDA 5M3FH 1FTSA 5JWRA 5GVSA 4A8JB 4TYPA 4R71A 3I4NH 5KSYA 5L3QB 1IXZA 3HU1A 4X64Q 4JI3L 3CM0A 4Z1MA 3A5UA 2A8VA 1VQLA 2RCNA 2FN4A 3TSZA 1FX0B 4JBJA 2V7QA 2WSSD 1NE3A 4OI2A 4BXXG 2BC9A 2QEQA 1XD2A 5CIQA 2D3WA 4V0KA 2NOAA 4LHZA 2XAUA 3TSWA 2O52A 1GL7A 1W3SA 1X1SA 2H16A 4LJ5A 1P6XA 2KBNA 2WPDA 2F1IA 1WOCA 5EXSA 3WMFA 2XOKD 1O7LA 1K8GA 4EPWA 2P6RA 4JI6Q 1J2JA 2GEVA 4W5HA 2ALYB 4WW0A 3HOWG 4OBEA 4LF6Q 2AR7A 5BQ5A 2Q2HA 3MCAA 4PZYA 5L3SB 4LHVA 2KHJA 3MUFA 3STBD 3R9IA 3GFTA 1W44A 4BFUA 4Q7KA 2A30A 5C3EG 2CCZA 1XTKA 1UWVA 4JVMA 4TLEA 2B21A 2IA5A 3IUYA 1OIXA 2ZAMA 5FH9A 4DV1Q 4R98A 1CEEA 4KKTA 2QT1A 2EJFC 5JSZB 3T1HL 2CCJA 1TWGH 3PVSA 2R6GA 3UE1A 1MO6A 1OSNA 1K0RA 3AF1A 3T15A 3THWA 3VNVA 2UXCL 4L5BA 4S35A 3HFZB 4Q66C 4GPTA 1T5LA 3ASYA 4BLOA 2ZRMA 2E2IH 1L7VC 3OAAD 3VU9B 4A3DG 2OHFA 2G1JA 1KAWA 1VTKA 3W5OA 2ZIAA 3CX6A 2PEZA 4YONB 2PZGA 3DVLA 1NJGA 4GS3A 1PLLA 2KBFA 4B71A 4V0NA 1GNQA 3CF6R 1G3RA 4JT4A 4AKEA 3U7HB 4M1KA 4II7A 4LJ6A 4KHZA 1ZP6A 3B9QA 3IIJA 1OIWA 3LDAA 4IXNA 1KI3A 1O78A 4BZQA 5AUPB 2QTFA 1J8MF 1G9XA 1CI3M 4DSNA 3I2ZA 4M4SA 1L0WA 4TZ0A 1WCMH 5IP7G 4LFAL 1AN0A 1NMZA 3TR5A 3HYTA 4FXPA 3HOWH 5EE9A 3X1WA 2HXYA 1GUSA 4DR4L 3SDZA 3LAWA 4MQBA 3AVYA 4FI3C 3KFVA 2O8DB 2DR3A 2YC4C 1E2LA 4D6PA 4YHHL 3J81i 4OQNA 1SN8A 4MNOA 4GOKA 4KYIB 1A5TA 1G17A 4TL9A 1P61B 4ITRC 3X1ZA 4GRAA 1N2CE 3CW2C 1NRJB 3EASA 3OW7A 3PUYA 1I3QH 4TKOB 4B3MQ 2D5DA 1FMJA 1JQJC 1VIAA 1D8TA 1X65A 1QHHB 5L3RA 4ABYA 5GROA 4A2WA 1GJXA 4IFDH 3RVBA 1GM5A 2EQSA 1D2MA 2GESA 2Q2IA 4JOIA 2OBLA 2GHIA 2YJTD 2ASEA 4FCWA 4FMBB 3V4RA 4YCWA 1W5SA 1SVLA 2XEXA 1TWAH 1N5IA 4TYNA 1X54A 4C2UA 3SGIA 3LNNA 1R0ZA 4IFDJ 2A19A 1SULA 3ZVLA 1GWNA 1KSHA 3X1YA 1IAQA 2DUDA 1O3YA 5CDFA 3WHKA 1DAIA 2BDOA 2JA8H 2YOFA 4RZ3A 4BRUA 1KGDA 1XTDA 2F3TA 3DMNA 3KB2A 4PTLA 4AWXA 1MO5A 3BS4A 4KXFB 4PO1A 4TQAA 3D7MA 4JLKA 3I55A 4PAMA 5JZVA 4Q18A 1Q22A 3EN2A 2HJVA 1JXMA 2QTVB 4FCVA 2H7VA 1G16A 4L5TA 1HZAA 3RS5A 5JCZA 3KKNA 1G64A 2A3RA 2ZRAA 5KDLA 3U2QA 1EUJA 2CL6X 1A8VA 3GJ0A 4RKFA 3AKYA 4P74A 1Z6XA 5EUQB 2BM1A 3T1YQ 4B76A 2VIIA 5FTMA 2JA6H 1XXHE 4X62Q 1IOZA 4DR1Q 1G7TA 2NIPA 4AQYQ 2V4ZA 4LJ9A 4PC7A 4JBWA 4DR7L 2WJYA 4TL7A 2WV9A 4M9XA 1I94L 1AA9A 3STBC 2YVUA 3CW2A 4GP6A 4HB2A 4KFSA 4KYUA 2QRNA 4IOMA 5EUMA 1FZQA 3TH5A 3CPFA 4PMWA 2HIVA 1XXHA 3EWSA 1LFDB 3FE2A 1U98A 5EXPA 2G9NA 1HH2P 3L2PA 1YHNA 2AFHE 3V4FA 4A6PA 3AQQA 3P4XA 3UMSA 3X2SA 1FW6A 4KLKA 2EWVA 3HOUG 1DARA 5CYPA 4ZKDA 1COWD 1DAFA 3SC3A 1XRJA 3VX3A 1PH8A 5GJCA 3L82B 1VQ6A 1JI0A 2E75C 1ZKOA 521PA 4HIOA 5EAYA 3BFVA 4HSEA 1ZYUA 1SRUA 2FF7A 1S9DA 4PSKA 2NPFA 2JDIA 5HZKA 2QPOA 3ADDA 4GNKA 2GN5A 2NTYC 2ODEA 2C96A 2C35B 2QAGC 1CR1A 1EX6A 1OHHD 1T0JB 4M53A 3J81k 3E70C 1GUTA 3U6BA 4MRPA 3EAQA 4URZR 4IOJA 2DN8A 3QPUA 1IM2A 1Q7YC 1NMGA 2V4DA 2Q0HA 2J45A 5KDOA 2ZM6L 4DV4L 1UEJA 3NVAA 4FIDA 5AJVB 3TRFA 4OX9L 4E07A 5TB5A 5AJYA 1OE0A 2WPDD 3RYTC 5FPYA 4UP8A 2XOKA 5J4LA 4A3CG 1G291 1YU9A 2KE5A 1SFOH 1GUNA 1MKHA 1LTQA 4HUQA 1KY3A 4G3XA 2MSCB 4QG7A 2JLUA 3C5HA 1N6PA 2D7DA 3QXSA 4G5QA 1X56A 4B3XA 2BE5D 1A62A 1FFHA 4XIGS 3AEZA 4FDBA 1BMFD 1SROA 1EFUA 4C7OA 2BKEA 1E2ZA 3K9LA 4DV0L 4A9AA 3MJHA 1Y8PB 1VF7A 2D2CC 1ZU5A 5FUYA 4A8JC 3JAMi 4JI0L 4K46A 4ACBA 1AM4D 4X65Q 1L8QA 2CE2X 3GLHB 3GP8A 3S15H 2QMUA 3PUWA 3DOFA 5CLQA 2XXAB 3K70B 3D31A 2VLIA 1TU2B 1NSFA 3K0EA 4RSGA 3S16H 2ZJYA 4E03A 2B7BA 5J4YA 4O2DA 2YHSA 5EJEA 5EP4A 3FTQA 1B70B 3A37A 3EZ7A 1A0IA 1TUEA 3AEVA 1ZW6A 1NJFA 2H8KA 4DUZQ 3CF5A 3OEHA 4M1WA 3SBDA 5E95A 4DDUA 5M3MH 4JYCA 2WJJA 3A1SA 4PAOA 3UMFA 2Q3FA 3TAHA 3G82C 5LBIA 3BG3A 3UDFA 1YZTA 1KL9A 1LF0A 5JI2E 4D26A 2RAPA 2X2FA 5FPKA 2DWPA 1KK3A 1EQRA 4Q7MB 3SBEA 1E9DA 5DNYB 2K4KA 2MFIA 1KZGB 1QG2A 2YV5A 3LD9A 2ZR0A 4A3IH 4BFWA 1YZKA 4DDVA 5ELNA 1U2RA 3P26A 3KQHA 4JYAL 4JI0Q 4PHGA 3QXCA 2YYZA 1QHNA 3VMFA 4B35A 3DHWC 5IYDH 3RNUA 2OCAA 5HCNA 4LF5L 3TNFA 1JJCB 2ZAOA 1RFLA 1W48A 1SVWA 4GT1A 1E32A 4DK6C 2N8NA 4NE2A 1GL9B 4JOIC 4UNSA 4R7ZA 4JI7L 5CM9C 1T6NA 4A3JG 1PH2A 5FBWB 3RS0A 4I4LA 1FR3A 2LMCB 4X8MA 5B2ZA 4D0LB 3DXJC 4LWCA 4NMMA 2CNWA 3SNHA 2Q3HA 5E4FA 5TV2A 4L8JA 3I4LA 2ID0A 1GAJA 1HR0W 3QKSA 4TQ9A 4ZKEA 1E9RA 1E2NA 5GAGC 2ZTDA 1IBML 3KLWA 4BY7H 1TF5A 2HIXA 1Q82C 4DB4A 5JECA 1WA5A 1KK0A 2VF8A 2WWFA 1CJMA 3G0HA 1JR3D 1AE3A 2B8WA 2HCJB 4LFCQ 3BOSA 3EWAA 3N2EA 4JZKA 4NYMQ 4BEJA 3GLIA 1RRCA 1G7SA 1PV4A 1EFRD 2GDJA 2OXCA 3WYAA 4UNQA 3DLLA 4RCZA 2CQOA 5C44H 4QHTA 3CB4A 4AKHA 2OWOA 2ATVA 1GOTA 4YMUA 5C4MA 2PCJA 2C8VA 1K8RA 1NLZA 3M4PA 2EVBA 3MFYA 1EQQA 2E5LL 4JI8Q 1OTCA 3Q5DA 4OK3A 3WHLA 4UKDA 4DSUA 5EP1A 4Z1MD 1YQTA 4JI5Q 4B3TQ 2R92G 1R8QA 2J0SA 1VKJA 4Y0VA 3ZD7A 2NO9A 3ETLA 4TMZA 4ASUD 3PGZA 4DLTA 4JG2A 3HGBA 3AM1A 2ZYUX 3NE5B 5FUWA 3S1NH 5GVRA 2PLFA 4C0QC 4DR7Q 3W34A 1GITA 2ZXUA 1OH6A 4C9BA 2HT1A 4K0KL 3IFTA 2GCOB 4CGZA 2Z6KC 1YIJA 4KFTA 2VY3A 2GWHA 2R92H 4I1UA 4Z8YA 3T1YL 2J59A 5CB6A 2QNRA 3U44B 1MT0A 1IHUA 4GOXA 5P21A 4PZLA 1JJGA 1VCOA 4ESHA 3EG5A 3CCLA 1U5KA 2JK8A 3OTOQ 2IXFA 2ZS8A 3K09C 4YMSA 3RANA 3W5JA 1TQ2A 2PT5A 3CWZA 3VKHA 1Z7TA 2L0XA 1ODFA 3U3KA 1VQPA 1YJWA 2IHBA 1IYJB 2WVJA 3WP1B 2VYFA 2MMCA 3KQLA 1XEWX 2JJ2A 3I61A 1KZ7B 3CR7A 1XZPA 3RSOA 2FJUA 4GLAC 5GQOA 3K0FA 1ZINA 2E9SA 1FNNA 4DCUA 4WBSA 4WJ4A 2UUCQ 4JLMA 3U60B 1E22A 1N6HA 5AUQA 3IPXA 2FG5A 5ELOA 1EFHA 2IYLD 2VHQA 4P32A 4LF7Q 2QGNA 3SS8A 1II0A 1KHIA 2ZU0C 4POAA 4AYWA 1W36C 4M9ZA 4KU4A 4GZLA 2JE6I 3AVQA 2B8GA 2HUPA 1WXQA 3QPWA 4M0LA 1P3JA 4A3GG 1TU4A 3DM9B 1OXXK 3O47A 4IXMA 2VQEL 4JLPA 1CKMA 4BEBA 2XGJA 4BZPA 2UXDL 2KCMA 3IPYA 2EFGA 1HT1E 4QBIA 4B3ML 3O8BA 1JT8A 3PJRA 1H8HA 1NY5A 2ZI5A 1LW7A 4JLJA 4FCTA 1RRGA 1JB7A 4UY8C 1R10A 2DNCA 1VG8A 3ZD6A 1MR3F 1FP6A 2R65A 3S1AA 3HKZE 3A1WA 3H0GG 3LWUA 4IO9A 1VCIA 1NF3A 4M1SA 1SE8A 2MMGA 3LLMA 2X19A 4AIIA 2VQEQ 2NVTH 2HDNB 4X8LA 3WP0A 4DXAA 2QN6A 1H9SA 3FKIG 1EOVA 4Q1DA 1QRAA 4LBVA 1FQKA 1E9FA 3HPRA 4G5SA 4C3ZA 4DV3Q 2CVFA 1NLFA 3VFDA 1IYVA 4ERNA 3KKPA 3BZKA 4NKRA 3H0GH 3NH6A 4FMDB 1KO4A 3FWYA 4NU0A 4A4IA 4OO1I 3K7AH 1GNPA 4BLTA 1VHLA 2Q6TA 1HZCA 3T1HQ 2F52A 1BOFA 2HLDD 2F7SA 3B1ZA 3BK7A 4B75A 1T3HA 2VHTA 3AVXA 2FGKA 3KDFB 5M5YH 4W5JA 1UKYA 3RS2A 2OBMA 2HF9A 3SR0A 2CE7A 2QGQA 1H8ED 1KI6A 1HUQA 1UDWA 2PJZA 1FJGL 3PCRB 3QF4A 1TWHH 3OTOL 3I3SR 2L15A 1AGPA 3GTGH 2DFNA 2IHFA 1ZCAA 4DV5Q 1NVWQ 3Q3JB 4IOKA 2UUAL 5LMNQ 2WOOA 4B6FA 3U9SA 3M0EA 4WOPA 4PHFA 4NBSA 1F2TA 3L0SA 1H9RA 4ZDIA 1BBUA 2QY9A 5G3ZA 5JS8A 4DLYA 1KSGA 3K0FB 1CF4A 2PQAA 4X64L 1G3QA 4US2R 4NPHA 1L2FA 4D0NA 1Z8FA 3AF2A 3BRWD 1ZCBA 3OIWA 1H95A 2OCYC 2PT7A 3ADCA 1G1MA 1CKEA 1LF5A 1G5RA 2FDCA 3EX7C 4QJ5A 2XZPA 2GK6A 4V0ME 3UWKA 4GL2A 1EIFA 4KN7C 3HOXG 1Z0AA 4OONA 2F9MA 2FEMA 4TQUS 2WHXA 4IPGA 5C0XG 1Q3HA 3K9GA 1XEXA 3V00A 3M4YA 1SGWA 2J0UA 3H1TA 4LGMA 3UMRA 3SZRA 3WBKA 3QG1A 3AP3A 5FR2A 3B78A 1DGSA 1JXOA 1E1QD 1MO4A 1Z0DA 2C2HA 4KFRA 5AWFC 1RPZA 3R7WA 3KF8B 4A3BG 2RHSB 4DPGA 1HY3A 1COWA 5F98A 1IXSB 4XTCS 4MKIA 3U5ZB 4YCUA 3J80c 1FL9A 1N0VC 5G3YA 3VR3A 1J70A 4Q1FA 3ZZUA 4PZ7A 1PH1A 1PVOA 2VRWA 4Q1CA 4JYBA 1E1OA 4PC2A 3PUZA 4R4OA 1FVIA 4DSOA 1U8AA 1Z5ZA 3QI2A 4OWWB 4H1UA 1DO0A 5GJBA 2BBOA 2LWIA 2XB4A 1VQFA 2MO0A 5KNCA 2QPTA 3L0OA 121PA 2BCJQ 3NEJA 2XSZA 3TBKA 3R9WA 3NC1C 3THYB 4V0OA 2V55B 3GEIA 3G5UA 3S1RH 1E2QA 4XVRA 1T9HA 2OQKA 2JGNA 1HA3A 2IX0A 2CCKA 2VSXA 3GJ3A 4X66Q 1T5EA 4QFMA 4LF8Q 4D25A 3PO2G 2AWOA 3W1GA 1TF7A 3QEJA 2K5HA 3AH8A 4YDSA 5EE1A 3IEVA 1II8A 4ESVA 1ZBDA 4LUOA 1WJJA 1IBLL 2AX4A 4A15A 3PCOB 3CKLA 4QY7A 2RF4A 1LACA 4DV5L 4KV9A 3ZDQA 2UXBQ 1JEEA 3GO5A 4B3CA 2K5VA 2ZE7A 1T8TA 2IY5B 4HAUA 4BBRG 3RN2A 5G40A 1T91A 2VW9A 3AFPA 1XF9A 4F93B 4NP6A 3OE7A 4LJ4A 4H9GA 2AXNA 3OFNA 4YC7A 2DWQA 3QG5A 3AB9A 2IYYA 2UUBL 3H84A 3S17H 3M4OH 1N6OA 4B34A 4A3JH 1S1MA 4DUGA 4LUZA 2JLQA 3ONWA 2PQAB 1CUKA 1VF5C 3KXLA 1S4QA 4G7OC 3SN6A 4P71A 4RCNA 3LVRE 3UPUA 1P2VA 3I4OA 1GRNA 2IYRA 2OM2A 3AF4A 4QC2A 1PH3A 4A3BH 2KENA 4DUZL 1DTSA 3A8JE 2IXEA 4LJAA 4Q4AA 4CW7A 3RWMB 2ZJAA 5JJKA 3KKQA 3W90A 1NBMA 4NXNL 1L1OA 2JA5H 2GA8A 1GVNB 2VBCA 4NYJQ 4D2IA 4R4TA 4S2EA 5FJ8G 2VHJA 1WE2A 5DIFA 5B57C 5BWMA 3NKVA 4B6EA 1LYLA 4RFSB 3K9HA 4FMCF 1H9MA 2R7ZG 4IFDI 1IY1A 2GJAA 4ZO4A 5CITA 4ACAA 1T8UA 4OK5A 1TADA 2CJWA 3CMAA 2YC2C 1AKEA 3B5JA 4P72A 1DAHA 3HR8A 3PITA 1YNXA 4M1OA 2J41A 4YY3Q 2ZUDA 2KA7A 3NBXX 1TPZA 5EXXA 1W46A 2ZSDA 4ZCLA 3RS7A 4F4IA 4DLSA 2PNRC 2REOA 1CKOA 1RL2A 3K0CC 4A0GA 5SZIA 1G6PA 1B0UA 1KI4A 3LBNA 5FUXA 5G53C 3WMEA 5JHGB 1KDPA 4B3FX 5LD2C 3RHFA 1P5ZB 1FL0A 4TN1A 1NL3A 1IZ6A 4EQ5A 2QMHA 5D3MB 2K75A 5C0XJ 5JJLA 5JEAH 1G41A 2GK7A 4Q02A 3VR1A 4OHYA 1YZ6A 4YMVA 4UXJA 1XTRA 5C46F 3SQWA 1W2BA 1E2GA 3IIKA 3PG5A 1QVAA 1OH7A 1GL6A 1E3MA 4PR0A 4B3DA 1QF9A 4LNQA 2JLXA 1NNEA 3KB1A 3A6PC 4HAWA 3DKVA 1XNRL 3TS2A 4DV1L 2D74A 1PHJA 3F3YA 5L3QA 3ZVNA 5ELXA 2IS1A 421PA 1TKWB 4JI6L 4OX9Q 1E1TA 3GDEA 4QL5A 4IJMA 3UK6A 3H0KA 3EC2A 3RR5A 2ZRLA 5LDDC 3GD7A 2X77A 3FHCB 4M2LA 3ZIAD 1AGRA 1YZQA 3IQWA 4LRWA 3BH0A 4BFTA 1DAMA 5KSOA 2VA8A 5IK2A 5JSZA 4NPSA 2IEYA 2XGTA 3VR4A 4L5QA 1Q90A 3U58A 1AZTA 1RKBA 1U90A 2JJ8A 1X8LA 2FXQA 1YE8A 1E24A 3ER0A 4PQFA 3S1AB 2BEKA 5D3QA 4CRWB 2N3SA 2ZSBA 5FI1B 1HNWQ 1P73A 5L3SA 1KKMA 3BE4A 5AJWA 2L5TA 1E2MA 3A4NA 4X8OA 2HCBA 1KTVA 3SQXA 3IQXA 2VP6A 2D7CA 4Q4AB 4XVQA 2GTPA 2AK3A 2CLDX 3LH5A 3HU2A 5AR1A 1VQIA 5IF9A 3KYHC 1B9MA 3KF6A 1T3SA 4EJSC 4ZI2A 5G41A 1ZM7A 4BXXH 1FOEB 4TLAA 3R9XA 2J46A 4Y0AA 1MIUA 1VQDA 1PUJA 2W6IA 3QNUA 4J0QA 1CFMA 1BYUA 4M1TA 4UXHA 2EYUA 5TARA 3WXMA 2ZTEA 3DKPA 3WY9A 4HLUC 3JZMA 3QXJA 3TAUA 2FZLA 2YTYA 5CB8A 2ODBA 2ZSEA 4MGKR 2BM0A 4QBGB 2Z83A 4RZXA 2VP0A 2XNDA 2X8AA 2GF9A 4JVLA 2K7VA 3J81j 1EESA 1I2MA 4OI4A 4P31A 1L2TA 3FDIA 3HYRA 4L15A 2NZOA 4A3MG 1NBMD 1H9SB 2X2EA 5L3VA 1E94E 2CNWD 3ADBA 2QP9X 4MH0R 2YOHA 2XITA 3QF4B 4LUVA 2OCBA 4C0KA 3LVQE 2AXPA 4OGQC 1UE6A 3JC66 1I4TD 3FPPA 2HV8A 3BBPA 1S0UA 1HNWL 1ZM2A 1YR9A 3MXUA
chains in the Genus database with same CATH superfamily
1M2NA 2PANA 4BQRA 2J07A 3CZMA 4LCBA 4M7OA 2AXQA 2YMPA 2XWSA 4RJJA 1ZUD1 3GH1A 3GUHA 2GZ2A 1R2QA 4TV8A 5EUBA 2SDFA 2WB1B 3K16A 2IUUA 3WHPA 2Q21A 4EI2A 1BDBA 1TAHA 2WKRA 4G5RA 4M99A 3V1LA 2BM9A 3HOZB 2HSWA 4AZTA 5F7XA 3LP6A 4FWBA 4JBMA 1U80A 2ZPTX 3NDPA 4B7AA 5TMEA 1LX6A 1N6KA 3Q40A 1SOUA 1D1SA 1W9HA 1YRYE 4TS1A 5C44G 3U9LA 1GRQA 1F6BA 1SEVA 2FXIA 4IRUB 3W04A 4C4PA 1X9NA 4BNNA 2DERA 1OFUX 3A4TA 4C14A 1JAXA 3L07A 5DW3A 3UC9A 1N7IA 2EBWA 4JP1A 4K3UA 1Z45A 2CLCX 1DC3A 2BHSA 3LYLA 3K1TA 3MA0A 4K9NA 5E1DA 3F6CA 4A1FA 4CMKA 4D9CA 3F2DA 3P0FA 3WK8A 1EK0A 4YCVA 1NC3A 3C45A 5CLJA 2BDNA 3I01M 4GZYC 3IHWA 4QUIA 2E48A 2LXKA 2AE2A 1U8TA 1FDOA 1RBMA 2YJ5A 3LFHA 2DF8A 1E3EA 2X1HA 2M6SA 1R7RA 1CU1A 2EQ5A 2E7ZA 4Z9AA 4FHFA 5LPNA 1AS0A 1EVKA 1Q50A 3QUAA 2O7VA 2YJNA 4M1MA 4RV5A 5ALWA 5GY7A 3HM9A 1U4NA 2GPTA 4OJTA 2CFRA 2CWPA 1A4UA 3NG1A 5DWQA 4AP6A 1ZU4A 4JGGA 2WP0A 2JI7A 2HF7A 4YVFA 4YWJA 4YY3L 3AHHA 2W11A 3ROGA 4DYDA 3W5BA 4RCYA 1YITA 3DOJA 1WB9A 4QKQA 2WV6D 4B81A 3TMKA 4UP9A 3ONVA 1V1QA 2L1BA 3SK5A 3RSQA 2AWNA 2Z8LA 2QP4A 5SY9A 4Q16A 5FOXA 3SYTA 4NG5A 4BLSA 2ZIWB 4QLOA 1ET6A 4Y2TA 4ZCQA 1QWSA 1T3GA 2LE0A 4Q1VA 3VOAA 3JRWA 2QTTA 4GLJA 5DM60 4BXOA 1QP4A 3DGFC 4P22A 3T9AA 4H4CA 4IH1A 1QG6A 4IIBA 1H2AS 4XA8A 5DN6D 3HEJA 2KSQA 3BJZA 1DTWB 2XNHA 3C4JA 4M49A 1KE2A 1PNOA 2QM8A 1ZL2A 3A0RB 4O63O 3Q2OA 4UXIA 3NOXA 4K9SA 1XZQA 1H6DA 3A06A 3E5HA 3IDAA 4WLNA 2H17A 1UP4A 1F48A 1XCLA 3AP1A 2QGZA 4DV6L 1J23A 2V5AA 5PGMA 1FNMA 1K6IA 1B0AA 1RYFA 3PCXA 1N2ZA 4KK4A 4G4KA 4PZ8A 1U5CA 2AA3A 2Y6UA 2PPBC 4O25A 4U2BA 5ULLA 3EIUA 5U4XA 3MJRA 4DIMA 4H02A 4E13A 4ZXPA 3SP1A 5BMVF 4W5TA 1OFIA 2NTNA 1HFWA 2DUJA 1N92A 3G5AA 2WP8J 4YH1A 2ZSJA 3ZGNA 2QYOA 3L79A 1PT6A 1OFGA 5KBYA 5LNK6 2WIJA 4XB2A 5KYWA 1B16A 5C8DA 4B3HA 1NVVQ 1ZIPA 2AUNA 3CJQA 4MUKA 1QZ3A 1RLMA 4H18A 3VNUA 1BROA 4GLXA 3FLBA 5BMVB 4L5CA 2RKSA 2YN2A 1UM8A 4K81B 1N9GB 4HVCA 2AVNA 3NTKA 2C29D 4EUKA 1TYEB 1YBHA 4GOPB 3TVTA 3F5MA 4RK4A 2IUEA 3HK2A 2RKBA 1JLLA 4GU5A 5CA1A 3X1JA 7REQA 5EHZA 3G0IA 5DEOA 1DIRA 4WUVA 3MBIA 4I6EA 4R6WA 1V43A 4KR6A 2R93G 3OD1A 1DQNA 1G5PA 2R1TB 1Z5GA 4J0CA 1ORWA 4IX1A 4M0EA 4W8OA 1R4QB 2A6EC 1VJ5A 3WDLA 4EMSA 1K7CA 3N28A 4UHKA 4CM7A 4GR9A 3D81A 2QX8A 4GOMD 1I7QB 1M74A 3LYHA 5TRTA 2A5GA 3EODA 4JLBA 2WF8A 1BQEA 3EZNA 4LE0A 2ZSAA 3IT0A 4K03A 4N54A 1AC5A 1MRZA 2IGTA 3I2HA 2C8LA 4K0RA 4WN9A 1T3TA 2UYYA 3BXEA 1UDRA 1YOBA 2FFQA 1ZQ9A 1K86A 3UJ6A 2P2GA 2CJWB 3VVLA 3D3QA 3QU7A 3U7QA 1DEHA 3WLIA 3PSIA 5BN5A 4DT1B 3ZV7A 2X40A 4KW7A 3T3EA 1DCTA 2JYOA 3DEPA 2PX0A 4I1VA 2O3TA 1FFBA 3G2OA 3NKLA 3Q15C 4RL4A 1ZJ5A 3N76A 2DECA 1K6JA 4L4XA 4YB8A 3ZHUA 3GGJA 1U5BB 2YBDA 3IJRA 5A35A 1E9SA 4KHPL 4IUDS 4EI8A 3EZFA 3RAEC 1DEOA 1AUOA 4F12A 3M4QA 2F0MA 3LUDA 5K8UA 5LN1A 1SJHD 1DTEA 1E6MA 2HXGA 2OFWA 4DA2A 5IP9H 1YJCA 2HBZA 2YXDA 3LUCA 3NYRA 3P2IA 4WOCA 5EJAA 1Z0IA 4FD2A 5CBPB 3PKIA 3HVRA 1O4WA 4ETWA 3I2KA 4F6CA 1IMJA 2I0FA 3A6FA 1GGKA 4O4LF 1KRSA 1GNRA 1BE0A 3KHKA 4OOFA 1YB1A 1A9XA 3DL7A 1H2FA 2VB3X 3K20A 3EZ2A 3A0JA 1WMDA 1E2EA 3MAAC 3A7AB 4BDSA 9ABPA 4GLOA 5IT4A 3ETHA 2ZBUA 3DC2A 4QQKA 4IQZA 2OVFA 5TX7A 2C5HA 3JTMA 5CB4B 2C0PA 2IHYA 1VSQA 1QIKA 4IJQA 4EYKA 3U61B 2PUVA 1H4QA 1MD9A 1I5RA 1HDZA 1F1BA 3CNLA 1KDAA 1V8DA 3NT5A 3PBKA 3OJFA 1VQMA 2REQB 4KVGA 5A4FS 1NYTA 1AA6A 3GROA 2BMDA 3UWPA 1U65A 2ZRDA 4KACA 3SX4A 3B6JA 3ZQUA 5E9JA 1HR0L 3C7CB 4OGFA 1DDOA 4HLCA 1CR0A 4RD3A 5HZMA 5EGNA 1IU9A 4NK4A 4MMXB 4TWIA 5JTTA 4G0YA 1A8IA 3IEUA 1JHVA 2JXMB 2L17A 4R3UC 1I4HA 1N9KA 1ZOSA 2FR8A 2GBIA 3GYBA 4GGPA 1EVLA 4LE2A 4P8RA 4DMLA 1L0YB 2YVLA 3BSSA 3I1YA 5FBVB 5KU7A 1GEGA 3SEAA 1WTVA 1UZLA 5JPNC 1E5DA 1H6CA 1UK8A 2X0RA 2Z5LA 4HP8A 5AXBA 3TSYA 4BE7B 4DV0Q 5KREA 1GTSA 1T0UA 4MQ4A 2F0LA 4GKKL 3W1EA 1VGQA 2G25A 2CHFA 4I5DA 5K8CA 1XNQB 4DJTA 1DKUA 5FEUA 2V7BA 4XDXA 5J3BA 3JYNA 4TLLB 4EGCB 4UU0A 1EJ2A 3I62A 2CUTA 4NMXB 2EJGC 1AZQA 2VSFA 1MLDA 3N7AA 3CN9A 3EW9A 5LMZA 2GM4A 3ASZA 4PLHA 2GM3A 3R4CA 3NQTA 4JKYA 1N5JA 3B36A 3RC1A 1RRPA 4U7DA 2YL2A 3UG7A 3W2GA 4ZLTF 1R9TH 1ELOA 3M9WA 5FWNA 2P40A 4MB2A 1KY2A 3CPJB 3GFPA 4MUAA 4V39A 1B2TA 1F2UB 3LNTA 4CJ2C 1U5BA 2GN2A 3GFOA 3DS8A 5E2BA 5I9MA 3L41A 3MD9A 3W1WA 1M75A 1EXWA 3KJNA 3OE1A 4NBNA 5DTJA 3G1TA 3NTQA 4B74A 4B5KA 2ZJRA 2C7RA 2C04A 3O1HB 4UFNA 4ZRDA 3V1UA 4PVCA 4B2LA 1KI1A 4FJ0A 3UHJA 3OUTA 3EW7A 1FD7D 1U0HC 2FR0A 2GAOA 3HNRA 4RA6A 4P4SA 4YRJA 1E96A 1EFAA 1V1PA 2FGJA 1C9KA 1QO7A 1E2WA 2ZT6A 2F4NA 2RGYA 2O0JA 1ZRMA 5FNVA 3ROQA 4WLVA 1A4XA 3ZZNA 4RQTA 3CCSA 5GOZA 4HG2A 2VC2B 4L16A 2X7HA 2SOBA 3EQ7A 3SM9A 4JQZA 4EQOA 1PZID 2Q8NA 2JB9A 2P9JA 1T5DX 2OAP1 5FLEX 1ULSA 3PIRA 2W7TA 3GJQA 1B4DA 2O5RA 3MIIA 1QRRA 4FYVA 3TOCA 3CQZB 1SYFA 1GNSA 2R8YA 1IEVA 2V45A 5FRDA 5BNZA 2I4TA 1W581 5KPJA 2E5LB 3W4JA 1WPRA 2VDKB 4BV8A 2QTGA 2IW3A 1M7BA 4X62L 2C2XA 3BPSA 2XUQA 3EFBA 3NBFA 3RRJA 3W9YA 4PBTA 4D8YA 2W2VA 2B5WA 4YASA 3IBTA 4ASUA 3PTAA 1MHWC 2GPNA 2YY7A 4MS1B 3F8TA 3Q7QA 1EIGA 1QHYA 3OMXA 2PLNA 3C7TA 1K89A 5I9SA 4DA0A 4K0KB 2P91A 4GEKA 2BHTA 3LWDA 4Q0FA 1UZUA 1ZEQX 2HA4A 2OY0A 3PE4A 2J3IA 2W98A 4QQ8A 1YGYA 1MB0A 3BH6A 4WT7A 1LBTA 2E4XA 1NTRA 1E1MA 1L5HA 2YH2A 4N9WA 2CXXA 4LYFA 5IYZF 5TY0A 4C05A 3CC7A 4PNZA 4Y2QA 3KALA 3P20A 4DK3C 2R93H 1ESFA 1UBHS 1YIDA 3PWZA 1LVHA 4UAVA 4DCNA 4NJOA 5A5GA 2Q6OA 4GX0A 3ZNQA 5LZ5A 4BWVA 2A78A 4BYGA 2G63A 3A8KE 2PRZA 3K8OE 1K5PA 2WU4A 3H3VH 1U3WA 2Y9PB 3H8WA 1QK4A 2A35A 2A5JA 2O0LA 3GP3A 1T2EA 3KOZA 3P0IA 4L57A 1D3AA 4C87A 3VA7A 1SBZA 4XWAA 4F0JA 3S8MA 1CS4C 2ISCA 3CV3A 1ZDMA 1EWRA 4DGZA 3H91A 2KCNA 1M8PA 1PT8A 4M6WA 3WG9A 4D96A 3V33A 1GDDA 1CRLA 4YDRA 5JOBA 3V48A 3W2DA 3MXTA 2WQZA 1TVXA 3ELDA 2YIDA 2GFIA 3KBGA 3MCZA 3NHZA 3OMWA 1XX8A 3HN6A 3QYAA 4WADA 5KNBA 1C0KA 1VA5A 3EIVA 1SVOA 1Z5UA 2P3SA 3K1JA 3NFRA 2QTCA 2G5CA 3BB1A 3QBDA 4V3BA 5JH7A 2C4MA 1GA6A 3WLEA 1CPYA 1Q57A 4ZVOA 2JK0A 2VUTA 2I1VB 4D80A 4J2HA 3A9WA 1ONSA 2ONKA 1V11B 4XEHA 1KNQA 4G2TA 3ZGZA 2VHCA 3QR8A 1SAYA 4U5QA 3NVDA 2VJBA 1NXSA 4XUCA 1XCBA 2EZVA 1VQ1A 2AB0A 2Z43A 2O2XA 3I83A 3AOGA 3OZBA 4I99A 2WG2A 5GMOA 2BGGA 2O3SA 3HUEA 1YL7A 2JEYA 3AY0A 3NNSA 2HEGA 1HYGA 3P5BA 4INPA 5CLLA 2FZKA 3SC4A 1H2ZA 4PBSA 4W7HA 4GI5A 4BO5A 2ZRIA 2F90A 1AKMA 3CPEA 3E8XA 2HRDA 4FN4A 2AOTB 4XARA 1H5QA 3VVBA 3LK6A 1HNWB 1GG5A 3VYSB 4QAJA 1J39A 1X32A 2I3GA 4G8JA 4BMNA 1BCSB 3KYCB 2FSFA 3CH4B 4ZDKA 1IJEA 4S0ZA 5IYCG 1KS9A 2H8GA 3I32A 1SBCA 4GKAA 4DCGA 4JCVE 3Q2IA 2WLSA 4NPAA 4Z4GA 3QPDA 3KSBC 5AKLA 1B6SA 3GZNA 4H7EA 3IT2A 3VYTA 1J0CA 1WF6A 3KTFA 1UZAA 1KBOA 3BTSA 4BX8A 1OXSC 1LSUA 2H1FA 1ZGBA 3WGVA 3SHFA 3JWGA 3EVTA 1L8LA 2Q6VA 3RG2A 3C3WA 1ZICA 3QLTA 4XX0B 3STHA 3PQFA 2C2KA 4JXKA 4FNGA 3KWFA 3HUFA 4MO2A 1XWFA 4RL6A 1IMOA 1WTOA 4KN9S 4WZAE 4YR7A 1M2HA 3GJSA 4P35A 4NCAA 3DBVO 2AZXA 1V9PA 5I3ZA 3N7UA 4KKXB 3HB7A 1A5ZA 3HADA 4KN6A 4KY7A 5COYA 1A9RA 3DAOA 5GV8A 3HU5A 3EZLA 2W6OA 1Q0TA 3JWJA 1ESZA 2I03A 2ZU6A 3QWBA 4MGZR 4P80A 1P77A 2Y0EA 4MAFA 1RBQA 2HWUA 4AN4A 1JZTA 3KS9A 1XN4A 3QFTA 4HN7A 5DISB 5M9OA 4IJ5A 3M7GA 4UDOA 1JEYA 3BERA 4ZVKA 2XF8A 5D7NA 2F3SA 4QXAA 2G9ZA 1IHOA 3N53A 1B1ZA 4PG3A 4JGIA 4ZWNA 4JB2A 4KMUC 2FFJA 1DZ3A 1QE3A 4WY2A 4M3NA 4X85A 2J5QA 1V8QA 2Q8IB 3ZY4A 4O4HA 5THKA 1WV1A 1FNBA 4HH3C 4PLGA 3G0DA 3QYPA 5AXDA 5H8WA 3RFCA 4CDEC 1F4LA 2JRCA 2OGTA 1JJ2A 1TIBA 3RUPA 3CX8A 3RFVA 1EEFD 4WGGA 4Y2UA 3V3TA 1YR6A 1DQSA 2W83A 4B7UA 3TP8A 1AGYA 2QG9A 3HRIA 5H81A 1OJLA 4DLXA 2G77B 1XA3A 5JLAA 4AJLA 1X94A 1YVUA 3GFBA 3ZGLA 1G8GA 4M9RA 4BFSA 4CGYA 5AUNB 3HA7A 1XMOQ 4LEIA 1WCIB 5I45A 5IKPA 3HY3A 2HREA 5REQB 3KBBA 3CRLC 5K6TA 1EMDA 3UF0A 1FFGA 1GTZA 4DR1L 3BWDD 4NFHA 5LZ8A 1CSPA 2PMWB 2XNDD 3T0FA 4JI3Q 4IIJF 4WCFC 3GA7A 4D1YA 1EGVB 1BMFA 1EY4A 3AJAA 2BFAA 3ZE9A 2HRRA 5HKKD 3H2SA 1NAHA 1HX7A 4KQJA 4XZ3A 5I7AA 5IANA 4P2CB 1FCJA 1KVTA 1QH1A 3MSCA 1OT5A 4OO1H 4AJ2A 1MOSA 4Q3KA 4C04A 1SFRA 2AEEA 1KC8C 2B99A 2JGIA 1E1LA 2AQ8A 2DFKB 3GLFB 3K7EA 3TQCA 3D4IA 3GH3A 4IIVA 1BWRA 3D6AA 4IRMA 4J0DA 4ZYUA 2AN5A 2GKOA 1AMOA 3R3XA 2FYTA 3B89A 4N5HX 1VC2A 3VYVA 2ENUA 2Y0SG 2QD5A 1G91A 1VYUA 4K5VA 5C4HA 3NT2A 3R20A 3K5WA 4GIBA 2M1ZA 5LWQA 1DG1G 5E7MA 3ZKWB 2IHVA 1LDMA 1CVRA 1S2IA 3FRJA 2QRKA 3P2MA 1OLSA 3DCYA 3L92A 3R5KA 2ECOA 1IHPA 3GRFA 4FQ5A 1DDIA 3WKCA 4PPGA 4C0AC 4CDNA 5KJFA 3UKJA 4LI0A 1YRLA 2AG1A 1RWPA 4B31A 3S15B 3O4FA 1Q5PA 5LL6S 3FKIH 4INAA 3DHNA 1RJTA 1SEBD 1Y1WB 4IO0A 3F9IA 2Q3MA 3JYLA 5HQJA 2XCQA 1V3UA 5IJ0B 5HM8A 4M46A 5JD5A 2V6MA 4G5GA 4D9JA 2IDZA 2JFXA 3L1VA 4BO6A 4N1AA 1W75A 1VQEA 3K31A 2O2EA 2NZJA 1F3OA 1O94A 3B8HA 3NAGA 2K6AA 1THTA 4H0NA 5L3ZA 2OD2A 1Z4JA 4AYBE 5JCXA 4ZREA 4BBSG 2B2UC 2XMPA 1BYIA 4KG7A 1DWOA 3C48A 4NJEB 4QEKA 1CR6A 2R97A 2HQBA 1CK4A 2Q5LA 5AYVA 1ZVQA 4B3SQ 3HACA 1EG7A 1D6SA 1K97A 1QHGA 1O58A 1OKKA 2XGSA 1JJFA 3PC4A 4M1ZA 3LLCA 4LK2A 5B7GA 5J22A 2C8KA 3FPHA 1SOAA 1N9ZA 4GHWA 1JB1A 1TE2A 5JQWA 5CYFA 2WZQA 4A0FA 5TMPA 3O7WA 4CDMA 2YHIB 1RXWA 3WQHA 5EINA 2H4WA 3ND7A 4IF6A 5A4JA 1VFNA 2YUTA 5HRCA 1SUWA 2ZIXA 2WM3A 4WKOA 1ATIA 4RVDA 3E5NA 2WIBA 3LZCA 2JAQA 1L7PA 3CNHA 3JQFC 2AJLI 3WOVA 2HDWA 5BSFA 2BYTA 4TT3A 3C3EA 1ZC4A 3AWDA 2XA2A 3U48A 3AR9A 4CTOA 1NF2A 2F1HA 3Q7IA 3UW3A 4B9EA 3RVRA 3EIHA 2VEDA 2DJIA 4V38A 1CLUA 5ARBA 4A6DA 2XJ9A 4E5SA 1LA2A 3KTAB 1YKGA 4FOPA 3WOHA 3FBTA 4ENSA 2L11A 3F7TA 3WNBA 2PTGA 2EKBA 1SQ6A 2PO7A 5D84A 2DWOA 4UAIA 4P2GA 2B2YC 3C5WP 3O90A 5TNXA 4JKIA 4NDNE 3BJIC 1LKZA 1TMOA 2XVZA 1DG3A 2TSYB 1R5NA 3EISA 2WF9A 4RV9A 1U1FA 3HXLA 3IEPA 3T0IA 5K3EA 5GAEC 1ZN7A 2G3YA 2WZBA 3H9UA 3JWEA 4K2LA 3S2EA 4C4AA 4DV3B 2L9HA 3Q9UA 2KVMA 3RYIB 1JIXA 2A7QA 4W6QA 1CDEA 1W5TA 3STTA 3WO0A 4D0GA 1T1JA 1EK1A 3BTVA 3O8QA 3UM9A 3ZTYA 1E0DA 2Y71A 5IAJA 4BO2A 1P2TA 1SMYC 3P75A 3OHMA 3RAGA 1I4LD 3WOEA 1HDEA 3IDZA 4QUFA 2JFQA 4ISCA 1JIJA 1THGA 2DKNA 5CYOA 2E82A 4DTCA 4EEXA 1NQ5A 3F2BA 3QXXA 4EPXA 3G6EA 3UG6A 2P69A 3WNCA 2DXIA 4KNYA 4YPFA 1IATA 3BS1A 1XDBA 1ZNWA 4BP9A 5GWXA 4ZAWA 2O7RA 2PV0A 1F2LA 3K5MA 2VQDA 3GGOA 4PSVA 2ZI9A 4OHMA 4TM8A 4Y18A 5LIPA 5EZ5A 2C3PA 1FDUA 4JFAA 3QEAZ 1K6MA 4CKXA 4H7PA 3KYDB 1SU8A 4ALLA 1PZGA 3SY8A 2A9PA 4URVR 3JVDA