1OXTA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 95
structure length 352
sequence length 352
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxtA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxtA01
4TYQA 3M7NA 1YITA 1P6XA 3FTQA 4KHPQ 2NO7A 2ZRJA 5JEEA 2BH8A 2J7PA 1MR3F 3H84A 4RKEA 5LMNW 2B7CA 2VLIA 3CM0A 1PFSA 4OHZA 1IBLL 3A1SA 2MO0A 2FGJA 2A5FA 4OI1A 2CXXA 2DWOA 3DHWC 4UXJA 4BFUA 2OILA 3EASA 4Z1MD 5J4VA 4QGGA 1K8OA 1N36L 2XITA 3PEYA 2DGYA 3TS2A 1NN3A 1OHHD 1GKUB 1Z6TA 2ZPTX 5CM8B 4S2EA 1S3SA 4LZZA 2ZT9C 1XNRL 4URXR 5JSZB 2NGRA 2VSOA 3ZZUA 3UDXA 2CHVA 2IUTA 3L0SA 3RSLA 3WYGA 1UWVA 4BEBA 2V4ZA 4DSNA 5B30A 1ZUHA 3G4SA 2J46A 1NVVQ 1WP9A 1IM2A 4UNSA 3RS5A 3OEHA 2J1LA 4FXPA 5AK0A 1YRBA 3J80i 1EFRA 1DAGA 4DR6L 1MJCA 3FFAA 2JA6G 5GJWC 3NBHB 1EK0A 1HQMC 3VNVA 1Z6GA 1ZNXA 1QRAA 3QBTA 4OKSA 3KDFA 4DKXA 4JIMA 1S8FA 2HLDA 3VFDA 1N0UA 4A2PA 4NXNL 3TAUA 1TU2B 2Z6KA 1CR2A 4US1R 1QHYA 1YJNA 4OHVA 2MFIA 4UXHA 4ZKDA 2HF8A 1IAQA 4PX9A 3PITA 4RZ2A 2GXUA 4KU4A 4HJ9A 1YJ9A 2OLJA 4RFSA 5JI3E 1WBDA 1YJ5A 1XTSA 3W5OA 2V3CC 4R4IA 4FINA 1JJ2A 4JI1L 2R8RA 2NO1A 4QBHA 1T0HB 2G0TA 4M22A 4UKDA 5ELXA 1Q3TA 5FFMA 4TQUS 4LF5L 5DI9A 5FUYA 1F2UB 4HIDA 3J80c 1TEXA 3CR8A 3STBC 2YNMA 2ZIAA 3GLFA 3FMPB 1N36Q 1G1MA 4GN3B 4KBGA 4GZMA 1X6OA 1XNRQ 1KKLA 1YNJC 2CW0C 2QT1A 1E9AA 4V0MA 4HLCA 3GLFE 3ZVLA 2DWQA 1PV4A 1W44A 2W2XA 1H9RA 2DR3A 2JDID 1PYBA 3O47A 3IILA 3OE7D 4V0ME 2A69C 5FH9A 1G3MA 2V6IA 3CCUA 1W0JD 3EIEA 4UNQA 5LBIA 3TS0A 4C0SA 4YCWA 1E0JA 1KSHA 2I4IA 2VY3A 4DR6Q 3OEEA 4OWTB 1QZXA 3N5CA 3KDFB 4DK1A 2HV8A 4FCVA 4Q7LA 4X8HA 4RY2A 2IHEA 1OH6A 4DWJA 2BJVA 3B2EA 3HOZG 4IJMA 3LBHA 4Y0VA 1BS1A 4NXNQ 3H15A 4WXPA 5FBWB 1XCPA 3HOWH 3PG5A 4XVRA 3RAPR 1J70A 4DR7L 1E1RA 2I3BA 2B8GA 5H1SE 1FTSA 4RFSB 3THOA 4MRPA 3TVDA 1BDOA 5IYDG 2ZRKA 2RGXA 4KYUA 4JI1Q 1U8ZA 4NMMA 4JBJA 1H95A 2H8KA 3S2DH 3KYHC 3JZAA 4B3GA 1SR3A 3NH9A 4B32A 2WBLC 3HGBA 3DM5A 3GLFB 3CP0A 1Z2CA 2HDNB 4DCUA 2NPIA 3IGFA 4A3KH 5FTKA 2JA8G 4R4QA 1CJMA 1KO1A 2GAAA 4YWMA 1E2QA 4O2LA 3ZZTA 2HJVA 4QBIA 1CTMA 3S16H 1A2KC 1D9ZA 4IOCA 1SVKA 2CL0X 1L4UA 2YHSA 3KXKA 1E9CA 1P73A 1CKOA 3TUIC 2XZLA 2FV8A 3BRWD 2PT7A 4NYMR 4BRUA 3BG3A 4POGA 2JA5H 3C15C 1HE1C 2DFNA 1E0AA 5IYCH 4BFWA 2XNDD 3JAMc 2IK8A 2IYSA 1XP8A 4RD6A 3EQLC 1S96A 3FGNA 1XD8A 4AKEA 2FDCA 2W6JD 3H86A 3S1AA 3ZVMA 3AVWA 3WDNA 1NN5A 1X56A 2ZANA 3I4NG 1E96A 4GSYA 2WB1G 3DMDA 5IP9G 2F6RA 3ND8A 1R7RA 4JLAA 4NCNA 4GOPA 2ZVPX 3UANA 3REGA 2DN8A 2F55A 3K70B 2ZJBA 3VR2A 3IBGA 2KHJA 2VIIA 4FDBA 4DR7Q 1MO3A 1OF1A 2C96A 2WM9B 2NN6G 4YONB 3LBIA 3QPVA 4OI2A 2VTKA 2VYFA 2IS6A 4LF7Q 4LRWA 3WBJA 4PPGA 5TY0A 4BBSH 2CQOA 2KCTA 2IYQA 2OCPA 5B58C 4FMCB 4M8NE 1LFDB 4HAVA 1G6HA 1VIAA 3QXJA 1PLJA 5KDOA 1Y1WH 4YC7A 2J0SA 1XMVA 1T5LA 3PO3H 5G40A 4KYIB 1VQLA 3NEJA 5E7IA 4G5GA 2EXDA 1QVFA 1E2PA 3KX2A 4D2IA 3KJGA 4Q9JA 3CH5A 3SYNA 4HZUA 5EUQB 2ATVA 1N6PA 1W46A 2X2EA 4Z8YA 4TVAB 3ADCA 2VHCA 3IEVA 3CB4A 5JS7A 4ABYA 1RIPA 4A93G 4V0NA 3S1AB 3EC1A 5FI1B 3OTOL 2XJ4A 4AD8A 5GAGC 1SVWA 3GJ5A 3IBYA 3UPUA 1UEBA 1JEEA 5CYOA 2QEQA 5CB6A 4BA1I 4P72A 2A8VA 4GOPB 1NVUQ 2PBRA 1PH9A 1YBYA 2WPDD 4BZXA 3AEZA 5L3QA 3KLWA 3S1RH 2KB0A 5KSZA 2E8GA 5KSPA 4IFBA 2OM2A 3U6KA 3OFNA 2ONKA 2QG6A 4OWXB 1G9XA 1HUQA 3Q85A 4GBMA 1VCMA 3TEHB 1N32L 1B7YB 3GJ6A 4OK5A 5TXGA 1L4YA 5L3SB 1NY4A 2QUZA 5FJ8G 4OO1G 2J7PD 1IZ6A 2GCNA 4A76A 4H1UA 3IPXA 2GTPA 4PSKA 2WJIA 4Q5IA 3TH5A 3WHLA 1NBMA 5JBQA 2JJQA 1KGDA 1H9SA 1IW7C 3T1HL 4JI0L 2YOFA 4D80A 1G5TA 1JAHA 2C99A 1SXJC 2KBEA 2D2CC 2WOOA 1W0KD 3CPJB 1OYYA 4F92B 3RRZA 1WA5A 1X65A 1O87A 4LJYA 1P75A 2ZQ5A 4AKGA 4UPAA 2ODEA 2WJGA 3C4JA 3K09A 1V5WA 3BH7A 1CULC 2NVXH 3M4PA 2V7QA 4HZUB 1TMKA 3ZJYA 1F5NA 3A1VA 2OO7A 1RZ3A 4ZV4A 1PMRA 1OKKA 2NQ2C 1TADA 3A5UA 3LLMA 1E32A 4WZ6A 1AZTA 3OEHD 3NBYC 4EFMA 3M4YA 1EFRD 4FN5A 3SR0A 4WA7A 3OTOQ 2ZR7A 1CKMA 3A1WA 3DEFA 3V9PA 2FA9A 3UMRA 2WKRA 3ULLA 1JPNA 1XD2A 3IPYA 3Q7PA 3QXCA 4JYAL 5EZ6B 5L3QB 1WCMH 1TF7A 5L3RA 4DHEA 2BWJA 2F9MA 2HLDD 8OHMA 1HR0L 1EQRA 2A2ZA 3UATA 3A1UA 2WTUA 4BFTA 4XVQA 3VKHA 3ECCA 3NDPA 1EFTA 2HIXA 2FSIA 4B35A 1N32Q 2V54A 1EX6A 2EIFA 1E6CA 1E2ZA 3K80C 2D4HA 2GZDA 1AK2A 1Y3AA 1G7TA 2ZS9A 4OONA 3D8BA 3NVAA 4D25A 1VG9B 2QORA 1PH1A 1WBBA 3T1HQ 4JI0Q 2DFKB 2PLFA 2OESA 4BRWA 1JNYA 2A5YB 4D26A 3FPPA 2GJ8A 3G0HA 4C30A 4AG6A 5M3MG 3E9IA 1XXHA 2ORVA 4N0EA 1E0SA 4KN7C 2PZEA 3KL4A 3B13B 3KZ1E 4JV5L 4I1OA 1RYFA 4LYJA 2P65A 4NU0A 2D06A 1KMQA 3VHXA 3NG1A 3FKIH 4NPSA 1B0UA 4KFUA 4YY3Q 4DV6L 4MGIR 1XF9A 2NG1A 3IO3A 2CVFA 1E98A 3TREA 2OG2A 1DBSA 4URYR 3S17H 1VHLA 3EWSA 3OEED 4TYPA 4GOKA 2C77A 5JHHB 1PH3A 4TLDA 4QOSA 1FP7A 4HAXA 1EWHA 2A9KA 4Y0AA 2PJRA 4LUZA 1JXOA 4LBYA 3PIRA 3LD9A 4WW0A 4QIWE 1LYLA 4JYAQ 1W48A 4L15A 3GP8A 1HR0Q 2CJWA 3RS4A 5M5WH 4D0GA 1RC8A 2H1LA 4AWXA 1E1RD 3K70D 1M90C 4HAUA 1RFLA 1CRPA 2MMGA 3C14C 4TMZA 3HKZG 3UK6A 5ANRB 3VDYA 3KOJA 2R93H 5JFGA 1G3RA 1P2UA 2AK3A 2YWFA 2A6EC 2GVZC 1P3JA 3H3VH 4DEYA 1Q86C 4GKJL 2IYLD 2XB2A 1N6OA 2AHOA 5HPYB 1P60A 1XXHB 4UP7A 4PO1A 3AP1A 5JEAG 3GJ3A 4OXPA 3AP3A 4I4LA 1Y8PB 4DCTA 1TTTA 5JWHA 1DXMA 2VP9A 4ITRC 4JV5Q 4M1MA 2XTIA 1TU3A 4LJ6A 3T12A 4A82A 4IJHA 2YOHA 1E2NA 1OV4A 3LVQE 3B9QA 3RWOA 4DV6Q 4LUCA 3ZYCA 3F8TA 1W4RA 4JCVE 3B85A 2AXNA 4H9GA 4OX9L 5IYBH 2NVTH 2PZGA 4IEIA 1LF5A 2EQBA 1Q12A 2ZRPA 4WJ4A 1MOZA 4MRRA 1Z28A 4PHFA 3UE0A 4MZ9A 1J7KA 4OYHA 1KIXA 2GZAA 4C3HH 3EN2A 4OI0A 1JJGA 4M1OA 4TMVA 2CJWB 5EQTA 2FFHA 4R4CA 2A68C 1OW3B 1TXYA 3U50C 5ELNA 3RR5A 1MABA 3I92A 3VQTA 1NJGA 1QVAA 1X9NA 3Q8XB 1E9SA 1RRFA 2Q3FA 3G48A 2ZRFA 4B3FX 4D4MA 1M1YE 3HOUG 3ZD6A 1G51A 5FLMG 3LVRE 2ZRDA 3M85A 3CC2A 1R0YA 3W9YA 4F93B 1ZCBA 3BFVA 2AX4A 5KSYA 2ZUBA 2IT1A 4ZPXA 4DK3C 1OJLA 4FWTA 3GEEA 2AHOB 2VL7A 3I62A 4GKJQ 4EKDA 4X6AH 3KXIA 1M2OB 4LJ9A 1U81A 2XGJA 3LQQA 4IHQA 4A75A 1ASYA 1JJVA 3Q72A 4G0NA 2ZJQA 1IYVA 1E2GA 3AGQA 4DLYA 3A8IE 3LO5A 4IO9A 4G1UC 2ZRCA 4BLOA 2QMOA 4GPTA 4LFAL 3TRFA 2LXKA 3HKZE 3D0FA 2JCSA 1II8A 2EDGA 1J99A 2DNCA 4U02A 1YZTA 3KUCA 3QVVA 1A6XA 4QG7A 1FTNA 3Q5EA 3NEYA 1S72A 1KI7A 5KUTA 4IPCA 2WSSA 2E2IH 1VQ7A 3K9GA 2ZSBA 2P5SA 1MABB 1QVRA 3TGPA 4PQYA 2BM0A 4MRSA 4ZDKA 3E0EA 1I2MA 1M74A 2Y0SE 2G88A 1XEWY 2RMKA 3OFND 4P73A 1DS6A 5C4XG 3OESA 3DO6A 3GPLA 2XAUA 3L8YA 3M6AA 1ZD1A 4GS3A 1C9OA 1GDDA 2MQHA 4DV4L 1TUEA 1W4CA 2G1KA 2VO1A 4DR2L 1UDXA 3QBVA 1NBMD 3GEIA 4Q9IA 1AS2A 4DXAA 1AJEA 4BFVA 1U5KA 2K75A 1UKYA 1HQCA 2PLRA 1YEZA 4QBGB 4Q7MB 5KNBA 1DCZA 2PEYA 4NCKA 4LHWA 4KMUC 5H1YA 2XEXA 4C0HA 4X65L 2YTVA 3K9NA 4KFRA 4B43A 1HYQA 2V7QD 3CRQA 4YXWA 1KIMA 1J2JA 2VP6A 4MITA 3GLIE 4GDFA 3QVUA 4QKQA 1OKKD 1E1OA 2IYYA 1II8B 3ERSX 5C0XH 2BJWA 1IHUA 4LFAQ 2FSGA 4DSOA 3M1IA 3U7FB 4Z8XA 1NJIC 1HURA 1P8LA 1VYTA 2OCAA 1MRSA 2E1RA 4JOIA 2QTVB 2QM8A 521PA 2H57A 1AS0A 2D7CA 2IXEA 3BORA 4YWKA 4JT4A 3Q5DA 1PUJA 1RYHA 5CK4A 3ZS9A 5BW8A 3CKLA 5DNYB 3U6BA 1GUGA 1PH8A 1NTGA 4LHXA 1WB9A 3UXMA 1A0IA 2CL6X 1FL9A 2YVUA 4Q9KA 2C9YA 2XNSA 1RRCA 4O0MA 1WRBA 4Q1BA 1N34L 4DV4Q 2ZRHA 4W5WA 4DR2Q 2F9LA 3NENA 1PH6A 2ASEA 4BFZA 3A7AB 4L9WA 4A1FA 4DLRA 5CB8A 3KQHA 3TLXA 4CDGA 3CAMA 3LQRA 4Q21A 5HKKA 1GUAA 1XMIA 3KTAA 4QJ3A 4X65Q 3BFXA 3I61A 1EWQA 4HDOB 4QGFA 1UEIA 3DKPA 5M3FH 2V8OA 1GP2A 1YVDA 3H0GH 3G6EA 4TL9A 2VQEL 2VNUD 3TQCA 4NHOA 1PVOA 1SXJA 1YZLA 3B5JA 3A6PC 2OSBA 1LTQA 2QRNA 5KNCA 1DAIA 1J8YF 4P71A 3NHAA 2OBNA 2R6FA 2WJVA 4Q1EA 1FUKA 1UPTA 1A2BA 2JEOA 4Q18A 2NVYH 1SXJE 3CLVA 3IIJA 3OW7A 1U0HC 1SFOH 4LF6L 4HAWA 4A3EG 4GP6A 4K81B 1D7QA 1NVWQ 5C18A 3JVUA 2PT5A 2EYUA 1BVSA 4V03A 5K8LA 2WJYA 1KO5A 4IFDG 1S9HA 1SULA 2PEZA 2A5GA 721PA 3EIQA 2QPAA 4DCSA 2H16A 1NI3A 2Q21A 3I56A 3WP1B 3FPAA 1UKVY 1N34Q 2BM1A 4F4IA 1DGSA 4AYBG 4DIDA 5EJEA 2VBCA 4JLMA 3D4RA 1XFAA 4C0QC 4UY8C 4C0LA 1E2EA 2A30A 2QQ0A 1YRAA 5E7MA 5G53C 4KN4C 2ZI3A 6Q21A 5HCIA 1ESMA 4LJAA 4GLAC 2W83A 3KTAB 4LOAA 3AFQA 3I5YA 5G41A 3O8DA 1CIPA 3DZDA 5FTNA 3TSZA 5DISB 4EQ6A 1SXJB 1VQDA 2E5LL 1N6RA 1UBGA 2VQEQ 1YKSA 3LV8A 4QL3A 4K46A 4PXAA 4TTPA 3STBD 1DAHA 1UBEA 4TWZA 3K0XA 1TWFH 2BMEA 1K8MA 3PEUA 2AD1A 4C3ZA 1IBKL 1P7CA 1Q81C 2O52A 1RVDA 1S2MA 2RKOA 2QPOA 4HDQB 1IXZA 4LF6Q 2FE4A 1IN8A 2D2FA 4W7SA 1ONBA 3U7EB 3PSIA 5GQOA 3C7KA 4CEJA 2K7VA 1WXQA 3CW2A 2A69D 3GTOH 1QUQA 4GOPC 1VQKA 1GNRA 1LS1A 1MO5A 2QN6A 2RHQB 4NCHA 4A4IA 1S40A 4B3TL 3G5UA 4GZLA 1OLOA 4KLNA 1N3BA 4DAYB 2QENA 4KVGA 1YHQA 1UEJA 4BWYA 3I73A 1E9FA 1T8UA 2ZEJA 2G3YA 1W47A 1IJFA 3VR3A 3U61B 4IDOA 3S1MH 1JB7A 2FZLA 4LF8L 4I1UA 1K5DA 3AVTA 1KAGA 2EFCB 2FSFA 2WWHA 3QKSA 3SJZA 2UVQA 3K7AH 4EFLA 2D7DA 2K5HA 3PENA 1GKIA 2BBWA 3AQ4A 1C1YA 4LBVA 3W1BA 1F3OA 4EQ6B 2EFHB 2JASA 3FHTA 4II7A 2ZI9A 2DWPA 3ONWA 2TMKA 2E5LQ 1M7BA 1XMSA 5DN6A 1OFTA 3EW9A 4AIMA 3A5ZB 5ELOA 2N8NA 3WWVA 4MUAA 3FMOB 3FVQA 2XB4A 1O7IA 2WAYA 1LACA 3QKRA 5DE3A 4AQYL 4D82A 1IBKQ 1MV5A 1G3UA 5FPKA 1J8MF 4LUVA 4AYBE 3DOEA 3MJHA 1TWHH 5LDDC 1XJ0A 5GVSA 1GSIA 4CEJB 821PA 2IHFA 2WSSD 1KDPA 1QUQB 2QMUA 1A5TA 4JLOA 1NN1A 3IRBA 3QKTA 4A3FG 4FMBB 3GTMH 2QL6A 2G9NA 4BASA 1MH1A 4CW7A 4B3TQ 4H1VA 1T5IA 4URUR 1EXMA 2ZE7A 5C44H 1E4VA 3EX7C 3BFKA 1FZQA 3MMPA 1D2NA 4DVGA 2AKWB 3DVLA 5D3MA 2RAPA 4LDJA 4LWZA 4LC0A 4JLBA 5FUWA 2FH5B 2IYXA 3QF4A 2BE5C 3HOWG 4LF8Q 3QKSB 4URWR 4A15A 1AE2A 1OH7A 4FCWA 1PLLA 2XZPA 4Q9LA 4BEJA 1K5GA 4CIDA 2CDNA 3K09C 2OQKA 4R71A 4JI3L 2HF9A 4YXWD 5HR5A 5H68A 1LUZA 4LJZC 3U3JA 3ZJYC 2UUCL 4QGUA 3KKQA 1ZAKA 3TSOA 4BLPA 4YMWA 3OYYA 5BN5A 3FHCB 3QKRB 4IVQA 2I5LX 2VHUA 2IUUA 3U3MA 4H44C 4AQYQ 1V9PA 2QGQA 4UXIA 2QA4A 4JL6A 4C2TA 4GLVB 3KFUA 2VP0A 3CF6R 1GL7A 3NBZC 1W2BA 5EXSA 5TV2A 3TBKA 1II9A 4PQRA 1WI5A 3GQBA 1VG8A 4B47A 3GLHE 2W2TA 3NC1C 1U8AA 3BZKA 4XH9B 4RMFA 2AWNA 3HOXH 5IE8A 1GILA 1T9HA 4BY1G 4DR1L 5K36H 1II0A 1I3QH 5E4FA 5BN3A 1S1CA 2ZUDA 1XWIA 3PGZA 5D3MB 2R6CA 5AJYA 3TNFA 1N5KA 1G3QA 3CF0A 3CRVA 4B3RL 2Q9AA 3KQUA 3M0EA 1QG2A 2Z4SA 1P2SA 4TT3A 2WWXA 1OIWA 3LAWA 3V4RA 4TTQA 4OQFA 1H8EA 1SMYC 1DD2A 5HKKD 2RGNC 4GKKL 4IVPA 4KKUA 4G5OA 2NOAA 1GHJA 1AS3A 1Q22A 4P3YA 4JI3Q 1VQFA 1IW7D 3BOSA 3EZ9A 2FFAA 2UXBL 3CONA 4LPSA 2UUCQ 1OSNA 1SXJD 1H9KA 4BY7G 2BBTA 1F2UA 2FGKA 3ASZA 2ZTCA 4R4TA 5JS8A 3Q8DA 4LHZA 3PO3G 2D0PA 1PH7A 2JXMB 2O5VA 3QF7A 4X8LA 1CF4A 2DB3A 4M1TA 4B2IA 1X3SA 1G8GA 1H65A 2EFGA 5SZKB 4Q4AB 2F7SA 4E03A 4X66L 2NN6I 3N70A 3RZDH 2IYWA 2OFWA 3AQQA 1Z0IA 2KI5A 4OHWA 2GXAA 2OE2A 3I3SR 2WWYA 2H5EA 4M4SA 2YKGA 5IRCD 2RGCA 4BZPA 4P75A 2JE6I 3F2BA 3WNDA 3RC3A 4DR1Q 5C3EH 4LFBL 2NZHA 2OFXA 4QJ4A 2VS1A 4FWIB 2FEMA 3AVPA 3OZXA 4KFSA 5K8IA 5LPNA 3J81i 1VKJA 4LBZA 1FVIA 2YTYA 1KY2A 2BDOA 4B3RQ 1W2GA 4N0DA 4TLBA 1KQSA 3RS3A 4PAQA 1CEEA 4U7DA 2Z43A 4HAYA 5J4YA 2ODWA 5GADl 4GKKQ 2Q3HA 1W7AA 1G6PA 5C4GB 1T3LA 3ICEA 2ZRNA 2VHJA 1DTSA 2RCNA 2GKSA 5J4HA 5LD2B 3RDPA 4BLSA 2ZM5A 2IS4A 1IBLQ 4C3IH 3QOFA 4RKFA 2UXBQ 1GFIA 4FMDF 4R7ZA 1TAGA 5EE3A 2VSXA 3T1OA 3K0FA 2A6HC 4DNIA 2ZJPA 4DUYL 5EXTA 3A36A 5CJ2A 4EQ5A 1UBCA 2UXCL 3F1ZA 4JS0A 2N3SA 3BJUA 1FQKA 2PCJA 3J81c 5HTKA 1IY2A 3CCRA 3L82B 2O5JC 2XSZA 5JJIA 3W6NA 3NBFA 4X66Q 1F6BA 1PLKA 3PIPA 1Y69U 3IHWA 3QUSA 4A3GH 1VHTA 4OO1I 1R8QA 2MNAA 4Q03A 1YR6A 1JT8A 4EPYA 3T51B 3WYFA 3FOZA 1VQNA 3PF5A 1JEDA 1U94A 4DC9A 1JR3E 3BDOA 2CE2X 2Q6TA 5HY6A 4LF9L 2Q8IB 2G0NA 2FU5C 3AB9A 1TNDA 1BO6A 2IX0A 1ODFA 2AFIE 2YC2C 1WCMG 1N33L 1DG1G 4RCZA 3D31A 4DV2L 4R98A 2NO9A 4F4CA 3SQXA 2YWEA 2IW3A 4JLKA 4A3MH 2OZEA 5DYIA 5BR8L 4GOXA 2ZRAA 1ONLA 3EIVA 3JAMi 4OL0A 4TTRA 3WY9A 2ANCA 3RRMA 3EBEA 3ZLJA 4A3CG 4Q1AA 2A6ED 1O3YA 3K8AA 1CR0A 3PJRA 1PUIA 3KKOA 5K8TA 1GUTA 1Q0UA 3VR6A 4LF5Q 1G5RA 1P5ZB 3K0FB 5DN6D 5KTYA 1U8YA 1WJJA 3VR1A 4DUYQ 2P3SA 2VQFL 2ORWA 2OCEA 3BU2A 3WBKA 3QXSA 5DIFA 2UXCQ 5C4JH 2YC4C 4PZLA 3OOCA 1K9MC 4D0NA 1XTDA 1NG9A 4CEIA 4B2LA 1VCIA 1Z63A 4G5SA 4N1AA 4M1YA 4TL7A 4B3XA 3REFA 2GCPA 2F52A 2WP8J 5HZKA 4DV5L 2JA9A 3HOVH 1WDTA 5AJXA 4DUZL 2KWIA 2WSMA 5IP7H 1CBUA 4US0R 4G7OC 1QVGA 3PCOB 2LWIA 4R9UC 2HYIC 1MJEA 4RD0A 5FPTA 1SE8A 3U4VA 1HR0W 1HZAA 2NVQH 2P5TB 1KL9A 2E9SA 4R2IA 1VS0A 2C98A 2PPBC 3EZ2A 3GCGA 4NH0A 5H70A 1L2FA 3GTJH 3LWUA 2ZSDA 2J0QA 4HAZA 1I6VC 2A68D 1N33Q 2O0HA 3RC8A 1DOAA 4ACBA 4YMVA 4DV2Q 3ZVRA 1VQ5A 2QT0A 5FBVB 4CZ2A 2HIVA 4MRNA 4NPHA 3HFZB 1YZGA 4TLAA 5BR8Q 4I81A 2XTMA 2GEDA 4F91B 4AH6A 2MSDB 5AUQA 4Q7KA 3V4FA 3SYKA 2HUPA 1IN4A 2ZRLA 5L3SA 4A3LH 4TLEA 3Q9LA 2RGDA 4A3JH 3EG5A 1ZINA 4JBWA 4MDFA 1T6NA 2J3EA 3AF1A 2GK7A 5BXQC 5FPSA 2EW1A 2H18A 3CNNA 4IFEA 4PHTA 2QP9X 3K1JA 5FUXA 2VQFQ 1NMZA 1XTQA 3P32A 4IJLA 4A3IH 1T3HA 1QHGA 4M9XA 3TVTA 1G18A 4CEIB 5GROA 3B1ZA 4JOIC 2ZJRA 1XJVA 2K50A 2J59A 3IUYA 1WOCA 1S4QA 4DV5Q 5BYKA 4JC0A 4DUZQ 4FIDA 3I72A 3AM1A 1QHNA 5IYBG 2LMCB 2QQEA 3SS8A 4IKEA 4YMSA 5KO2A 2EU8A 3FKQA 4H13C 4K8OA 3T56B 421PA 1Z0AA 3MGCA 4BPBA 3CC7A 2EJMA 4NL4H 4CF7A 5FTLA 5AJWA 1NE3A 3Q3JB 1EIFA 4P4TA 2JLXA 4DLWA 3TW8B 1EFUA 3FHWA 1T91A 1Z83A 2OT3B 4DUGA 2E87A 4TT3D 1N8RC 2A5DA 2C04A 4AYTA 3MFYA 4BBRH 5TMPA 2ZTDA 1H8ED 2VUMG 4GL2A 2QNRA 2EVWX 4B44A 4L8JA 1K3RA 1VQMA 2C5LA 3T5GA 1B9NA 1G41A 4RD3A 5JRJA 2BOVA 4I7ZC 3J7ZC 3TAHA 4LJ5A 4C0AC 1VMAA 2OFOA 2ZE8A 4IDNA 2JA6H 5JECA 1G16A 2ZRBA 4MGKR 4DDWA 1I2DA 1RIFA 4A0GA 4NTZA 1ZC3A 3CCQA 2J0VA 1XTIA 1KSFX 3CR7A 1K8GA 3NXSA 3OAAA 2PNRC 1YVCA 1P2TA 3W3AA 4HB0A 4KVAA 4Q00A 5EE9A 3FKSA 2A3RA 3NTUA 2W6IA 2GVDC 2N1BA 3HDTA 4EJSC 3B1VA 4EPVA 1S0UA 5EXXA 4KXFB 3GJ0A 3RRYA 2K33A 2AUJD 2IHYA 2R44A 2HCJB 2JJ1A 3HR8A 2ZUCA 2PJZA 4Z51A 4HB2A 2FJUA 4QHYA 5GAEC 1KK3A 3X1WA 3CRLC 3HPRA 3IDQA 2D0OA 1E2LA 3VAAA 4BQSA 2B63H 3EPJA 3QJYA 4P0TA 3UKDA 4ZCMA 3A74A 1YE8A 1U90A 1UBFA 3BB1A 2Q2UA 2KA7A 1G7RA 3C8UA 3GJ7A 4TSFA 3PXGA 1MKHA 1UKZA 1YHAA 1ZNZA 3GTQH 4K0KL 1F60A 2DHRA 4M2LA 4PC3A 4XSGA 1JQJC 3KB1A 1VYUA 1TF5A 4PHHA 1YR7A 4KJZA 4DB4A 3PVSA 1IN5A 2QAGA 1XX6A 4UP9A 4B75A 4DLXA 3KKNA 3OIYA 4A8JA 1SN8A 1NVXQ 1Q44A 2ZSFA 3B1XA 4TYWA 5EP2A 4HJ8A 2WWFA 4JLVA 1E22A 4O2DA 1K0RA 2V1XA 1XJCA 1KO8A 1FR3A 2B7BA 3L8ZA 5HE8A 3EARA 3U7GA 1K8RA 4ZIRA 3CMEA 2ZJ5A 2RGNA 2BA0A 1GJXA 2GRJA 1ZKOA 3VKGA 4A3BG 2FMXA 2QAJA 4BUJA 1H9MA 2ZREA 4OK6A 2GXSA 2XTZA 2XSZD 3AGPA 1G8PA 5EP3A 3HOYG 2JIZA 1R6BX 1TWAH 5FTMA 4UNPA 4HUTA 2CWAA 3TE6A 1P2VA 3QG5A 3CW2C 5IYDH 2IL1A 2VF7A 4HIKA 1VQ8A 5C0XG 4BZQA 4E22A 1Z0DA 3DZ8A 4B6FA 1JJCB 2Z83A 3EXAA 3AVXA 1TU4A 1AA9A 3BS4A 2I1QA 1ZW6A 3MWLA 4QGHA 2Z5FA 1OB5A 1KNXA 1XB2A 4TQAA 1HA3A 5FR1A 2VH5R 2IYZA 2Q9CA 1CKNA 2CCJA 2JGNA 3ASYA 4LBWA 4GNXC 1RJ9A 3ADBA 2JA8H 1XMJA 3PO2G 3E2IA 4NBSA 4K0KQ 4TMKA 2RB4A 1COWA 2GF9A 2XTNA 2R7DA 5UKDA 2R7ZH 2QAGB 1KJYA 4MKIA 3NELA 4TL6A 4A8JB 1W4BA 4B3DA 3D6TB 1ZYUA 1R0WA 2HT6A 3LW8A 3KF8B 3VX4A 1Q20A 2VSFA 3E9HA 3K81C 5CDFA 3TQYA 4LGMA 5FPYA 3I55A 1XCMA 4YDSA 2GETA 3PUZA 1HV8A 1S9DA 1Z06A 4ZIRB 1OPXA 4JI8L 1XRJA 2DFTA 1VQ6A 2OAQ1 2WHXA 1SKQA 2XX3A 1X3EA 1TQ4A 3D7MA 5CDFE 2CHGA 3CX7A 5JWOA 1OT3A 4G7ZC 1D2MA 2Y0SG 2WMOB 2OBMA 3CPHA 2ZYUX 3ND9A 2A78A 1E1TA 1GUOA 3CH4B 2ZVQX 4JJKA 4A0FA 4BE7B 3VU9B 4DZZA 3NH6A 1VPLA 3H0GG 4WZBE 2NN6H 2ZM6L 2A19A 1GAJA 4JYBA 4WOPA 1HH2P 3HU2A 2GEVA 4OQNA 5J3BA 4A2WA 4X64L 1GKHA 5GADC 4D0LB 4ZDIA 2V1UA 3A37A 1E2KA 1OIVA 4BFYA 3IIKA 1NMYA 4ME3A 1CKNB 2AKYA 4Q48A 1X55A 4B3ML 1LW7A 1RJ9B 2QSZA 2F1MA 1F48A 3KJHA 4YDHB 1WMSA 1ZVQA 2CK3A 4KI0A 2P6UA 3OF5A 2N49A 1Z3IX 4KBFA 3GMTA 3SQWA 4DAMA 2HQLA 1BOFA 5D3QA 4KV9A 1KD1C 3K0SA 1E99A 1NMGA 4IPGA 1ZC4A 1G4AE 3KFVA 2VRWA 1SGWA 3HYTA 2CLDX 1G7SA 2C35B 1ZP6A 3JC66 1C7YA 1ZUNB 2CL7X 3KUDA 2FNAA 3DPUA 4XTCS 3TMKA 3AV0B 3SFZA 3NIBA 4JZKA 4TYYA 1Z6YA 1ZRHA 4QNRA 2OUKA 2GDJA 2D74A 3MXNB 5C0XJ 4JI8Q 1ZCAA 1Q1QA 4M9QA 1N6KA 2IX1A 2Y8EA 1E94E 1XNJA 2D3WA 4J15A 4ESVA 4L5BA 4ZDWA 5KYKA 3M9BA 2ERXA 2ZJZA 4IFDI 4R2HA 3O8BA 1US8A 2Q2TA 2QMEA 3CZQA 2ZM6Q 4LV8B 2OWOA 1WCV1 5EZ5A 4X64Q 1MKYA 2NO0A 1P16A 5FJ8H 4OO1H 1Z6AA 2UUBL 4OX9Q 4JMPA 1U9IC 2JLVA 2AKAB 4PPFA 1L1OC 4OK3A 5FOWA 2E2JH 2P67A 1CXZA 2PX0A 3BC1A 4C0BA 4DRZA 4AI6A 3RN2A 4B3MQ 4BXXH 3L2PA 4WJ3M 4L8GA 4BLTA 3K9LA 1G19A 4HI0E 3LX8A 2R2AA 4DUGD 4JLPA 1TWCH 2QROA 4PR0A 1U99A 5JEAJ 4AYWA 3SDZA 1DAMA 1WQ1R 2NO6A 5IT5A 3WP0A 1HT1E 4Q47A 2MSEB 3PUVA 3PUWA 1KO7A 2WMNB 1EFWA 3ETLA 4U00A 2REOA 1YNNC 5CITA 3CCJA 3LX5A 4ILEA 1BYIA 1TX4B 2BE5D 4JJZA 3RVBA 5JHGB 3T06B 2BDTA 5LD2C 2QGNA 3CRW1 1QBKC 3A58B 3QXXA 3OAAD 2FPLA 1BKDR 3GLIA 4HDCA 1VF7A 4KCGA 5C46F 4M1KA 3GFOA 3WNCA 3FKSD 1US8B 2AXPA 4DDVA 2F3TA 2W6ID 2FN4A 2ZR9A 2RHSB 4ACAA 2ALYB 4Q01A 1T4GA 3THYA 4DDTA 5AUNB 1NIPA 4A3DH 4PAOA 4L5SA 4KLKA 4HYYA 2PMDA 2N46A 2UUBQ 3MD0A 3LBNA 1IONA 4QHTA 1FOEB 2L15A 1TWGH 1Q1ZA 1NLYA 3EC2A 4IDHA 5J5CA 3UE1A 1E9DA 1HZ9A 2IXGA 1E2DA 3I2ZA 1KDTA 2VP4A 1VQ9A 2OXRA 1N5LA 4RD4A 5M3MH 5JZVA 3NHBA 3EAQA 4PAMA 3WMGA 4C7OA 2YV5A 5BN4A 2BH2A 2EVBA 2IYTA 4G5RA 4GN5A 2JA7G 1H9JA 2WVJA 4BECA 5TARA 3QY0A 5C44G 2EWVA 1GUSA 3CBQA 3AKCA 2FFQA 5KPDA 1HNXL 4RG1A 3X1DA 4JI5L 3LFUA 4B33A 1E2MA 3RN5A 3KKPA 3ZH9B 2K52A 2GJKA 2MSCB 3TW4A 3W6OA 1CSPA 4A6PA 1N0WA 5JWRA 4Q66C 2MMCA 4OJKA 3THWA 3GLIB 2HYDA 4A92A 2E2HH 2D62A 2Q3MA 1Z0FA 1Q1EA 3IQWA 3MLEA 4MUBA 2K32A 2OTJA 3MXUA 1R5OA 1NKSA 1GZSA 3CZPA 4QBFA 3CF2A 3T34A 5JMTA 3THYB 4URZR 2JIZD 1FNNA 3S24A 4TLCA 3THXA 1I4DD 4XD7A 3I4MG 1XEWX 4AG5A 3DDCA 3EIHA 4LV6A 2BCJQ 1DVRA 1Q8KA 2C9CA 4BGDA 4Q4HA 1GOTA 5B2ZA 3VKWA 2BVNA 1I50H 2OCBA 4QM6A 1I5FA 1W1WA 3RLFA 3VMFA 1VDZA 1VF5C 4DEXA 4EJSA 4C7OB 2PMZE 2XZOA 4RJLA 1FJGL 5IY0A 1NMXA 4YCVA 4N3NA 4HR7B 1LTLA 3CIOA 5E7JA 1Y1VG 3AVUA 4GOJA 1XEXA 3GFTA 2E76C 1COWD 5IF9A 1YU9A 4HLQB 4MYCA 1Z7TA 2ORIA 3C5CA 4FMCF 2PH1A 2WWWA 4HEJA 5K36G 1CU1A 4PG3A 1HNXQ 4DR3L 3ADKA 3GFPA 2X1VA 3R9IA 5F98A 5E3HA 1ZM7A 3KF6A 3THWB 1R10A 3RS7A 4MKGA 4DLZA 4M0LA 3J81j 3LA6A 4O3MA 1BYUA 1RRGA 1BBUA 1RL2A 4KKTA 3S1NH 1EX7A 3I4LA 1N5JA 2G83A 2HXYA 1SKYE 4OWWB 2ZTEA 5CIWA 4XVUA 1X8LA 3R9WA 2FX3A 2NIPA 2PCFB 3IEUA 2AUKA 3THXB 1P4SA 2WV9A 2WJJA 4LK1C 2QPTA 3D3QA 3EZFA 4LJ7A 4ON9A 2GHIA 2F1IA 3PV0A 5FLMH 2A6HD 4HJAA 2P2LA 2YZ2A 1KAOA 5E7NA 4OQLA 4Q4HB 3T5DA 2UUAL 1XNQL 1YR8A 4LHVA 5FOVA 3UG7A 4MGZR 4MKFA 4ZDJA 3U44A 3CQZH 1IJEA 4P32A 3L7ZC 4EJSB 2Z6VA 1D2EA 2O0JA 1GNPA 1FJGQ 1MT0A 4HLUC 2V4DA 2CK3D 1XEXB 1AQYA 1GRRA 2GCOA 2ZITA 3FMIA 3CRRA 1OE0A 3BIFA 3L43A 1K6MA 4FCTA 1ZBDA 4JVNA 4X8MA 4Q1FA 5C3EG 1AH9A 1E24A 4PMWA 3PUXA 2QEXA 3GJ8A 1Z0JA 1GUNA 1B23P 3AVVA 4GNXA 4DR3Q 1ZU4A 4NB3A 1IQPA 3KF6B 1MO4A 3EPHA 1D8TA 3KJEA 4ESHA 3VNUA 1OFHA 2JLWA 1VQOA 3HR7A 2JQOA 2G77B 3X1XA 2W0SA 1ZM9A 2WJHA 4MGYR 2CEAA 4CGZA 5E95A 4JBMA 3W5JA 4UP8A 3B82A 4TL8A 4L9SA 4JI7L 1IN7A 1HNWL 1E7ZA 3IHLA 5AJZA 4DB2A 1KDRA 3DOFA 1NY6A 3GO5A 4A0RA 1KK1A 2BEJA 3PIOA 4JKIA 2R62A 1YI2A 2GNOA 1TKWB 3NE5B 1TL7C 2ECKA 4IFDJ 2FEOA 2QMHA 3U44B 5F3WB 1V43A 1VQGA 2UUAQ 3H0KA 5FOXA 4JBXA 4ZO4A 4ZCLA 3VHLB 2KSQA 1BMFA 1T5EA 1PHJA 2IC5A 3AF0A 4JVMA 4R4OA 1R0ZA 3OHMA 5BWMA 4A36A 2IYVA 1Q57A 2ZAOA 3UWOA 2VP5A 3KFXA 1E3MA 2GCOB 1P62B 1LF0A 4A3GG 2FOLA 1FP6A 3RS0A 3TJZA 5HZHA 3AF3A 2L5TA 1AIPA 5GJBA 5AR1A 1ZD9A 2UZ3A 3M4QA 5IK2A 3SHWA 2ZJYA 3N6RA 3RRNA 1JR6A 3QG1A 2QM7A 1JALA 4GNXB 3RSOA 4KSCA 4F7WA 4DLUA 4EPTA 2KCMA 4D4JA 1SQ5A 2AFHE 1ZJ6A 1P61B 4Q1CA 1XU4A 2B8WA 1GIAA 3RABA 5JCPA 2IS2A 4XTRA 4JT2A 2QP4A 2KBNA 3QSYA 4IQZA 3U5ZB 5GAHC 4GP7A 4JI7Q 4YLGA 3CMAA 3E1SA 3KKMA 1HNWQ 2GK6A 4ALPA 1GVNB 3QI2A 2MO1A 4LYHA 3ULJA 3P1JA 3UG6A 2JAQA 4JVLA 1K73C 4MDEA 2O0KA 4EFNA 3GTPH 1GD7A 1JI0A 1TPZA 1EIYB 4KFTA 4A3KG 1QHHA 1IXSB 1JMCA 2HJGA 1PH2A 1Y14B 3A1TA 4Y7NH 4P4UA 1J5EL 2IF2A 2AK2A 2W2VA 3GLHA 3HPQA 5TDHA 3U3OA 1XPUA 1OXTA 1FMJA 4JI4L 1KK2A 1CJUC 4TMWA 1EFHA 3DKVA 3I8XA 4R1JA 1SHZA 2JA5G 1QHSA 2K5UA 3F2CA 4TZ0A 4JBYA 5EP4A 5IYCG 1U9IA 1NG1A 4M21A 1WE2A 1L1OA 2QA5A 2WIBA 2ZRIA 3RYTC 2F4VL 1RPZA 1L0WA 4NP6A 5C1BA 4TMTA 1E79A 4HJ5A 2QAGC 2LXJA 4QFMA 1KC8C 2EJGC 1NMFA 1XMQL 3OPOA 2F3RA 2JA1A 621PA 2O8FA 4A8JC 3SJBA 1KHIA 5EAYA 3VA7A 3H1TA 2B92A 1G6OA 5HGQA 2JATA 1UDWA 2JLSA 4KODA 4L4UA 4WAUA 3RLNA 2PQAA 4E5UA 3C5HA 1HZCA 1HNZL 3B7GA 3GTGH 4Q02A 2PNHA 1KHTA 2BBSA 5JLJA 3A7LA 1VCOA 3T61A 3FB4A 4MTNA 2J5XA 5KHOC 1NSTA 2HEIA 3PF4A 1LNZA 1I4TD 4POFA 1CJVC 2RHMA 1CS4C 2KE5A 1MRNA 4PO8A 4F4JA 4PQFA 1FGUA 2CCKA 3T1YL 4A3LG 4BBSG 3MWYW 4GNKA 3TR5A 2BMDA 4XJXA 3GD7A 1GTVA 4BFSA 1A1VA 3T1TA 4XD7D 2IXFA 1XZQA 4YMUA 2ASBA 3VTKA 1Y1WG 4B76A 1QHHB 4DR5L 2LKCA 3BH0A 2YINC 4OI4A 5FPHA 4A3IG 3W90A 3GLHB 4I99A 2UZIR 3TR0A 5JJLA 3JVVA 5CM9C 2AD5A 1J5EQ 2ATWA 3S14H 5LB4A 2O8DA 4UQOA 4DK6C 4JI4Q 1CUKA 3AYHB 1G5PA 4YCUA 2IWHA 1YR9A 1XTRA 5B64A 1L1OB 4X8OA 3K53A 1KRSA 1NSFA 4EIWA 4NYIR 1E2VA 1DAKA 2F4VQ 3LW7A 1OTCA 3H3VI 1P72A 1Z29A 3BH6A 3HU1A 4WZAE 2O8FB 1Z2AA 4MNOA 2JEAI 1K83H 1XMQQ 1W0KA 3MG9A 4NKRA 1EFCA 4DDUA 1UE5A 1IYJB 2PQAB 2F1RA 2PZFA 2VA8A 2DCUA 3P27A 2DNEA 2IEYA 3B1WA 3X1ZA 4B73A 4RCNA 4LI0A 4EUNA 2NZOA 1HNZQ 4GT1A 1SVIA 4BBRG 2KENA 1R4AA 5FLXc 3OW2A 2REXB 3AUYA 4PV1C 3GEHA 4UJ5A 3UMFA 1KI4A 1IY0A 2OHFA 2X19A 4IOJA 4U5XA 2JJ2A 4A4DA 1EWIA 3T1YQ 1ZMXA 4NDZA 2CNWA 1NIJA 3C41J 5AJVB 3SZRA 4OBEA 5FOSA 1GL6A 2P6NA 3QEOA 4B3SL 1Y8OB 4DR5Q 3CF5A 1G20E 2C95A 5CYPA 3SBEA 2OV2A 3SNHA 3CX6A 3K0CC 2O8DB 2R7FA 1IXRA 4HIMA 2PCLA 2F1HA 1QHIA 1M1KC 2IYRA 4D4KA 2GN5A 5BQ5A 3WMFA 1JR3A 1CRQA 2GILA 3BGWA 3IO5A 4O25A 2QRZA 4QY7A 4L5TA 4BLQA 1Z07A 2ANBA 2OQ0A 1PJRA 1ETUA 1VIYA 3E70C 3EWAA 3SU8A 1LV7A 2RF4A 5FOTA 4QM7A 1Z6HA 2B63G 4LFBQ 4PSAA 1DADA 2QBYA 1PH5A 3QE0A 5LMUL 3T53B 1Z9FA 1G17A 2QY9A 4IDQA 2FWRA 3OIUA 5IDVA 3RNUA 3U58A 1GHKA 1IBML 2A7QA 2BC9A 4YWLA 2J87A 5TVKA 4AYXA 5JCZA 3SJCA 1X54A 3W3ZB 3MJRA 2IS1A 1HTPA 1SMXA 4EPWA 3PFIA 1I94L 3FWYA 1D5CA 4D81A 2H17A 2ZAMA 3O8CA 2P6RA 4A3FH 2AL7A 2DPXA 4DJTA 2RHDA 1AKEA 3VR4A 4HZIA 3WNBA 2X8AA 1E1QA 3X2SA 2YWGA 1UE6A 3IKJA 1A8VA 3R8CA 3T35A 2R92H 3MSXA 4B3SQ 1YHNA 2ZJOA 3AB3A 2NZ8A 3TUZC 1BMFD 2OXCA 3K7UC 2I0QA 1IBRA 2CLCX 2QP3A 1KI8A 2OLKA 2QE7A 2K4KA 3CPFA 2VHQA 5FL7A 3M3YH 3FKIG 3RS2A 4C3JH 1DELA 4YMTA 2WIAA 4EAQA 5FR2A 3VR5A 2R65A 4LF7L 3SI7A 1IOZA 1QG4A 5SZJA 3LXRA 3GJ4A 3I5XA 5IK2D 2QBYB 2JLRA 3AVOA 1NN0A 3NKVA 4LF9Q 2IX3A 4B6EA 4M9SA 2J7KA 4OQMA 3ZIAA 5CJPA 5LMNL 5LMUQ 2LKDA 4G5QA 4IDPA 3VX3A 1FYCA 4QL5A 1VQIA 4HLUA 2GVBA 1LABA 1IYUA 1QZGA 1IBMQ 1UFQA 2IEZA 1VG1A 3RANA 1B8AA 3WYAA 3CWQA 3WHKA 1A82A 3K9HA 4B2PA 1FUUA 2ZI4A 4DNRB 2ZYWX 3IIMA 2GWHA 4WXRA 4V0LA 3W1GA 4JLJA 2R7ZG 2K14A 1HTWA 4HUQA 2CCZA 4DLTA 3T1VA 1I94Q 2RGGA 2QI9C 4DT1A 1KDOA 4EPXA 1QDEA 5C0XI 3G82C 2R93G 5K8UA 3I7FA 1ANKA 5J4LA 3CC4A 4NE2A 1KK0A 1KI1A 2WWIA 2B8FA 4BY1H 1T3SA 2RGEA 4CRWB 4LNQA 5FBLB 2H5XA 3FP9A 2Q2HA 1CFMA 1YZNA 5SZHB 5KDDA 3L0PA 4PPNA 4KKSA 4JKYA 1CI3M 4JI2L 4WIAA 1XTJA 1OXUA 3X1YA 1N6LA 3LH5A 3SFVA 3WRYC 1Z0KA 5AWFC 4DV0L 1QHXA 4Q19A 1XTKA 4DSUA 1W36B 2J45A 3LDAA 1TEVA 4IW3B 1RW4A 3ULPA 2OBLA 4RZ3A 1Q21A 4O0AA 1Q1BA 1UKEA 3S2HH 3EPKA 2FFBA 1KOFA 4JI6L 2ZROA 4V02A 1XBTA 1NP6A 3UIEA 1E79D 4BY7H 3CXCA 5LMNQ 4DLVA 1Q3HA 4TMXA 2W0MA 1S3OA 3AF2A 1W3SA 1TQ2A 3CO5A 1SVSA 1KSGA 5A35A 1AZSC 4HUQB 4Q4JA 5KSOA 2I5MX 2V9PA 5DSZA 4DT1B 3F2DA 3TZUA 3FDIA 2IUSA 1VQ4A 1OYWA 2SHKA 3ZGXA 4PTLA 1BBWA 5LB2A 4ZI3A 3B78A 2IA5A 4DNTB 3P26A 1SRUA 3UDGA 2P0EA 3HJNA 2ZU0C 3AKDA 3IFTA 3SN6A 5A4JA 3GLGA 4L5RC 2DY1A 2QTFA 4JI2Q 1DG3A 3A4NA 1AGRA 2R6GA 3LY5A 1D8LA 2FXQA 2LCFA 5L3VA 1HZBA 1R5NA 3CRKC 1T0JB 1XPOA 2QU8A 3GLGE 2LSSA 1SHKA 2R9VA 5C2JB 3A8TA 4DV0Q 4QGAA 3MWJA 2QTHA 5DI3A 1WFQA 2NTYC 4LPKA 1A7JA 4I1VA 1KAWA 1N9WA 1CLUA 2GESA 4CEHA 1W2HA 4LK2A 1OXSC 4LYAA 2IWRA 3U3KA 3AKYA 4JI6Q 5A0FA 4JK1C 1K8AC 1QVCA 3W8NA 2K5VA 3L0OA 1D6JA 3TSWA 3LNNA 3MRSA 1Z08A 1ZNWA 3RNLA 1TF2A 4P74A 4G3XA 4BXXG 3KDSE 4MRVA 1NBME 2EWWA 1IL2A 3U7HB 1B70B 3JZMA 3CCMA 4V0OA 4WBSA 2WB1E 4Y52H 2BA1A 1FQJA 1FX0A 4Q4JB 3CCEA 3EZ7A 3HWSA 5F9HA 2B8TA 1JXMA 2CVHA 4LW1A 5EE1A 4YY3L 1OB2A 3F3YA 2NPFA 4JL8A 1ZU5A 3QIAA 3QNUA 3T1QA 2JJ2D 2VL6A 1E4YA 1M7GA 2UKDA 3Q7QA 4TQ9A 4KITB 1OFIA 3S1QH 3U4ZA 1D9XA 2CNWD 3EA5A 2W00A 4ZKEA 3GLGB 2ZJAA 3LRPA 1C4OA 3H4MA 4HATA 1XCGB 3N2EA 3RHFA 2GVAA 2JLYA 3HOZH 5BYJA 3A4MA 3MAAC 1XJQA 3BK7A 3PUYA 4I1SA 4UJ3A 5P21A 5DI3B 1GKYA 5J4KA 3VU9A 2ZXUA 1JR3D 4CEHB 1UE1A 1AGPA 4JLDA 4A3DG 1BKBA 1H8HA 2Q2IA 1G8FA 1YQTA 4A3CH 3CD6A 2CHQA 1W5TA 2V55B 3BXZA 4RVCA 3LGJA 1W4AA 3W8RA 2JEBI 3LNCA 3V00A 1H9SB 2D5DA 5EP1A 5DLQE 3MEFA 3QENA 1KMHA 1Y63A 1YNXA 2IYUA 2XGTA 5DYGA 5KDLA 3SE0A 2J41A 4EPRA 3SYLA 1GRQA 2PI2A 4GZYC 5FBQB 1EWRA 1OIXA 4AURA 1FX0B 4GMDA 4A9AA 2JLZA 4PC7A 2K5NA 4UNRA 3CRMA 3TKLA 4G7HC 2E74C 1ZM3A 2ZRMA 5J47A 2IBMA 3B6EA 2PI2E 1AKYA 1HQYE 1N6HA 1V1QA 1XXHE 4PHGA 4Q1DA 3ZD7A 5FL3A 3W5IA 2WKPA 3CNOA 4DSTA 4M1WA 1EYGA 1ELOA 2ZETA 3MCAA 3SJAA 1B9MA 5A5GA 1NLFA 1E1QD 2ERYA 1SLJA 1UM8A 1KKMA 4HLDA 3F5FA 1RKBA 1E0KA 3KB2A 5EE0A 1OXXK 2ATXA 2DYKA 1S1MA 4NYJR 1XD2B 2HXSA 4GN4B 2KJQA 2UU9L 4C2UA 3ZQJA 3I4NH 2GEUA 1LVGA 2Z4RA 5IP9H 1G4UR 1KZ7B 3I32A 5KPJA 1JB1A 3B1YA 1VQCA 1EOVA 3BJIC 1EQQA 2QE7D 5M3FG 5FL7D 4BFXA 1X86B 2BIFA 1E9BA 2PL3A 3HU3A 1DPFA 1AQUA 4NYIQ 4RD1A 4H0LC 2NMVA 3ZZ0A 1W36D 1KXLA 4HSEA 3UDFA 1VG0B 1E2JA 2DUDA 2HCBA 3K0CA 3UWKA 4ARZA 3I1FA 1FFHA 4DV1L 1KMHB 3I8SA 5CLQA 4IOAA 3ZIAD 5DO9A 2ZE5A 1CP2A 2QF7A 1KI3A 1Q90A 2AMCB 4XIGS 4IOKA 2O8BA 4KLZA 3P4XA 2ZYTX 4W5JA 1VQPA 2WFWA 4XWAA 1J90A 4ZCIA 3ADDA 1TQ6A 2BMFA 2F3IA 3U2QA 5CLLA 2Q0HA 4GI7A 4B74A 1LB1B 2KCCA 3UDIA 1X1RA 1VQEA 2D2EA 1JJ7A 1EG7A 3KXLA 3LWNA 4CYMA 3H2YA 5HE9A 4A93H 4JL5A 5AUOB 2OCYC 3BD9A 1LY1A 3UMSA 3W6PA 5M04A 2YU9H 2YJTD 1TQDA 3CPEA 2J0UA 2I5HA 2UU9Q 5DGXA 4HIOA 1YIJA 4LYFA 3TIFA 4XWKA 2ZI7A 4HB3A 1CR4A 1VQAA 4ZI2A 4L16A 4CT5A 1DEKA 3TQFA 4QJFA 3GTKH 4PZ7A 4IPDA 2ZTSA 1G8YA 2KBFA 2ZR0A 2PMKA 2C2HA 2VUMH 4C9BA 2REBA 5FUVA 4RD2A 2CBZA 5JJKA 1NF3A 1L7VC 1XEFA 2BV3A 4FD2A 2WWGA 4ARZB 2DBYA 4B3CA 5F2EA 4LFCL 4IEEA 2ZSEA 4KHZA 2O8CA 2IHBA 1A63A 4DV1Q 4BLRA 5KOYA 2EJFC 2ZSAA 5FTJA 4TYNA 2B3GA 4DKAC 4LCBA 2O8BB 2ZJ2A 2NZJA 3BE4A 3PQCA 3K0AA 1N6IA 4XWOA 4J0QA 1N5IA 4RFVA 2WZQA 2VF8A 1N2CE 3GDEA 3J81k 2EFDB 3TRZA 1UJ2A 1L2TA 4HB4A 4MH0R 1DARA 3R9XA 4TZ6A 2O8EA 3K8YA 5EE5B 1PH4A 1CJKC 1PZNA 4C2MH 1VQJA 4B71A 1Z47A 2O5IC 4OQXA 4B48A 4MYHA 1XMOL 1GITA 2OTLA 2GJ9A 3P20A 2BCGY 1E2HA 2C8VA 2DFLA 2J0UB 4PSVA 3NWJA 3AEVA 1U0LA 4FMDB 1OXVA 4W5HA 3SGIA 1ZNYA 1OH8A 3QXHA 1YZQA 1DE0A 1HE8B 3AH8A 4AKIA 1NY5A 1Q82C 1X8KA 1XZPA 2GBLC 4PC2A 3R20A 1DO0A 2G6BA 4FI3C 3U9SA 4GLXA 2IY5B 4JLNA 1IY1A 4QXAA 1E69A 1AE3A 2VP2A 1LM0A 2AWOA 1NVVR 4XSHA 2JJ1D 4DPGA 2HT1A 3EA0A 2ID0A 1L8QA 4ASUA 5IHPA 1U0JA 2O8CB 4LFCQ 2QZ4A 1GWNA 3AF4A 2GF0A 1TUIA 1EGAA 1SVOA 4MYUA 1VQBA 4DR4L 4Q4LA 3K0AB 5B57C 2ZJ8A 3U60B 1LS6A 4TSFD 4OGQC 4C0KA 1HJPA 3SC3A 1N0VC 4URVR 4IXNA 4A3BH 2FG5A 4NYMQ 1T8TA 2Z0MA 4NCIA 1ZM4A 2YWHA 2JJ8A 4LSGA 2O8EB 1KSJA 3AP2A 4MA4A 1G3IA 3SHFA 1UE7A 3HOYH 1R2QA 1NL3A 1ZM2A 1X6VA 2AR7A 1G21E 2YOGA 4A2QA 4PC6A 1E2IA 2B21A 4NZYA 2W58A 1KNQA 4IVRA 4Q7JB 1FMLA 4QNMA 1XMOQ 4YHHL 2BMJA 2Q9BA 2ZS7A 1UAAA 1ZD8A 4DIEA 3W34A 4D6PA 3B60A 3WRXC 2F1JA 3ZQ6A 2UXDL 3FMCA 3PEWA 5C4MA 2R6AA 3R8FA 3ZDQA 3CWZA 2AN9A 4W9MC 1JE5A 1G8HA 1E2FA 3PO2H 5EXPA 5G3YA 2WAQG 1IXRC 2RH5A 4DBLC 3O8RA 4DV3L 2Z6KC 2H7VA 121PA 2OAP1 2H92A 1OH5A 1FNMA 1M7HA 3KQKA 4A0HA 2GA8A 5F9FA 1GNQA 1H8HD 4PANA 2GZHA 5IT9c 1RE0A 2B29A 2HHHL 5EUMA 1ZIPA 1KO4A 5H8WA 1P9NA 1HEIA 2FPMA 2A1AA 2XOKA 4LV5B 3IQXA 4DR4Q 4DCNA 1W5SA 3U4QA 3J7A5 5AJ3L 1SVMA 3BB4A 3U3RA 4CVNA 5JEAH 1S3GA 4L5QA 4DCVA 1M8PA 3L0IB 4X62L 1P9RA 2ZE6A 1YZ6A 4H02A 3HOXG 1KZGB 5KU1A 1U2RA 4MYTA 4RZUA 2CCGA 1EUJA 3CPWA 1EESA 2KHIA 2BKEA 3C16C 3LLUA 4JYCA 5DHFA 3GJXC 4JI5Q 4Z1MA 3SEAA 3WMEA 1UF9A 1ZUIA 1ASZA 5JI2E 4YHHQ 2WAXA 1GO3E 2XXAA 3A8KE 1OHHA 3CNLA 3HYRA 4PFSA 1I4LD 4M9ZA 1Z22A 3QKUA 2UXDQ 1DAFA 1X1SA 3NC0C 3A8JE 1ZIOA 2CFMA 3TK1A 3ER0A 4G01B 4RCYA 1KRTA 3AVYA 4P33A 3BBPA 2IF0A 4RSGA 4DV3Q 1YZUA 4O2RA 2JLUA 2G1JA 4ERNA 3K70C 2EYQA 4Q9HA 3HOUH 3I4OA 1YZKA 3FHOA 5FOUA 4E09A 221PA 3A0JA 1W36C 2YTXA 4AIIA 1Q7YC 2ZI6A 4C4PA 2HHHQ 1C9KA 1P9WA 1FL0A 3T15A 2QSYA 3EPLA 2B6HA 3U4QB 2CMKA 1KI6A 1OFUX 1YJWA 3NEMA 3KQNA 1FPMA 1CTQA 2WKQA 5FI0B 5AJ3Q 5GVRA 2VW9A 3RZOH 1HCZA 1V8QA 4DK0A 4QHSA 4X62Q 2YYZA 1WYDA 3BAFA 4CT4B 5JRZA 4PZ6A 2ZU6A 2GAOA 5GJVC 1HPCA 2WAQE 2GXQA 3K0EA 1Z5ZA 1Z6XA 2VQSA 2FSHA 3N2IA 3DM3A 1U98A 2XXAB 2F43A 2V6JA 5FBRB 1R0XA 4OHXA 1CR1A 1SKYB 3HP1A 1R8SA 4IXMA 1DO2A 2VHTA 4LY6A 1YHBA 2EFEB 3PEVA 4US2R 1J6QA 4B34A 2EQSA 1GG2A 3E5HA 1ESNA 1SZPA 2X77A 2ES2A 4MQBA 1X3GA 4D4LA 5L8VA 1XPRA 2ZS8A 3G71A 2JDIA 1SVLA 1HT2E 1PA6A 3OE7A 3DL0A 1G64A 4P4SA 1X3FA 3WXMA 2FF7A 3KQLA 4LX0A 1W0JA 1VTKA 2ZYVX 4LF4L 3L2OB 3MWKA 4HJ7A 5C4XH 2OEPA 3BERA 3CCVA 4DV7L 1N6NA 1O7LA 1NKTA 3P4YA 4M53A 4LC1A 4IRUB 4P31A 4WVFA 1DAEA 3AUXA 3KLRA 4FW9A 1XNQQ 1HH4A 4M1SA 3TUJC 1CSQA 1BIFA 4GFDA 4C0JA 1NRJB 4EX5A 4IPHA 1M6NA 2BEKA 1KI6B 2FZ4A 1MIUA 3NBXX 4PPQA 4BA2I 5M5XH 2C78A 1XDBA 1CJTC 4LWCA 2GJAA 4AK9A 5G3ZA 1QJOA 1KJWA 1VCNA 2WOJA 1ZYRC 1PYSB 1AM4D 3AKEA 4QC2A 4OHYA 1Y8NB 4KAXA 4PO9A 5CK5A 5M5YH 2I1VB 4KO8A 4KSBA 2V1CC 2BBOA 3GTLH 4XOIA 4LJ8A 1GL9B 4POAA 2WICA 3QQ5A 2F43B 2R6DA 4NYJQ 5TB5A 1KI9A 3F0TA 3AFPA 3DMNA 3S15H 3M4OH 3FFBA 2CWPA 2ONJA 1X8JA 4EDHA 1I6HH 1JQLB 3KJOA 2C03A 4AKHA 1MO6A 1AN0A 2Z0SA 5IWAL 3CUEF 1G291 4A3MG 2JK8A 1NLZA 2CLSA 1Q46A 1F2TA 3QPWA 4P4SB 2ZI5A 3RWMB 1GM5A 2CE7A 3SOPA 2N42A 4PZ8A 2L0XA 1UADA 1M34E 2VZAA 1BH2A 1QZHA 2XNDA 3DLLA 3EZ6A 3SBDA 4LF4Q 3RLOA 2JA7H 5HCNA 4DV7Q 1WF3A 2W6JA 1E9RA 4APVA 3KJIA 4F38A 2R92G 1XD9A 1JBKA 3B9PA 4ASUD 1G7CA 4NXML 2C9OA 3PCRB 2RGBA 1NJFA 1A62A 4S35A 4JSYA 1E9EA 4B3BA 3KJPA 4E07A 3LXXA 4JG2A 4LUOA 4TN1A 4AC9A 1NNEA 1R9TH 3R7WA 3FE2A 3ZS8A 3ZVNA 1CKEA 1W49A 2PX3A 3B6YA 2GJSA 3QPUA 1C0AA 1VECA 3HOVG 3AVQA 4Q4AA 4QRHA 4KHPL 1Z8FA 5IP7G 2BKUA 1IN6A 1GRNA 1N25A 2JLQA 4IOLA 4JSTA 4OJQA 2ODBA 5AUPB 4PZZA 4LHYA 2RGAA 1R5BA 1JECA 4GMXA 3DXJC 1KY3A 2X2FA 3I4MH 2VPPA 1FW6A 1A4RA 4AY2A 3BWDD 5J40A 3DM9B 1HY3A 5DHAA 4NONA 1NBWA 1KI2A 3OIVA 3FYHA 4JBKA 4QQBX 4NCJA 2N78A 3BZCA 1JAIA 4YQFA 3QEJA 2CKZB 4MKHA 4A3EH 4A6XA 5GJCA 5IWAQ 1F2TB 3CX8A 3PR1A 1QF9A 5JSZA 2ODNA 1SROA 2ZRGA 3OIWA 2E75C 1O78A 5CIQA 3MUFA 3BB3A 1Y1VH 4IFDH 3CCSA 1E3PA 1VYVA 4UNNA 3HKSA 4PZYA 2QGZA 1GVPA 4A3JG 2FPKA 4RZXA 2XJ9A 1E2WA 1KTVA 3A4LA 4IOMA 5DH9A 5DLQC 5SZIA 3NDBB 3B8HA 2J9RA 4NXMQ 4JVSB 2WPDA 1KYIA 4PC1A 2GBLA 1KJZA 4LJ4A 4Z54A 4TKOB 1RRPA 3ICQB 2VEDA 5KNDA 2XOKD 3H94A 3QF4B 4QJ5A 1JPJA 3R7WB 5JEDA 4GRAA 4DLSA 1VQHA 2BHRA 2A5JA 3FMFA 4V0KA 3CCLA
chains in the Genus database with same CATH superfamily
3U40A 4MULA 4KHPQ 3F74A 4WCVA 5ALSA 2DKOA 1NBWB 1AZQA 4OGKA 2I54A 2ZPTX 3SC2B 3ZZUA 1ZUHA 4UNSA 1G20A 1EFRA 4DR6L 5GJWC 3G1TA 2QUHA 4U8HA 1HQMC 1W34A 3UXHA 3VR0A 3EGOA 4XJVA 4JIMA 3NHLA 4ZK2A 1YJNA 2MFIA 4RZ2A 3WRVA 6ABPA 2R92B 1RBQA 3MS2A 2R8RA 1XDZA 2NO1A 1T0HB 1Q3TA 2C42A 5DI9A 1EX1A 3O13A 2OB2A 1F9QA 1ML0D 2EZVA 5THQA 3S99A 3TOZA 1PV4A 2JDID 2C9BA 1P7PA 1W94A 5EKIA 4Q7LA 4PFQA 4JI7B 4QTTB 4WN9A 3BHIA 2B8GA 5H1SE 3EXHC 4TRJA 4L08A 5HG0A 4B3GA 5C5CA 4B32A 3P0RA 1TAUA 4LK3A 3UMGA 5B5SA 1WLYA 4O2LA 1D9ZA 5AJTA 4QTZA 3U49A 4BRUA 4OA5A 5D84A 3WOEA 5CLFA 4CG1A 2QXYA 2QTGA 1DONA 1X74A 3L4SO 2IYQA 1S5FD 3EH2A 1PLJA 5KDOA 4PYMA 3UCFA 2KUMA 3KJGA 4W8GA 2WDPA 3T7CA 1D4AA 5EUQB 1CVLA 3AEQA 4IIBA 3S1AB 1LJUA 4Z5XA 4NBVA 1L9XA 2C4HA 2BGWA 2PZ8A 2QG6A 1AV6A 1OWMA 1ESCA 1L4YA 1MB3A 3HNRA 1OJ7A 5C1DA 1K9VF 2IUFA 3JWGA 5JPMC 3BH7A 1WUTA 3QYAA 3KEGA 1TADA 2CXSA 1EFRD 2YMLA 2PH5A 1Z2DA 4Q1VA 4JYAL 5CPBA 1WCMH 4E32A 3FGZA 1N32Q 2YQ4A 2H2DA 3Q0IA 3AY7A 1RYFA 2C9DA 4F97A 4F60A 3T3DA 2N75A 5LMUB 1E98A 1DBSA 1QANA 4B7CA 5TEWA 1HEUA 1VA5A 2EKLA 3PIRA 3Q0EA 3HVIA 2CHEA 5JAHA 1E0BA 4PSDA 1F20A 3AHCA 1Q86C 2C9ZA 4KEAA 4I4LA 3ENNA 4LF7B 5C3MA 3IALA 3LVQE 4F4DA 1F17A 2H2GA 1K1EA 5K03A 2LCQA 5JCOA 3BWVA 1L5FA 2W4IA 1TXYA 1YFLA 1R0YA 4XWYA 3HYNA 4RY8A 3BJMA 1G8AA 3SXUB 4DV0B 4A75A 2Z2IA 4DLYA 1ENYA 3SEBA 4GLFA 1HDZA 2FMFA 5EFOA 3OESA 3UXEA 1TYZA 5EBDA 3FLAA 4MYRA 2MQHA 4RK5A 1J24A 4UPEA 5G1NA 4QBGB 5KX5B 4YAWA 5ETJA 1RACA 4PIMA 3ZDEA 3GLIE 2OZKA 1E1OA 1U9RA 3U7FB 4AZ3A 3M1IA 1B93A 1HLGA 2XA1A 4QPPA 5I6DA 2J8ZA 1ZZGA 3CKLA 3OJXA 4CKCB 3LC0A 2Q8TA 3PPIA 4MWSA 2XNSA 4IPTA 3A6EA 2QDXA 4ZYXA 3PD7A 4BNFA 1MH9A 3V7WA 5CB8A 3WWPA 4MWDA 2D54A 1Q77A 1DO8A 3LQRA 1TPYA 1Z2EA 2XE8A 3DPSA 2VQEL 5FJIA 4F11A 1ULHA 3AI7A 4MYDA 3ZBPA 1W581 3STVA 3EEQA 2C0QA 3R5SA 5CB4F 3IS3A 3O4JA 2D2VA 2RJNA 4DAYA 2NZ1D 2H7XA 3LGAA 3UFXA 1T5TA 1G8ZD 5HCIA 3DT8A 3NO4A 2OWDA 1Q11A 1UBGA 4QL3A 2XB9A 4H7EA 2IPNA 4YAIA 1GEGA 4YBRA 1K9SA 4CEJA 2JKYA 1QUQA 1Q83A 3R0XA 1NDHA 3AR6A 3ZDRA 4MKZA 5ED4A 4DY6A 3ZQUA 2DBZA 3FFTA 1XZHA 1WY7A 2UVQA 2EX1A 1C1YA 3W1BA 2GZ3A 2VWQA 4RTSA 5JFOA 4PLWA 1KZ4A 4PZ9A 1OTXA 4G0PA 4JELA 1G3UA 3UT0A 4WVLA 4FX2A 5GVSA 1FUEA 2YS7A 3OD5A 2L4NA 5AK3A 3M1LA 1PL8A 5KVQA 4M60A 3RW9A 2Y1XA 4LWZA 4LC0A 4OREX 4QYTA 2OOKA 3HOWG 3QKSB 1GQQA 1FYDA 3WISA 2XZPA 5B3KA 2O14A 3FTFA 3DLHA 2I65A 4NC9A 4QGUA 2C3PA 2OC9A 1ZAKA 1NI4B 2IUUA 3NTXA 1SIOA 5JSUA 4FFPA 1II9A 4NECA 1NYQA 1OI3A 1CY8A 2FWAA 1ND5A 1PTOF 1KE2A 1S1CA 3T16A 3L7OA 2H1RA 1TCCA 1IYZA 4OQFA 1E7WA 1X3PA 1M6HA 1SMYC 5FHRA 3KOMA 4CODB 2VXWA 4GKKL 5FUMA 1T35A 3ZCUA 2R60A 4F6CA 3VAYA 5BN5B 3LDGA 4CIYA 4X62B 4RGYA 5DGIA 1GCOA 4QOEA 4Z2YA 5K3FA 2EFGA 4M1ZA 3S6JA 4K6KA 1DZ1A 3F2BA 3DTVA 2H00A 1DEXA 2N0SA 5LPNA 1QS0A 3IBSA 5GONA 1WTVA 2VF5X 4U7DA 4ANFA 4B4KA 1PJCA 3DBHB 5F1YA 4BLSA 3O3CA 1JWMD 2UXBQ 1L4FA 1W5FA 2AS0A 2UXCL 4MUFA 3LX6A 4S1TA 1U4OA 1F6BA 3Q6IA 2QE6A 2EZTA 4OU4A 3T51B 4Q93A 3WYFA 2Q8IB 3E3XA 2O2IA 2WHQA 3RG2A 2NO9A 4TV8F 3M8KA 4XA8A 4XAQA 3PYLA 2EGUA 5KTYA 5ERXA 1U8YA 5ADHA 1N77A 2OCEA 1UPAA 3GFQA 4MA5A 1Z63A 1VCIA 1WUIS 3B51X 2JA9A 3ZE2B 4DUZL 5HTOA 2W42A 1K8QA 1CRZA 4ZOLF 4RENA 2Q5OA 4FFNA 1DOAA 5E9WA 1FS5A 5CCXA 5CU7A 3FZEA 2OZLB 1V39A 2GEDA 4F91B 4NXMB 3Q9LA 3TVYA 1PQPA 4UREA 3FX2A 1BX1A 4PCVA 2A1TR 3VU8A 3N0XA 3UK1A 5DGHA 3ZE1B 1QP0A 4P35A 4B8YA 4YMSA 2A84A 1WCIB 1DM0B 2GD0A 4G2TA 2C04A 1P1CA 1GUDA 3NALA 3FPGA 2VDNB 1FS4A 4K6LA 1VMAA 4KN9S 5F1PA 4GAEA 3TTUA 3OX4A 3R3VA 1SXGA 1Z4PX 1VJRA 1SDFA 5EY5B 4UD2A 1ZMTA 1FS6A 1FW8A 4KPEC 3SZGA 2EG9A 1WP4A 4LY9A 1U3VA 2HJHA 1LH0A 3C1AA 4M7OA 5HQJA 4RJIA 4XM1A 2VDRB 5M5WB 3EZXA 1DP4A 4H4CA 4JU8A 4MKXA 5LZ7A 1PEAA 2XTZA 3TXYA 3KSAC 2HPAA 2BGMA 4ML3A 1SBZA 4B6FA 3EXAA 4YJHB 1HA3A 4CMEC 2C5EA 3HS0C 3F67A 2R7DA 2R7ZH 2E55A 1ZYUA 1FTYA 1KY5A 4UAGA 4DOMA 5IKMA 4AUKA 4CMIA 4CGYA 3I55A 1NULA 3PUZA 2F0IA 3M9XA 1IM8A 1VQ6A 3D7MA 5JWOA 1JC7A 5KOJA 4BE7B 5LQSA 5EQFA 3PP8A 4D0LB 2KOLA 1E2KA 5J3JA 3DHQA 4QEDA 1LTAD 3ZGVA 4IMRA 1PQUA 2CYBA 1S8OA 1PBTA 4M0CA 4IH9A 2FRDA 1ZRHA 1QORA 2Y0DA 2D3WA 2ERXA 2EIHA 1J06A 1Q91A 2I8CA 1T34A 3I05A 5HW0A 1J0BA 2CFSA 3U4CA 1M9NA 1ZWLA 2W2OA 3N39C 1GSHA 1NJ5A 2V5AA 4LDAA 5FV4A 3HCPA 3E5MA 3QLEA 1U99A 4AYWA 3II6X 1C2YA 5CFNA 4RO0A 3VYTB 3PUWA 4CETA 5LN1A 1OROA 1BYIA 4OYRA 1EK5A 5TSSA 1K4KA 3TM4A 1Y1KE 3A58B 3PWTA 2B3TA 4I9UA 3Q1LA 3OPNA 1VF7A 4AJ2A 3WNCA 4XUCA 4ACAA 2C9MA 4DF3A 3Q9NA 1R4NB 5AUNB 2NP7A 4HQFA 5KJEA 4HYYA 1L4LA 2FLWA 1VMIA 1VQ9A 3VI4B 3SFTA 5KPDA 3X1DA 1N2SA 3UA3A 2GJKA 4R41A 1PT5A 3PF8A 4MHTA 2F1KA 4QBFA 3PWZA 1VE1A 4E5NA 4AG5A 2PMZE 2XCIA 1WMDA 4YCVA 4HR7B 2BDUA 2E76C 1TYAE 5ALYA 3IJ5A 2QCPX 3B6IA 4S1WA 4DR3L 1XU7A 4ZOBA 3RS7A 3H4TA 4M0LA 2J3DA 1EX7A 2WG2A 4NBLA 1S3IA 3RV4A 3L4JA 4C6SA 3MHPA 4XGRA 3L7ZC 3G0CA 1A5ZA 1PWEA 3PLNA 3WLNA 5K05A 1H05A 3L43A 4K9NA 3NVDA 1HE3A 3O38A 1QR6A 2GM3A 1B0AA 3KJEA 5T8KA 3AX6A 3WLSA 4PE5B 2AI1A 1YC5A 3FYUC 1SE2A 3OPYB 1P44A 5LU9A 2AZTA 1KQGA 4C3IG 1ISIA 3CC8A 1MC5A 1JJBA 2VAPA 2KSQA 2ODAA 3Q7EA 1QZUA 2IC5A 2QRMA 2Z30A 3UWOA 2BL4A 4N18A 2GCOB 1Y9DA 3MAJA 3SMQA 1AIPA 1BQQT 2C20A 4GYKA 2Q3BA 4CM4A 3IELA 4RJJA 4MDYA 1D4ZA 5GV8A 4RXUA 2PH3A 1C8KA 1TPZA 1QHHA 1BOOA 3G2JA 5BV2P 3GLHA 5KYWB 2K5UA 4QLBA 3PWSA 1QTQA 4FNGA 2D7DA 2LXJA 2JATA 2GO1A 1ISHA 1T3TA 2ZTLA 4UU8A 1X94A 5GY7A 2KE5A 2D5LA 4B9WA 2Z5VA 4A3LG 4GNKA 3WYNA 1Y1WG 2LKCA 3W90A 2AD5A 4DK6C 2EL9A 1CUKA 4M46A 2CVQA 1HHVA 1ABEA 5WRFA 1X7GA 4KQ2A 3WQSB 5KJFA 3T7TA 1XSEA 1ZHHA 2X0RA 2PZFA 1HNZQ 4TVBA 2KENA 4PV1C 3MF4A 3GFBA 5B2FA 5A4AA 1EHIA 4L22A 3MXGA 3FGOA 4ZALA 4DLPA 3JZFA 3FTCA 4LDRA 4YFYA 1Y3BE 5LBTA 4WESB 3I9MA 1FXWA 4AS3A 2HA2A 3FNGA 4IF4A 1Z0ZA 1IKMA 1QGDA 3L4BA 2J87A 5TVKA 1KVRA 4HTAA 3KYDB 1SMXA 1Z75A 1K0SA 1V4VA 4MLZA 1RI4A 5JVDF 2A0UA 5JPNC 1ND6A 2R61A 2QP3A 3AFNA 3LPNA 3L92A 1Z13A 1NYTA 3O2JA 1R50A 2RIRA 3OZCA 4B6EA 2LCIA 5CJPA 1LI7A 1HDRA 1LABA 2CNLA 3VV3A 2NUPA 1KF0A 2K14A 4BBZA 4JQYA 3ZHUA 1T3SA 1P5HA 4GYYA 2OZVA 3QNMA 3ROKA 3T1NA 4OXXA 4RELA 1Z0KA 3KSMA 2JGEA 3NWOA 1FYWA 3LDAA 1TEVA 5AKZA 5LIRA 3I1JA 1SVUA 4E6PA 2EKDA 3M4XA 5LMNQ 2WTAA 1LV9A 2WDZA 4O02B 3HI6A 1H69A 2IZOA 1EVLA 1GDHA 2Z56A 3DNPA 2SHKA 3IQDB 4MIEA 2INGX 3P2OA 4WK4B 2QTFA 3PGXA 4U8GA 3NRCA 2OMEA 4JUIA 3JR3A 4CEHA 5K0BA 4UE3S 3OLZA 2Z4IA 3KDSE 4ARCA 3EZ7A 1OB2A 1RTOA 4OQQA 4OHMA 4FBMA 2JFNA 3OEYA 3G1UA 1V3VA 2EYHA 2J4DA 4ZMBA 2J5QA 5EJ4A 1JUDA 1WKVA 2CT8A 1Z82A 2XGTA 1GRQA 1H6CA 4C4AA 3GVPA 1SBQA 4G7HC 3TMAA 5J47A 1HQYE 3JU3A 1RQ2A 4IINA 4TYMA 4BVBA 5EE0A 1W96A 4W9NC 5FA6A 2A35A 3LUJA 2BEUA 2EY2A 4F46A 3HSYA 2OO3A 1C14A 4MV3A 2OGWA 2DUDA 4Z4CA 1QVVA 1HDCA 4DQLA 2I4RA 3TFQA 2QF7A 2AMCB 2K4MA 2WFWA 1P1BA 3F4LA 2VBFA 1UBOS 3OUZA 5KB3A 3EBOA 2J0EA 5AW4A 4RKQA 1H5UA 4R8SA 5FUVA 1NP3A 2A88A 5B2EA 4LDZA 2ZSEA 1A63A 2HUNA 2VVTA 3TEMA 2O2ZA 1STAA 4EFDA 3L0BA 2WFLB 2FCRA 4TWIA 1DARA 4DQKA 1P7VA 3DEJA 1NE2A 2UVDA 1IUNA 3KV3O 3QXHA 1E4EB 3AY3A 3NHFA 3O93A 1V5GA 1K7YA 4RIIA 2RD2A 3CXRA 2QZ4A 3N3AC 4FYPA 4NRDA 5JQGB 5C32A 1LS6A 1RQNA 2H9YA 5E4JA 3W2GA 2O8EB 1YZVA 5EHIA 2C2KA 1KNQA 3I1YA 1FMLA 1QM5A 1XRQA 4K0KB 1LI4A 1E89A 3AHJA 2H2HA 3R8FA 3ZDQA 4RAOA 1E2FA 2W6CX 2WAQG 1CQWA 1GTZA 2Z6KC 2D3TA 3KPJA 2K6GA 2GZHA 3L5KA 1P9NA 2B36A 1O94C 1XTVA 3BB4A 3U3RA 4PYOA 5I3ZA 1OI4A 1XK6A 4LSMA 3FTDA 2EY5A 2JNWA 4JN6B 2BKEA 1VJCA 1NQWA 4ATNA 4G0WA 1CHPD 3CNLA 1I4LD 2XVAA 2UXDQ 1ZIOA 3KTOA 3LKDA 1MAWA 4RSGA 5D5PA 3N2GA 4ERNA 3EWNA 3HOUH 1YZKA 1EJ6A 1XDSA 3EMDA 4FGJA 1FL0A 2FW1A 4UTVA 1JA1A 4BGIA 2I6QA 3AYZB 1X80B 4X64B 1V8QA 5IBRA 2CLEB 1J5XA 3ZWWA 4D98A 3HGTA 1R0XA 2Q6OA 3WK9A 3NUGA 1J6QA 2FG7C 3GTMB 2X77A 2ES2A 2Z08A 4GLJA 2HDHA 3DNMA 1HT2E 1NI5A 2XB8A 4P4SA 4K6MA 2P78A 4M53A 2Q0SA 4NARA 4J90A 1KYXA 1CFJA 2PGNA 1KS2A 3WYBA 4LWCA 2OD2A 5DLDA 3MAGA 2Y9MB 3I76A 3ACDA 4DLAA 1N2EA 2ONJA 3D6VA 3A9VA 3AFIA 2C03A 1F2TA 3L8DA 2PZUA 1GM5A 2M2LA 2L0XA 2Y27A 5I4CA 5D51S 3FOEC 4QZVA 1E9EA 3JYHA 1MENA 3DO5A 1C0AA 1GRNA 2SICE 2RGAA 5C35A 3LYHA 3I4MH 4AY2A 2C1ZA 3FYHA 3S28A 1BNCA 1TK3A 3UOGA 2ODNA 2Q49A 3LOPA 3H09A 4TRRA 1JWBB 2IY8A 3IESA 3B8HA 4JVSB 4OSOA 2FN8A 4PZ0A 1VQHA 1PJ4A 3R75A 4V0KA 4HWGA 2WU4A 3ZXUB 2J85A 3CM0A 3NXWA 3EASA 4BYMA 3VNQA 4KXVA 2XITA 3ZV7A 3AR4A 4EI9A 2BSAA 4P5DA 3PXEA 4U7PB 3TW6A 2VSOA 1YOVA 2IEBA 3OT5A 2RI1A 2B2VA 1N78A 2P2NA 3NBHB 4LNUB 4CCYA 4EY8A 1DKUA 3ANLA 5JSHA 3VFDA 1P29A 5BRAA 2EJBA 3HXKA 5DBFA 4ZGBA 4MR8B 3VYRA 5C4JB 4TQUS 1TEXA 2HMAA 2WQZA 4KBGA 2BFEA 2H5JA 2SBTA 1UBHS 4OXKA 3TS0A 1BVRA 4C0SA 4YCWA 1QZXA 3OWXA 4P3KA 1JEOA 4WXPA 4GGMX 3IAUA 3G9XA 4MRPA 1QIGA 5FNZA 4S04A 2E4WA 3AFHA 2HDNB 4ZCSA 2WJPA 4ALMA 2BI8A 3IMCA 2GAAA 4Z4FA 2PKQO 3D2LA 1QK4A 2JA5H 3CLKA 1KLGD 4QCLA 4DWVA 1P5RA 1Q7GA 2P2SA 5FB3A 4NJEB 2FDCA 4Q9NA 1XO1A 3AVWA 4EUKA 1E96A 3DMDA 1ZR2A 3NEAA 2RG7A 3IBGA 3QPVA 1AUPA 2P9QA 1AKNA 2ONZA 2I66A 1FNCA 4HAVA 3EA6A 3GLUA 1M2EA 3E3LA 5HM8A 3IPLA 3EC1A 3HVUA 3GZJA 5CYOA 4P1ZA 2WIFA 4JWKA 3GJ6A 3ZHYA 4A76A 5JBQA 4K86A 5YASA 2WOOA 2C99A 2O1XA 5HWSA 4GM0A 4UBJA 5A4IS 1O87A 4J07A 4M6WA 3QPBA 4NICA 3DTNA 3GVHA 4HZUB 3IOMA 5HX7A 5T3UA 1G5FA 5IN4A 5AO9A 1M2KA 2DERA 5C3XA 5TQJA 2WM3A 5IFKA 1ODCA 3RTDA 1XU9A 5E6SB 3NDPA 5EGNA 3RFCA 2JIBA 2PO7A 4ZO7A 4F0JA 3CLTD 2GZDA 1AK2A 3DDWA 1YASA 5EZYA 1NM5A 2COUA 1GQYA 3B13B 3VHXA 3NOOA 4YY3Q 3IO3A 1WQ4A 1IBMB 3S17H 2Q7DA 4TYPA 4Q39A 1P1RA 3FA2A 4Y0AA 1BEEA 1IK6A 3DFIA 2CJWA 3Q98A 3I58A 4QUCA 1F2DA 2UZ1A 3I8OA 3QX8A 1O08A 3VDYA 4BLVA 2XB2A 5FUQA 4E2WA 1NQOA 2PE5A 2GD1O 5JWHA 1KL7A 4QYSA 2YQ5A 5CORA 3F6RA 1B0ZA 4MRRA 2FMHA 3I53A 1KIXA 2GZAA 1JG3A 1E4EA 4TMVA 5LQCA 3DDNA 3Q8XB 1E9SA 1Z62A 4DA0A 1Z74A 4ARIA 2ZRDA 5EMHA 1QK3A 3IT2A 4GKJQ 4RH1A 1ADFA 5D86A 1PR0A 3UZUA 3GUCA 4FR5A 1CIVA 2M6RA 4I7AA 1FJHA 2FXIA 1PJLA 1DBWA 2DSTA 2ZJ0A 3BT7A 4KMRA 4LWOA 3KQWA 3K9GA 2J3HA 1AXEA 3PQ4A 3BUSA 2MIIA 3A2LA 1TMYA 3A2KA 4P86A 2O0MA 1C9OA 1TUEA 4M0EA 1BJRE 3QBVA 5TPWA 2Q3DA 5KNBA 4LHWA 3BDAA 5F21A 4C0HA 1HYQA 5EJ8A 2VP6A 3QVUA 4S1PA 4AP9A 3ERSX 5C0XH 5JOQA 3F6YA 1EY6A 3ECAA 3NBAA</