1OXTA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 95
structure length 352
sequence length 352
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxtA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxtA01
3DM5A 2BA0A 1BIFA 3BFKA 4YDHB 4DCTA 5CB6A 2V3CC 4JLOA 3U2QA 1VHTA 1QUQA 3C15C 3GFPA 3OPOA 4YY3Q 1HV8A 4PC3A 4F7WA 1F2UA 4WAUA 1Z6HA 3HKZG 2AD1A 4TL9A 1JR3E 4B47A 2K4KA 1E2QA 3A8TA 2OWOA 2F4VQ 4PHFA 4L5TA 1UE6A 1FPMA 2VHCA 1YHNA 1XZPA 1VQMA 4M1YA 2IYRA 4OQXA 3K0XA 4UPAA 2A5JA 3IIJA 3OAAA 1IY1A 3UWKA 4G5SA 4LYHA 4Q4AB 2QP4A 5HKKA 1IN8A 3PITA 4NXNL 1QZHA 4O2LA 1AE2A 1JR3D 1NG1A 1P62B 2PEZA 4TSFD 3TUZC 2J0QA 2C98A 2IUSA 2ZJ5A 3RSOA 3KYHC 1XXHB 2IF0A 4UP9A 3L0PA 3MJHA 4Q7JB 4BUJA 4HUQB 3OE7D 4LJZC 3RZOH 3RR5A 4TT3D 4BEBA 2B92A 2D7DA 1TWAH 2JLWA 3DKVA 4Q01A 2ODWA 3B85A 5B64A 5GAGC 3U3RA 1CKOA 5GAHC 121PA 4RKEA 3U6KA 2XJ4A 3FKQA 4M1OA 2R62A 2DNCA 5JS8A 3EPLA 4JI3Q 3WRXC 1Q46A 2QRZA 4JSTA 5D3QA 1OYYA 4BFVA 1PH6A 4LV8B 3GLGE 1E0AA 4QY7A 3I72A 1EOVA 1F5NA 1S3SA 2X77A 3DDCA 1NY4A 1X65A 3QF4A 5FI1B 3KTAB 1EWHA 5BN3A 3EPJA 4JYCA 2AXPA 3ZVMA 5J4KA 1E1RA 4LSGA 5CITA 2W6ID 1E99A 2JATA 3HOUH 2DHRA 2KBNA 1OFTA 3T15A 1S72A 3R7WA 5BXQC 1LM0A 3L0IB 4IRUB 3DM3A 5L3QB 4YDSA 1OIVA 2Q9CA 3MRSA 4P33A 5E4FA 1KI4A 4JI8L 4TN1A 3EPHA 3ECCA 5FLXc 3ADBA 4GZMA 5IWAL 1PH4A 1GSIA 3H3VI 1M7BA 3QF4B 1KO1A 4MKGA 1H9MA 3ZGXA 5BWMA 2NZHA 1I4DD 1XMOQ 2HLDA 3G82C 2A9KA 2BA1A 3FMOB 2CFMA 2LXKA 3A8KE 2REOA 5IE8A 1JAIA 3FGNA 4KVGA 4LRWA 3AQQA 2FE4A 2ANCA 2AN9A 3PR1A 3GDEA 1GL7A 1QZXA 2K32A 1R7RA 2D7CA 2XB2A 2E8GA 3CNNA 3GFOA 5FOVA 5B30A 4A15A 2DCUA 5AJXA 4LGMA 2ZYVX 2CHGA 1SVLA 4ARZB 2VZAA 2ZTEA 1IW7C 4GN5A 1E9RA 1SVSA 5C0XI 3C5HA 1N5KA 3EW9A 3QI2A 4E03A 2ONJA 1HURA 1MR3F 4OXPA 2PX0A 3QIAA 3L43A 2B8GA 2K75A 2UVQA 4NXML 2ID0A 2AKAB 5HE8A 4Q02A 4C0KA 1HQCA 3IDQA 2EYQA 1N5IA 4BFUA 5K8LA 1IW7D 1NNEA 2AUJD 1NL3A 3LX5A 1GZSA 4DUYQ 1H8HA 3TNFA 5KOYA 4KSBA 5L3SB 1Q1ZA 3DLLA 4TKOB 3E0EA 4FDBA 1FNNA 3SYKA 2QORA 2ZUDA 2RB4A 3ZD6A 4OWTB 4M2LA 1M74A 1NMGA 1S3OA 3LXRA 3B2EA 4M1TA 3NDBB 2K33A 3ZJYC 3AKCA 5IWAQ 4OK3A 5B57C 1VQOA 1XPOA 1D5CA 1BMFA 3H84A 5JJLA 4GT1A 5L3QA 2E2JH 3EZ9A 3WBKA 1C4OA 1VQ5A 1BO6A 2CQOA 1Z07A 1GKIA 4FMCF 4TQUS 3FMPB 4QRHA 1W48A 1ZBDA 1GHJA 1E9SA 1IYJB 5JEAG 2J87A 3T06B 1TF7A 3EX7C 1UE7A 5GVSA 2N8NA 3HOYH 4ZCLA 4B6EA 5C0XG 2A68D 4DSTA 1U94A 2JJ1D 1AS0A 2VHQA 3U60B 1F2UB 3FPAA 2Q9BA 1CKMA 2ZREA 1WP9A 3N2IA 4TQAA 4EUNA 3JVUA 4CEIA 5DIFA 4KKUA 1LF0A 1CRQA 1N6RA 4E09A 3D7MA 1US8B 1AIPA 3IILA 3BRWD 1H9SB 1VCNA 4WOPA 4WXPA 4Q18A 4MYTA 1II8A 2DY1A 3UDIA 3G71A 2GEUA 2A69C 2GJ9A 4QJ5A 5JWRA 1JJVA 4JLJA 2O0JA 3DOFA 4JI6Q 2OLJA 1I4TD 1MO6A 4YWMA 4RKFA 1KK2A 1KO5A 5FR1A 4C4PA 1R0ZA 2QRNA 2RCNA 2GBLA 2CL7X 2RGDA 1I4LD 4PZLA 1KQSA 5K8UA 1Y8NB 4B75A 3B60A 3RS0A 3A1TA 1J6QA 4TT3A 2PNRC 1KZGB 2ALYB 4OX9L 1NMXA 3HOZG 1Q8KA 3AYHB 3B78A 4RD6A 1GRRA 1RC8A 4LV5B 5EP2A 1NJIC 4GKJQ 1KK1A 1E1OA 4O2RA 5M5WH 3NBHB 3MXNB 1HR0L 2OEPA 4IDNA 3CCMA 3HOZH 4M9SA 2QE7A 4OJKA 4Q7KA 2ZI3A 4QQBX 3IRBA 3E1SA 3MGCA 4LJAA 4YHHQ 2AFIE 3PVSA 1G18A 4V02A 4EKDA 3GLGA 1X1RA 2B8FA 4KKSA 1RKBA 2OCAA 4NDZA 4NB3A 4B74A 4Y52H 3RRZA 3CR8A 2YOHA 4C3JH 2IYQA 3AH8A 4EIWA 3WYAA 2ZJYA 1YVDA 2P6RA 3U7FB 2ZSFA 4IFDH 1ODFA 1L1OC 2GZHA 2QPOA 4YHHL 3CUEF 1QHGA 3QPWA 1CSPA 4X66L 2E87A 3WMEA 3B8HA 1M7HA 1YZKA 1KMHA 4OYHA 2GAAA 1HR0Q 2LKDA 4NL4H 4MTNA 2Q2TA 3AEVA 4DEXA 5KDOA 3FTQA 3AVWA 1IJFA 3BK7A 4NYIQ 2HLDD 4PZ7A 2OBMA 3GLIB 2OFOA 1EWQA 3TQCA 2FJUA 4Q1EA 3CAMA 1E9BA 1XMOL 3K7AH 1PHJA 1NKTA 4KHZA 1NVUQ 4PAOA 3CR7A 5LDDC 3TUIC 4DVGA 1GUNA 2NVTH 2IXGA 1TEXA 2ZRGA 1S8FA 4R7ZA 1EQRA 3P20A 2WPDD 3CPEA 4NP6A 1KMHB 3L8YA 3KKPA 5DSZA 3FKSD 3NBXX 2J9RA 4MGKR 1XMQL 1VDZA 3D6TB 2Q8IB 3NE5B 1Y8PB 1EG7A 1ONLA 4O2DA 4MRSA 5FPTA 4A6XA 4CZ2A 4CEHB 2UUAL 4AY2A 4RMFA 1GUTA 1J70A 1T6NA 3DO6A 3HPQA 5M3FH 1EFUA 3GLHB 1NN3A 4F91B 1VQHA 2F1RA 4DAMA 3IHLA 4V0ME 1Q20A 2EDGA 5IYCH 1AQUA 2WJYA 1ZJ6A 4IPCA 2YZ2A 1XEWX 3PUWA 3NIBA 4LJ5A 4LJ8A 4RD2A 1G5PA 4IJLA 2WWYA 4V0KA 4MQBA 4HI0E 4BFWA 4BA1I 3KB2A 3TW4A 4DLVA 3CCSA 2UUAQ 1KTVA 5C4MA 4R4TA 1KNXA 3KKQA 1G19A 4IDOA 2V9PA 4EQ6B 1FTNA 1KL9A 4ZDWA 4IJMA 2PJRA 4IHQA 3U61B 1RZ3A 1P5ZB 2GXQA 2J46A 2QY9A 2WWHA 4BY7G 1MH1A 3KOJA 2MSCB 3WDNA 2IYZA 1G3MA 4JL8A 4PV1C 3SHWA 4CRWB 4EJSA 5TY0A 1HH2P 4YWLA 4M1WA 2IX0A 1EESA 1AGRA 1TU3A 2XZPA 4A36A 2GILA 3OIYA 3ZD7A 4IXNA 4HAVA 1XDBA 3WXMA 1B9NA 1CP2A 5FLMH 4DNTB 4DV4L 1R9TH 1R5BA 2KWIA 4M1SA 1LB1B 2GVZC 2H8KA 4C30A 2YTVA 1DO0A 2R7FA 1AQYA 1OHHD 3WBJA 1JI0A 4L8GA 4IDHA 3RABA 2AR7A 1T8UA 5M3MG 2E9SA 1E2EA 1VQJA 1VQGA 1KDPA 1OIXA 1UKZA 1YJWA 1VG1A 4PSVA 4RZUA 2P6UA 4Z1MA 4B2PA 1PH1A 1ZIOA 3OW7A 1G6HA 1U2RA 2EWVA 3RC8A 2W0SA 1N32Q 4QM7A 2Z0SA 2VPPA 4KV9A 2B21A 821PA 1Z06A 2HHHL 2MQHA 3TUJC 4A82A 2AMCB 2R7ZG 2ODNA 3K81C 2R65A 5J47A 1GUGA 4C0JA 4MKFA 4B3DA 1D9ZA 3NC1C 3M1IA 5D3MA 5FL3A 4Q1CA 4UJ3A 3SYLA 1CEEA 1QVCA 2J7KA 5GQOA 2ASEA 5LB4A 2IYUA 5HZKA 5DLQC 2QMOA 3ADCA 3M9BA 3NC0C 2B8TA 4GOPB 4DR7Q 3KFXA 4GN4B 1OW3B 5BR8Q 2BEKA 4TLDA 3H3VH 1R8QA 2JEBI 4DJTA 4KMUC 2E2HH 4DIEA 4MYCA 3A4LA 5JCZA 4DB4A 3IPYA 1VPLA 4OHYA 3OEEA 2UXDQ 2BCGY 3I4NG 4GZYC 4ZDKA 1D8TA 3GEHA 4FN5A 2FPLA 2JJQA 3O8CA 2YC2C 4AURA 1G9XA 1Q44A 2A6ED 4DR5Q 4GSYA 4A3IG 3TAUA 4QIWE 2X8AA 1SE8A 3QKRA 3QVUA 2D0PA 4UXIA 5EXXA 4ZKEA 1N9WA 4Z54A 2Z4RA 3FMFA 1E7ZA 1U81A 1G3QA 2ZRCA 2WVJA 4QGFA 4DHEA 3KQUA 1AS3A 4PHHA 2J59A 2FV8A 2JEOA 2ZETA 4ASUA 5F9FA 3V9PA 3B82A 2IWRA 3I73A 1PV4A 1T91A 1Z28A 2GK6A 3EG5A 3HOYG 3FHCB 5G40A 3CPJB 4IVPA 1KI8A 2UZ3A 2QZ4A 1Q7YC 2FMXA 4Q19A 4L16A 3QG5A 4X64Q 1EWRA 2V7QA 4MYHA 1ELOA 2IS2A 3KUCA 1UEBA 5IY0A 1TU2B 1I6HH 3X1WA 1W2HA 4OQMA 2ZVPX 3QKTA 3E9IA 4HAUA 4MUBA 3RWOA 2ASBA 5JS7A 1NKSA 2VEDA 1G4AE 1W5SA 5C0XJ 2CKZB 2HF9A 3J81j 3R9IA 2DPXA 1BKBA 4P4TA 4HIKA 1L7VC 5ELOA 4DEYA 2GBLC 1IBKQ 4Q03A 3UDXA 3P32A 2VW9A 3PCRB 2LWIA 2B63G 3U3JA 3GLHA 2ZQ5A 1JE5A 1XZQA 2E75C 2O5JC 1SULA 1U0JA 1HH4A 2C2HA 5EUMA 4DNRB 4NCHA 4F4CA 2RKOA 4LF6L 2CMKA 2NPFA 3T1VA 3UIEA 3J80c 1X8LA 4C3ZA 2KB0A 2GF9A 3MLEA 5DO9A 2OQ0A 1GVNB 2YC4C 1HQYE 3WRYC 4A4IA 2R9VA 2V4ZA 5CLQA 3O8RA 2DWPA 3DKPA 2YHSA 4WZBE 2WIAA 5FI0B 4I4LA 3D0FA 1SKQA 3VX4A 1W0JD 4C0SA 4OX9Q 4LHWA 4ZCIA 1C9KA 3AB3A 3F1ZA 4BFSA 3ZVNA 5BR8L 1GKHA 1CSQA 1E9CA 3AQ4A 4DLZA 2JCSA 1LW7A 1SQ5A 1N34Q 3U6BA 2G0NA 1LY1A 4Q4AA 1E0SA 1X3SA 2IYWA 2JJ1A 3CD6A 1FMLA 1XD9A 1W36D 5JI2E 1GJXA 3RLOA 1Q21A 3F2DA 1Z6YA 4RFSB 3VQTA 1K8MA 4O3MA 1K9MC 1K8AC 1LTQA 1XP8A 2D5DA 1E4VA 1HTPA 4H1UA 1E69A 4DCVA 1KI6B 4P74A 3UDFA 4A3LH 2OILA 1CS4C 3JZMA 4HZUB 5IP7H 5H1YA 2V1CC 5DGXA 3K09C 4NTZA 3CWZA 3EIHA 1Q81C 5FTNA 4I1UA 4Q7MB 1KC8C 3WMFA 3IO5A 4Q1AA 4ABYA 2QG6A 5JLJA 2FWRA 1PUIA 4LJ6A 4NYMQ 3KKOA 1SFOH 4GZLA 3VX3A 1LUZA 2VS1A 2QMHA 2XB4A 1WJJA 2MFIA 2KENA 3MWKA 3P27A 4JIMA 3FMCA 4HLDA 3RVBA 4DV0Q 1OHHA 1HY3A 1SHZA 2L0XA 2YTXA 2OFXA 3IGFA 1YQTA 3H1TA 1TWHH 1W4BA 2CE2X 1HUQA 3CX6A 4FMCB 1WQ1R 3H15A 1IOZA 2P65A 4B6FA 2C99A 4U5XA 1V5WA 1JMCA 5IP9H 2P3SA 5E7NA 3BH7A 4MZ9A 1K3RA 4MRNA 3T12A 3OZXA 1BVSA 4LC0A 4L5RC 5J4LA 2JA8H 5F98A 3LVRE 1FYCA 3CC4A 2PMDA 1GWNA 3Q8DA 3I4OA 3GTJH 4HJ8A 1ZRHA 3EWAA 4ZKDA 2PI2E 3MUFA 3ASZA 1LYLA 1HNXL 1T3LA 4QL3A 1WFQA 4HZIA 1AN0A 1YIJA 1M90C 2OTLA 3CPFA 3ONWA 1G8GA 4K46A 2EFHB 4NBSA 4D2IA 5EJEA 5DN6D 3SI7A 4DRZA 4G5RA 1NSTA 1KI3A 2GWHA 1Y69U 2GXSA 2H16A 3EC1A 1Z3IX 3TKLA 3K70D 1VQIA 2ZTSA 2PQAB 2AFHE 2NO1A 3CCEA 4P3YA 5CM8B 3TK1A 4WZ6A 2K5VA 4J15A 4A3FG 1XMQQ 1MO4A 1WRBA 5HCIA 1TPZA 2VP5A 1Y1VG 1G6PA 1WE2A 1NVVR 1I3QH 1PH7A 1RRGA 2DFKB 2FNAA 3BJUA 2WWFA 1Z83A 3HKSA 4B35A 1PA6A 3S2DH 1KJYA 2QP3A 4ESHA 2MMGA 4PPNA 1UBEA 2HEIA 2OCPA 1Z22A 3PUYA 3A8IE 1M7GA 1S2MA 3R9XA 2AKWB 1YR9A 1DXMA 3QKSB 1D2NA 4QNRA 5JRJA 2IT1A 4FW9A 1Z0JA 2H1LA 3W6OA 2ZJ8A 1DARA 1X1SA 2H18A 2XNSA 4OK5A 4EQ5A 1NLFA 2GHIA 5JSZA 1G17A 4XJXA 1X8KA 4IEIA 2JIZA 3BH0A 1XMIA 1BBWA 2FSFA 4Q7LA 3KJHA 1HCZA 4GDFA 1XCPA 2UXCL 5JBQA 2F55A 2P5TB 1E2NA 2VP9A 2V7QD 4R4QA 2W6JA 4TYQA 3VTKA 3F3YA 1QVRA 1T0JB 4TWZA 3HJNA 2QU8A 5M3FG 3ZQ6A 1M6NA 3SQXA 5FBVB 1MABB 3K9NA 3M0EA 2GEVA 4RY2A 3RRYA 3T1OA 1W44A 4DSNA 1S3GA 3KXIA 2ZRJA 2O8FB 1NBME 2GCNA 4DUGD 1YZQA 5FBLB 4G7OC 1Z2AA 3TS0A 2YWEA 2VYFA 3PFIA 3S1QH 521PA 2D2EA 4HDQB 2WB1E 3Q9LA 4M21A 2CBZA 2ZTDA 3SBEA 4X65Q 3KFUA 3U58A 1KRTA 3IPXA 1ZYUA 4TTQA 3GLGB 4GL2A 3CCLA 4QFMA 2LCFA 2IYLD 5C44G 1P9NA 1UKEA 1XEFA 1Q82C 3BE4A 2ATWA 2N3SA 3OF5A 2OAQ1 1FGUA 2D4HA 3RHFA 1N6NA 1WMSA 2I1QA 3VDYA 1IXZA 1T3SA 4X8LA 3GLFE 2L5TA 3ND8A 4C0AC 1JALA 4A3EH 4U00A 4YCWA 2WMOB 3FOZA 1MV5A 1TWGH 1W0KD 5GADl 4MGYR 2HIXA 2RGXA 3RZDH 4DR6Q 3KTAA 5FFMA 1BDOA 1B8AA 3NELA 3K0CC 2VBCA 4NE2A 3TGPA 4MDEA 3M3YH 3VKHA 5EE3A 1CI3M 1N33L 4JVNA 4D0LB 1HNWL 2C78A 3I4NH 2CJWB 2IYYA 2VHJA 4A76A 2GXUA 3CNOA 2YYZA 3IEUA 1OFUX 1K8GA 2BBTA 5LD2C 4TTPA 3HOUG 3QBVA 5M5YH 1HJPA 1K0RA 4M22A 3NWJA 3VKWA 4DAYB 3AF2A 3TAHA 4KITB 1X3FA 3PIPA 3OTOQ 2CEAA 4OHWA 3LD9A 4DUZL 1LS1A 3ADKA 3ZDQA 1UDWA 4IW3B 3T34A 3HR7A 4DCNA 3I5XA 5LMUQ 1IN7A 3FFAA 4KFSA 3LLUA 4TLCA 3SN6A 3T61A 3ZIAD 2C77A 4PMWA 1NN1A 1VQPA 4UXJA 2D62A 1KNQA 1Y3AA 4Q9KA 1B70B 3HOWG 4JI1Q 4C9BA 3HU1A 1SZPA 4FINA 2H5EA 2NO0A 1U8YA 1AK2A 1FP6A 4LF6Q 3UMRA 1YNJC 4LNQA 2O0KA 2Z0MA 1K5GA 2ATVA 5SZJA 3JZAA 2WAQE 3IEVA 2CCJA 1XTSA 5F2EA 4EQ6A 4DKAC 1X9NA 2AX4A 3AVQA 1YZLA 3H4MA 2MNAA 1DO2A 1TQ2A 1DD2A 3R8FA 4IFBA 1MIUA 4K0KL 2GCOB 2YV5A 4WW0A 5CJPA 3UG7A 4EX5A 4JI3L 1H65A 1VG0B 2W0MA 3KJOA 4ASUD 2I3BA 2IL1A 4Z51A 3TEHB 3QXXA 4LWCA 2R93G 5GJWC 1CF4A 3BG3A 2ZE8A 1RJ9B 4LF4Q 4LBWA 2FF7A 2F43B 4OK6A 4PSKA 2O8EB 1IJEA 4B3ML 5EP3A 3AVVA 3MD0A 2F1JA 4BE7B 1E2GA 3VHXA 5AJYA 5JI3E 4B3GA 3LNCA 4WXRA 2K7VA 1GUSA 1OXTA 1NP6A 2ZJ2A 4C0LA 4TQ9A 5ELXA 1DS6A 2OQKA 1VQAA 3LNNA 1CULC 4OWXB 1F2TA 1UE5A 2A5YB 2BBWA 2RGNA 4LK1C 1AM4D 3A4MA 5SZKB 2C96A 3W3ZB 4NYJQ 2LMCB 4B3MQ 2FGJA 1OKKD 6Q21A 5FUVA 4LFBL 4MNOA 3IBGA 1YZGA 4BZXA 4HR7B 1G4UR 1U8AA 3EIEA 5JCPA 5D3MB 4KLZA 3UKDA 4URWR 2HV8A 3I61A 1NIJA 4P73A 2GVDC 2ZE6A 4E5UA 2GNOA 1KY2A 5CM9C 2OO7A 3CQZH 2GF0A 4UQOA 4UNPA 1X3EA 3KLWA 2ECKA 2B7BA 1MKYA 1JT8A 3C16C 4DSOA 4DR3L 2ZRIA 2HQLA 2V6JA 3B1XA 2F7SA 4DUGA 5IF9A 3QNUA 1T0HB 1NBMA 4G3XA 3FHOA 2QAGC 5BW8A 3KF6A 4JV5L 3S14H 3GJ8A 3CF6R 4WIAA 4Q00A 4BA2I 4OQFA 1SLJA 1NIPA 3DPUA 4AG5A 2QGNA 4D4LA 4I1OA 5FUWA 1QHYA 3LY5A 3PV0A 4PQYA 5IDVA 2C9CA 3RNLA 1GO3E 4XIGS 3MG9A 1KJZA 3HWSA 4DV6Q 4DV3L 1WOCA 3VR5A 4M1MA 1HZBA 1LTLA 4A3KG 1YZUA 2V54A 3RRMA 1I94Q 3K53A 2JLXA 2OCYC 3BIFA 3BH6A 1M2OB 4G7HC 3WMGA 4MUAA 3BDOA 1U8ZA 5C46F 4RD0A 4M0LA 2ZI9A 2OHFA 3LAWA 2AXNA 5ELNA 1KIXA 4BZPA 1JJGA 1Z6XA 1AH9A 1KI6A 4GNXA 4JI5L 2NGRA 4RCNA 4JT4A 4JYBA 2A68C 3CP0A 2BE5C 2VQEQ 1NG9A 1PFSA 2CVFA 3O47A 4JI7Q 3LX8A 3M7NA 3E2IA 1U90A 1SMXA 3AF0A 1DELA 1LVGA 1CR2A 4JVLA 4A3JG 2P67A 3FKIH 3F2CA 1CR4A 3PUVA 2QL6A 2JLZA 1G3IA 3KLRA 4LV6A 4XWKA 5KSYA 1IONA 2ZS7A 2OESA 2ZANA 2DFTA 4MRRA 2ZRNA 1WCMG 1E3PA 4HDOB 3T1TA 4B3TL 3CC2A 4M53A 4LPKA 2ES2A 3FKIG 1AJEA 3KZ1E 3HOXH 4LYFA 2VL7A 4YC7A 5C4JH 1XWIA 4IPHA 3IQWA 4TMKA 3BU2A 1UKVY 1HT2E 1WCMH 1II8B 1ASYA 3BFVA 2QA4A 5EP4A 3UWOA 4Q48A 2BMFA 5K36H 3B9PA 2CWAA 1XJVA 2FN4A 3RRNA 2RHMA 2Z6KA 2UZIR 2ZJAA 4YQFA 1KKMA 1Y14B 4JBWA 2PH1A 3REGA 1XJ0A 1KJWA 2PT7A 5GJVC 1KI2A 2C9YA 4B3SL 2B3GA 4HJ5A 2JXMB 2ZJQA 3S15H 1G51A 1Q57A 1OH6A 1E3MA 5DN6A 3GD7A 2KHIA 3HDTA 5L3VA 2X2EA 4LHXA 1KSHA 1HE8B 4LI0A 2D2CC 1HYQA 5DISB 2VP6A 1TAGA 4KN7C 1GD7A 1NMZA 4NH0A 2HF8A 3I62A 2JDID 3Q5DA 3CRVA 2JA1A 2OM2A 4KCGA 4EPVA 3Q3JB 1EFTA 5JHHB 4H44C 1ZIPA 1G1MA 4M9ZA 5KU1A 2RAPA 5LMNQ 1VCIA 1YJNA 1R5OA 4IFEA 4DDVA 1XCGB 3BFXA 3KX2A 2KHJA 4NPSA 2F3IA 3TE6A 4DV7L 4ME3A 1FUKA 2G1KA 3IFTA 2WAXA 3ZH9B 3CO5A 1GFIA 2N46A 3EZFA 3G5UA 3N70A 3GTMH 3IBYA 4QXAA 3A0JA 1E2HA 2ZRAA 2ZR7A 5LB2A 1M1YE 4AC9A 5BN5A 4AQYQ 1RW4A 2NVQH 3K0CA 1N6HA 4JI8Q 1UEIA 4UNSA 2B8WA 5EE9A 5FOUA 4BZQA 4PZZA 3Q5EA 1RFLA 1QHHB 2Q3FA 5C4XH 2CLCX 2QEQA 3T1HL 3CZQA 2IS6A 2VL6A 2NPIA 4NYJR 1HQMC 4P72A 2JJ8A 1G3UA 2ERYA 4JC0A 4OI1A 2JIZD 1Z63A 4DR6L 1ZM4A 5EAYA 2VF8A 2ZU6A 1YVCA 2ORWA 2RF4A 2ZE7A 1ZD9A 2ZRDA 1ZCBA 4QG7A 2PLRA 2NN6H 2YOGA 4LF8L 1Z8FA 4JI4Q 3CX7A 3EC2A 2VQFQ 3LO5A 4GRAA 4A93G 3MCAA 4JSYA 3U44B 4LYAA 3LQQA 3B1YA 4P0TA 4C2MH 1W0JA 2IEYA 4PO9A 3TR5A 4ZPXA 3LRPA 1FW6A 1P2TA 1V43A 1XPRA 2GVAA 1OIWA 4IOKA 5GVRA 3GJ0A 1F6BA 4GKKL 4DR1Q 1KO8A 1VKJA 1Y1WH 3TMKA 1OB5A 4PPGA 5IRCD 4XH9B 3HGBA 4DPGA 4DK3C 3NEYA 4X65L 1K8RA 2XTZA 2H5XA 3BAFA 2BH8A 1PYSB 2REXB 1R5NA 2K50A 1GAJA 2OUKA 3FP9A 4BGDA 1NMYA 2FFBA 3AM1A 4IEEA 3W9YA 1NY6A 3SEAA 1E6CA 2EFEB 4B71A 3NHAA 5AUQA 4Q21A 1ZCAA 3B1WA 3QE0A 1H9RA 4H02A 5J40A 1GP2A 1FFHA 3TVTA 5GJBA 4DCUA 4DT1A 4JI2L 1S9HA 1LACA 2FPKA 4MGZR 4FMDF 4RD3A 3T5DA 4URUR 3W6NA 2QGQA 1PH3A 4BBSH 1W4RA 4FD2A 5CK4A 1SVIA 1YKSA 4HIOA 1OLOA 4IPDA 4M4SA 4JBKA 4B32A 3CRMA 4G5GA 4MKHA 1YR6A 1OTCA 1QHNA 5BYKA 4RFSA 1GUOA 2OE2A 4LX0A 1DTSA 1VYUA 1EFWA 4K0KQ 3I4MG 4PPFA 2BOVA 4IFDJ 2HCJB 4Q4HB 1D2EA 4D26A 4PG3A 4Q4JA 5M5XH 4JOIA 4JL5A 4C2UA 4P75A 2J0SA 1GKUB 1MRNA 2P6NA 1VF5C 3KQHA 1IBLQ 4W5HA 4BXXG 1K83H 4LCBA 3AUXA 4HAYA 3S16H 1OH8A 5JZVA 1H95A 4XWOA 1U98A 4RG1A 4TMTA 1CR1A 2FA9A 3WY9A 1XNJA 4DLRA 2CCKA 2PZFA 3B5JA 1FVIA 4XVRA 4HB2A 3ZIAA 4BXXH 3W5JA 1H9SA 3DEFA 2GJKA 4TTRA 3DXJC 5G53C 2G9NA 4B76A 1O7LA 1WYDA 2IX3A 2JASA 1QHIA 3KL4A 5LMUL 2QEXA 2Q3HA 1ZUNB 2CWPA 2O8EA 2K52A 1COWA 1KAGA 2I4IA 2G83A 4OI4A 1Q0UA 3ER0A 3O8BA 1C0AA 2FGKA 2ZR0A 3GJ5A 1Q90A 3GQBA 4X62L 3L2PA 1KAOA 2AD5A 3IKJA 4JI0Q 3J81c 3HOWH 1GDDA 1A5TA 1MABA 2YNMA 4HLQB 1ZM3A 4JLDA 2KI5A 3BERA 1P2UA 2IUUA 1D8LA 2C95A 1W47A 4UNQA 3PSIA 1KI7A 1IYVA 2LSSA 1NN0A 4GLVB 1ZM7A 4A2QA 2CJWA 1ANKA 1G7CA 4LF7Q 2NVYH 2VQFL 3BORA 3MWLA 4JBYA 1PMRA 3M85A 2IC5A 1G3RA 4DV4Q 4JI0L 2CK3D 1NLYA 4ALPA 1XTQA 4R9UC 1ZNWA 5JEAJ 2IWHA 2W6IA 1N0VC 2C5LA 3U5ZB 3HYTA 2ZSEA 3A1UA 2E1RA 3T1HQ 4XTCS 4A3IH 2ZU0C 4W5WA 3RSLA 1L2FA 2CNWA 5EZ5A 4KLNA 3NEJA 5HPYB 3ICQB 2GN5A 2WKQA 4DSUA 2G88A 1U9IA 3GTGH 2QNRA 3SGIA 1VQEA 2IHYA 2GJ8A 2QM8A 4BY1H 2OXCA 2D3WA 4RZ3A 4DKXA 2QMEA 2WHXA 1L2TA 3GLFB 4N0DA 1NMFA 4JOIC 1OKKA 2J5XA 3FMIA 3WP1B 1IBLL 4HB0A 4OO1G 1XU4A 2R44A 3FKSA 1S9DA 4HLUA 3T51B 3TQFA 1LFDB 4V0MA 1M8PA 4QNMA 1T5IA 3KQLA 1WCV1 3GTKH 1NN5A 1IY0A 4BRWA 1RIPA 1JEEA 2HJVA 1TX4B 2BBOA 2CDNA 3AKYA 1E0JA 4JLPA 2IK8A 4MITA 3K0FB 5AK0A 2KCMA 2ZJPA 3S17H 4A0FA 4AG6A 4JI4L 4AKGA 1OB2A 5AUOB 1P6XA 3SR0A 4GNKA 1Y63A 3UMFA 3QKSA 2A5GA 3SFVA 4UJ5A 4HIMA 4JYAL 4XVQA 3CCVA 2GZAA 1E94E 4MA4A 1CR0A 1BS1A 3CPHA 2AWNA 2WJJA 3PXGA 2OXRA 2C04A 3RS2A 2PPBC 1H8HD 5DHAA 3WYGA 4BLPA 2XSZA 1IBRA 4W5JA 3W8RA 4HIDA 4MKIA 3TW8B 5CJ2A 2ZSDA 2VF7A 2Z43A 3C14C 1LNZA 4Q4LA 1TU4A 4LZZA 1TF5A 2ZJRA 1B9MA 3I5YA 4DV1Q 4QBIA 2N42A 5KNCA 4IPGA 3STBD 4H0LC 3SFZA 2EXDA 3V4FA 2WOJA 3ZZ0A 4TMXA 2QM7A 5A0FA 4E22A 2BEJA 5F3WB 1B23P 5J4HA 1EUJA 3OTOL 3Q7QA 4B2IA 2JA5G 1TEVA 4XVUA 3QSYA 4DBLC 4LDJA 2ZT9C 1JB1A 2O8DB 3U44A 1R0YA 4JKIA 3VR1A 4R2IA 1IN4A 4PQFA 1PLJA 2EFGA 4CIDA 3CLVA 4NXMQ 1FL9A 3J81i 1X56A 2WJVA 1HNWQ 4LFCQ 3GJ3A 5TB5A 3JAMc 2CCZA 3DVLA 3AEZA 1XFAA 3EWSA 5DE3A 2FFAA 4A0HA 4Z1MD 5B58C 3RNUA 3HKZE 1AZTA 4PO8A 3NXSA 3K9HA 5SZIA 3WNDA 1JPNA 1K6MA 2RGAA 2V6IA 3OEHA 4X62Q 1XTJA 3W90A 3K8AA 3LWUA 4OQNA 1CTQA 3V00A 1ZD1A 3ULLA 5TARA 2EJFC 3CH4B 5JRZA 4LHVA 3ZS9A 4TZ0A 4I1VA 5KNDA 2EVBA 3JVVA 5C4XG 5FTKA 1BOFA 1Z9FA 3FYHA 5IK2D 3DHWC 5E95A 3F2BA 4AYWA 1TWCH 4JBJA 2JA7H 3KJPA 2VSFA 2VP4A 2ZVQX 2Z6VA 3EA0A 3OIUA 1SRUA 1N36Q 3RC3A 3PO3H 2NN6G 2FSHA 2W2XA 2XTMA 1NVVQ 3A1VA 5KUTA 3UMSA 1PH5A 1P9WA 3L0SA 5TVKA 2QSZA 5JSZB 1G7RA 1Z6GA 2O5IC 3EIQA 4HATA 1E1QA 4OWWB 1W4CA 1M1KC 1CJTC 5J4VA 1CU1A 5DI3A 1RRCA 4QGHA 4C0QC 1IXRA 3EIVA 3P26A 1VHLA 4A0RA 2EVWX 1D6JA 4A3JH 5K36G 4LUVA 1GM5A 1OFHA 1E9FA 4IOMA 3NTUA 4KI0A 3A1SA 1VQDA 4LBZA 4MRPA 4J0QA 2GA8A 3OIVA 3W8NA 3GPLA 1LABA 3CMEA 3AVUA 4RD4A 4ZCMA 1MJCA 1ZW6A 2XAUA 2EW1A 4HB3A 3D3QA 3OESA 4A3FH 2YOFA 5CYPA 1RPZA 1JB7A 3C4JA 1YZTA 1G8FA 3TR0A 1ZNZA 4GOXA 3H94A 2ZTCA 2BKEA 3QXJA 4X8HA 2HYIC 2Q9AA 2JQOA 3QPUA 1FMJA 1F2TB 4KSCA 2A6HC 1SVWA 5EE1A 2OCEA 1NY5A 3R9WA 4BFYA 2JEAI 2UXDL 4QKQA 1EXMA 4EFLA 4IFDG 3KKMA 4ACAA 3N6RA 2OFWA 1FQKA 2ZIAA 4DV7Q 2BDTA 4TZ6A 4G7ZC 4DR2L 1UJ2A 2IS1A 3KXLA 4JLKA 4TMWA 1O87A 2A5FA 5KDDA 3EASA 1WDTA 4TYWA 3NDPA 4TVAB 3R7WB 5IP9G 5KHOC 2V4DA 3AF1A 3RN5A 1IBML 2FFQA 1N2CE 3BBPA 1CJUC 1Z2CA 2L15A 2FSIA 1E2WA 4IJHA 3QEJA 2YWGA 4DZZA 1NBMD 4PANA 4WA7A 3THXB 4ACBA 4EPTA 4RZ2A 3W6PA 3G4SA 2ZS8A 2CNWD 1B7YB 4BY7H 1ZU4A 3KF6B 1EFRD 4LFCL 1E2DA 1T5LA 2MMCA 1VCOA 3K0FA 1N6PA 2I5MX 3RN2A 1XX6A 3EXAA 2KA7A 1PYBA 2HXSA 2DWQA 4FWIB 1W2GA 1NSFA 2QTFA 3CPWA 3L2OB 3QY0A 3K80C 5JJKA 3EPKA 3LW8A 4IOAA 3AP3A 4KXFB 3REFA 4A93H 5KPDA 2QF7A 1OFIA 1DAKA 2QPTA 3EZ6A 2GJAA 3LVQE 1BYUA 1OPXA 2A3RA 4Q1DA 2DFNA 3RWMB 4B2LA 1S96A 1A8VA 3FVQA 4PXAA 3SNHA 1KYIA 3CCRA 5KDLA 5BYJA 4H9GA 4GN3B 2WV9A 1E0KA 2NZJA 3HU2A 4URZR 2V1XA 4PSAA 4GNXC 4JBMA 1JECA 1YBYA 1N0UA 1GITA 2PZGA 1L8QA 3QEOA 3KB1A 4POFA 2JLQA 4IXMA 4H1VA 4JK1C 1W2BA 1XTKA 4AWXA 4UY8C 2OBNA 4TL7A 4ZI2A 2J0UB 2WTUA 1KDTA 1Y8OB 2IYTA 1A2BA 4RD1A 2QSYA 3F8TA 2EIFA 1EX6A 2NTYC 3K1JA 3HOVH 3GP8A 4H13C 1XEXB 1MO3A 1W1WA 4RFVA 1IAQA 4EDHA 1W3SA 4JCVE 4RCZA 1OXVA 2R92H 1UE1A 1CKEA 3D8BA 3PQCA 4PC2A 1IXRC 5AUPB 3LW7A 4NONA 3MAAC 5IYDG 5ANRB 3K70C 2VUMH 1T4GA 1AS2A 3H0GH 4N1AA 5JWHA 2IS4A 2JGNA 3W5IA 2FXQA 1XNRQ 5TXGA 2FU5C 1IYUA 4MGIR 5LD2B 4C0HA 2O52A 3OAAD 4QHTA 4BWYA 1X8JA 1VYVA 1XXHA 1F48A 5FTLA 3IO3A 4JI1L 3UE1A 1ZC4A 4M8NE 5AJWA 4DV3Q 3LFUA 2WMNB 5DI3B 1NF3A 1VIYA 1W49A 2FPMA 3RS5A 3ZQJA 2Q0HA 2GJSA 3AVXA 4KJZA 1P4SA 4A3BG 4Q9IA 2QGZA 4LHZA 3V4RA 2PI2A 3B13B 3GTQH 2JDIA 4XOIA 3RAPR 2HXYA 4LUOA 2CHQA 3CKLA 2QTVB 2O5VA 4OO1I 4DV5L 1G8YA 1W46A 1A82A 2GEDA 4A3BH 2IEZA 3N2EA 4P4SA 2UUCQ 1M34E 1TUIA 4QJ4A 5A4JA 1DBSA 3EA5A 4TLAA 4A3DH 4DDTA 5DNYB 4PZ6A 4A4DA 3B6YA 1P72A 2V1UA 3EBEA 2RHQB 2HHHQ 4HZUA 4URVR 1Q1BA 1ZUHA 3THYA 1QHHA 4IVQA 4A75A 4BY1G 4ZIRA 1XD2B 3CC7A 1KI1A 1DGSA 3OE7A 1IBMQ 1ZD8A 3M4YA 1KO4A 5CB8A 1V9PA 2O8CA 4HJ9A 4JKYA 2JLVA 3VA7A 3UDGA 1CKNB 4NYMR 4CEJB 4OO1H 5FTJA 1I50H 4D25A 2GXAA 2WSSD 1ASZA 1XXHE 4BLRA 2WJIA 3U7EB 1W7AA 1E2JA 5K8IA 1IL2A 1XNQL 4JLAA 4DLXA 1TKWB 1J7KA 4GKJL 4LF9L 2NOAA 2PCJA 4HYYA 4B3XA 4TLBA 2ZM5A 4OBEA 1SGWA 2N78A 4W9MC 1IQPA 1Q3TA 2BWJA 2WJGA 1FJGQ 2CVHA 1GL9B 1WA5A 2WKRA 2WWXA 3Q8XB 4X64L 4JI6L 3WNCA 4DUZQ 3HPRA 4B73A 1E1RD 4G0NA 1IHUA 2C03A 3SJAA 3AF3A 1QF9A 1UDXA 3BD9A 4CVNA 5JECA 4GLAC 3SE0A 1RIFA 1YJ9A 5EXTA 1JBKA 3KFVA 4DR3Q 1JAHA 4KHPQ 3FHTA 4DLYA 4Y0VA 2QENA 3CWQA 3LBIA 4LJ4A 1P60A 1VS0A 1G8PA 1R4AA 4D4JA 2HT1A 1TQ4A 4O0AA 4NPHA 4M9XA 2W6JD 2CLSA 1VG8A 4QGUA 2JA7G 1U0HC 1HZ9A 2NO7A 2C8VA 3RLFA 2UXBQ 4B34A 1G5RA 1XBTA 4TMVA 1SKYE 4E07A 1ZM2A 3Q7PA 1E2MA 4LWZA 4KYUA 1BKDR 2WWWA 2ORVA 1TL7C 3I55A 1E2VA 2R6GA 2ZI5A 2HCBA 3A7AB 1XJQA 4Q4HA 5FOWA 4DIDA 4ITRC 1PVOA 3MFYA 5H70A 2ZI7A 4F38A 4DDUA 3VNVA 1SVMA 3RDPA 1AZSC 1EFRA 5FBWB 1FNMA 2XXAA 3RYTC 4BPBA 3GLFA 5JEAH 3NG1A 1K5DA 2OCBA 3IUYA 4JV5Q 4PZ8A 2XNDD 4P4SB 1YHQA 1U5KA 3SYNA 4NKRA 3T1YQ 2NIPA 3LBHA 1WF3A 2CHVA 1YRBA 1ZUIA 1UFQA 2BKUA 2BMDA 4O25A 1WBDA 1N33Q 1N6OA 2AL7A 1NBWA 2PZEA 3VU9A 3TQYA 2JA5H 1W0KA 2BE5D 1VMAA 4DUYL 4YCUA 2OLKA 3MSXA 4ZI3A 3WNBA 4GMXA 1QDEA 3J7ZC 3H2YA 1KI9A 3K70B 1ZMXA 3I32A 4L9WA 1YR8A 4CF7A 4P32A 1KD1C 1AE3A 1OSNA 1TNDA 3G0HA 2KBFA 1YR7A 2VY3A 4N0EA 4AI6A 2K5NA 1ESNA 1XEXA 3M4PA 2VRWA 1I94L 1CUKA 3T1YL 2Z5FA 1DAHA 4Z8YA 4ARZA 3VNUA 4P71A 4IOCA 2RGEA 3RS4A 3KQNA 4B3RL 2OAP1 1KOFA 3CX8A 1DG1G 1JR3A 3PGZA 1IZ6A 2R6DA 3NBFA 4TMZA 2ZRHA 3OOCA 1A6XA 3CRLC 1KZ7B 4JLNA 2XX3A 3GLIA 5LPNA 2XOKD 1QJOA 1GRNA 1N6LA 2AHOA 3HP1A 1II0A 4QOSA 1U99A 4X8MA 1C7YA 4R2HA 5CIQA 2GKSA 5A5GA 1AKEA 1N5JA 4HAZA 2OG2A 2QPAA 2N49A 3KF8B 3VAAA 2QE7D 1CJKC 1ESMA 3CF2A 3UE0A 4BLSA 4LFAQ 4IQZA 2P0EA 1KMQA 3NH6A 2O8BB 3VR4A 1EIYB 1W4AA 5C4GB 1WB9A 5G41A 1J99A 2RHSB 1LV7A 3K0AB 5FTMA 1XCMA 3DOEA 3T53B 5KTYA 3S1NH 5J4YA 4KVAA 2RMKA 1XMJA 4IKEA 2CL6X 4W7SA 1PH9A 1D2MA 4YONB 4F92B 3AP2A 2ZRMA 5E7IA 2ZYTX 2GDJA 3FE2A 4OHXA 2C9OA 4I99A 5IT9c 2JJ2D 3W1GA 3AGQA 4QL5A 4WZAE 2ZRBA 4DLSA 3VU9B 1D7QA 4DR5L 2QROA 4EPWA 2WM9B 2Q3MA 2Q21A 5H8WA 4LW1A 2BJVA 4AYBG 2ZR9A 4KHPL 1A7JA 2QUZA 1CLUA 3S1AB 3GJ7A 2G1JA 621PA 4B44A 2BJWA 5JEDA 1A0IA 1PLLA 1BYIA 2KE5A 1FOEB 3CXCA 1BBUA 3U4ZA 3NVAA 5FJ8H 3P4YA 3TZUA 2JA9A 3EQLC 1T8TA 4LOAA 1E98A 1CTMA 2QAGA 2UU9L 1VQBA 2JLUA 4OL0A 1DAFA 4I1SA 4YMWA 4BEJA 4EJSB 5FPHA 1A1VA 2VSXA 2V55B 3THOA 3GCGA 4JS0A 3KDFA 3TRZA 4LBVA 2E74C 4R1JA 4CW7A 4R4IA 3CF0A 2G77B 2A7QA 2QMUA 4QBGB 4XWAA 2ZM6L 3MWJA 2GVBA 4NXNQ 3CZPA 2EFCB 4TYPA 4UP7A 2WSSA 3K8YA 1FUUA 2NO6A 3OHMA 2ZS9A 4D6PA 4RCYA 3GJXC 3SU8A 2F1MA 4R4CA 5K8TA 2DFLA 2X1VA 1YEZA 2CXXA 2IYVA 2ZYWX 1IY2A 4PAQA 5KSOA 3THXA 5FLMG 1HNZL 4DB2A 2DB3A 3IHWA 3X1ZA 2OZEA 3T1QA 4FWTA 1RYFA 2NO9A 4HSEA 4LJ7A 4LJ9A 5EE5B 4BLOA 1MJEA 2XJ9A 3TLXA 4DR4Q 3ULPA 1IBKL 3T5GA 3PO2G 4LY6A 1HT1E 5CDFE 1WXQA 2I1VB 2R6CA 5AR1A 3Q85A 4YWKA 2R2AA 1UKYA 5EUQB 2UUCL 3F5FA 3NBYC 3QXCA 2PJZA 1E2LA 1OT3A 2PCLA 2ZAMA 4DV2Q 2ZRPA 1YHBA 3A36A 4DK1A 3LGJA 2XTNA 4KU4A 4LC1A 3UPUA 1SXJD 5G3YA 5LMNW 1XD8A 2YU9H 5FJ8G 5IYDH 1ONBA 1Q22A 3GMTA 3BGWA 3K09A 4Q9LA 1W36C 1QG2A 4POGA 4CYMA 4US0R 2VNUD 1HPCA 4GOPA 2SHKA 3UK6A 2HUPA 4NYIR 4M1KA 1GG2A 2K14A 4IOLA 2A6HD 3EZ7A 3A7LA 4XSHA 5P21A 421PA 3A8JE 3VR2A 1GVPA 4CGZA 4NCKA 2CE7A 5G3ZA 1YZNA 4FIDA 4CEIB 2NVXH 4GFDA 2WICA 4ILEA 1U0LA 4CT5A 2YKGA 2JE6I 2IYSA 2JLSA 2P2LA 2BMEA 2J41A 2ZRFA 1QZGA 1YJ5A 5M3MH 4L5SA 1QVAA 5C44H 2PMZE 1JXMA 1ZNYA 3MJRA 4GMDA 1G6OA 4Y0AA 4JYAQ 2BDOA 721PA 4HUQA 1KXLA 1X3GA 1HR0W 1R0WA 4S35A 3S2HH 2IF2A 1L4UA 1XF9A 1VQKA 2R93H 2H7VA 2X19A 1AGPA 4OJQA 5C2JB 1TUEA 3BOSA 1SN8A 2QI9C 4L5QA 5KSPA 2VUMG 1VTKA 5L8VA 4BFXA 3X1XA 1MT0A 2BHRA 5UKDA 5C1BA 2TMKA 3CW2C 3LBNA 2QAGB 3ZZTA 1VQ7A 1P16A 3CCUA 2IBMA 3C7KA 5HTKA 1Q86C 3LXXA 4TYYA 3BC1A 1EQQA 1KRSA 1FP7A 2VP2A 2O8BA 1SXJC 3DMNA 3KJEA 2F6RA 4TL6A 4XD7A 3AFPA 5IYBH 1ZU5A 4GP6A 5FR2A 3GLIE 3L0OA 3AKDA 4JJZA 2J7PA 3K9GA 2ZRLA 5FOTA 1NVWQ 1YRAA 4LF9Q 4GKKQ 3OFNA 3E70C 3T35A 3AVOA 3KDSE 4YMUA 1UPTA 1OV4A 2IHBA 2W00A 1OXUA 3A37A 3I3SR 3QKRB 3D4RA 2K5UA 2FSGA 2VQEL 3GTPH 3CRQA 4HLUC 1DEKA 2ANBA 2W2VA 3ASYA 1RRPA 1QHSA 1IM2A 1RRFA 4DR1L 2F52A 1EYGA 1PJRA 1YU9A 2FH5B 4K8OA 5AUNB 3KQKA 4PHTA 2MSDB 2LXJA 1OJLA 1Q1QA 1N8RC 3EARA 3LDAA 3S1RH 2B29A 3E9HA 2XOKA 1DAIA 1SR3A 4A3DG 3K7UC 3A5UA 2YWHA 2RGNC 3AB9A 4HEJA 4HJ7A 2D0OA 1ZNXA 2O8CB 2HJGA 3TJZA 3OEED 1ETUA 4KYIB 1DPFA 1SVKA 3HFZB 2EYUA 3GLHE 3UANA 4UNRA 2RGGA 3FB4A 2AUKA 2NG1A 3F0TA 3ZVLA 4DV6L 2FEOA 1N34L 2D06A 1R2QA 1KKLA 1TADA 2ORIA 4Z8XA 2R7ZH 1UF9A 4L9SA 3SJBA 1NE3A 1Z6TA 1E79A 4D81A 3A58B 1S40A 1K8OA 3HU3A 2JLYA 3AFQA 1E9DA 1EGAA 1XMVA 3TH5A 3QBTA 3EAQA 3U4QA 2ZJBA 2LKCA 3ULJA 2AWOA 2JJ2A 1P7CA 2F43A 2HDNB 1A62A 3NENA 1PH8A 2CLDX 1J5EL 4JMPA 4US2R 4C7OA 1UADA 4YMVA 2R7DA 1J8MF 4AKHA 5H1SE 3NHBA 1Q1EA 1DAEA 3N5CA 5L3RA 3EZ2A 4GOKA 2IW3A 4IOJA 1VQ6A 1CFMA 2ZI4A 2DUDA 3R8CA 5EE0A 3PEWA 3W3AA 3H86A 1S0UA 4ZDIA 1Z0FA 3AVTA 1YI2A 2ODBA 4JVMA 4B33A 1HTWA 1KAWA 3QXHA 5BQ5A 4KBGA 4Q66C 1T9HA 3VR3A 1G41A 1VG9B 1X55A 5EXSA 4BFZA 4AK9A 4KLKA 5CDFA 3CH5A 5EZ6B 1O3YA 2ONKA 1QVGA 4LFAL 2QQ0A 4BASA 1D9XA 3QXSA 2A5DA 2GK7A 2Y8EA 4OHVA 2WOOA 3LWNA 3I8XA 3CNLA 4C3HH 2MO0A 2B6HA 1S1CA 1I2MA 3QKUA 1Z0IA 4URXR 2P5SA 4LBYA 3VFDA 1VCMA 1G16A 4QC2A 2XZOA 1YITA 4JI2Q 1TMKA 1NVXQ 2OSBA 2RH5A 4HB4A 3WYFA 4NCJA 3PCOB 1P2SA 4PTLA 2ZYUX 2UU9Q 2WB1G 4DCSA 3PEVA 1N6IA 3M6AA 1E2PA 3SHFA 3PUXA 3U3MA 1R0XA 4A3KH 1MRSA 1X6OA 2RHDA 5FH9A 1NJGA 3K0SA 4MDFA 4A8JC 5CIWA 4B48A 1E9AA 3PO3G 4Y7NH 1ZC3A 4FXPA 4LPSA 5KO2A 3AUYA 3GEEA 4JI5Q 3STBC 1N25A 2BCJQ 2DYKA 4A3CG 3PF5A 4WBSA 4ZDJA 2PL3A 4II7A 1SKYB 3SS8A 1UAAA 3B1VA 2PCFB 1HNZQ 3PEUA 3ZYCA 4AYTA 4EJSC 2IA5A 4ERNA 2FEMA 1JJ2A 3PENA 2ZROA 1OXXK 2WWIA 4HDCA 1A63A 4QGGA 5SZHB 1I5FA 2J0UA 2YINC 4YXWD 3NH9A 1FX0B 4BLTA 2VP0A 3BB4A 2Z6KC 2B63H 1VYTA 4GPTA 3PIOA 4R4OA 4GLXA 3GEIA 4TLEA 3AF4A 4WJ3M 5FPSA 2DR3A 2H17A 2EQSA 4FCVA 3KJIA 3AV0B 3EN2A 2ZUCA 1SXJB 2OTJA 2I0QA 3S1MH 1SVOA 4A3LG 2ZE5A 4IDPA 3JAMi 1Z7TA 2XTIA 1H9JA 5JJIA 1C1YA 3OEHD 2A19A 1Z08A 1FX0A 1QG4A 1JQLB 1IXSB 3FPPA 1YHAA 2PNHA 5FL7D 4D82A 2Z4SA 2ZAOA 2KJQA 1Z0AA 2O0HA 4IFDI 4RZXA 4V03A 4R98A 4EFNA 2GETA 3D31A 4LUCA 5IT5A 4BRUA 3CRW1 3DMDA 1VQ9A 1RE0A 1KSFX 3MEFA 2KCCA 4PQRA 4ZO4A 3JC66 4TSFA 3U3KA 1KIMA 2EWWA 1XNRL 1OH7A 4BECA 3NEMA 2EU8A 4PPQA 4XD7D 4LUZA 5EXPA 2WAQG 4IDQA 5FUYA 2IX1A 2V8OA 3L8ZA 3B1ZA 5JHGB 2ATXA 1J8YF 3TREA 3U3OA 4JLMA 2VTKA 1E9EA 1GNPA 1LF5A 4DV5Q 5AJ3L 1C9OA 5IP7G 2VSOA 1UBFA 1FTSA 3K9LA 4IO9A 3LQRA 3UATA 1KDOA 4KFTA 1XTRA 5JWOA 2IHFA 1SMYC 2ZJOA 2KBEA 1P61B 2D2FA 1E32A 2AHOB 4U7DA 4YLGA 4JBXA 1VF7A 4LF4L 4GI7A 1X86B 4XTRA 3U9SA 1MO5A 4DV0L 1MOZA 2FFHA 1RVDA 3I2ZA 1HEIA 3QVVA 4US1R 4AIIA 1JEDA 2QT1A 1OF1A 2F3TA 1FL0A 2FX3A 1TF2A 3AGPA 3PIRA 4F4IA 1RL2A 3W1BA 1DAGA 3I4MH 2IYXA 5TMPA 5C3EH 1SROA 1V1QA 5GROA 4JLVA 3CM0A 1CBUA 1E2IA 1RJ9A 2PLFA 1UEJA 2ZXUA 1IN5A 4KODA 1QHXA 4D0NA 3X1YA 1KHTA 3SBDA 2HIVA 3CBQA 4D4KA 2A69D 3J80i 1PH2A 2R6AA 2QAJA 3CIOA 2DGYA 2CCGA 4PO1A 4G01B 4KO8A 5IYBG 1G5TA 3QENA 5IYCG 1O78A 3TS2A 2WSMA 3A1WA 4GBMA 221PA 1QUQB 1K73C 2WFWA 1YNNC 4HJAA 1Z6AA 2D74A 2WBLC 4KFRA 5DI9A 4F93B 5HR5A 1Y1WG 1QBKC 2IXFA 4A8JB 3U4QB 5M04A 2H57A 2VA8A 1SXJA 1HE1C 2XSZD 3C5CA 2HT6A 2BC9A 2JK8A 2YJTD 4PHGA 4U02A 2I5LX 2XITA 4GS3A 4OGQC 1LS6A 1UBGA 5B2ZA 2C35B 3KDFB 1BH2A 1NLZA 3UXMA 1VQLA 1N36L 1EX7A 1GILA 1VQ4A 2BM1A 2K5HA 4JLBA 4AYXA 2ZJZA 1TWFH 4HUTA 2PEYA 4C2TA 2DNEA 4P4UA 1CXZA 2A2ZA 3BB1A 1RYHA 2F3RA 2MSEB 2QTHA 2VO1A 5CK5A 4EAQA 5FBQB 3RANA 4X66Q 2GESA 2FDCA 3MXUA 1E96A 3SJZA 5AWFC 3I7FA 4ESVA 4MRVA 3TSZA 4LJYA 2OT3B 4RJLA 4DR4L 3H0GG 1EWIA 2DN8A 4L8JA 1BMFD 1E2FA 2ZITA 5FOSA 4V0OA 5TDHA 4CDGA 1HNXQ 3J81k 3L7ZC 3CRRA 4A3MH 4A3GH 4ZV4A 1XTIA 1G7TA 3SJCA 4MH0R 4A2WA 4DDWA 1COWD 2F1HA 1JQJC 3DZ8A 2AK2A 3AKEA 5FBRB 1E1TA 2Z83A 4OONA 3MWYW 2E2IH 4B3SQ 1H8ED 2VLIA 1G7SA 4EPYA 3PF4A 4NHOA 1US8A 2PQAA 1SXJE 2J1LA 3T56B 4JL6A 4XSGA 3W34A 1DCZA 1XEWY 4A92A 3C8UA 1JJ7A 1J2JA 2F9LA 3IIMA 1GRQA 4PC1A 1L1OB 2OV2A 2UKDA 2VQSA 4KAXA 2IXEA 4POAA 8OHMA 5HKKD 5KPJA 3I4LA 3OYYA 1ZP6A 4AYBE 3QPVA 4DR2Q 3VKGA 1F3OA 1N5LA 1ZAKA 5E3HA 2NZ8A 2Y0SG 3C41J 3KXKA 4Q9HA 2YVUA 3TVDA 1GOTA 2E5LQ 4BBSG 4ON9A 3FDIA 5FL7A 3PEYA 4JG2A 1XMSA 4YXWA 2CK3A 3CRKC 3VHLB 1KSGA 2O8DA 5EP1A 4AKIA 1VQNA 1MKHA 4JT2A 4L4UA 3ERSX 2UXBL 3OIWA 4EFMA 1E1QD 2ZI6A 3OW2A 4AKEA 3GFTA 4LHYA 1CKNA 3GTOH 1GKYA 1VIAA 3M4OH 4RVCA 4YY3L 3K0EA 4A2PA 1Q12A 1KY3A 3HOVG 3FFBA 3RS7A 1G8HA 4DLWA 2NZOA 2FOLA 2J45A 1II9A 1P73A 4Q47A 4C0BA 3R20A 1VQCA 2R92G 1Q3HA 1L0WA 4A3MG 4FMDB 4JJKA 1JNYA 3E5HA 1KK3A 2JAQA 3Q72A 4P31A 4A3EG 4A0GA 2QBYA 4HLCA 3GTLH 4LF8Q 3LLMA 2G0TA 4I7ZC 4KKTA 2PBRA 4BLQA 1OH5A 1A2KC 1XB2A 2ZSBA 3DM9B 3BZCA 3TBKA 1JR6A 4OI0A 1GNQA 4NU0A 1OXSC 5HY6A 3QG1A 2GRJA 4K81B 1ZINA 3TSOA 4B43A 4IVRA 1KHIA 3M4QA 2BM0A 3QUSA 3SC3A 4R71A 1OE0A 1FJGL 3CB4A 4OQLA 5KYKA 4DR7L 2XXAB 1DVRA 1UBCA 4OI2A 1DE0A 3A5ZB 3GJ4A 2CW0C 2WP8J 4G5QA 4I81A 1O7IA 3H0KA 4EPRA 1FR3A 4NCNA 4AD8A 4QBHA 1HZCA 4FMBB 4DK6C 1XD2A 1DAMA 4LYJA 4L5BA 2W83A 4PX9A 1Z47A 5DLQE 4JZKA 3S24A 3GO5A 5DHFA 3U7GA 2GTPA 1CIPA 3S1AA 3PJRA 4QBFA 5E7MA 3LA6A 2Q2UA 1B0UA 2A1AA 1XTDA 4PC6A 1WI5A 1Z5ZA 2E76C 4KFUA 1TTTA 1HA3A 3A4NA 3G6EA 3QQ5A 1FQJA 3KKNA 4QHSA 4A8JA 1GTVA 4A6PA 3I8SA 4PAMA 2EQBA 2EJMA 2Q2HA 3IQXA 3KJGA 5H68A 1X6VA 4DK0A 4GNXB 1R10A 2J3EA 2PT5A 4NZYA 3TIFA 3FHWA 2JLRA 1DG3A 1SHKA 5AJZA 2VIIA 4TL8A 4B3CA 4FI3C 3X1DA 2REBA 2KCTA 4CEHA 1V8QA 2ZM6Q 4BBRH 2QN6A 5C18A 3AVYA 3UG6A 1T3HA 4HAWA 4LFBQ 2I5HA 1W5TA 2Y0SE 2WIBA 2IY5B 3KUDA 5CLLA 4UNNA 5BN4A 1KGDA 2ODEA 3AVPA 1YNXA 1P9RA 1VECA 1EFHA 1UM8A 4BBRG 1H9KA 2AK3A 2Q6TA 1ZYRC 5EQTA 1N6KA 4NMMA 2O8FA 5C0XH 4Q1BA 3FWYA 1JJCB 1Z0DA 4DLUA 4C3IH 1CJMA 4DV1L 1GUAA 5GAEC 2FZLA 1W36B 2XEXA 1JXOA 3WP0A 2EJGC 4B3TQ 1PLKA 1E2ZA 3I56A 4HAXA 2EFDB 1KDRA 4FCTA 1E22A 2RGCA 1HZAA 5FOXA 4WJ4A 5HCNA 4A1FA 2VH5R 2BV3A 2DWOA 2R8RA 4A3CH 1I2DA 2FZ4A 5LBIA 2UUBL 1TXYA 5AJ3Q 1IN6A 1J90A 2ZRKA 1FZQA 1P3JA 4D0GA 4YMTA 4DNIA 1E4YA 1Z0KA 4A9AA 1L4YA 2GZDA 2XGJA 2MO1A 2A8VA 3X2SA 5L3SA 3SZRA 4DWJA 4V0NA 2G3YA 1EK0A 1G21E 2BVNA 5DYIA 5JEEA 3CW2A 4GOJA 2XNDA 2NMVA 1H8EA 2NQ2C 5DH9A 4PZYA 2A6EC 5HZHA 2J7PD 5F9HA 5CYOA 4YMSA 3CMAA 3TRFA 3LV8A 3OFND 1N0WA 1P2VA 2NN6I 1EFCA 1YE8A 4OKSA 4L15A 4DT1B 3SQWA 2VHUA 4UKDA 1GHKA 3ZJYA 3THWB 2G6BA 4PR0A 3NBZC 4Q4JB 3WHKA 1VQ8A 4QGAA 3TSWA 2FG5A 1G64A 1NJFA 2YWFA 2J0VA 4X8OA 4MYUA 1KK0A 4LF5Q 2ZUBA 3BXZA 5C3EG 1DADA 3IIKA 4LF5L 1TQ6A 4NCIA 5E7JA 2JA6H 5IK2A 3BB3A 2B7CA 2ZSAA 3B6EA 3K0AA 3W5OA 2WZQA 4DV2L 1XPUA 2BMJA 2N1BA 3BS4A 3CONA 4JVSB 5HE9A 3U50C 4BQSA 2BBSA 2KSQA 2ZPTX 1GIAA 4Q5IA 3G48A 3ZS8A 4D80A 2X2FA 3ZLJA 2BH2A 3I92A 4WVFA 1N32L 2QQEA 5KSZA 3GJ6A 1ZKOA 3O8DA 5KNBA 4DLTA 1NI3A 1Z29A 1GL6A 3NKVA 5DYGA 1PZNA 2GCOA 1KSJA 1UWVA 4AIMA 3MMPA 4B3BA 3HOXG 4N3NA 2XGTA 5FPKA 4CT4B 1E79D 4PFSA 1QRAA 1AKYA 4QHYA 3A6PC 5JFGA 4G1UC 1NTGA 2Q2IA 1A4RA 4BFTA 4CEJA 2ERXA 4O0MA 4LK2A 2WAYA 3ZZUA 3VMFA 3U4VA 4KBFA 4APVA 4YCVA 3P4XA 4EPXA 1VQFA 2W2TA 2IUTA 2CL0X 1PUJA 1Y1VH 1TQDA 2PMKA 4G5OA 1P75A 4AQYL 5J5CA 4GOPC 3PG5A 2DBYA 4UXHA 3THYB 3LH5A 2JA6G 4B3FX 1EIFA 3P1JA 2XZLA 5TV2A 3SDZA 1U9IC 1CJVC 3I1FA 2JA8G 1X54A 3ZVRA 3QJYA 3J7A5 3WHLA 3QF7A 4GP7A 2YTYA 4F4JA 2WPDA 3HYRA 2GAOA 3B7GA 1F60A 1WBBA 5LMNL 1NRJB 3CF5A 2F9MA 3WWVA 3B9QA 3ICEA 4M9QA 2QBYB 4JI7L 3BZKA 1S4QA 5FUXA 3ND9A 4LF7L 1N3BA 3DL0A 1G20E 2WJHA 4QM6A 3PO2H 1ZVQA 4UP8A 3A74A 1XJCA 2A78A 5IHPA 2RGBA 1JPJA 1S1MA 3BWDD 1R8SA 3SOPA 4C7OB 1DOAA 3VR6A 4D4MA 2UXCQ 5FPYA 5HGQA 2UUBQ 2WKPA 3DZDA 2BIFA 1G291 4QJFA 1YZ6A 2QA5A 3U7HB 2W58A 5JMTA 3CCJA 1KO7A 1P8LA 2HYDA 2PX3A 1E24A 3PUZA 2R6FA 1XRJA 2A30A 4Q1FA 3ADDA 4X6AH 3RLNA 4A3GG 2QT0A 1J5EQ 2F1IA 4V0LA 2E5LL 3AP1A 1OYWA 4KN4C 5GJCA 4RSGA 4ZIRB 2AKYA 2ZEJA 3RS3A 4DC9A 1XNQQ 1L1OA 2OBLA 4FCWA 5GADC 5A35A 1E2KA 1I6VC 3QOFA 4QJ3A 5J3BA 1AA9A 4AH6A 4S2EA 2F4VL 2VHTA 3CCQA 2GCPA 2QP9X 3BJIC 2WWGA 4B3RQ 4URYR 1QVFA 4DXAA 1T5EA 4Q9JA 3ETLA 1ZM9A 3HR8A 4OHZA 4PC7A 3L82B 1CRPA 1GNRA 1R6BX 2H92A 2IHEA 3THWA 4TYNA 5AJVB
chains in the Genus database with same CATH superfamily
3AR3A 3DM5A 1WXGA 1BIFA 3BFKA 4DIBA 2UXBB 1AMOA 3HYLA 2Q1WA 4MVJF 3DLAA 4DILA 2B4RO 2NXJA 4YY3Q 1NUSA 3LFTA 4ZAXA 4JJEA 1Z6HA 3GGGA 3I45A 3NTQA 1JR3E 4B47A 5JNUA 1GZVA 3A8TA 1T35A 4L5TA 1EQUA 3DZGA 4G5HA 1VQMA 3CZ4A 3V8RA 3AERA 3OAAA 3D81A 3EQ8A 1L1EA 3JZDA 3L7IA 3LRTA 1SOAA 2R8EA 4PE5B 1JR3D 2G40A 5LMUB 5ALKA 4R1LA 2CLKB 2ZJ5A 5K3BA 1E3TA 1LTBD 1KQOA 4NOMA 4P7GA 3RJ5A 4AUNA 4LA4A 4UP9A 5ADVA 1GPNA 4ODIA 4PGAA 3OE7D 4LJZC 1HFKA 1O4WA 1U3DA 2BFFA 5CV4A 5JAVA 1DC5A 2FQXA 4G07A 4TWJA 3BSWA 2O0LA 3GPIA 5TE9A 3UHAA 3HWRA 4ETNA 4HC4A 4INZA 4OBWA 5CA1A 3ECAA 1U1FA 3FKQA 5T5QA 2PX5A 3KTFA 1J42A 2R62A 3MMZA 4F6LA 5JQWA 5GZ6A 3MA0A 5JS8A 4GPIB 4JI3Q 4WZAA 1BCPC 4ECAA 3RVNA 1Q50A 3GLVA 4JSTA 1JTEA 4M0KA 1JGTA 5G1PA 4LV8B 1FYVA 4QY7A 3BXEA 3DDCA 4X85A 5CRIA 3UH0A 5HIAA 5JQGA 3HCNA 1UJMA 3EPJA 4LDQA 5LP6F 2QYOA 1LC3A 4ID3A 5B1EA 2B63B 2DQSA 1E1RA 3WWPA 2W6ID 4TV8A 3NBHA 3KD2A 1TD9A 1CQVA 1A7AA 3PL1A 2A14A 4BO4A 1FUYB 3KZNA 1OFUA 1XPJA 3QPBA 3VTFA 5JZBA 4MV6A 4HDRA 1X70A 4YDSA 4AZ3A 3O26A 1DKMA 5IJZA 4J3JA 4NJOA 2IQ5A 5JVDF 3EPHA 5FLXc 4DR1B 1S5FD 4P92A 5H80A 4MKGA 3QF4B 1IWBB 4LMRA 3ZW9A 2QJTA 4RF5A 1TLTA 1OLSB 3U1VA 4BDTA 4MQLA 1XU7A 4YJHB 3HCOA 2C4VA 2A9KA 2OP1A 2LXKA 3A8KE 4CTKA 1JAIA 3KQQA 3FN4A 3AQQA 2FE4A 1AT1A 1PQPA 3KR2A 4RL6A 1Q0RA 1MG5A 1HXYD 4Y6GB 3K0YA 2FQWA 1YL5A 2V0GA 2VWPA 1A8SA 1U2PA 2QRVA 3ZV6A 1GAEO 1F8XA 3FTEA 1H3NA 2IHTA 4ARZB 1TCAA 2I34A 2ZTEA 4GN5A 2BEWB 1E9RA 3ITPA 2QDBA 3DMHA 3HB1A 4S1VA 1ILWA 3T7KA 4ENSA 3H9JA 4E03A 1ORWA 4EJMA 4DCCA 4OXPA 1J2RA 3QIAA 1COZA 2B8GA 2K75A 1NRXA 2EARA 2PX0A 3JY6A 3M6MD 2AKAB 2HQOA 4C0KA 2YV2A 4DN4M 5HQ3A 1TKAA 1N5IA 2DBQA 3UF0A 4BFUA 5JG7A 3AFOA 2CW5A 2I07B 1DC6A 1GZSA 5KOYA 2YZGA 5L3SB 1YUMA 1Q1ZA 3JCZA 4RSRA 4IZ8A 2QZ9A 4DR7B 3K6RA 5IZCA 2ZUDA 1N0IA 2BF7A 3ZD6A 1OPRA 2UAGA 3C3LA 3Q6NA 1C1XA 2ZIXB 4EW2A 1XQ1A 4RMHA 1QYRA 1JXQA 2DULA 2VJKA 3AKCA 3B2EA 4A0QA 4OK3A 4BNLA 3U1BA 2QW1A 1XPOA 4TM8A 4RKWA 3TBHA 3BHMA 3H9CA 1EE1A 3WBKA 2QTWB 1UEAB 1VQ5A 2CQOA 2PTHA 3HDJA 3HB5X 3FMPB 4S24A 2Y0EA 1W48A 2B1RA 3ET4A 3JQFC 4YRJA 3T06B 4KC0A 1FDRA 1NTOA 2IUFA 4DPKA 3K05A 3UAOA 2NYAA 1H6CA 3OZBA 2A68D 1U94A 4QBKA 4U9UA 1O97C 3ZHTA 1QQ7A 1F2UB 3DTTA 2Q9BA 2ZREA 3N2IA 2HJSA 4EUNA 5F52A 2VOEA 4DV3B 2J4FA 3F3SA 5KKCA 4PBSA 3O84A 3HSYA 5ALFA 1LF0A 4M9RA 1QB7A 4BB6A 4I1PA 1KH2A 2G7MC 3IILA 3PSHA 4GQBA 3ZC3A 5B6IA 1VCNA 2J3MA 4E2FA 2ZAGA 3ANXA 2QX9A 4WXPA 5E9AA 4ZYVA 1T2DA 4MPDA 4AIRA 4MB2A 4Z5XA 2DY1A 1DBWA 3G71A 3CRNA 3FHLA 1RCUA 4YALA 1W4ZA 2ZSIA 4ENTA 3A7DA 1H0HA 4JI6Q 1I4TD 2HCTA 2L11A 3AX6A 1KO5A 5BXYA 1R0ZA 5HILA 1ULUA 3U80A 3NQTA 4PCVA 4TXNA 2P4HX 1JLKA 2QUJA 3BILA 5K8UA 1Y8NB 1O08A 2WG1A 4B75A 3KKKA 3O9ZA 1QZTA 1J6QA 2CD7A 5HJ2A 1O94D 5MFZA 3I3CA 3WI7A 1K7EB 1IC6A 1MIHA 5ALNA 1Y8CA 3EXG1 3JQAD 3RG2A 5HOEA 4BXOB 4EQZA 4F3TA 1ULAA 4CBVA 4OX9L 2COEA 3F6EX 4EARA 3P97A 5HM8A 5JNTA 1Q8KA 4GVPA 4QE3A 3B78A 2B83A 3ZQ4A 4RD6A 1RC8A 1N9ZA 3RUCA 3NEPX 5EP2A 3G89A 3S99A 4CHTB 4TZ0A 2NZVG 1NJIC 4GKJQ 1EVEA 4N9QA 2QQ5A 3SQOA 3LWEA 3M81A 4WCFC 3UPTA 4DKJA 2H2GA 3PO3B 1LRJA 2QE7A 5AP9A 1DXHA 2ZI3A 4PCLA 4V02A 4X1YA 3LWBA 3MGCA 3UT6A 5KTMA 4ZJUA 2P5YA 1RKBA 2OB2A 2C3PA 4NB3A 2DKFA 3V8VA 4Y52H 2ZOSA 4YP9A 2YOHA 5FFFA 1VI2A 2IYQA 2ZFUA 4X3SA 1BGWA 4XOUA 2COUA 2RA4A 5EMHA 5TQ2A 3AH8A 1C0IA 3WYAA 4EUEA 1ZGAA 1YVDA 3EF0A 5CFRA 3EUWA 4AULA 4HFRA 5ADHA 4KXUA 4Q0FA 1KDYA 2GPAA 4P3XA 5JVG3 4D4HA 1SG9A 4C0XA 3UC9A 1CSPA 1H5QA 3MGGA 1H42A 4RKBA 5I9PA 2X6LA 1YZKA 4IVNA 3T3IA 5KDOA 4DEXA 2XLCA 2O7QA 4U9IS 3W5CA 3AVWA 3FTQA 1ENFA 2BFFB 1T2AA 4DTIA 4EYQA 3A28A 5BW5A 3O4FA 1G91A 4AO7A 5CDSA 1C2YA 3CVOA 2X0FA 3SM3A 3D8HA 5CDUA 4NNJA 1BO0A 3IQGX 3LWDA 3OI7A 3BZUA 3GI1A 1SCAA 3ROPA 5C7IO 5L4NA 4KIGA 1M67A 4Q1EA 3I9MA 3BZBA 4GSKA 4ZCKA 1ZJJA 2HXGA 5TVGA 1SOUA 4PAOA 1NVUQ 1FDUA 1LJ8A 3FVVA 3NGXA 3OCUA 5LDDC 1GUNA 1TEXA 3GR6A 1S8FA 1S5ED 4BXOA 2WPDD 4UDYX 3JWJA 1KMHB 1CYDA 2GK3A 1WTHA 1VJTA 4MGKR 1XMQL 3AXTA 3EBPA 3KVNA 2HK9A 4GL4A 4AY2A 4RMFA 1ICFB 1UBOS 2XE6A 2BM9A 3KC2A 4Q6WA 4Y2SA 5CNKA 5M3FH 1IUKA 4PRLA 3M3PA 1NN3A 2A58A 2H9IA 1WD1A 2H1CA 1VQHA 4CUZA 2Q8PA 2XE8A 2YZ2A 3PNYA 5KTTA 2XV1A 2IW1A 1CJBA 4RD2A 1G5PA 4IJLA 2EL9A 3IT2A 3VKUA 4V0KA 4MQBA 5ISRA 4BFWA 3WC4A 1KY4A 3KB2A 2VXBA 5AM1A 1GTRA 1M1NB 1E64A 1MP0A 3PI6A 2XB9A 4R4TA 3KKQA 3TM5A 1G19A 1XWFA 3NFYA 5ELBA 1CRZA 1KEWA 1Z7WA 2V9PA 1NDQA 1V8OA 3K30A 4B4KA 3HJGA 2GSWA 4OFBA 4O8ZA 1FTNA 5ETJA 5AT1A 1T1SA 1X7XA 2HCRA 2OKCA 2PSSA 4IGEA 1RZ3A 3U61B 2SKEA 1PGQA 2QY9A 1SC4A 2QN1A 4WGFA 4YAIA 2NZ1D 3WDNA 3SVMA 2IYZA 2XRFA 3RTCA 4PV1C 2L69A 3EEYA 2I7TA 4EJSA 2A3NA 1GPBA 4YWLA 1Z4PX 3EXFB 1BBXC 1CYEA 3FJOA 3GLSA 1L4NA 3M2PA 4QAQA 1ZNQO 4EF5A 2HW8A 4A36A 1YBAA 4UZFA 5IN5A 1LTKA 5IJ9A 1WZNA 5DRYA 4S0XA 1B9NA 2KWIA 3LLCA 1R5BA 4M1SA 2AEFA 4FQ7A 1PHPA 5M5BA 2R7FA 4L8GA 1WUIS 2X5NA 2CLHB 4IINA 3RABA 4JDUA 2E9SA 4MEBA 2ISSD 5CPBA 4Z7NB 1TYZA 5K0CA 4CM9A 4YRCA 4RZUA 2MOKA 1F9SA 1VG1A 2D1RA 3HXTA 2B78A 2P6UA 2XUIA 4WMLA 3D6CA 2C61A 1PL8A 3DUFB 3W78A 1ZEMA 3RC8A 5TGTA 3ZJ5A 2W0SA 5E1DA 1CT9A 4RLSA 2Z0SA 4C06A 3AR6A 3JZFA 1C7ZA 4R01A 4RVFA 1TA0A 3K81C 2YTZA 2ZAIA 4REMA 3U40A 4C7JA 2I7DA 3O4HA 2ENBA 4H59A 1W581 4YLEA 5AHXA 3SSNA 3UOAB 4HX5A 1RS0A 1UP7A 3HNOA 1V5GA 4I50B 5CNMA 1MC5A 1QVCA 1DRKA 4F5DA 2CWDA 2BKLA 4ENWA 3DAYA 2F0TA 4MQEB 2IIVA 3UT0A 4C6TB 3H8SA 5HNKA 2XPCA 2C2MA 3NC0C 2B8TA 5LQJA 1XCLA 4BMYA 4ZD6A 1OW3B 1PW7A 3DHYA 2PV0A 3P0EA 2JEBI 1YQGA 2LE0A 4EKDA 4DIEA 3VO2A 2XTJA 4L8WB 4BMDA 1YDWA 5JCZA 4N39A 1EB9A 5ED4A 2J07A 3QWIA 4C78A 4BAZA 2I8AA 2VYQA 3LKVA 2UXDQ 2B9VA 1HBJA 1RXEA 1F9AA 3WB9A 1D8TA 4HL6A 2E89A 3JQQA 1PDQA 3L3OC 1Y8RA 3QU7A 3ROMA 4B71A 1NU6A 2H7YA 1SNDA 1QHEA 1PX0A 2YC2C 2FCAA 3II6X 1Q44A 2A6ED 4DR5Q 1TC2A 1VL1A 3HO6A 3HQ4O 4URFA 1ZR4A 3TAUA 3V4RA 2X8AA 4ZKEA 1SEBD 2ZXOA 3TTVA 3FMFA 3TL2A 4DDVA 2FB9A 4RENA 4WE3A 1I4HA 1AK1A 2WVJA 3AEYA 4P38A 3CLHA 2CXTA 3KQUA 3TPFA 3TTSA 3ITKA 2J59A 3P5SA 5F9FA 3H42B 2Z57A 1U4OA 3CSUA 3TN2A 3NMUF 1PV4A 1ET6A 3MN1A 5G40A 3EG5A 4CMEA 3TLEA 5AIBA 3FUXA 4CKYA 4IVPA 1KI8A 2UZ3A 1TAQA 3HNRA 3Q2KA 2YIJA 4UVEA 3PO2B 4X64B 2JRCA 3QWFA 3A2LA 4JOBA 3HB7A 4H6PA 2O5CA 1EWRA 1SCNE 3V8PA 4C5CA 4ENVA 3HKEB 4X24A 1I4RA 2IS2A 5IY0A 2G28A 2HRDA 5AD1A 3HFSA 2O57A 2ZBPA 3E9IA 2ZVPX 3ITDA 3THRA 2ASBA 5HUQA 2VEDA 1C8KA 3CZAA 1DL5A 3PKZA 3R5KA 3LPMA 4EG3A 5C8ZA 1PW5A 5C0XJ 1QIHA 2HF9A 1EXDA 2XGOA 4HEQA 5L51A 3LOUA 1ZRMA 2AXQA 2GBLC 5TT1A 4Q03A 3UT5B 2WEKA 4HYTA 3NTVA 3T4AC 3F9CA 3PCRB 5DGIA 1G6Q1 5T7BA 3KELA 3CEJA 3UJAA 1WVIA 4BTEA 1XZQA 1SULA 4M6WB 4FDUA 4DNRB 5LCXA 3CX3A 5JYEA 1UCFA 1KE1A 2N88A 2CMKA 2CUKA 1XZBA 5K99A 3DM1A 5AFSA 2KB0A 3ESDA 3TIGA 1UDRA 3MLEA 2EZTA 5DM73 1GVNB 2GFQA 2YC4C 3PT9A 1HQYE 5DO9A 3UAVA 3WQHA 2NO4A 2Q3LA 2WVGA 1WZEA 1YDMA 4J4HA 2WHPB 4WZBE 4YJFA 4CKCB 1PJBA 4GX5A 1MFPA 1W0JD 3LOPA 5K4GA 4OX9Q 4CJ0B 3O4VA 3AB3A 4KQ9A 4ZCIA 2H4WA 4Y6RA 1FRFS 3R23A 5BR8L 2F00A 2XKBA 3E7XA 3S17B 4K9SA 3ZVNA 4DLZA 1U0NA 2JCSA 4OPMA 3KBGA 2JL1A 2VNKA 2EATA 4F6RB 1LY1A 4Q4AA 4B3HA 1ZICA 1E0SA 4GPBA 3EVQA 5HFJA 4MAAA 4GUDA 5I7SA 1PTJA 2OCGA 1XZKA 4N0PA 2R47A 1YC2A 2MSWA 4O3MA 2FZ5A 3NCHA 5KQPA 5EIXA 3UJ8A 1XE3A 1K9MC 1KVRA 1LTQA 1V1OA 2ZQZA 4WESB 1NNI1 1PJTA 5JWOA 4P74A 1YZYA 4WFKA 3UDFA 3W2FA 4PYJA 1JE0A 4ILKA 4H1TA 4XD2A 1YQWA 3KE8A 3I70A 2FI1A 4NTZA 2BFBA 4Y98A 4BX3A 2K5DA 1D1SA 3HG9A 2B1IA 4I1UA 1RI3A 3QEBZ 1JIJA 4Q1AA 4CLHA 4EG7A 2YJ3A 3SJUA 4ABYA 4B5LA 1PUIA 4F71A 3RRBA 5JLJA 5LL6P 3JALB 1SFOH 5ALSA 1LUZA 3EUEA 3P27A 5IT9L 5K0NA 4HLDA 3SMVA 4DV0Q 1Y1LA 4PIPA 5CLJA 1SHZA 2IHZA 3GP3A 3MHBA 2JLAA 2Q99A 2YTXA 1K92A 3I5UA 4C3JG 2MYUA 4FZRA 1W4BA 1GU0A 3KR0A 3VYRB 2IZ7A 2JIBA 1SXIA 3H15A 1SB8A 1I2ZA 1WCXA 1WQ1R 2JKVA 3OOWA 4B6FA 1V5WA 1XRQA 1JMCA 2YIVX 1DCMA 2EYOA 5E7NA 1GPYA 3HVKA 4ZU1X 3P2OA 5HUHA 4MZ9A 2A35A 4MRNA 2NU9A 1NBHA 3T12A 4LC0A 1QH8A 1I3QB 1SAPA 2JA8H 4ZWNA 3HB9A 3CC4A 2Q2NA 1GWNA 3OKAA 3VOTA 1N2IA 4ZKDA 5HJ7A 1V2GA 4KE9A 3I1JA 4O6VA 1B8OA 1Y1RA 3L7DA 4OMDA 3JQ7B 1T3LA 4NBSA 1L7XA 5EJEA 1G8GA 5E4JA 1JG6A 3LS2A 1JX6A 2Q4EA 5E4XA 4BZQA 4KK7A 4G5RA 4O2AA 1GQFA 2JCVA 3C6YA 1Q0QA 2C2GA 2GWHA 1Y69U 3M4NA 4A1FA 4ND8B 4ZJPA 2H16A 3DL7A 4CCWA 2LIVA 1NJ6A 1CZRA 5CM8B 1HFWA 4P3YA 3TK1A 3GTJB 3QE2A 3RJMA 4J15A 4A3FG 2F8TA 2HZBA 2WM2A 4JA0A 4DCUA 5BQFA 2VP5A 5B5SA 1U5AA 1WEKA 3RK4A 4PW0A 1I3QH 2JVIA 4O4IF 2PTGA 3JVDA 4AX8A 2YXNA 3NXWA 3BD8A 4FFNA 1KLGD 1UPFA 4UBIA 1W85A 1SUWA 2WR8A 4DLKA 4B35A 2ZT6A 3AOGA 1PA6A 1KYTA 3C2QA 3PDCA 2QTBA 3GAAA 4K1XA 4KAAA 4ESHA 4HEDA 1H4QA 2MMGA 2BP7A 4GSLA 4PPNA 4K2KA 3G8CA 3GZNA 1TWHB 3A8IE 1M7GA 1YCGA 3FMVA 5LXTF 5J1ZA 2F0JA 2EZ9A 5JH7B 3MUEA 4YR9A 3QKSB 4YPVA 1I9CA 3I0ZA 4QDTA 4FW9A 4NBUA 3EOZA 2QILA 2X9NA 5CFZA 1A4UA 5A3RA 2XNSA 2YJ5A 3C3DA 1NLFA 5TRTA 4YAJA 5SY6A 1X8KA 1ZCZA 3KYBA 1CK1A 2DT5A 5HGJA 4Q7LA 2RG1A 5TQ2B 2IKSA 1DTWB 1I1QB 3OIDA 4WTOA 1XCPA 5FWDA 3SYMA 2CXSA 4ZVSA 3W2GA 1U9ZA 3IVRA 2QMYA 3H9UA 2VP9A 1E2NA 2W6JA 1U28A 4OLAA 4A3DB 2P1DA 4CG3A 2PD3A 3M34A 5J58A 3HDYA 3EISA 4E1BA 3H11A 2XDQA 3HJNA 2C2BA 1M6NA 4BL5A 1MABB 2GO1A 3LPNA 3M0EA 4GRDA 4I50F 5AVUA 1T13A 2O8FB 5DBOA 2PGAA 1QOZA 1ZH0A 2ZRJA 1DKQA 1BG6A 2GCNA 1YZQA 3AUFA 3H0EA 3L93A 1QO9A 5FBLB 4BV3A 4DUGD 5A9RA 2XB6A 3NETA 2E4WA 1E6UA 3S1QH 521PA 3U5TA 3HLYA 2PUJA 4WJKB 1V8ZA 2B9EA 4CM8A 2EBWA 5GAJA 2F0QA 8MHTA 4X65Q 3RC9A 1NONA 1HGXA 2YQZA 3KCQA 3ZQUA 4TTQA 3GLGB 2I6GA 1JAXA 1UKEA 1XEFA 4JHLA 5BV1A 3V6MA 5C8YF 1ZL2A 1NQTA 1WD0A 1POXA 2VJYA 3HEMA 3OJEA 2I1QA 3MERA 4X45A 1IXZA 3UJ6A 1T3SA 4Y2PA 4BGDA 4X8LA 4DLNA 1ZI8A 1DU4A 2L5TA 4ZO7A 3OLCX 2CY0A 1XALA 1VLZA 5ITSA 1W0KD 1OBHA 3U7QA 4MGYR 5CGZA 4DR6Q 3RV4A 3NELA 5ER9A 5MFPA 3K0CC 2XNJA 3PICA 4NE2A 1DOZA 4NK4A 3TIVA 3TLGB 2ZCUA 4QUKA 3O4JA 4OG2A 3MLAA 4IPTA 4ETWA 4ZGGA 4P0PB 3V8EA 2E3JA 2JVKA 4D0LB 2CJWB 1TJ3A 1Y33E 3I6BA 4A76A 4ZAZA 4ENPA 3HL4A 4L57A 4DSAA 1V8FA 4CKCA 2BBTA 1J9EA 3OTWA 1XHFA 3QBVA 4UU1A 1RLMA 3GARA 1X3FA 1WTQA 1K68A 3L7KA 4FLEA 4KDRA 3LD9A 4OHWA 4QFDA 1UDWA 2H59A 1Y0BA 5LMUQ 3FFAA 4FONA 5K0ZA 3SN6A 3T61A