1OXTA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 95
structure length 352
sequence length 352
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxtA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxtA01
3LGJA 1XTIA 3ZQ6A 1PH1A 2F1MA 2OSBA 1N6PA 3FKIG 2K50A 4O0AA 1VQ7A 1A8VA 2BV3A 1KGDA 721PA 5JS7A 2NMVA 2VW9A 1T91A 2BIFA 2FOLA 3BZKA 3FMOB 1E7ZA 1EG7A 4QHYA 3O8BA 2VIIA 1OHHA 3K0FB 3S1MH 2PH1A 4P4SB 4Q7JB 2EFGA 1KSGA 5JJLA 1U94A 1XNRQ 1Z6XA 2HLDD 3IO3A 3WRXC 1E9RA 3TE6A 1UFQA 3RLFA 3GLHB 5DH9A 3EPJA 4EPWA 1OIWA 3NEMA 3KB1A 1CLUA 1UE1A 1FX0B 4E09A 1Q1ZA 4HUQB 3Q7PA 4NDZA 2JXMB 2GEUA 3AFQA 1XTKA 2HDNB 2C03A 1TEXA 5IYCH 1HCZA 4HIDA 2IF2A 5P21A 3NBHB 3S24A 4X8LA 1S9DA 2H1LA 3PCRB 5JLJA 2HCJB 4DZZA 4IPHA 2ZJQA 3HKZE 4XJXA 3ND9A 3AVOA 4LWCA 1FTNA 2KBNA 1EK0A 1WYDA 4IFEA 2RGCA 2BKEA 1P16A 1X3GA 4NBSA 2O8FA 1UWVA 4LCBA 5DI3B 4ITRC 4P71A 3DZ8A 1UAAA 4ESVA 2RMKA 4LHXA 1J5EL 4BLPA 3I4LA 1NE3A 1EFUA 2X2EA 5A35A 4AURA 2UU9L 2BBTA 1ZJ6A 4FCVA 1JPJA 3IHLA 4C2TA 4GN4B 2FEOA 2G0TA 3UMFA 1S0UA 3TMKA 2JEBI 3C5HA 3W8RA 4DJTA 5HCIA 3K0FA 5C0XG 1T6NA 4DWJA 1K83H 2JATA 4FXPA 2QEQA 4TQ9A 4C0BA 2O8CB 2LKCA 2PPBC 2Q0HA 3VMFA 2F6RA 1I94Q 2HJGA 1X8LA 2PEYA 1SLJA 1E32A 4CT5A 3OEEA 1E69A 1FMLA 1ZW6A 3GLHA 1OT3A 1YZLA 4JBYA 1GZSA 2BH8A 1E9AA 1AZSC 1FX0A 4A3BG 4L5SA 4Y7NH 2ZU0C 4G7HC 4HUQA 1SVKA 4R98A 3FFAA 3CH5A 3A1SA 4ZIRB 4QGGA 1G1MA 1NIJA 3BFKA 1W3SA 1G3UA 1GL9B 3KKQA 3TJZA 3TSOA 3O8CA 4AKGA 4IQZA 1DAHA 2NO6A 5K8IA 4WW0A 4IJHA 1Z0IA 4Q21A 4M1SA 3SHFA 2LXKA 5FLMH 3GLFE 4DV2Q 2JA5G 1QHSA 1U8AA 3GFTA 3NH9A 1Q1EA 5DI3A 5GROA 4CT4B 1V9PA 3THYA 1ZM3A 3EASA 4IKEA 4NZYA 3V4FA 3PIPA 4A6PA 3CRRA 2Q21A 3LBHA 2JGNA 4E03A 3EWSA 4UNSA 3SBEA 4DV4Q 3H3VI 3HOUH 4RD2A 3PJRA 2WSMA 2QAGA 5K8LA 3QXSA 4I1UA 2O8CA 4B48A 4NYMR 1EYGA 1XF9A 4K8OA 2D5DA 3QKRB 2VSXA 1XCGB 3O8DA 4LFCL 3Q5EA 2ZS7A 3B9QA 4UNPA 4NCHA 2DB3A 3JC66 1Q57A 3MXNB 2ZJ2A 2O5VA 5DYGA 3NXSA 2IHYA 4L8JA 3VR2A 2WAQG 1KDTA 1LB1B 1MV5A 4B3RQ 2IYVA 1VYTA 4KO8A 3SZRA 5EE0A 2F7SA 2YTXA 1WBDA 3T1HQ 3U9SA 3I73A 2ZYVX 4EIWA 2G3YA 1MJCA 4ZPXA 1KOFA 1FUUA 3SBDA 4R4TA 3W5IA 1K5GA 4TMWA 1XMOQ 2UUCQ 1TU2B 2GJKA 3H15A 2CK3D 4IDOA 2ERYA 3J7ZC 1SE8A 4OYHA 4V03A 3C4JA 1PH5A 3MJHA 4JKIA 3FOZA 4RKEA 3K0CC 3SE0A 4AYXA 3JZAA 4DV3Q 1YU9A 3VA7A 2JASA 3LFUA 2MO1A 1HE8B 3VKGA 2OAP1 1G7CA 5AJWA 4QY7A 2P2LA 4M22A 5EXPA 4A3MH 3EQLC 4IJMA 3QKUA 4NXNQ 3EIQA 2EXDA 2E2HH 4X8MA 5FR2A 2P5TB 3NEYA 3B13B 4YMUA 1HJPA 1P9WA 4D4LA 2BWJA 4PMWA 1K8GA 1HV8A 1SXJD 4TYQA 4DLRA 2AX4A 3QKRA 2EJFC 4L5RC 1UPTA 1W5TA 4RKFA 5J4LA 2J41A 4JCVE 3I32A 1M90C 1JJCB 4D4MA 2GXQA 1XTSA 5C2JB 1CI3M 4IPDA 4BLSA 4KFUA 4RCNA 4OXPA 1X8KA 5KUTA 1ZM2A 2R9VA 2ZJ5A 4GKKQ 4PR0A 2WV9A 1U90A 5FJ8H 1ZYUA 2A2ZA 3KJOA 1KMQA 1QG4A 2DY1A 2V6JA 3HOZG 2VEDA 1Y63A 2Z0MA 3SDZA 1VQAA 2D62A 2VHCA 3HU3A 4DLWA 4M1YA 4YXWD 1GG2A 3IIJA 3AVVA 2NZOA 3UDFA 2BMFA 4RVCA 5IYBG 3TS2A 3LAWA 1WFQA 2KBFA 4MKFA 4MRRA 3CB4A 3GDEA 1IY0A 4LC1A 1W46A 2ZYWX 1BH2A 2OFWA 2V7QD 2ZTEA 1SXJB 4CYMA 2WJGA 3D0FA 2A7QA 1KIMA 1G7RA 1YNXA 1SKYE 4Q1DA 1A1VA 3CIOA 4LYFA 1FL0A 2VL7A 1E6CA 4M9QA 2GVZC 5LD2C 4BWYA 2WJHA 4D26A 1KO4A 5DISB 1ONLA 2RB4A 1WDTA 4M1OA 3AF3A 3IIMA 2R7DA 3F2CA 4Q9JA 3ZZ0A 2ZM5A 4DPGA 2BBSA 1UKYA 4G5SA 4KN4C 4TTRA 1KK0A 3VX4A 1E2KA 1Z2CA 2ODNA 1L2FA 1AS2A 2D7CA 1Z0FA 3GTMH 2ZRPA 3D6TB 4LI0A 4BXXG 3CWZA 2FN4A 3A1UA 3QVVA 2ZR9A 4QBFA 4X64L 4UY8C 2CK3A 4C0QC 3SFVA 1YHAA 3G0HA 2PJRA 2ZR0A 3HU2A 3S1RH 5BQ5A 2OE2A 5FUWA 3CBQA 2IF0A 1HQMC 1CP2A 1ZP6A 1XU4A 4Q19A 4HJAA 1G8YA 1Q81C 2ZVQX 4URWR 5J4HA 4BE7B 1JAHA 4NCJA 2IXEA 4DHEA 3I4OA 3KF6B 1O87A 1XZPA 2IS2A 1RVDA 3QPUA 2QZ4A 4FCTA 3MSXA 5TDHA 4X66L 3ZZTA 4F4CA 1UBGA 2ZJOA 3GLFB 4OI2A 3UANA 2CL0X 5A5GA 2FZ4A 1Q44A 4ARZA 2G77B 1YZGA 2QP3A 2VTKA 2AKWB 1UM8A 4HYYA 3NDPA 4V0LA 4LJ8A 3FE2A 3EZ2A 5CM8B 4PC3A 5C4XG 5EP3A 4FIDA 2ZRHA 1NY4A 2R65A 1HTPA 3HYRA 1WCMH 1HT1E 4F93B 4Q7LA 1VQCA 5AR1A 1VQNA 3B85A 1DCZA 2N78A 3CC7A 3S15H 2ZUDA 2C95A 5CJ2A 5FL3A 4YXWA 3UMSA 3PCOB 2QN6A 4BZQA 1IBLQ 3VHXA 1G5RA 2GRJA 3S16H 3LV8A 4B44A 3T1TA 2JLRA 1FQKA 1Z28A 1E9BA 2AR7A 1OFUX 2RGNC 5G3YA 3KJPA 1DOAA 4JBMA 1DAFA 2V7QA 1DE0A 4D81A 3L0SA 2BHRA 3HDTA 3HWSA 1LM0A 4B3MQ 4V0OA 5HE9A 3ZDQA 4C3JH 1QVFA 2EW1A 2FEMA 2ATVA 2BJVA 2XAUA 2GF9A 1C4OA 4M21A 1KI1A 4MA4A 4LOAA 4TYPA 4JSYA 2YKGA 3HOVG 1GILA 4RD6A 4NPSA 1AQUA 2EIFA 4Q1BA 3SN6A 2CNWD 3T35A 3GLFA 2R7ZG 2NN6G 1MKHA 5IWAQ 1UF9A 1E99A 1XEWX 1U0LA 2AXPA 4LF6L 2Q9BA 3T1OA 2ZS9A 1CR1A 3CF0A 4FCWA 4PC1A 1VG0B 4UNQA 4MKHA 3R9IA 5AWFC 1KI2A 2VUMG 2JQOA 1QVGA 1HR0Q 1Z0KA 2FGKA 4OK6A 1GNPA 4JI4Q 4DBLC 4YWMA 3U4QB 3AF2A 5JWRA 3AYHB 3K0EA 3IPXA 3I5YA 2WVJA 4P74A 5C4JH 3BWDD 4XOIA 4CEJA 1N0WA 5J4KA 4XWKA 2ONKA 4FWIB 2K5VA 1AE2A 3QEOA 5AJZA 3HKZG 4R4QA 2JLXA 1AS3A 1LUZA 2GILA 2NZ8A 3A1TA 3HGBA 4A3EG 2NPIA 5FPHA 3TVTA 3KQUA 1UKEA 2WTUA 2XXAB 4Q48A 4OO1I 5JBQA 2UXDL 4A3GG 5CB8A 5JEAH 3CCVA 3VR5A 2JA8H 3QBVA 2JA7G 5BWMA 3BFXA 4C3IH 3KXIA 1SVWA 2VZAA 1QBKC 1WA5A 5DIFA 2VS1A 1X9NA 1E98A 3AKYA 2VSOA 1L2TA 4TLEA 2VHJA 2I3BA 3CXCA 4HLQB 1XWIA 3E2IA 3QENA 1TKWB 1OPXA 1JPNA 2FF7A 1X6VA 2KENA 5CM9C 4XVRA 4A93H 2XB2A 2JEOA 5KPDA 4JI5Q 4PPNA 4FDBA 1W36C 3FKQA 1OJLA 1NNEA 3RABA 2CKZB 3AB3A 4A3DH 5KU1A 4UNRA 3IBYA 2ORWA 1KO1A 2D4HA 3VKWA 2IS6A 4L5QA 4GN3B 1G64A 1S1CA 1W0KD 2IBMA 3U4QA 3EIEA 4IFDJ 4JZKA 5KDLA 4LBVA 2AK3A 3EBEA 4DR7Q 4JLPA 5C3EH 3BC1A 5B64A 1VCMA 4TMTA 5AUOB 2EVBA 3B8HA 3KZ1E 3ICEA 3QKSA 4TMZA 3CQZH 3PEUA 1QG2A 2I1VB 1OTCA 4Z54A 3LX5A 4B6FA 121PA 4XVUA 4LUOA 3GJ7A 3M6AA 4RFSB 5EP4A 5IK2A 3C5CA 2JA6H 1P2SA 2ODBA 3L8YA 1AN0A 1KAWA 2ZI9A 1YEZA 2QEXA 2CNWA 1A5TA 4WZBE 2B21A 4QGAA 4Q7KA 4PZYA 3U3JA 1VQIA 3E0EA 3QPVA 3B60A 1IXZA 4AQYQ 1TQ2A 1TWFH 1Z5ZA 2F3TA 2EFDB 1A2KC 1OFIA 2UXCQ 1EQRA 3L7ZC 2ZRKA 4HJ9A 1GVNB 4JL6A 2HYIC 1A62A 2GZDA 1NVVR 3B1WA 4LFBQ 4ACBA 2NG1A 1K8RA 3K0CA 3O8RA 4V0KA 3DM5A 4Q47A 4TL6A 1UEBA 2K75A 1GSIA 5FTKA 4OHZA 3UWOA 1YRBA 3RANA 1P62B 2WPDA 3TAUA 1KK3A 4DDTA 4IEIA 1FOEB 4TVAB 1Q20A 4JT2A 4ZCIA 5B58C 1NY5A 2SHKA 4R2HA 3MFYA 4D4KA 3JVVA 4UP9A 3UIEA 1UE7A 4UQOA 3X2SA 5LD2B 3QG5A 4ME3A 3H0GG 3EC2A 4GKJL 4A0RA 5BN4A 4JI3L 4GBMA 1TXYA 4KFSA 3I7FA 4X62L 4DEXA 4FWTA 3HU1A 4JJKA 4H13C 2JLYA 3IEUA 1T5IA 4D82A 3OHMA 5JSZB 1JR6A 2BJWA 2WB1E 2I4IA 3KUCA 4OQMA 3OW7A 2JEAI 2ZS8A 4BQSA 3LX8A 4LFAL 3VFDA 1ZC3A 2QBYB 1SVMA 1VG8A 3NC1C 4DK3C 4B3TL 2ZAOA 4B3GA 3CCRA 2CLCX 3W8NA 221PA 1CULC 4MTNA 1X8JA 4DV6L 1HNXQ 4MZ9A 2C9YA 5E4FA 4DSUA 4K0KQ 5FPSA 2O5JC 2E87A 1HNWQ 2XITA 4LF7Q 4JK1C 1YQTA 2IT1A 2ZJPA 1GUNA 3M4PA 3G71A 4MGIR 1Q0UA 2K7VA 3A7LA 4TLCA 4EJSC 2FSHA 4ZKEA 2B63H 4ZI3A 2O8EA 4GOKA 3I4NG 4BY7H 2VQFL 3BS4A 4KLNA 1HZBA 2E1RA 3GQBA 3K9NA 1B8AA 4QJ4A 2XZLA 4DSOA 1AH9A 3A5UA 3KQNA 2JDID 5KNBA 4LSGA 1WI5A 1KAOA 2D2FA 3CX8A 1TWHH 2R93H 4F91B 2OILA 1YR6A 4QBHA 2Q2HA 2DNEA 1JEEA 4WZ6A 3LW7A 3EZ6A 5HE8A 4M1WA 1H9JA 3PUZA 2WOJA 4PZ8A 4DV0Q 4RZUA 1E3PA 5C1BA 1SMXA 2ZTDA 4DR2Q 1ONBA 3GJ4A 4B43A 2ODEA 3W6OA 3DMDA 1VECA 1Z2AA 1D6JA 1M8PA 4GT1A 3IQWA 2UUAL 2ZRMA 3I55A 2W58A 5FL7D 4DR6Q 1Y1WG 8OHMA 3ECCA 4LBZA 4DCSA 1T5EA 1H9RA 2HIXA 3IGFA 5KHOC 3PEVA 4I81A 2VF8A 4JYBA 3LXXA 1PYBA 2K4KA 1KHTA 3B82A 4JVSB 2Z83A 5FTNA 4GL2A 1N34Q 1I4TD 3UDGA 4II7A 4OQLA 3RSOA 1NMZA 3WYAA 2FMXA 3L2OB 1NSTA 3ADCA 1UBEA 4HSEA 1T8TA 3TR0A 2IYLD 2V3CC 4JI1Q 3L82B 5JS8A 4GDFA 3RNUA 2J5XA 2ZI4A 4NXMQ 3I1FA 1CJMA 2P67A 3AF1A 1W49A 5EP2A 1M2OB 1CRPA 2G9NA 1S72A 4YCVA 4MRSA 2NO1A 2ORVA 4HATA 1HZCA 1Q1BA 1TAGA 4TQAA 3EN2A 1OB2A 4P32A 1NVUQ 4TZ6A 1II8B 1W36D 1GD7A 4TWZA 4IFDG 2X2FA 3G48A 3ZD7A 2JLSA 1OXVA 4C0HA 4ASUD 1VQ5A 3AP3A 1KI6B 2O8DB 2Z43A 1GNRA 2OAQ1 4JV5L 5H1YA 2REXB 2BCGY 1WRBA 1ZYRC 2JJ1D 3VQTA 4DR4L 4X6AH 1ZAKA 2DWPA 2RGNA 2WMOB 2I5MX 4MGZR 2N1BA 2RHSB 2D2EA 2UXBQ 3BGWA 1YVCA 2E5LQ 2R92H 3H86A 2QA4A 3U50C 3UK6A 2KSQA 1X6OA 1J99A 1XNJA 1ZNWA 3OF5A 3VTKA 4YONB 1I3QH 4YY3L 5DN6D 5GVRA 3RAPR 4TMXA 4GLVB 5KNDA 1W47A 4DUGA 5GAGC 2XEXA 3RS3A 1HURA 1Y1VH 2JDIA 5IYDH 4DLTA 2KCCA 1OSNA 4Q9KA 4IOKA 1D2MA 1QVCA 3S2HH 2GCOB 3WDNA 2Q3HA 1K9MC 1DO0A 1VQDA 1P2TA 4AK9A 2QPOA 1EWRA 2OBNA 2C9CA 4DUZQ 4B6EA 1W36B 1HUQA 5GQOA 3GMTA 3CWQA 2QY9A 1YIJA 4DNTB 3UG6A 2DGYA 2MSCB 5C46F 3BZCA 2O0JA 1E0AA 5KPJA 3LQRA 2EJGC 4KLZA 2IUUA 4HB0A 3RS5A 1AJEA 4W5JA 4YHHL 2IUSA 3LY5A 4TZ0A 2KCTA 4F92B 2ZJRA 1II8A 2PMDA 2J87A 4KSCA 5FL7A 4E22A 1B7YB 4CEHA 2VRWA 1N0UA 4IOLA 1JE5A 3J81c 1PMRA 2EFCB 2Q3FA 3HOXG 1KI6A 2ZRCA 4JKYA 3WMEA 2O8DA 2WJJA 3MG9A 5FR1A 2GVBA 3RN5A 2OTJA 1D8LA 1AM4D 1CJUC 1RIFA 3JZMA 2VNUD 1Y14B 3RSLA 5JCPA 4OHYA 3P4YA 2ZE7A 3B6EA 4JL5A 4N0EA 2YINC 1PH9A 4HIMA 1N33L 4B2PA 4A3IG 1JJ7A 1KMHB 1AS0A 4RZ3A 4X8OA 1FQJA 1NVVQ 1ZUIA 2ZJYA 2Y8EA 4Q18A 4BFWA 1DPFA 1NLFA 1RYHA 4G5QA 4PAQA 4IXMA 3LBNA 4OI0A 1X65A 5HGQA 1N32Q 2HEIA 1C0AA 2WIAA 3K9HA 3J81i 4DKXA 2GCOA 1IBKL 4JYAQ 3T1YQ 1Q21A 1YE8A 4HB3A 5JRJA 3DPUA 4JYCA 3NH6A 2GDJA 5LMNL 4JC0A 1O3YA 4I1VA 1X1SA 2IUTA 3B1YA 2UUBQ 1AKEA 2PEZA 4QL3A 4KYUA 1KAGA 5CJPA 4OX9L 2F4VL 4ASUA 5AJ3Q 3CMEA 2VP5A 3WYFA 3WBKA 1SKQA 2ZSDA 1JR3E 1T3SA 1P9RA 3SJCA 2NVTH 2JJ1A 3I92A 3NBXX 4XWAA 2WAYA 2YOFA 3BH6A 3NTUA 3QXCA 5DYIA 5FI0B 3SYKA 3AKDA 2A3RA 3A6PC 1KQSA 4FINA 1EWQA 3BG3A 4KFTA 3THXA 5GVSA 5KO2A 2GAOA 2JLUA 4LY6A 1VF7A 3BBPA 3ULLA 5DN6A 1XB2A 1N6OA 3KXKA 4GFDA 5B2ZA 2J0UA 2JLWA 1LF5A 2N42A 4AKIA 2CCKA 4KVAA 3OPOA 1KMHA 4M53A 3DMNA 4HR7B 4D2IA 3QXJA 4IO9A 1IAQA 2IYUA 3VKHA 3PO3H 4DT1A 3IILA 4A3KH 4MNOA 2GEDA 1N8RC 1AQYA 2D06A 5DHFA 5H68A 1D7QA 2VQEQ 1KDPA 1WXQA 1OFHA 2ANBA 4LF9L 1P5ZB 1C9OA 1ZNXA 3I8XA 3KFUA 3BB1A 1S9HA 1ZD9A 2OLJA 2H7VA 2RHMA 2YWFA 2PLRA 3PSIA 4B74A 1G9XA 1L0WA 1JXOA 1HZ9A 4F4JA 2FSGA 3U7FB 1NLZA 3VHLB 3P27A 2EU8A 1XEXB 2WIBA 3DO6A 3LH5A 3OFND 2J46A 3QBTA 2IYYA 3K7AH 4UP7A 2A9KA 1YZUA 3BD9A 3MGCA 4GPTA 1GO3E 4BY1G 4A76A 5C4GB 1EWIA 3AVXA 2F9MA 4LF8Q 4M1MA 3CF6R 4EJSB 1VQKA 1IN4A 2Q9AA 3ULPA 2GKSA 1KDRA 3GFPA 3L0IB 4NCNA 2XNDD 3RLOA 4DR1L 4DUYQ 1AKYA 3ZJYC 1CJKC 3P26A 4QNMA 1YI2A 2GTPA 4GMXA 4DCTA 1GVPA 4GOPB 4GOJA 4A75A 2FFBA 4L16A 3PXGA 2IHEA 1I5FA 1SXJC 1YHNA 3H4MA 4HB4A 3TH5A 5HR5A 3DXJC 1T3LA 4LNQA 1JI0A 5C44H 3LNCA 2CL6X 4JLBA 2KA7A 2HXYA 1Z6YA 3KB2A 1E2MA 1JJGA 1E2FA 1N5IA 4L4UA 4Q9IA 3E9IA 5FOWA 3ZZUA 3EC1A 1FJGL 3K0AA 2WKPA 4O0MA 3FKIH 1MRNA 3AUXA 2FFHA 2IW3A 1D9XA 2VHUA 5KDOA 4A15A 3VNUA 4LJ9A 3MJRA 3R20A 2IX1A 4D25A 1N36L 1HEIA 1E4VA 2FPLA 2W0SA 4MYCA 4NH0A 4RJLA 1NN0A 3KKOA 3SFZA 1RPZA 1RRPA 1GKHA 2ANCA 1IXSB 2WB1G 1KZGB 2BEKA 1SRUA 5K8UA 4DK0A 3J81k 2JJ2D 4EJSA 1DG1G 1GUSA 3LXRA 4AKHA 5IT9c 2O0KA 1VYVA 3K8YA 4GNXB 2D3WA 4C3ZA 2DCUA 5BR8Q 1XNRL 4LHWA 4MRPA 3G82C 5GJBA 4DR5Q 4PQRA 1LFDB 4WBSA 4JVMA 3WMFA 2DBYA 2FDCA 3Q9LA 3A74A 1XZQA 5FBRB 5M3MG 3CCEA 1JR3D 1RE0A 4B33A 1EFHA 1EX7A 4H02A 1TWAH 1FMJA 1PHJA 1X3SA 3PITA 4PHHA 5EAYA 4PSAA 3TSWA 1ZRHA 4JMPA 1FZQA 4JG2A 1UKZA 4TYYA 1SXJE 3NBZC 3OFNA 3TW8B 2OT3B 1YJ5A 2WP8J 3CX6A 5F2EA 3TLXA 3TR5A 1R0YA 2XTNA 4PO9A 2Q6TA 2WWHA 1H9SB 4DNRB 2JJQA 3EIVA 1R5NA 2GVDC 2KI5A 2QP9X 5C0XH 3FPAA 1Q90A 2CLSA 1ESNA 3LQQA 2D74A 4PZZA 1IW7C 5GJCA 2JA1A 2WWWA 2I0QA 5LB2A 3BB4A 4LHVA 2FG5A 2HHHL 1NJIC 2LWIA 3J81j 1E79D 3GTLH 4P4SA 2C99A 1DTSA 2XNDA 3B1XA 3F0TA 4EQ5A 1MH1A 4IW3B 4S2EA 3GTPH 3JVUA 2ZUCA 3S1NH 1CF4A 3S1QH 3N70A 4Q4LA 2UU9Q 1LVGA 3KFXA 4HLDA 3O47A 3R7WB 1TMKA 1JQJC 4A82A 4B2LA 5LDDC 1TQDA 5A0FA 3A8IE 4AH6A 4DR3L 1I94L 3BRWD 4R9UC 3U4VA 1U9IC 5KYKA 3ZQJA 2JLVA 2QM8A 4YLGA 1F60A 1XJ0A 4BA2I 4HAYA 1R10A 3Q72A 1GDDA 1FR3A 2P65A 2W2TA 3G6EA 1JMCA 4A3CG 1WE2A 1GTVA 5IP7H 1IM2A 5GADC 3GTKH 4JI7L 1NN1A 3KYHC 1D2EA 3AF4A 1P60A 1DAGA 5BN5A 2W2XA 1BVSA 1OYYA 1DGSA 3S14H 2KBEA 1PLKA 3GPLA 5CK5A 1LW7A 4DB2A 2KHIA 3SR0A 2NGRA 4KCGA 4QHTA 2ZXUA 2WKRA 1KO5A 3SS8A 3TAHA 3W6NA 5FPYA 2JJ2A 5LMUQ 4C0KA 3U7HB 1ZNZA 5ELXA 3IDQA 2ZI6A 2HLDA 1FPMA 2F1IA 1GKIA 4DV2L 1JT8A 4OK5A 3PEWA 1AGPA 1TUEA 2J59A 1FVIA 2HJVA 3AP1A 3OTOQ 1Z6GA 4C4PA 2B92A 2VHTA 5E95A 4Y52H 1OB5A 1KRSA 3UATA 1LYLA 2RHDA 4IDNA 2MSDB 4DV4L 1R4AA 5HZKA 4CRWB 1KI8A 1JR3A 2VP2A 4IDQA 5J4YA 1F2TB 2NTYC 3MD0A 1TQ6A 3TRFA 3SJBA 1E1TA 3W1BA 4YWKA 4N1AA 3RLNA 3A37A 2D0PA 4OONA 4IRUB 4LJAA 4ZIRA 2VQSA 2CE2X 2Z4RA 5SZHB 2P6NA 4I1SA 2P6RA 1RYFA 2ZRBA 4C0AC 4RCZA 2B3GA 4B3RL 4NYIR 4O2DA 4D4JA 5JFGA 2XJ4A 3T1HL 1QZGA 4XTRA 4JL8A 4JSTA 3BU2A 2N46A 3TQCA 1SVIA 1CU1A 5GADl 3CPHA 2ZYTX 1XMOL 3SJAA 2UUCL 2DFNA 1E79A 2GN5A 1ZUNB 4IEEA 4EPRA 3HP1A 5E7IA 3CAMA 1SR3A 1BBWA 2G6BA 4ZCMA 2JE6I 4HAWA 1P72A 2OG2A 2ZE8A 4DV3L 1XXHE 2LKDA 1W0JD 2DFLA 2Z0SA 1R8SA 1G3MA 1VG1A 4DDVA 3TK1A 3FMIA 3WXMA 4DK6C 1T4GA 4BLOA 4ZO4A 2ATXA 4XD7D 2J7PD 4HAUA 2PZFA 1CRQA 5J47A 1GHKA 2R6DA 1KK1A 3TBKA 1XPOA 1F2TA 3CPEA 3SNHA 4RCYA 1E2QA 4FW9A 5JZVA 2J0VA 5EQTA 5H8WA 5ANRB 4DLXA 1Z7TA 2HYDA 4JI2L 1K6MA 5JMTA 4B75A 4Q4JB 2R6CA 3FTQA 4W5WA 3BFVA 2ZETA 2ZIAA 1NF3A 1VQLA 4DLUA 1NVWQ 4I4LA 4DCUA 3EAQA 4CEIB 2FA9A 2CJWB 2ES2A 1XJVA 1B9NA 3QUSA 2WJIA 4A3MG 2B8TA 4YCWA 1P75A 4FMCF 5JEEA 1ZD1A 1Z83A 5FLXc 3H1TA 2EQSA 1KYIA 1PVOA 5J5CA 5HZHA 2YU9H 1ASYA 3DKPA 4QBGB 2ZM6L 1CFMA 1E0KA 3WHLA 2RGAA 2C78A 1YNNC 4KMUC 4KHPL 3Q5DA 2VP6A 3CR8A 2MO0A 2BDOA 1G7SA 3PFIA 4A0FA 3UE1A 1XFAA 2HF9A 5SZIA 2Q3MA 1EX6A 5HKKD 2ZEJA 1HPCA 2O5IC 1TEVA 2GEVA 6Q21A 2MNAA 2AFIE 2OCPA 1YRAA 3GJ0A 3M9BA 4BXXH 2A69C 2WOOA 1U0HC 2PJZA 2CHQA 3B2EA 4H1VA 2YC2C 4W5HA 1COWD 2GK6A 2C98A 3SYLA 1E9FA 4R1JA 1U8ZA 3K0XA 4JLKA 4TMVA 4Q4JA 2IEYA 4G7ZC 2ZI3A 2FU5C 5EXXA 3KKNA 4LGMA 5FUYA 4J0QA 3AQ4A 2CJWA 1OXSC 2BC9A 3QIAA 1IW7D 3VR6A 2WWFA 3CP0A 3AQQA 3N2EA 3QNUA 4XWOA 2PMZE 2JCSA 4MQBA 2GA8A 4QM7A 3ZJYA 2NVXH 2V4ZA 2ZRJA 4D0GA 2XZOA 1LF0A 1W0JA 5DHAA 3C8UA 3AGPA 3UXMA 3SQXA 3CUEF 1OIVA 2EWVA 1AA9A 1IQPA 1SXJA 3W9YA 5M3FG 2MSEB 4XD7A 3CCJA 1LV7A 2J7PA 4JVNA 2OCAA 4B32A 3U61B 3CRMA 4FMCB 2AN9A 2GZAA 4URUR 4BFVA 3OOCA 1X54A 1FP6A 1W44A 4V0MA 5EXSA 2XB4A 5CIQA 3IQXA 1M7HA 1R0ZA 1OLOA 2GJ8A 1A0IA 3CLVA 1GKUB 3PG5A 3HR8A 1VKJA 1HT2E 3F5FA 4G01B 3OEHD 4QM6A 4BBRG 2C9OA 4DIEA 2IX3A 1F2UB 1YHBA 2V4DA 1G3RA 2R6AA 4Q00A 4D0LB 4A3JH 5AUPB 5LB4A 2ZJBA 2EJMA 4H9GA 4A9AA 2X77A 4HDQB 1GL6A 5TB5A 1WQ1R 2K5UA 1E2NA 2EFHB 5F3WB 4DV5Q 4KBFA 2B6HA 5JEDA 3CCQA 1IBLL 3GEHA 4RZXA 3W3ZB 2AHOB 3KL4A 1PZNA 2REOA 4ZDWA 3PUVA 2GVAA 1V5WA 2E9SA 5ELNA 2ZVPX 3CNLA 4US0R 3KF6A 1IN7A 3D31A 5M04A 3CH4B 2HCBA 3LWNA 3EZ9A 5HKKA 4MRVA 4C0SA 2NN6H 1EFWA 3DL0A 3ULJA 4A3FH 2ZANA 3NHAA 4QGHA 4XVQA 1Q22A 2ZI7A 3GD7A 2ORIA 1WCMG 4IOAA 2QRNA 4JLOA 1MABB 4NKRA 4XSGA 4QJ5A 4EDHA 1Z6TA 3CRQA 4ACAA 2VUMH 2RGBA 3LVQE 1WB9A 1R0XA 2YWEA 1H8HD 1ODFA 5LBIA 1COWA 4D6PA 1RL2A 2PI2E 1MT0A 4NYMQ 3PIRA 4PSVA 1JJVA 2VP0A 4IPGA 1XXHB 2QTVB 4KJZA 4L5TA 3CZPA 4BA1I 1P8LA 5LMNW 4LF5Q 1LTQA 3EPLA 2MMGA 3I2ZA 4C30A 1H65A 2QPAA 2V9PA 4TLBA 2FJUA 2R6FA 3KX2A 5EP1A 1F2UA 4JI4L 4A3LG 3M0EA 2ZRDA 4A3GH 2L5TA 3BAFA 3S1AB 2O0HA 2JA7H 1IXRC 1XD2B 3PVSA 1N6KA 1WMSA 2PMKA 4NYIQ 2RCNA 2A78A 3LDAA 1C9KA 1OV4A 3B1ZA 2AHOA 1BOFA 1NG1A 1CEEA 2LMCB 4CF7A 3VX3A 1SVLA 3HPQA 1U9IA 4OWTB 2AKYA 3G5UA 821PA 1N5JA 3GEEA 5FTLA 3EX7C 4OQXA 4BRUA 4BASA 1GL7A 1QVRA 4PC2A 5L3QB 1KY3A 1E2GA 5FOTA 3N5CA 4AIIA 2CFMA 3J7A5 4LYHA 4URVR 1G18A 3M1IA 1E22A 2RAPA 3TUZC 2CBZA 2H18A 5FUXA 3CCLA 2IWRA 2GJAA 4B3SQ 2GNOA 3P4XA 4JIMA 1VQPA 4RMFA 2PQAB 3TREA 1QZHA 1HE1C 2QMOA 2X19A 2YWHA 3CPJB 3GTOH 4A8JB 3OEHA 1Z9FA 1D9ZA 3NBYC 1JAIA 1XXHA 3TSZA 3U6BA 1HNZL 2VHQA 3QXXA 4QG7A 3HJNA 2CVHA 3AKCA 1NSFA 4LK1C 2JA8G 3CPFA 1TU4A 1W5SA 4IPCA 1XMSA 2GESA 2QORA 3R8CA 4LV5B 2OCEA 1RRFA 3STBC 3EARA 4A6XA 2K5NA 3HOYG 1CBUA 2FFAA 1R8QA 4KU4A 4YDSA 1J2JA 4HAZA 2XXAA 3CMAA 1XD2A 3QXHA 1EESA 2Q2TA 1HQCA 1TTTA 1VQBA 2F3RA 1EIFA 3L8ZA 3DZDA 4A93G 4P3YA 4B3XA 4B76A 3PUWA 4AIMA 1V43A 1OIXA 3OIUA 1NL3A 3H0KA 4URYR 4YC7A 2VL6A 1RC8A 3K7UC 2EWWA 3GTJH 3K8AA 4A3DG 3UPUA 1H8HA 4BGDA 4KITB 2A69D 2H8KA 1G51A 4MDEA 4QBIA 4ZKDA 2PT5A 3KXLA 4UXHA 1PLLA 2ZR7A 3SJZA 2YWGA 4C7OB 2XNSA 4MH0R 3AH8A 5CYPA 4CDGA 3HPRA 2PQAA 3V9PA 4AQYL 1G19A 1GUTA 5FBLB 4EPYA 2ZRFA 1IBML 2RH5A 3KDSE 3WHKA 2UXCL 2YYZA 3IFTA 5C0XI 2K14A 3NHBA 3K9LA 4BFTA 2E2JH 3FHCB 4DLZA 3LO5A 4PHFA 4LFBL 1QHHB 1UJ2A 2HV8A 3H0GH 4BFZA 5E7NA 1WCV1 3TW4A 1U2RA 3RRYA 4EQ6B 3U5ZB 3A8JE 3CW2C 1RZ3A 1VIYA 5FUVA 4QHSA 3VR4A 3PO2G 2DR3A 4TTPA 3AP2A 4R4CA 5AK0A 2ZROA 4RFSA 3HOWG 1V1QA 4BBSH 4IJLA 1G7TA 1KD1C 1OE0A 4JJZA 4NMMA 1E2PA 2CMKA 3I56A 4LV8B 3M4QA 3LW8A 2FXQA 3HR7A 3EIHA 1L1OC 4QXAA 1IL2A 2O52A 4B2IA 5KSZA 3GCGA 3WP0A 4NCKA 1E2VA 4JI3Q 1RFLA 1ZCBA 5FBQB 2F55A 4UJ5A 1IN5A 1W4BA 4X62Q 2ZPTX 1XRJA 1W0KA 3K1JA 1YBYA 1IY1A 4TL8A 3RHFA 2YTVA 5B30A 2IHBA 3FHOA 1W4AA 3ASZA 3KTAB 1VIAA 5IF9A 3M4YA 3DDCA 3T53B 1U99A 1Z6HA 4V0NA 2ZSAA 3MWKA 4ZV4A 4O3MA 3I4NH 1O7IA 2QGQA 5AJVB 4LFAQ 3C16C 4K0KL 3P32A 4XSHA 4PZ6A 1NBME 1TL7C 4LF7L 4CVNA 3M85A 1P7CA 2A5GA 4Q9LA 1DD2A 3R8FA 3TS0A 5DLQC 4EQ6A 4JOIC 1MIUA 1N6LA 2A5FA 2EYQA 4UKDA 3QG1A 4GOPC 3WY9A 4JI8Q 2YC4C 3EA5A 3OAAD 4LHZA 1XMQL 1XD8A 3ERSX 1P6XA 5A4JA 2ZRNA 1SQ5A 2UZ3A 5JSZA 2VQFQ 4DV1L 3RC3A 3TIFA 421PA 4EX5A 3NVAA 2JA9A 3CF5A 2ZRLA 4E5UA 4F38A 1E3MA 1Y1WH 1PH7A 2G1JA 1Q46A 4IDPA 4EUNA 1RRCA 1A7JA 1SN8A 1FYCA 2QBYA 4KODA 4DV0L 1S4QA 4A4DA 2L0XA 1DAMA 2B63G 1KXLA 1Q7YC 2QMUA 2F1RA 3AFPA 4PG3A 1S3SA 4QRHA 5IHPA 2C5LA 2BMJA 2J45A 3RZDH 1PH8A 3I4MG 4IDHA 2ZSEA 2QA5A 4WA7A 4PPQA 1AE3A 1CKOA 1AIPA 3B1VA 1Y3AA 5H70A 4OHWA 1IY2A 1WOCA 1E1RD 1NMYA 2WMNB 2PI2A 4JLMA 5EJEA 1N34L 3W3AA 3F2DA 1E2DA 4UPAA 2F3IA 4GNXC 2P0EA 3NWJA 3WP1B 3ZS8A 4PXAA 4YMVA 4OQFA 1B0UA 4LJ4A 4C0JA 4JI1L 2QM7A 3RWMB 2DFKB 2XTIA 4NXML 2W0MA 4CIDA 2H16A 3AVQA 3K0SA 4IFDH 2C04A 3W34A 1G291 4GZYC 5DLQE 1FNMA 1K0RA 3OW2A 2ZT9C 3FB4A 1E2ZA 4RZ2A 1DXMA 1H8ED 2BCJQ 3AVYA 3MLEA 3UDIA 1K8AC 4BLRA 1QHNA 5EUQB 2IX0A 4DSTA 1X3EA 3JAMc 3DM9B 2N8NA 4WIAA 1OH8A 1GIAA 5AUNB 3UDXA 1RW4A 2XTMA 1IN6A 2MQHA 4TMKA 3U7EB 2RGGA 1JNYA 4Q1FA 5K36G 1OF1A 1GP2A 1IYJB 3DM3A 1VG9B 5KSOA 3STBD 3CCSA 3DHWC 4K46A 1DEKA 3BE4A 4PPGA 1Q82C 1VQ8A 3RS7A 4KKUA 4ILEA 3KLRA 2XTZA 1YJWA 4G5RA 5HY6A 1M34E 2ZQ5A 2FV8A 3JAMi 1ZC4A 3OAAA 5AJYA 2ZU6A 5FBWB 3U44B 1KRTA 4TKOB 4TTQA 4AC9A 2DFTA 1RIPA 1I6HH 3B78A 1EOVA 4FI3C 5L3SA 3BOSA 1FW6A 1S40A 2E76C 2OWOA 1NVXQ 2X8AA 2WWGA 4MYTA 4MYHA 4RG1A 4NCIA 3U3MA 3GLIE 2GJSA 5CIWA 2DHRA 2HIVA 5L3SB 3D3QA 3HOXH 3EXAA 1KO7A 1NBMD 3IPYA 5L8VA 1EFTA 2FNAA 2V54A 1EUJA 5L3RA 3RS2A 2Z6KC 1MJEA 1RJ9B 1X1RA 4M2LA 2W6ID 4XH9B 1SHKA 3VR1A 3GLGE 3K81C 2XZPA 1EXMA 1IXRA 3MAAC 1F48A 1G16A 2GBLC 3CNNA 3ZVMA 1XMIA 1L4UA 2VO1A 1KJYA 3H2YA 4FMDF 4G3XA 1XP8A 2YHSA 1E1RA 4Q1AA 2O8BB 2QQEA 2CCZA 4ZDIA 3U7GA 2A6HC 3FHTA 4A4IA 3GJXC 1ANKA 4NONA 1A2BA 1PUJA 2PZGA 3M4OH 4RFVA 3BJIC 1KJZA 4LZZA 2IYRA 3BIFA 4I1OA 3X1XA 2ZI5A 2ODWA 3W5JA 3AVTA 5B57C 1N33Q 3PENA 3U4ZA 1N32L 1G8HA 3RRZA 4DEYA 1II0A 1NMXA 1ZD8A 2REBA 4U5XA 4X65L 4GS3A 1SHZA 1E1OA 2C2HA 4DB4A 1H8EA 3AKEA 3T1YL 5FPTA 2A5DA 4JVLA 1VCIA 1OXXK 3MXUA 4D0NA 2BBOA 1KKMA 1L8QA 1IHUA 1YR9A 1G6OA 2GWHA 4LRWA 1XNQL 1J7KA 3EWAA 2YZ2A 1IBKQ 1QUQB 1PUIA 2RHQB 2PNRC 2CHVA 4PSKA 5BW8A 4GP7A 4OI4A 4TQUS 1SVSA 4R2IA 5CLLA 4G5GA 1E2WA 5D3MB 3BXZA 4LDJA 4Z8YA 3AVUA 5LMNQ 1CTQA 1G4AE 2OFOA 2GJ9A 3F1ZA 3W1GA 1RJ9A 2QT1A 2IYWA 1CR0A 3KJEA 4RY2A 4LV6A 3RWOA 3CCMA 3K70D 1NTGA 5GAHC 2F4VQ 1P2VA 4LBWA 1GM5A 1VQ4A 4B35A 4B47A 1X3FA 3UMRA 2IXGA 3WNDA 1JJ2A 4XIGS 2RGXA 4NTZA 2QRZA 3GJ3A 1US8B 4A2WA 5IDVA 2NN6I 1PFSA 1L1OB 2GXSA 3CRW1 3FFBA 3NBFA 3Q7QA 4LJ6A 4AG6A 1Z0DA 4R71A 3RS0A 1FGUA 3T61A 3P1JA 1KC8C 1QVAA 2PZEA 2VA8A 5JJKA 1DAIA 2ZRIA 3VU9B 2XGJA 3ADBA 4FMDB 2IYXA 4PPFA 4WXPA 1NBMA 2FWRA 2TMKA 5IP9H 1MO6A 1PH2A 2OFXA 3GP8A 3F2BA 1Z22A 1YVDA 1HH4A 3K70B 1TF2A 1J8YF 4EFNA 4P31A 2BDTA 3RRNA 2IC5A 2OXCA 3E70C 5D3MA 1DADA 1P73A 1NJGA 4JI6L 4PC7A 2V1UA 4LC0A 2QGNA 4Q1CA 4LF8L 1QHXA 3RRMA 1G21E 4B3FX 3ZVNA 3CW2A 3CZQA 3I5XA 2GCPA 4DV7Q 4LYAA 4QIWE 1D8TA 2G88A 4LF4Q 1UEJA 4KHZA 3QSYA 4RD4A 1EFCA 3THWB 1I2DA 5DI9A 5SZKB 1E2HA 1TNDA 2GXUA 3U58A 4URXR 3IKJA 4JI0L 1US8A 5TV2A 4MITA 3ZYCA 1OH5A 3TZUA 3SI7A 1L1OA 4HLUC 5DSZA 2IL1A 1TPZA 1L4YA 2BA0A 4ERNA 1NN3A 3AM1A 1M74A 1HZAA 1E0JA 2D0OA 2BM0A 2KB0A 2WJYA 1NRJB 4HAXA 1NBWA 4M9XA 4GZLA 2DWOA 4C2MH 1E9EA 5IE8A 3VU9A 3VNVA 3WRYC 1KI7A 2LXJA 3OE7D 2ZE6A 1XEXA 2CWPA 1S8FA 3CKLA 4PZLA 2JLZA 1E2EA 4OI1A 5FFMA 3NEJA 4OO1G 3IIKA 5C18A 2GXAA 1Z0JA 3OEED 4LBYA 1B23P 1SZPA 4A2QA 3AV0B 1M7BA 1N5KA 2X1VA 4URZR 1HH2P 3NE5B 4BFXA 1D2NA 1G41A 2EFEB 2QSZA 3MRSA 3H94A 1X56A 5UKDA 1VQFA 1N36Q 1BMFD 3IO5A 5BYJA 3ND8A 1OXTA 4JBKA 2DNCA 4EFLA 3GLIB 3A1VA 2EVWX 3W5OA 4GNKA 2XX3A 4JOIA 1Z63A 2O8FB 4EPTA 1MO4A 5M3MH 2ASBA 1QF9A 4GOPA 4Q9HA 4PAMA 2H5EA 1ZNYA 1P4SA 3LBIA 3C15C 1C1YA 1OFTA 1Z3IX 3THWA 4K81B 5EE1A 1XBTA 2ZTCA 1ETUA 4MKGA 5BR8L 3WMGA 3LRPA 2BOVA 3GLGB 2PNHA 4DR5L 2FX3A 1SULA 2AFHE 2AD1A 4HIOA 1BS1A 1I6VC 2PBRA 2P3SA 1OKKD 4HLCA 5J4VA 1CUKA 1KI3A 1JALA 4GMDA 4DAMA 2DN8A 3ASYA 1BKDR 1YZTA 4OJKA 4BECA 4LWZA 2B8GA 4V0ME 3OIYA 4P72A 1CR4A 3OYYA 4NE2A 5CITA 1S2MA 1DAKA 2IYZA 2AD5A 4NU0A 1WP9A 1I2MA 4OL0A 1CXZA 3P20A 2HF8A 4GN5A 2NO0A 3TUIC 4AY2A 5E3HA 5IYCG 4G7OC 5CDFE 1P61B 2XSZD 2A6HD 1J5EQ 4A3BH 1N2CE 3PQCA 4GNXA 2VBCA 3GLIA 2QNRA 2AUJD 5L3VA 3KF8B 2YTYA 1QDEA 5BYKA 1H95A 2J7KA 3KJIA 2A19A 5DNYB 4M1KA 2HHHQ 2G83A 4NB3A 2PLFA 3THYB 4L9SA 1B70B 4A3CH 5BN3A 1XMJA 2HUPA 1UADA 4AG5A 2K32A 1G3QA 2LCFA 1E24A 3GTQH 1G6PA 1MRSA 1W48A 3GLGA 3V4RA 2J9RA 2W00A 2QAGB 2BVNA 3OE7A 2VF7A 1HY3A 2JA5H 2ZITA 3FVQA 5JHGB 4PQYA 4RSGA 1VHLA 4DR3Q 4LPKA 1W4CA 1OXUA 4DK1A 5M5XH 3GJ5A 1A4RA 1NN5A 3AEZA 1UBFA 1UE6A 4NPHA 5TARA 2IWHA 1Q3HA 1H9SA 5DE3A 3W6PA 3FKSD 3BORA 2ZREA 2Z6VA 5LPNA 4RD1A 4JI7Q 4YQFA 3I61A 2PCJA 1BMFA 2HT1A 1NMFA 3L0OA 1FUKA 4Q02A 1GNQA 1E2JA 1L7VC 3WNCA 1SROA 1OW3B 2QE7D 5LMUL 2IHFA 1GKYA 1LNZA 3K09C 2IYQA 1QHGA 3T34A 3KJGA 3Q3JB 4JLJA 4QJFA 4BUJA 4C0LA 5FBVB 2VY3A 2OEPA 4DDUA 5IP7G 2G1KA 1T3HA 3RC8A 3OTOL 2VP9A 3R7WA 4D80A 2BE5C 4PV1C 2ZJ8A 4NP6A 2WFWA 4MRNA 3RR5A 1NJFA 3T56B 4BZPA 2XJ9A 5FLMG 5KOYA 2EQBA 4YMWA 2YVUA 1OKKA 3U3KA 3PEYA 1HA3A 1B9MA 1TUIA 4LFCQ 2WJVA 3MWLA 2JJ8A 1JECA 3BB3A 2W2VA 1NG9A 4ZI2A 2QSYA 1KNXA 4UJ3A 3AEVA 2Z6KA 3E1SA 3A58B 2MFIA 4QL5A 2WSSD 3HOUG 4A8JC 1TX4B 5IT5A 1Y8PB 4HZUB 3SOPA 4B3BA 3U6KA 2GBLA 3DVLA 5J3BA 4OHVA 4H1UA 2Q8IB 5FOUA 1CKNB 3TRZA 3A8KE 2A68D 2AUKA 2OCBA 2XSZA 2A5YB 1AK2A 4US1R 1JXMA 3T1QA 3QKTA 2V1CC 5EXTA 3THOA 2OTLA 2KWIA 4NXNL 1J8MF 1GFIA 2UZIR 3ADDA 4BEBA 1O7LA 2ZUBA 1T9HA 5JJIA 3U3RA 4F4IA 1UEIA 3T15A 3W90A 3MCAA 4KKTA 3A36A 4OWWB 4IFDI 1VQGA 3D4RA 3HOZH 4HDCA 4DRZA 3M3YH 3HYTA 3R9WA 3A7AB 2QTHA 5M5YH 4MGYR 4GKKL 1KZ7B 1Z0AA 3T12A 5IYBH 2AMCB 4HJ7A 3FKSA 3LLMA 4KXFB 4RD3A 1G20E 1E4YA 2A6ED 1LS6A 4L5BA 3CCUA 1E9DA 2F43B 4POAA 4QFMA 3RNLA 1S96A 4JI2Q 4HZUA 3RS4A 4PAOA 2UVQA 4AKEA 2QE7A 1VQ6A 4JBJA 5JEAJ 1M7GA 3LD9A 4HI0E 1CKNA 1E2IA 3A0JA 4NHOA 3S17H 1G8GA 4TT3D 5JI2E 1E94E 1M1YE 1MO3A 4LPSA 2YV5A 1KDOA 1T0HB 1XCPA 2V55B 4KAXA 4WZAE 5D3QA 2CVFA 3REGA 1EFRD 2AK2A 3CRVA 3NDBB 4R4OA 2ZM6Q 1CSPA 5FJ8G 4KHPQ 3FDIA 4W7SA 2RKOA 4QGFA 3KFVA 2FZLA 4DLVA 1IBRA 2OXRA 4N3NA 5DO9A 1N6IA 3U2QA 1N9WA 3EZ7A 2H57A 1ZU5A 3ZH9B 2W6JD 1ASZA 4Z1MD 4WJ3M 2G0NA 2D7DA 1Q3TA 2WSSA 3CD6A 1ZM9A 3TQYA 1OYWA 4CEIA 4RD0A 5FOXA 4DIDA 5KNCA 1I4LD 1YZQA 3WYGA 4ARZB 1G17A 3I8SA 1F5NA 3H84A 1CKMA 1Z8FA 3N6RA 2C96A 5HTKA 5KTYA 3C7KA 2L15A 1M6NA 1UBCA 1IN8A 2F43A 2VPPA 1YR7A 4X64Q 1SGWA 2B7CA 1QZXA 5M3FH 3B7GA 4Z51A 1CKEA 2F52A 2QPTA 2R8RA 4KSBA 4PQFA 1X55A 4U00A 1YHQA 4GSYA 3PIOA 1TWGH 1JQLB 2WICA 2Q2IA 3SEAA 1ZBDA 2PCFB 3CNOA 4KVGA 4HLUA 4X8HA 4APVA 1SMYC 4US2R 5C4XH 3K53A 1GUGA 4AD8A 2JIZD 3DKVA 2WZQA 3A1WA 1YITA 1HQYE 2AL7A 4QNRA 2OCYC 2R7FA 2KJQA 4JLDA 3TQFA 2ZRAA 4BBRH 3FMFA 1O78A 4X66Q 1ELOA 4Q7MB 4HEJA 1OH7A 4LJ7A 5CDFA 3EPKA 1PH3A 5JWOA 1Z07A 4WAUA 4A2PA 2BH2A 4M9SA 2J0SA 2OQ0A 4IXNA 4M1TA 1QJOA 4LJYA 3AUYA 1YZ6A 5JHHB 3B6YA 4PANA 1MR3F 1G3IA 4TT3A 3PGZA 1XJCA 1ZIOA 1G8FA 3FMCA 3HOVH 3V00A 2RF4A 3RN2A 1S3GA 3BK7A 1BIFA 3PV0A 1TADA 4DV5L 2R7ZH 4AYWA 1EFRA 4YMTA 4JBWA 1VQOA 1VMAA 3VAAA 4CEJB 2ZE5A 1E1QD 2JAQA 4B3ML 2BE5D 3GJ8A 3REFA 5BXQC 2KHJA 1D5CA 3ZIAD 1K8MA 1RKBA 2VH5R 4S35A 5AJXA 2Q2UA 2NPFA 1U5KA 2NVQH 4KFRA 5FTJA 3TVDA 4UXJA 4A0HA 2J0QA 4OHXA 5HCNA 2RGEA 4E07A 3UG7A 4A3JG 1KKLA 4NYJR 5IWAL 2CCJA 2W6JA 2ZSFA 4Z1MA 1F6BA 5F98A 1PYSB 4A36A 4A3LH 1X86B 1XJQA 1XEFA 2MMCA 1HR0L 3BH0A 3UKDA 4DC9A 4DLSA 4LF6Q 4A3EH 5IK2D 1VF5C 2QI9C 4P4TA 1KNQA 1DAEA 1T8UA 4BZXA 4LF5L 3T1VA 5JI3E 1DARA 1W2HA 4HJ5A 2C77A 1PH6A 2QROA 4HDOB 4QOSA 4AWXA 3L0PA 5IRCD 4A3FG 3EG5A 4GRAA 2JK8A 3K80C 2BM1A 3F8TA 3E5HA 1S1MA 1H9KA 1XPRA 3S2DH 1Y8NB 2A30A 1YKSA 2BEJA 3ONWA 3PR1A 2VYFA 3CONA 2CWAA 5CYOA 1BKBA 5E7JA 4PZ7A 1GRNA 4EPVA 2JIZA 3Q8DA 1N6HA 4AYBE 1GAJA 1IJFA 1TU3A 2NOAA 2GF0A 4OGQC 1YJNA 4Q4AB 4R7ZA 2UXDQ 1FP7A 1MABA 4POFA 1QRAA 2CCGA 1R2QA 4YMSA 4HJ8A 3NC0C 5J40A 3QKSB 2WAXA 3KDFB 3GO5A 3ADKA 4BPBA 2IS1A 2WPDD 2WWXA 2GZHA 3SGIA 1KL9A 1EGAA 2OBLA 2QAJA 2AXNA 1N25A 3EZFA 1CJVC 4MUBA 1ZINA 4WVFA 4PO8A 1K5DA 4Q01A 3VR3A 5F9FA 1P9NA 4JI5L 1LABA 2OESA 4L15A 4B3SL 4PO1A 1Z08A 5E7MA 2LSSA 1YR8A 5JEAG 1BO6A 2PT7A 1NKTA 5EE3A 5G40A 4OBEA 3KJHA 5EUMA 1IZ6A 3NG1A 2DWQA 1Q86C 3HOYH 1N6NA 1R5BA 2JLQA 5TY0A 1J70A 1N6RA 4LJ5A 2E8GA 2J1LA 2A1AA 3K09A 3QE0A 2QMEA 3S1AA 4DXAA 4DR7L 4MYUA 4FMBB 1DO2A 1HNZQ 4HZIA 2B29A 1NI3A 1Q1QA 5SZJA 4MDFA 1WJJA 2Y0SE 1E1QA 1MO5A 1XCMA 3ZIAA 1XTQA 1SKYB 4IOMA 2AWOA 4TN1A 3X1WA 3ICQB 1KK2A 2NQ2C 2OM2A 1VQ9A 5C4MA 1QHYA 5L3QA 2FPKA 4Q4AA 1U81A 1W4RA 4GP6A 1WBBA 3QOFA 3IRBA 2CL7X 3UE0A 5FH9A 1BYIA 4I7ZC 2YNMA 2QP4A 5C3EG 3KDFA 4U02A 3IBGA 5EZ6B 1E9CA 4TL7A 1DELA 4A8JA 2XGTA 3LVRE 1TF5A 1IYUA 2ZAMA 4PFSA 2NVYH 3OESA 2NIPA 3WBJA 1HTWA 1GHJA 3GFOA 2GCNA 4TSFD 1BBUA 1VS0A 1C7YA 1KY2A 4P73A 1XX6A 2JA6G 2BMEA 4IVRA 5KSYA 1PJRA 4PC6A 4Q1EA 3QJYA 1N5LA 5JWHA 3T5GA 4TL9A 2BBWA 3PO2H 1JBKA 2WBLC 5H1SE 1ZIPA 1A63A 1Z47A 2K33A 3B5JA 1IBMQ 3HOWH 3QEJA 1R6BX 5TMPA 1XTJA 3CX7A 4OK3A 4BRWA 4C2UA 1AZTA 3L43A 1JB7A 1KHIA 1XDBA 3IEVA 1A82A 2GAAA 2R44A 4BLTA 4KN7C 3NIBA 4KKSA 2D2CC 2CE7A 2NO7A 1KO8A 4GKJQ 4A0GA 4DLYA 2O8EB 1CJTC 1U0JA 4H44C 1GRRA 4G0NA 4G5OA 4IFBA 1LY1A 3ZGXA 1II9A 1CTMA 3DOFA 1GOTA 4GI7A 1XMVA 4C9BA 3TEHB 4C7OA 4WJ4A 4WOPA 1G5TA 5GAEC 1ZVQA 3QI2A 3KQKA 2Q9CA 1RRGA 2DUDA 4MGKR 4AYTA 4NL4H 4LUVA 1J90A 1JEDA 2HXSA 5HPYB 2P6UA 1GUAA 1R0WA 5JCZA 1HNXL 3K70C 2ZSBA 2OHFA 2VP4A 3FPPA 2QQ0A 2ZYUX 1HNWL 3A4LA 4B3TQ 2ASEA 4JS0A 1H9MA 4Y0AA 1QHHA 2XOKD 2NO9A 1NP6A 4BBSG 2QL6A 1G5PA 3CO5A 3LNNA 4OJQA 4AI6A 4DV6Q 1ZKOA 3DOEA 4GLAC 4DCNA 1GWNA 3FHWA 4O2LA 3MEFA 3D7MA 4A1FA 1ZM7A 3KKPA 4B73A 2F1HA 2GK7A 1ZU4A 2ECKA 5CK4A 3CRLC 3FP9A 1Y8OB 1FL9A 4CW7A 4LYJA 2IS4A 4JLAA 1NKSA 3EA0A 4Q66C 3D8BA 2CXXA 1VDZA 3N2IA 4HUTA 4W9MC 2IXFA 5AUQA 1VPLA 4DVGA 4JI8L 1EQQA 2QU8A 3H3VH 4GZMA 3RDPA 3RZOH 1KSHA 2QMHA 4M4SA 1E0SA 4QKQA 4UXIA 2E2IH 3K9GA 2GHIA 5G3ZA 3CM0A 4DR2L 1XMQQ 1GITA 1DVRA 3QVUA 2C8VA 3I4MH 5EE9A 1G4UR 4DUGD 4BY7G 4M0LA 3FMPB 4TSFA 2H5XA 1T0JB 2IK8A 3HFZB 4DV1Q 3KTAA 4P33A 4DR6L 1YZKA 3KLWA 4B3DA 3NENA 1I4DD 5EE5B 4NYJQ 2UUAQ 1VQEA 1CS4C 2R93G 4OQNA 3GEIA 1KJWA 1ZMXA 4LHYA 5CLQA 4DDWA 4MKIA 1KI4A 2OZEA 4IHQA 4PHGA 2OQKA 3SU8A 2CLDX 4B3CA 3A5ZB 1BYUA 1U98A 2EYUA 2KE5A 3IUYA 4TLAA 1PH4A 1DS6A 2HT6A 3ZS9A 3TGPA 4UNNA 3CC2A 621PA 2CDNA 2B8FA 2ZJZA 3IHWA 1V8QA 2FE4A 5FTMA 4UP8A 1R9TH 1XD9A 3KQLA 3NELA 4BEJA 1UKVY 4QC2A 2K52A 1IOZA 2QF7A 1KIXA 2QENA 3Q8XB 3HKSA 4M9ZA 4ABYA 2V8OA 1K8OA 4O25A 1P2UA 2DYKA 1LS1A 1NMGA 5K36H 3X1YA 3CRKC 2WM9B 1ESMA 1DG3A 2OLKA 3T51B 3L2PA 2ZJAA 4YDHB 2VLIA 5TXGA 2A5JA 2OUKA 4BLQA 5JRZA 3EPHA 1K73C 1Q12A 2NZJA 2ONJA 2KCMA 2XOKA 1GJXA 3SYNA 4EKDA 1LACA 2FFQA 5DGXA 2B7BA 5JECA 4Q03A 1BDOA 3J80c 2UXBL 2V1XA 1YNJC 3I72A 1M1KC 2E5LL 4JV5Q 4PTLA 1FFHA 2IA5A 4LJZC 3M7NA 5GJWC 4CEHB 4DR4Q 2FH5B 3BJUA 1VQHA 4LUCA 4EPXA 3ZD6A 1QHIA 2WHXA 3OIWA 1UDXA 4DNIA 3PUYA 3OIVA 4IVPA 1J6QA 3SHWA 3TKLA 5EZ5A 2Z5FA 3QPWA 2H92A 2Z4SA 2QUZA 4PX9A 4YY3Q 4HB2A 3AVWA 4A92A 4XTCS 4CGZA 1IONA 2DPXA 2I1QA 4ZDJA 2WAQE 4DUZL 2OBMA 5KSPA 2WWYA 2FSFA 2E74C 3J80i 4YWLA 2R92G 3MUFA 4TYWA 1GUOA 4BFUA 3BDOA 1TWCH 2QAGC 1TF7A 1G6HA 2R62A 3SQWA 3KKMA 3TNFA 4U7DA 4J15A 2WWIA 3BERA 3CR7A 4IVQA 1PA6A 4JLVA 2EDGA 4DAYB 2I5HA 2P5SA 2ATWA 1Y1VG 4A3IH 5IYDG 3AF0A 3ZVLA 4YHHQ 1SVOA 3GTGH 1GRQA 1VTKA 4O2RA 2I5LX 3R9XA 1MKYA 2ALYB 1S3OA 2RGDA 1OH6A 4B34A 2ERXA 1E9SA 4ON9A 2BKUA 4G1UC 5G41A 4JT4A 3GLHE 1PLJA 1XPUA 2R6GA 4DKAC 4Q4HB 4IOJA 4KV9A 3KUDA 3T06B 4LK2A 3EW9A 1E2LA 4GOXA 2PX3A 3SC3A 1K3RA 3NKVA 4LX0A 4YCUA 2V6IA 4N0DA 4P0TA 3U3OA 3WNBA 1VQMA 1YZNA 1Y69U 3THXB 3U44A 3RVBA 1AGRA 1ZUHA 1VCNA 3QY0A 4B71A 4JLNA 1FNNA 4WXRA 1EWHA 4JYAL 2J0UB 4H0LC 5ELOA 4Y0VA 2OV2A 3A4NA 3G4SA 2K5HA 1I50H 1MOZA 2FPMA 4R4IA 2UUBL 3LA6A 3Q85A 5C0XJ 4TLDA 4DT1B 5KDDA 1LTLA 4AYBG 2FGJA 5AJ3L 5TVKA 1T5LA 4QQBX 2QG6A 3QQ5A 5FPKA 2ZTSA 4X65Q 3AGQA 4P75A 3U60B 4HIKA 4OX9Q 4Q5IA 2F1JA 4BFSA 1W1WA 3KQHA 1R5OA 1ZCAA 4Z8XA 3ZLJA 1XEWY 4MUAA 1IJEA 3E9HA 4FD2A 1N0VC 5FOVA 1XNQQ 4DCVA 3OZXA 2O8BA 2J3EA 4ZDKA 3ETLA 1KTVA 2IEZA 4QGUA 1Z6AA 1WF3A 2QT0A 4Q4HA 4I99A 4F7WA 3BH7A 1CSQA 3X1ZA 4EFMA 2F9LA 3MMPA 3FWYA 1ZM4A 2E75C 3CC4A 1KSFX 1W2GA 5CB6A 5K8TA 3CPWA 1Q8KA 1OHHD 2H17A 3QF7A 3X1DA 4M8NE 2QGZA 2ZRGA 4BY1H 1SFOH 3QF4B 4FN5A 4JBXA 3I3SR 2VQEL 3VDYA 2QTFA 1KI9A 5G53C 5IY0A 3A4MA 2C35B 2Y0SG 4KYIB 2YJTD 3TUJC 3I62A 4KLKA 2OO7A 3PF5A 4EAQA 2W6IA 1XTDA 4LF9Q 3UWKA 4L9WA 1QUQA 1UE5A 2BMDA 2AWNA 4OKSA 1EIYB 2CHGA 2UKDA 4KBGA 3PO3G 3K0AB 4V02A 5F9HA 4A3KG 1VQJA 2A68C 1YJ9A 1NLYA 1NY6A 2FSIA 3F3YA 2GETA 2CEAA 3FYHA 4HAVA 3DLLA 1PV4A 1UDWA 2YOGA 3AB9A 4LW1A 3CF2A 4GLXA 2N3SA 4IOCA 3DEFA 3RYTC 1W7AA 4KI0A 3KOJA 2B8WA 5M5WH 3MWJA 1CIPA 1NIPA 3AVPA 4DUYL 2PX0A 3ER0A 1Z29A 1R7RA 4QJ3A 4JI6Q 2NZHA 4DV7L 2AKAB 2PCLA 3PF4A 2CW0C 3WWVA 4LF4L 1XTRA 2PL3A 3B9PA 5IP9G 4DR1Q 1W2BA 4POGA 2IYSA 4C3HH 2BA1A 1IYVA 1N3BA 2CQOA 1JB1A 1P3JA 2IY5B 1KSJA 3ZVRA 4CZ2A 2ID0A 5FOSA 3LLUA 2IYTA 3C14C 521PA 3GJ6A 4OO1H 2WKQA 4ALPA 3QF4A 3T5DA 4JI0Q 2VSFA 4P4UA 2HQLA 1DBSA 1CR2A 3A8TA 1E96A 1TQ4A 1VYUA 2A8VA 3FGNA 4L8GA 1U8YA 1Z06A 4TYNA 2N49A 1FJGQ 4OWXB 2A6EC 3PUXA 5FI1B 4DSNA 4ESHA 1A6XA 1HYQA 1FTSA 3MWYW 2YOHA 3LWUA 1VCOA 2W83A 4PHTA 1VHTA 1HR0W 2R2AA 3C41J 5GJVC 1G8PA 4BFYA 4LUZA 5C44G 1F3OA 4ZCLA
chains in the Genus database with same CATH superfamily
1C3OA 2CZGA 3ZQ6A 3ASVA 4LWOA 1L5FA 4LFCB 2WG0A 3Q2KA 2HPAA 1WD1A 2NADA 1Z2NX 4IV8A 3NALA 4AF8A 2WKWA 1CLUA 2FEAA 2G9UA 2RGYA 1ZFNA 2JXMB 2GEUA 1UZUA 2BUBA 3FOAA 1IHOA 3LECA 4X8LA 4Y2JA 1BW9A 4NKLA 1GCOA 5JV5A 1X3GA 4ESVA 4PICA 2RMKA 4BKMA 2O5CA 1GGJA 2BBTA 5HCIA 4EQZA 5M5YB 4DWJA 1C14A 5JAUA 4K6DA 4XT1B 1AKMA 3NU1A 2QS9A 4JOSA 4GMGA 1YU6A 1SCQA 4H59A 1NW4A 4QGGA 1GL9B 2ZK7A 4KWTA 5DCYA 3G49A 5FLMH 4GWGA 5IC4A 5GROA 2FE1A 2PX5A 4YV2A 4QLAA 1N9ZA 3MBKA 4AZTA 3MIIA 1YO6A 2ZJ2A 2H4WA 1DC8A 1TY2A 2A5LA 5A4IS 3U48A 1H2XA 3CLUC 4UMDA 1R9MA 4BJ3A 2HX1A 4NJMB 1SXJD 3GZTB 4V1CB 2RQXA 4IPDA 1JSRA 4OXPA 3FBTA 1DC4A 2PXCA 1RHPA 4MVJG 4D8XA 1U7TA 3OH8A 2C7OA 1Y63A 3SDZA 3WB2A 1P1RA 2MHVA 3UAZA 5J22A 1WFQA 2C94A 2R5WA 5A6SA 3MEQA 3CIOA 1WTQA 4D46A 2VOJA 2G9QA 1KO4A 4GX5A 4ZK2A 3F2CA 4YT5A 4KN4C 3VX4A 1FVOA 3BKXA 2E0IA 2D7CA 2UXDB 3IA7A 2Q3JA 2ZR9A 3MMZA 2VDOB 1F0NA 2G82A 1YHAA 5D6NA 3BHMA 2C4WA 1U9YA 4OQ4A 4CNQA 2L55A 3GK3A 1O87A 4FCTA 5F21A 1HNZB 2C88A 4KUGA 1QILA 3FE2A 3QUAA 1JWUD 3RBXA 4FIDA 1HT1E 3B85A 4K14A 3K8OE 4YO8A 2OXFA 3W7AA 1EU1A 1IBLQ 2R87A 3CR3C 3KJPA 1DAFA 4HNSA 4RVUA 3S2GA 2FEMA 4O33A 2Z98A 2NN6G 3I42A 5LL6X 2ISSD 4MKHA 5AWFC 1EEXB 4JI4Q 2I22A 4DBLC 3D4NA 1FU7A 2VQ3A 1QGZA 5J4KA 1CYDA 4RQBA 2NZ8A 4IV5A 2XMSA 3N8KA 1GLNA 1P0IA 4RU1A 1GZ7A 1DIGA 1QE5A 4F60A 2X7JA 3HBJA 4J3FA 2JEOA 4KWCA 3NHRA 1RWPA 4FDBA 2HK7A 4F85A 3DDNA 2ORWA 3S99A 1GQ2A 3C46A 2AK3A 2FWBA 4L8FA 3M1AA 2EVBA 4CIYA 3CQZH 1D2BA 1QG2A 3I1IA 5C8YB 3K2IA 3SJ7A 3KAKA 5HDBB 3ZBUA 4IWYA 2ZB4A 3UKJA 1S2OA 4Q47A 1EA5A 3F9CA 2K75A 3AHGA 3BDVA 5EIHA 4DDTA 1G2PA 2GM4A 2H1VA 3PDIB 5ITZA 5LD2B 1Y3IA 1T0PA 4A0RA 3V33A 2JLYA 1PF7E 5A7FA 2GCIA 3LX8A 2WU1A 1VG8A 1QU2A 3FZEA 3R3YA 4BB6A 5FPSA 4YCJA 1MB9A 3AI2A 1FLDA 4RV5A 4FB4A 5LU8A 3T3HA 4F4HA 3SY8A 2ZIXB 3OOWA 1E3PA 3KPUA 3GJ4A 4RPKA 3RYIB 2W58A 4LBZA 5TQ0A 5KHOC 2QTLA 4C4ZA 4ZK9B 5FTNA 3AR5A 1NMZA 1UBEA 2YZGA 3GFBA 1Z4QA 3TL2A 4CM4B 3ON5A 3O93A 4HN2A 4OJMX 2C7RA 1L4LA 3BWBA 1ZJZA 4QAJA 5H1YA 3L9AX 1WRBA 4X6AH 2I5MX 2M2IA 5J1ZA 4MV1A 4PMCA 2F3QA 3OCVA 3WKDA 2PKCA 4JJIA 1UPUA 3SDSA 1VQDA 4NAHA 4PYRA 3TQQA 3UG6A 5A7HA 3QVXA 1T1GA 3Q10A 4KSCA 4HUJA 4EW2A 2M6SA 4ALNA 1STEA 1N33L 4C5BA 4B2PA 2CLHB 2WF9A 3LIPA 5LP6B 4PAQA 2VTBA 5SYMA 3UMGA 1HM5A 1PK7A 1AKEA 2FQ1A 3WBKA 2ZSDA 2FP4A 4MZDA 1SZCA 4EKIA 3SYKA 1YS6A 3KNZA 4N7RA 5IJWA 2JHPA 4GO1A 4F71A 5THXA 3MSCA 4AKIA 1ISRA 1MP0A 3FNBA 1XAJA 1T9ZA 1JDNA 3PL1A 3WBFA 1ZD9A 1UXIA 4B74A 2WIBA 4F8MA 3BD9A 1QG6A 2RB5A 1HUMA 1UXHA 1YI2A 2GTPA 1JVSA 1W88A 1ZMTA 3AY3A 3TH5A 1I7QB 2UYOA 5JAVA 3LNCA 2WHPA 1G8AA 1D1SA 4ZRNA 3FKIH 2H0QA 5IBRA 1USGA 3BJZA 2Y3IA 4DV4B 2R00A 2ZWPA 3RVNA 3HEJA 1IXSB 1QBGA 3T7TA 4EJSA 3VYSB 4E7PA 2IGBA 4GNXB 3D3WA 1V5GA 4HQ0A 2MR5A 4EA7A 4QOEA 4ALLA 2FW0A 4PZDA 3H4IA 1AMOA 4XWTA 4L4ZA 4M49A 3W8FA 3DAGA 3KOXA 4Z6KA 2BTEA 3N3AC 2O2CA 3SK5A 3RSCA 2E2HB 3TMAA 2VAPA 3N70A 4MRAA 3A8IE 3VJLA 1GXSA 4ND8A 4MW1A 1FR3A 3LKVA 4A3CG 1MLDA 1PLKA 1LW7A 2OT2A 1A9YA 1ZGGA 4QOHA 2QUJA 1R64A 1C9JA 1W581 4DA7A 2Q1SA 3OTOQ 5E95A 5EIFA 4PVDA 3UXYA 1KI8A 1JJIA 3QTLA 3WLEA 3F5DA 2CE2X 3GC6A 5SZHB 3ONAB 1ZONA 4BBRB 4R3WA 3IBSA 3H3VC 1EUDB 1D4FA 4MR7B 1R8SA 3PA6A 4BLOA 5C8VA 4KQGA 4DJEC 1KK1A 4RCYA 2J0VA 2P9JA 3C3WA 3HVIA 1VQLA 4DV5B 3BMNB 4Y7CA 1XJVA 1FGBD 3BWYA 4A3MG 4CV1A 2GSDA 1XVIA 3EWNA 4GSKA 4RKQA 3ZJ4A 3DM1A 4KHPL 1A0OA 3UE1A 3S2YA 4DJ5X 4P86A 4QQKA 4KKVA 4R54A 3UCXA 2PJZA 4H1VA 4TS4A 4R1JA 3PT5A 4O2BF 4TMVA 1JAZA 1TKCA 1UC8A 3LDUA 1TJ4A 2CJWA 3N2EA 3CP0A 3DQZA 2YWXA 4FJ2A 2V4ZA 4KREA 1AA9A 2CKDA 2MSEB 1DJNA 4DDMA 3OQIB 2QXUA 4GWLA 2VF4X 2YHUA 3NJ8A 2FUNB 3DYVA 5KYLA 3MZ5A 2V4DA 3HP7A 5TB5A 1I4WA 2K5UA 3WLSA 2GUWA 2A14A 2ZI7A 1WCMG 4QJ5A 4I50F 1H8HD 4PLZA 4RE6A 1F4VA 1SXIA 4I14A 4L51A 3TZQA 4EGAA 4CQNA 2WYUA 4M0MA 3OJCA 1BTOA 5LWQA 1B8OA 3K0HA 4ZRZA 1RAFA 3GEEA 3HEMA 2R86A 2JCBA 1A1SA 2IZ0A 5CA1F 1NV9A 5HW0A 3C2PA 3MYRA 1JAIA 4QICA 1J2EA 2A9FA 2KECA 1P1IA 2ZAYA 1W5SA 1XMSA 2ZIZA 4FQ7A 4EHDA 1GU7A 1F06A 1X70A 2J08A 3A7DA 4R1QA 2W6NA 4YC7A 1MX1A 2H8KA 1EK6A 1RTNA 4AQYL 4IMJB 3WOVA 3MN1A 2FDRA 2BCEA 1CZWA 4UHCA 5CLJA 1WCV1 4TRJA 4QHSA 1GPKA 4OHPA 1A95A 4CI9A 1W87A 3WJ2A 3EIHA 1M1NA 1NHWA 2AX3A 4UUNA 2M6KA 2V7VA 1XTVA 2UXBB 1ZCBA 4ZOBA 5FBQB 1IN5A 3RHFA 3G9XA 2R92B 3ZNNA 3GCWA 2O1WA 1Y1VB 3DMTC 4MGHA 4TV9B 2K6GA 3S2HB 2WG1A 3H8WA 1CZLA 2G06A 4M54A 1Z17A 5CBKA 4B9AA 1SQ5A 5HZGA 2EYJA 3P0EA 4XR4A 1CF2O 2JA9A 3W9BA 4EUNA 3OX2A 4ZOEA 3ROMA 1BR9A 4K1XA 1SVUA 3I4MG 4YRDA 3HU5A 3LWZA 4EB3A 5H70A 4BDSA 1WOCA 5EJEA 2VSQA 4BMYA 2WNHA 4OQYA 3WP1B 4JUCA 4PXAA 2Q5CA 3RWMB 2XTIA 4N48A 1L5MA 5E2IA 1E2ZA 1DXMA 3RU9A 4YH1A 1B26A 2GKOA 4QUFA 5BV1A 4ZQGA 3SWWA 3CCSA 1C0KA 3DHWC 1DEKA 3TTUA 1XTZA 2Q8PA 1YBFA 4CM4A 3KUKA 3ACDA 3KJQA 1KQFA 4MYTA 2GJSA 1L4HA 3HOXH 3H3XA 2Z6KC 4RAQA 3B6MA 1IXRA 3H2YA 4G3XA 5F1YA 4UZEA 1F8FA 5E1DA 3AIKA 3UUWA 2F17A 4H3SA 5FXMA 3U4ZA 4HZGA 4U5XA 3LLCA 1T9GR 4FFOA 4R9SA 4AO7A 4YRZA 1E6EA 3F6CA 1D5ZC 1QAOA 1HA5A 3UUFA 1T35A 2X4IA 3TQTA 2B2CA 1TU0A 4A5SA 3PGMA 4B47A 4B0OA 1C7JA 1T43A 4A2WA 5LP6A 3GIWA 3OZBA 3T61A 3P1JA 1ONSA 2ZRIA 4PPFA 5TQ2B 3KZMA 2PL5A 5D3MA 1DADA 4X93A 1UZLA 5BV7A 4EF5A 1FP1D 2XYHA 3S8EA 4Q0FA 4L4RA 5E1MA 3MWGA 1PTJC 3THWB 1PZFA 5G3LF 1TNDA 4DMRA 5CB4B 3GTKB 1K7CA 3WL8A 4EYQA 1HDYA 5DSZA 2I54A 1QC5B 3GX1A 1E9EA 1ZGBA 4PLFA 4IUCS 2CWPA 3CKLA 3WMWA 4PZLA 1SB8A 2R1TB 4A2QA 3VV2A 2NP6A 1DCTA 2QSZA 1BMFD 3X2FA 4H7IA 3GLIB 3N75A 4D3YA 4Z0PA 4Q9HA 1QIMA 4MKGA 4Z4CA 1GAXA 2NSHA 3V42A 1ESCA 2Y0PA 3HJTA 4P72A 2IYZA 4NU0A 5JRDS 1ZVJA 3P20A 1ENAA 2JGKA 2LY7A 3VYSA 3IVRA 4GNXA 4HDNB 1JDTA 2JH3A 1WHTA 1SG0A 4JIGA 4HDRB 3OT5A 4X63A 2FN3A 3D6HA 3WLIA 2WIKA 1V96A 3VPAA 2JL1A 1OXUA 3C6KA 5H16A 3OUTA 3ZYYX 4PAWA 1E4OA 3GLQA 2PPVA 1CEXA 1XXGA 1W8DA 5CYFA 4GXTA 3Q3JB 4XJVA 4MRNA 4JB3A 2O05A 2XJ9A 3F4KA 2H54A 2IU0A 3HOUG 4IWNA 4Y3UA 4UOEA 1E4EB 3DP7A 3A8KE 3QX9A 3R7DA 3H99A 3MHTA 4O6VA 3BL8A 1JSLA 2HD4A 3A7AB 2BFEA 3SEQA 3OEWA 1PQPA 3Q3CA 3QOWA 2AFHB 3PGJA 3G0DA 4NHOA 1E94E 1WP4A 4C01A 1D1QA 4MR7A 3L1KA 3TEJA 1UT6A 2ZM6Q 4RTQA 5FJ8G 4LF5B 3ADOA 4DLVA 3VH1A 1TM7E 5EYPA 3JD0A 1KFBB 4WJ3M 1Q3TA 2WSSA 1I10A 3BMNA 4HDKA 1IIBA 4L8LA 5CK4A 4Z51A 1Z62A 2QPTA 3T3MB 4CN9A 4NBNA 2B1RA 4P38A 4EWLA 3ZX4A 3GTOB 4WESB 1ZK0A 1AFPA 1KMNA 4X66Q 1JFFB 2N9UA 4LYYA 3PK0A 2FOIA 3FFXA 5E6RA 5CDGA 1BGXT 2Q28A 4O0LA 1MR3F 4ZCKA 4GXNA 1S3GA 2DJ5A 1EYZA 3TLJA 1X14A 4GS5A 2VH5R 3OQIA 2Q07A 1JEOA 4CCSA 3UG7A 3G5AA 2DSNA 4XEHA 5HJ5A 1HR0L 2XY4A 2OORC 2X2PA 4HDOB 1ENOA 4AWXA 4FGLA 4A3FG 1KAEA 3AJEA 4GRAA 4KZPA 3K80C 3TRDA 5D3ZA 2L17A 5E7JA 4RV4A 3ORHA 3UO8B 5I4CA 4POFA 1Z5GA 5LYJF 3KDFB 3ADKA 3NLLA 1ESEA 2JLXA 5ESRA 2AXNA 2WYHA 2O2YA 1ZINA 2G9VA 5T6BA 1YR8A 3HHPA 1XU9A 1VHDA 4X44A 4YRKA 4CHGA 3EQ6A 4C6TB 2VQFB 4L2IA 1Q1QA 5SZJA 2PY6A 1IUOA 4IF4A 1QH8B 2AWOA 1AUXA 3ZHUA 5JD5A 3II6X 5ICCA 2FZCA 1A97A 4Q3OA 5FH9A 4UBKA 5SY6A 2AOXA 3IUNA 1O9BA 4OMUA 1A50B 4PC6A 4TL9A 1VDMA 2BFNA 1X9GA 2YN2A 3PJFA 4D3XA 2OCGA 1Z7WA 5E9JA 3LUHA 1C7EA 1RLTA 5HS6A 1U0JA 4G5OA 4G0NA 4PO3X 4FGSA 4NENB 4WOPA 5ESXA 5GAEC 4YAOA 5FNZA 2DUDA 4ZWNA 4AYTA 2XLCA 5HPYB 4JBLA 1WTPA 4OELB 3C8MA 3FUWA 3DAOA 3L9WA 1FFSA 3DOEA 3QE9Y 1YQ9A 2VHWA 4L8WB 3MEFA 4XUCA 3KKPA 4BVBA 4B73A 1XVUA 1RWBA 4X7BA 5I9IA 3TYXA 4UXIA 1RZVA 4L1KA 4DR2L 2FI1A 3COSA 3F5SA 5T8KC 4IDBA 1U1FA 5A4FS 4IHJF 3U9OA 5JBIA 4PEVA 2UUAQ 4UEOA 1J9GA 4B3CA 4DA0A 3A5ZB 4TV9A 1DS6A 1O0BA 1PQ4A 1T10A 2V7WA 2HREA 3QVTA 4BEJA 2VPIA 4Z7QB 1XUOA 4O25A 3WSTA 3VOTA 3E2MA 3EXFB 5EQDA 1YDMA 2V1XA 2IA5A 2BEWA 1S7CA 2HD3A 2XHZA 3IOCA 4Z0TA 3ISVA 4UREA 4YJHB 5JS6A 3G88A 5CT6A 3TKLA 1O9GA 3CCFA 4RVHA 1BQQT 3MUFA 3NP9A 4BHTA 5F7XA 2R62A 3SQWA 3FTDA 2EY5A 4DV7B 3S2UA 3QU4A 3ZVLA 1SOUA 1SVOA 1FU4A 3ROGA 5L7YA 1KVTA 2WV6D 2XKJE 4G1UC 5ISRA 2BKAA 4KV9A 3T06B 4XX0A 1H2WA 1K3RA 3W2EA 2V6IA 1CUYA 4P0TA 1ADBA 3LWDA 2PGIA 3L7LA 5EIAA 4LQCA 3PHHA 4OOFA 5AVWA 4RKYA 1IL8A 1UXKA 2EYPA 3T5BA 4V1CI 4Q15A 3D8GA 1WF3A 2HIGA 4O42A 3SHOA 4XE5A 1QPZA 4LYDA 3UVEA 3CPWA 2QGZA 3TZHA 5IY0A 4KLKA 1S02A 3PC7A 3MOGA 3M4ZA 3BXGA 3AUKA 4J0HA 4S0ZA 3UK1A 2BGTA 4EYGA 1NLYA 1NY6A 3KZKA 3DLLA 4GLXA 4R2WA 2N3SA 4IY1A 2B8WA 4D9IA 2EJUA 2AKAB 4DR3B 4GGPA 1N3BA 4ENQA 1ESRA 3DKKA 2LR0A 5TIIA 3M81A 5BPHA 3GG2A 3ZW8A 1HRDA 4ITUA 3DWPA 1VYUA 1PUXA 3V8BA 2TYSB 2G08A 4DSNA 4BQFA 4PHTA 4YP1A 3C41J 5CD1A 1GEEA 1JVNA 3DFUA 4QUIA 2R8YA 3BXOA 4XQGA 1N6PA 2BV3A 5LA6B 2QTNA 1GSOA 1EEID 4QHYA 3D7SA 5IGGA 2DH5A 1QC5A 3IAAA 3DEJA 1E9RA 2K87A 2WVHA 1A15A 4G0OA 5JZSA 1KS2A 4WADA 2O50A 4MULA 3KJZA 1SKAA 5ELEA 3J81L 1J5EL 1NE3A 4AURA 5FPPA 1ZEMA 5EIOA 1GYQA 4JI2B 1HFWA 2HJGA 5ELLA 1FMLA 1ZW6A 4MWBA 1IZYA 1EY6A 3A6ZA 1TFRA 1F2LA 3D4DA 4ZIRB 4OY3A 4AULA 4DCCA 4R2MA 2XMDA 2Z56A 1KYWA 2Z2IA 4HDNA 3GLFE 4DV2Q 5DI3A 1Y8QB 5IXSA 3EWSA 4UOZA 3R2TA 4B48A 2WAAA 1TKAA 3EXHC 4OQQA 3MXNB 1CNFA 4H60A 3KPYA 5C5MA 2FYTA 3KUPA 4Q12A 1W5AA 5C4XB 3W5IA 1A9SA 4J4TA 3IVAA 2GJKA 3RVKA 1HL3A 3LY7A 4OH7A 1UIRA 4V03A 3VKGA 3MC0B 1PSWA 4H0NA 4R1UA 4NXNQ 2RK4A 3EIQA 4LXIA 2PWAA 2QN9A 1HJPA 2A0XA 3INNA 2BWJA 4MW5A 4N3BA 1B7GO 2AH5A 1NV8A 3AB7A 1LT4D 1XZNA 3QBEA 5KUTA 1ZM2A 2R9VA 2YDYA 4IL5A 3G2MA 5HKBA 3WWZA 5LXTF 1N2BA 3R3OA 1ZYUA 4ZOAA 3HOZG 3HXKA 5JY6A 3AVVA 5K0NA 2WF5A 3TS2A 4JA0A 3GDEA 4XKJA 1X13A 2G72A 1K27A 1SKYE 1NOIA 5EZYF 3S2DB 2R7DA 3D2CA 1UKYA 5CRIA 5IUKC 3KD3A 3HU2A 3S1RH 3PNMA 1QRSA 2FMKA 2IFTA 4WL0A 1Y9DA 3ZU5A 2IXEA 4RL4A 1EUQA 1B41A 3EXG1 1WB6A 3WZLA 1UZMA 1ZRSA 5BSGA 4OHMA 4FHZA 2XNAC 4WWHA 1PQUA 3O38A 5DP1A 4E31A 4WESA 1GYRA 3NYQA 4B3MQ 1AO0A 2ATVA 1AQLA 2BJVA 5ARCA 3AY0A 3T3OA 1RCTE 2JVKA 5DJ5A 4UNQA 3E3MA 3QOYA 4QLBA 2DM6A 1KI2A 4ZJYA 3K0EA 4XYLA 3V96A 3D8TA 3PYMA 4D3SA 2C7VA 3KQUA 2WTUA 4EVIA 1QBKC 3EIUA 3AW9A 1U65A 3QENA 4KNVA 1LLDA 1G6KA 4RDXA 4JI5Q 1ET9A 3EXEB 1U6KA 3AG6A 1JVBA 3IT2A 2V7TA 1ATZA 2MYUA 2ESRA 2IBMA 1LTHR 4DR7Q 3D6VA 3ZHOA 3BC1A 2QMZA 4GU5A 3ICEA 1YVPA 3H7IA 3VGJA 4Z54A 3E1GA 4P53A 3IKLA 3S2IA 2A1TS 1IXKA 2HIHA 5KJ6A 2VRCA 1PYGA 3NM4A 1JYFA 3B7PA 3KQQA 2GPNA 4C6TA