1OXTA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 95
structure length 352
sequence length 352
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxtA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxtA01
3KXLA 4J0QA 2PLRA 2RH5A 2W0SA 2A6HD 4B43A 1SVKA 4YWLA 1KI6B 3T1YQ 2OBNA 4APVA 3BERA 3FYHA 1ZKOA 1MRNA 3WNCA 2IL1A 3S15H 1L7VC 4DCNA 1YEZA 1EGAA 3RLOA 4EQ6A 3HKSA 2WJIA 1Q81C 3HOYG 2B8TA 2EU8A 4TLBA 2OT3B 1NBMA 1JPNA 3V9PA 2IX0A 1X1RA 1P72A 2QRZA 5DGXA 2WKRA 3T56B 1GUSA 4LF4L 3MUFA 3M9BA 1HE8B 4GRAA 1A6XA 2XJ4A 3BH7A 1DE0A 1ONBA 1XTJA 1XZQA 4DV2L 3FKQA 1KL9A 2BMFA 4DK6C 2ZPTX 4U00A 2RGAA 3MAAC 1VCNA 2CNWA 5FUVA 3WYGA 5L3VA 1V8QA 2DNEA 4NYMR 4TN1A 4WXPA 4EIWA 1ANKA 2HLDD 1JBKA 2XAUA 1E0AA 5CLLA 1D7QA 1JR3A 2VSFA 1AE3A 4A4DA 1T9HA 2PQAB 4JOIC 1NN5A 2YOHA 1COWA 2VTKA 4A3FG 1CR1A 2OBLA 2FSFA 1G8GA 3H3VI 4QHTA 1NVWQ 3TRZA 4I1OA 2QI9C 1MABA 2ZRFA 4B47A 3TW8B 2NZOA 3DMDA 3T51B 4A36A 3QF4A 4ZDWA 4D26A 3EWSA 2GHIA 1JXOA 4A3IG 2J41A 3CRMA 5JEAH 2QU8A 2RKOA 5B30A 2PCLA 3GQBA 3P20A 3A37A 4HIOA 4Z51A 4NDZA 4GNXC 3H0GH 1KIXA 2YC4C 1VQ7A 4DVGA 3NWJA 1BS1A 2VHTA 4V0ME 2UXBL 1EK0A 1R5BA 3UMFA 5DSZA 4G5GA 1C9KA 1Y69U 1I4DD 3AFPA 3KKMA 3TUJC 1Q12A 2HQLA 2A5JA 3PO2G 3CCQA 1BH2A 4DR7L 1ZYUA 4TL9A 4X64L 2IXFA 4IPDA 2V6JA 3LH5A 2DFTA 4II7A 3PENA 1Z22A 4QFMA 2JA8H 2GVAA 3DLLA 1I6HH 2E5LQ 1RC8A 1E2WA 3RC3A 2PI2A 5IDVA 2UXCQ 1G6PA 3QXXA 5KTYA 3OF5A 4DLRA 2MSDB 2OE2A 4C3ZA 1PH5A 5JEAJ 1OXTA 1VF5C 1J5EL 2A69D 1UE1A 4DEYA 3OW7A 2H7VA 2JEOA 1SULA 1VG8A 2BBWA 3PO3G 3SHWA 3H2YA 5FR2A 3TSZA 4B3SL 3VA7A 1CLUA 5SZKB 4R1JA 4X66Q 4QQBX 5FFMA 1Z6GA 2EWVA 8OHMA 1JR6A 1XTSA 1G5TA 2X77A 3IPXA 5LMNW 3NBFA 3B1ZA 4JI6L 2L0XA 4EKDA 2XXAB 5C0XH 1GJXA 2BBSA 2ZUBA 2GNOA 4LDJA 3PUWA 2BEJA 1G41A 4ME3A 1YVDA 3W6OA 1Y63A 3B6EA 1U2RA 3WNDA 2PX3A 3MLEA 3OIYA 4IOLA 1NMGA 4M8NE 4C0LA 4YDSA 3WY9A 5GAGC 2PEYA 3FMCA 1AH9A 3THXA 5FOXA 2V4DA 1HNXQ 2VH5R 3A58B 3TE6A 3LXRA 4DLXA 3IHWA 2WPDD 2UUCL 5TXGA 2V1UA 1ZCAA 1RIPA 2ORVA 4DV2Q 3OESA 3RSOA 1SMXA 3KKPA 3CR8A 5KOYA 5D3MA 3K53A 2C04A 1N9WA 4JI8Q 3U9SA 3FHCB 2KCMA 5FL7A 3OEEA 1HNZQ 2AXNA 2IYZA 2UKDA 3HR8A 2I5MX 4WA7A 1BMFA 3ZVLA 5P21A 2QGQA 3LX5A 4JOIA 4G5RA 4DNRB 4R4IA 4OQMA 4JV5Q 4CYMA 2UZ3A 3TKLA 1GAJA 3CRLC 1WCMH 4A3EH 2A30A 3G82C 2BMEA 1XMSA 4X8LA 4J15A 5KU1A 2ERXA 3PF5A 3I4LA 4TL7A 4E03A 5HPYB 4XOIA 4OK6A 5JWRA 1IJFA 2FGKA 3TVDA 2D4HA 4JI8L 4BFZA 4LYAA 3BZCA 4EX5A 3CPWA 4Z1MA 4RCNA 2NVXH 3B82A 3NC1C 4MKIA 3TQYA 2IEYA 4JI0Q 1ONLA 3M0EA 4B3DA 2IYXA 5IP7G 3L2OB 5JSZA 2JA8G 2H1LA 5CK4A 1XJ0A 2ODEA 5H68A 3AVPA 1E2IA 2QY9A 4HAZA 5CDFE 4F4CA 4Q47A 2BMJA 2OFXA 2YKGA 2AD5A 3KKNA 1ZUIA 3QUSA 4LHXA 3NIBA 2ZYTX 3CX6A 4DUZL 5J3BA 4ZIRA 4R4OA 4DZZA 2Q2TA 3K81C 3K9HA 1P4SA 3ULJA 1KDRA 1OFTA 3GJ6A 1XDBA 2ZI3A 1OSNA 4NMMA 2CCZA 2IUSA 4IPCA 4B3SQ 4QG7A 3QIAA 4A3IH 1G18A 4RZ3A 2BVNA 3LA6A 4Q9IA 2AHOA 3QKTA 4V0MA 3NEJA 1VPLA 2FPLA 1W48A 3BB3A 4WZAE 5F2EA 2ZU0C 1D2MA 5ANRB 4AYBG 2ZR9A 4N0DA 3FHOA 1AGPA 4JT2A 4JCVE 4JIMA 1JQJC 1N6HA 4ZCIA 1M1KC 2ZAOA 4MRRA 5DISB 3BIFA 2PMKA 3C15C 3CONA 4ASUD 3KJIA 3GLFA 1CJKC 2C9CA 3BBPA 3MG9A 1ODFA 2VY3A 1M34E 4DDUA 1X56A 1OIVA 1YRBA 4A8JB 1PLJA 1W4CA 2XTNA 1IYVA 5AJ3Q 4PAQA 1ZINA 4KN4C 3WRXC 5ELXA 2AXPA 4GP6A 4TYWA 1L0WA 1G6HA 4DCTA 5LBIA 4LF9Q 1U94A 2HXYA 2YWGA 4ZO4A 3KKOA 5J4HA 2OQKA 4L9WA 4FIDA 1OXVA 5FR1A 2IUUA 3A1WA 1OXSC 1Z0DA 3DZ8A 2NTYC 2BIFA 2CW0C 1KI2A 3HU3A 3UMSA 5CITA 5AUOB 1NVUQ 1U0JA 5EE5B 1Q22A 1F2TA 4LW1A 4DV0Q 3CPEA 1PFSA 3CXCA 1LB1B 2WFWA 2A68C 2FSIA 4GLAC 3GTGH 2ZJBA 5M3MG 1IBLQ 3PCOB 2OCEA 3LVRE 2L15A 3IDQA 3B1YA 4R98A 1E9SA 5JJKA 3CW2C 1EFHA 2DR3A 4HJ9A 2J3EA 2QT0A 4PSAA 4Q7MB 4QNRA 5C1BA 4IOCA 1DAMA 2EFCB 2PT5A 4HAWA 3KJEA 5E7MA 4X66L 2ZJQA 4PZLA 4A0RA 3WMEA 4IHQA 4C0KA 3CC4A 3KB2A 4OHWA 1T5EA 4AURA 1VIAA 4RD2A 2QMUA 1ELOA 1J5EQ 3FFAA 1ZMXA 3TVTA 5L3QA 3RC8A 2NGRA 1AZTA 4HAXA 4ESHA 2O8EB 3JVVA 4BLRA 4TQ9A 3QQ5A 4HLUC 1SMYC 2HCJB 4DT1B 3ZD7A 5L3RA 4BLTA 1XTRA 4LFAQ 1VIYA 4JI2L 4M22A 2ZE6A 4LK1C 5BQ5A 1OIXA 3HOWH 3JC66 4DV6L 2DNCA 2YYZA 2ZE5A 3E2IA 1EFUA 1KO7A 4D0GA 3U3RA 4C7OB 1Z6HA 3VNVA 2PBRA 2UUBQ 1Z0FA 2CL7X 4XVRA 1NKSA 1UKVY 2DFKB 1MKHA 4DR6Q 1R6BX 5HGQA 2GETA 1W2BA 1RRCA 1JEDA 4QM7A 2JXMB 3DO6A 2MO0A 1GVNB 3CC2A 1WE2A 1FGUA 2WBLC 2ZSBA 2AMCB 2IHFA 2OG2A 3CF0A 3CPJB 4Y0VA 3FKIH 1PYBA 3D31A 1F2UB 4Q4JB 3EBEA 5GADl 3BD9A 1GTVA 1LVGA 821PA 1MO6A 1HPCA 3OIWA 4DHEA 2JJ1D 2ZSEA 3OZXA 2IW3A 3H84A 1XMOQ 2E87A 4DNIA 2DY1A 3FKSA 1E2DA 1KJWA 4URVR 4BA1I 1RFLA 2A69C 1G6OA 2FEOA 2QE7D 4A3JH 1TF5A 1UDXA 1A7JA 2BKEA 3W9YA 4CT4B 5CB8A 4IFDG 5DYIA 2VHUA 1NRJB 3H86A 4A1FA 3NH6A 1NMZA 5AJXA 3K7AH 3OPOA 1AK2A 1YHBA 4LHYA 4ON9A 3VU9A 1D2NA 4YWMA 1S96A 3P26A 1AQUA 2PNRC 4PG3A 2CEAA 3QY0A 2V8OA 2ZIAA 2C98A 3TSOA 5H1SE 2BBTA 2N8NA 2WICA 3HP1A 1EWHA 2WWFA 3CM0A 2RHDA 3UE0A 2YOGA 3NKVA 1OFUX 1PYSB 1UBCA 2VA8A 2XOKA 3CX7A 4Q19A 4QNMA 2XX3A 5TB5A 1U8YA 2K32A 4L5BA 4IW3B 3GLGE 1EFTA 1JECA 2B7BA 5JFGA 2QM8A 4BXXG 3NC0C 1OJLA 2QMHA 5C4XG 3PUYA 1HUQA 4LJYA 3FMPB 1G8PA 1XMOL 4PMWA 1HT2E 5EE9A 3AP3A 4X8OA 1N5KA 1ZVQA 2ZYUX 5BN3A 1M74A 4QBHA 2RGBA 1V43A 4KSCA 3B7GA 4IXNA 2DCUA 5EXXA 2QBYA 1CUKA 2A3RA 1HNWL 3U44B 3NG1A 3A36A 1X8KA 4LJAA 5C4MA 3I4NG 3ZH9B 5C0XG 2F1IA 1K6MA 4C0BA 2ZTDA 3HFZB 4TMXA 3U7HB 4OXPA 5M5XH 4D4LA 2OCAA 4B35A 4FMDB 2ZR0A 3R9XA 1YNNC 4QKQA 1JAHA 3B9QA 4YCWA 2ALYB 3HOXH 3NXSA 4M1YA 1LTLA 4XVQA 4Y0AA 2JA5G 1IBRA 3QNUA 2R44A 4DLTA 1IN8A 2ODBA 4Q4AA 3O8BA 5DI9A 1YHNA 1COWD 4GKKL 1KK1A 2ZI9A 2FA9A 2FFAA 4QGGA 2X2FA 2O8BB 1NY4A 3B8HA 4BY1G 3T12A 4GZYC 1Y1VH 4U02A 3P27A 2O8CB 4FWTA 2BH8A 3J81c 1E2FA 2YWFA 2IYQA 3DKVA 4IEIA 1X3SA 1DVRA 4EQ6B 2QSZA 2J0QA 3T15A 1GITA 1PVOA 3QG5A 1B9NA 5FOVA 3J80i 4LF5Q 4MTNA 1XEFA 2HT6A 3PVSA 4TLCA 2ZRKA 4NXML 3ZVNA 4GP7A 2EJFC 4RFVA 1TU3A 5EP2A 1NJIC 3CF6R 3W8NA 4BFUA 3NENA 1NIPA 4HSEA 1ZRHA 4M1WA 3ER0A 3GJ5A 2W6JD 2ATXA 2YZ2A 3X1XA 2K50A 1CF4A 3HU2A 4XD7D 4A2PA 4YWKA 4G5OA 3U58A 2OFOA 2PJRA 1HZ9A 2IA5A 4PANA 4TT3D 2G9NA 2CE2X 1NSFA 2QTFA 2IY5B 2XTMA 5H8WA 3I56A 3GTLH 5JLJA 2IS2A 4WBSA 2R92H 4P4UA 1JR3D 1TXYA 4JL6A 2Y8EA 5GQOA 1ZNYA 1T3HA 1GNQA 1G7RA 2OESA 3M4PA 1HR0Q 1G64A 3F2CA 4H1UA 5KNCA 2Z6VA 2ZSDA 4HB4A 4YHHL 1T0JB 2CCKA 4NPSA 2F3TA 2UUCQ 4P71A 2V6IA 2X2EA 3BORA 4RD3A 3T5DA 2R6DA 4CEJA 4LBZA 4Q01A 4ITRC 4LF7Q 2I3BA 3TK1A 5BW8A 3RWMB 2ZYWX 3EIEA 4MRSA 1XD9A 1II9A 3LBHA 2Q6TA 3J81j 5KDDA 3KXKA 1XJVA 4KAXA 1W0JA 4I1VA 4HDCA 3GEIA 4OBEA 4R2HA 1KHTA 1VQKA 1DD2A 3GMTA 4B3CA 3U44A 5C4XH 3QBVA 3DM5A 2ZETA 2YU9H 4LY6A 4JC0A 5JI3E 4E09A 1K8OA 1X1SA 1GDDA 4RKFA 2BDTA 4OO1I 4BRWA 4QJ3A 4DUZQ 5EQTA 4PC3A 2EVWX 1OH5A 1H9SB 1II8A 2FWRA 5DI3B 3GLIA 2J5XA 3THYA 2LMCB 4Q1CA 1LABA 4QJFA 1S9DA 3KFUA 2CL0X 2WJGA 4B3RL 2D74A 2XITA 3CWZA 4OKSA 2B3GA 3RNUA 2A5YB 2F1RA 2QZ4A 2YV5A 1SGWA 2XZOA 4IFDH 2F1JA 2QPAA 2GF9A 2O5VA 3EN2A 3AF0A 3RZDH 4WAUA 2JLVA 3AVYA 3CNOA 1YZNA 3I4MH 3OE7A 2NQ2C 1E9RA 1C7YA 3E9IA 4TTRA 2QORA 2VP6A 3K0XA 4A3LG 2V9PA 4JI4Q 2HJVA 1Q3HA 1VQ4A 1IN6A 2NO1A 4MUAA 4RZ2A 4TLDA 1J7KA 3K70C 1TUEA 1B7YB 3THOA 1N36L 3GJ3A 3SBDA 1YZQA 2OLJA 3NBHB 4XWAA 3KDFB 5FBQB 4QXAA 4DDWA 3HOUH 3I72A 2UVQA 1G9XA 4HIDA 1L1OB 5FL7D 3EZ2A 4GOJA 4M21A 5LPNA 3QPUA 1PH9A 4A0GA 1TF7A 5KYKA 4OHXA 4GOXA 1P73A 4GL2A 4L5TA 4P3YA 2Q3HA 3IFTA 3G6EA 2QBYB 3IRBA 1CTQA 4BLQA 4W5HA 1HQYE 3JZAA 5DE3A 1P2VA 3OEED 2FJUA 4IFEA 2CWPA 4LF5L 4HAVA 2CBZA 4MKGA 2E8GA 2PX0A 1C9OA 1JT8A 3R9IA 4X65L 2F4VL 1FPMA 4K0KL 1WCV1 1YZ6A 3LQRA 1E2ZA 1ZM3A 3C7KA 4MGYR 1I3QH 1L4UA 4OWTB 3ULPA 3RZOH 2MSCB 4BZQA 3ADCA 3K70D 2EWWA 4PHGA 2F1HA 5IYCG 3ZIAD 4B3BA 5IP9G 1SRUA 2JA6G 2OUKA 1GILA 1XZPA 2QTHA 1G17A 3MSXA 3B1VA 3QEOA 4GZLA 3UWKA 4EPVA 5F9FA 2AUKA 3K0CA 3GP8A 3EPJA 3U7FB 4HJ5A 2ZQ5A 1E2KA 1G1MA 3DMNA 3N70A 1HQMC 1Q21A 2ZROA 2JLXA 1VQ9A 2D5DA 1ZD1A 2MNAA 4TLAA 4DSOA 1ZD9A 5CM9C 4M53A 4FW9A 4G01B 4Q1DA 2J7PA 1ZYRC 3B78A 3FHTA 3WWVA 1ASYA 2C03A 4BE7B 3WP0A 3KX2A 4NE2A 4DIDA 2QA4A 3X2SA 4F91B 2XSZA 3TREA 1U98A 1LY1A 1Z2CA 5IYDG 1Q86C 2GJ8A 4A76A 2IF2A 2GJKA 3SJAA 2W2XA 5JHGB 3EQLC 3BDOA 5JRJA 3D0FA 4TKOB 4C2MH 1FNMA 1N33Q 2WOJA 4HYYA 4B3GA 1YITA 2EDGA 2CVHA 5KPJA 4GOPC 3F5FA 1DADA 3LW7A 3TSWA 5AUPB 2HUPA 1A1VA 4QY7A 1R5NA 1QVCA 1W4RA 4LRWA 2WWWA 4DUYL 1Q44A 1SHKA 1QZXA 1T91A 2QF7A 4LJ5A 3CF5A 1J8YF 1N6RA 2RGEA 4A3GG 2YJTD 1P75A 2JLZA 2O5IC 4WOPA 4QM6A 3A5ZB 1N0VC 2R93H 3U7GA 3GO5A 3ZJYA 3PXGA 4JL8A 4ILEA 4IOKA 2R6FA 4D6PA 1NBME 4JLPA 4NZYA 1VHLA 4BBSG 1UEBA 1ZP6A 2G0NA 1IHUA 3MWJA 3SJZA 1QVGA 3TR5A 4DR1L 1QHSA 3MCAA 2Q3MA 3O47A 3W6PA 4B2PA 2JJ2A 3IBYA 1W0JD 3QKSA 5FTNA 4YC7A 3DZDA 3EZ7A 1G51A 4AH6A 2D06A 4QBFA 2ZRIA 5FTKA 1HR0W 2CNWD 3OEHD 2A1AA 2JDIA 1N36Q 3IIKA 2GXUA 1N5LA 1Y1VG 3KTAA 4QGHA 5DHFA 4DBLC 4H9GA 3GEHA 1SVIA 1JPJA 1W0KA 3BGWA 1DELA 1JQLB 3SJCA 3QPWA 3PEYA 4A15A 1XTKA 1WDTA 2E2IH 1LFDB 2IK8A 4NYJR 2V4ZA 3H3VH 2BHRA 2AWOA 1HE1C 1ASZA 1DG1G 4HJ8A 3K0SA 1SVSA 3FPAA 2V3CC 2G88A 1E94E 2GCOA 3HDTA 3IHLA 3RRMA 4ZCMA 1FMJA 4R4CA 1IY1A 2H57A 2PMZE 2QQEA 4HDOB 3U3OA 2WWGA 2IYWA 1Y1WG 3WBJA 1J99A 3AKYA 1Z08A 3GLFB 2BE5C 4A75A 3WHKA 4F93B 1NJGA 4BLOA 1U0HC 5FUXA 1DOAA 3BE4A 1GVPA 1U0LA 3W1BA 1P3JA 4K81B 3NDPA 2N42A 3I92A 4LF8Q 3AVWA 1S72A 3OIVA 2QM7A 3GJ0A 1A2KC 1S8FA 5JI2E 4IDNA 3WBKA 3U2QA 5LMNL 5AUNB 4X62Q 1WYDA 4B3MQ 4B48A 4HAYA 4MYUA 2ZRPA 1XJQA 621PA 1ZUHA 3ERSX 3QE0A 3CAMA 4I1SA 5A5GA 1GUGA 3A74A 1W47A 3A0JA 4AQYQ 4WZBE 3PUZA 3SDZA 1AN0A 4OYHA 3RVBA 2QT1A 2ODNA 3RNLA 5TY0A 1CKEA 3BS4A 4CVNA 1Z0IA 2JEAI 1XD8A 4Q1FA 4QHSA 4ACBA 1CIPA 1XD2A 1SXJB 4DNTB 5BR8L 2ZRJA 4TYNA 4MYCA 3EZ6A 3DL0A 4FMCB 4V02A 1JJ2A 2ZJAA 5JCZA 4LPSA 4TYQA 4G5SA 5FLMG 4A3DG 1WRBA 3PQCA 4LF9L 4PZ8A 1Q90A 1AKYA 1UM8A 5H70A 5C46F 1HR0L 1Z3IX 3TS2A 3K8YA 1HA3A 4XSHA 5BWMA 1VQEA 3ETLA 2OWOA 5HZKA 2IYTA 4C0HA 1I2MA 2RGNA 3ZZUA 5KPDA 5DLQC 1GRQA 3SR0A 4QGUA 2R6AA 1M6NA 1CKOA 2KCTA 3PO3H 2CHQA 4FI3C 4LK2A 3F0TA 3RS7A 5M3FH 4ESVA 2GXSA 2O0JA 1VCIA 1MJCA 2D0OA 2GCNA 4JI1L 2HCBA 1R8SA 1K73C 4DV6Q 1EFRD 4FXPA 3SHFA 3I5XA 5B2ZA 1CRQA 1PUIA 2RGNC 2JA9A 3NELA 2UXBQ 2XXAA 1RRGA 3JZMA 2W83A 4S35A 1VHTA 2AFHE 2XOKD 2ZXUA 3IILA 1TNDA 4YCUA 1NI3A 4Q9HA 3GCGA 1G21E 1JEEA 2QP4A 1F48A 2KCCA 1HT1E 4NCNA 1NN0A 5EE3A 3L82B 1KRSA 2FDCA 1KO8A 4A3CG 1QG2A 4MKHA 5SZHB 4Q4LA 4YLGA 4BZXA 1XMQL 5UKDA 1Q1BA 2FG5A 2NN6I 2EQBA 1E7ZA 2ZRHA 3AGQA 1OF1A 1C0AA 4B3TQ 1UKYA 3GJXC 3TJZA 4BEBA 1OHHD 3FWYA 1EUJA 3LO5A 1CKMA 1H65A 2JJ2D 3LWUA 3BOSA 3IGFA 3Q8XB 4BFYA 3RAPR 2UUAL 2VSXA 3WYFA 1G20E 4B3FX 2OM2A 1M8PA 2R93G 1NIJA 4FMDF 2DN8A 2Z0SA 4OX9Q 4D25A 1AS2A 1W2HA 2YTXA 4A3GH 3B9PA 1XWIA 3OAAA 1N0WA 4FMBB 4ERNA 4GDFA 3FPPA 5KNDA 121PA 1W5TA 1E2VA 2Z83A 1YHAA 3Q9LA 4BFXA 4BA2I 3WRYC 1HURA 3HKZE 4TL6A 2JLYA 3ZJYC 2BA1A 4O3MA 1K5DA 1UF9A 2GA8A 2ZS8A 1TEXA 1NN3A 2QRNA 3HPQA 4GMDA 4P0TA 4BLPA 5CDFA 2QPOA 2RHQB 2UU9Q 2WP8J 2WB1G 4A8JA 1ZW6A 2QAGC 4ZKDA 5CIWA 1PH7A 2BJVA 3QF4B 1SVWA 1LS6A 1NN1A 2JLRA 3UIEA 2VHCA 3PV0A 1HNWQ 4DV4Q 2B7CA 4BFVA 2Z4RA 5L8VA 4JJKA 3GLGA 4C9BA 4M1OA 1NMYA 3CRKC 4LV6A 4TWZA 3B85A 1LNZA 1OPXA 4A4IA 3QBTA 5EXPA 4C0SA 4IDOA 2UZIR 1CSPA 1GM5A 3EA0A 4MGZR 3I73A 1O3YA 3K80C 2XNDA 1M7BA 1FP6A 3QXSA 1X6VA 5GROA 3AF1A 1QZHA 3BH0A 4OJKA 2ATWA 4QJ5A 2C77A 1NF3A 1VQFA 2WJJA 2OFWA 4GNXA 2C9OA 4CEHA 1V1QA 4IDQA 521PA 4B6FA 4F4JA 3DHWC 1CP2A 1CULC 4EJSB 2ATVA 5IYCH 4FD2A 1YNXA 1KDOA 1BBUA 1E2LA 4NBSA 3I55A 4PQRA 5CB6A 2DYKA 1Q1ZA 4LYFA 3GLHE 2K5HA 1TWAH 1DARA 1KMQA 3AUXA 2GK6A 4P32A 3W8RA 2ODWA 4HATA 4DLSA 1KRTA 2HEIA 3MGCA 2WWHA 4DLYA 1TL7C 1ZNWA 5GJBA 2O8FA 5C3EG 3GTKH 3MJHA 3VFDA 1KI6A 1MRSA 3R20A 4EAQA 4NXNL 4X65Q 2F4VQ 3CW2A 3M6AA 4LZZA 2JQOA 1YRAA 3B2EA 2VS1A 4L15A 4LF4Q 4XWKA 5GADC 2BBOA 1N6LA 3VAAA 3PIOA 2ZM6L 1YZKA 4ZIRB 1HZBA 1CBUA 4DSUA 1G4UR 3AKEA 1PH4A 4JI5Q 2WAQG 2ERYA 2JDID 3CZPA 4MH0R 1GWNA 2SHKA 3SU8A 2JLSA 2KSQA 2O5JC 2UUBL 1QHXA 2H8KA 1XNQQ 1UBGA 3CR7A 2BCJQ 3BG3A 1EWRA 1RYHA 4JS0A 1XB2A 1NE3A 3S2DH 2IYUA 2VW9A 2CDNA 4XTRA 3RRYA 1XD2B 3H1TA 3L0SA 2G1KA 4PX9A 1P9RA 2QMOA 1HNZL 4GLXA 3GD7A 1OHHA 3CNNA 3I4MG 1KC8C 1HEIA 1Y14B 3ZIAA 3PJRA 1IN5A 4AD8A 1YZUA 2ZVPX 4LFCL 4M0LA 4G7ZC 1X3GA 3RN5A 1VQGA 1ZBDA 2VQSA 1E79D 2OCBA 3FGNA 4EPRA 3STBD 2XZLA 1UWVA 3BU2A 1SN8A 3CCMA 3X1WA 3I7FA 1KD1C 4JVNA 2X1VA 3GFPA 4JI2Q 2NN6G 2ZRMA 3AVOA 4O2RA 4DR1Q 4LUOA 4B3RQ 2ZYVX 1K8MA 1K5GA 2ZI7A 1NBWA 1YZLA 1S3OA 3UDXA 4U5XA 1D9XA 5FBWB 1X8JA 2BWJA 1ZC3A 1GSIA 2FSHA 3QSYA 1GUTA 1NNEA 3U6KA 2D2CC 1P61B 2RGGA 3PIPA 2VRWA 3AUYA 2OAP1 4A3MH 2GESA 3L0PA 2EFGA 1GUNA 4KLNA 5D3MB 5JHHB 4N0EA 1EWIA 3L2PA 1AS3A 1N5JA 3BWDD 3PR1A 3DOFA 1BKBA 1P8LA 1YVCA 4CRWB 4TTPA 5EUQB 1KY2A 1TMKA 1ZD8A 3ZYCA 1K8RA 5HCNA 1IW7D 1GP2A 5C2JB 1MR3F 2RMKA 4C4PA 3OFND 2QUZA 4DV0L 5K8TA 1PLLA 3HYTA 2KB0A 1FR3A 3DDCA 1Y8OB 4IJMA 1W7AA 2B29A 1F2UA 1FX0B 2HXSA 5IE8A 2RAPA 1A5TA 2Q0HA 4P72A 1WQ1R 3FMFA 1MT0A 5GVSA 1VQAA 3AF3A 3J81i 4S2EA 4IPGA 1M2OB 2R92G 2CLCX 2WHXA 3LNCA 4LYHA 3A5UA 4PTLA 4XH9B 1W36D 3GJ4A 1YU9A 4KLKA 4HB2A 3S17H 1RVDA 2VHQA 1KAWA 2DGYA 4UQOA 3GJ7A 3A8IE 4TSFD 4DR2Q 1D2EA 3U61B 5DYGA 4H13C 3E0EA 5IYBG 5FBRB 2WM9B 4KHZA 3I2ZA 1Y8NB 5KNBA 5M04A 2C99A 2IEZA 1R8QA 4DCUA 1TWFH 1IZ6A 2PEZA 4IEEA 5J4YA 1X6OA 1CJMA 2DFLA 3EC2A 3NHAA 3F1ZA 1TKWB 3PUVA 2ZM6Q 1T8TA 2DWPA 3H0GG 1L1OA 1KY3A 2ZRAA 3HPRA 1HQCA 3LD9A 3NBYC 1YJ9A 1UFQA 4OHZA 3WMFA 4EPTA 3ZVMA 5GAHC 2NO7A 3HJNA 3HU1A 4NHOA 4B3ML 5IT9c 4AKEA 3LNNA 4OQLA 3I1FA 1FW6A 4RFSA 3FVQA 4HR7B 3VKWA 5IYBH 1IBML 3MFYA 4JI0L 1E2QA 1US8A 2NZ8A 2VP5A 3A7LA 2N78A 3FP9A 2FF7A 1M7HA 2WSSA 1F5NA 3BFKA 3CKLA 3P32A 2IYVA 2JCSA 4RD6A 1H8ED 4NCIA 5KHOC 4G3XA 3VR2A 4WW0A 1IW7C 1W1WA 4O25A 3LV8A 2AD1A 4PAMA 4TZ0A 3TRFA 4L5SA 1VCOA 1RZ3A 2PH1A 2JA5H 4LF7L 2Z5FA 3PUXA 3N2IA 3HOXG 4KU4A 1QRAA 3CH5A 4KFSA 4DR5L 5DN6A 4DR2L 4KI0A 4MDEA 1YJNA 1O87A 4TZ6A 4LNQA 3CP0A 2G6BA 4B71A 3U6BA 5HCIA 5JJLA 2ZSFA 2ZE8A 2E2HH 3X1YA 3GLFE 1IOZA 4AKGA 4CF7A 1E2MA 1E99A 4Q1BA 4JI4L 4RY2A 2A68D 3NH9A 2ZS9A 4YY3L 4UNPA 4DR6L 1Q1EA 2VSOA 2WSMA 5CK5A 3ZS9A 3QKSB 2EW1A 2GAAA 3VTKA 1TU4A 4JKYA 1GOTA 4Q4HA 1N0UA 3A8KE 2WTUA 2X19A 3HYRA 1UEIA 1QG4A 3SC3A 4JG2A 1RL2A 4B6EA 1T3LA 1L8QA 3ZGXA 4XJXA 4GPTA 4DJTA 4WVFA 4Q1AA 3I5YA 1E4VA 4JI5L 2O8DB 2BE5D 1OFIA 1U5KA 1UBFA 3VKHA 2W6IA 3L8YA 4KJZA 3AGPA 5EP4A 1IBKL 5LMUL 4V0NA 3THYB 2VP0A 3RR5A 1G8FA 1NY5A 5AR1A 5JS8A 1WI5A 3BK7A 3K0CC 5LMUQ 3LGJA 1P2UA 4WZ6A 4QOSA 3K0FB 3T61A 2QPTA 4I4LA 1KK2A 1W5SA 2VF8A 5HE8A 3X1ZA 2PI2E 4RG1A 2E76C 4YCVA 2GVZC 2BH2A 1XBTA 4D2IA 2JEBI 4H1VA 5EE0A 4OQFA 1PH3A 1YKSA 5JEEA 1WFQA 2CLDX 3G5UA 4OO1G 4IDHA 4G7HC 1NMXA 1A0IA 3PEUA 1OYWA 1Q82C 3C14C 3D6TB 1PJRA 1XF9A 5L3SB 2GJSA 1CKNB 3GJ8A 3ND9A 2IF0A 4JI7L 4LFCQ 4AG5A 4D0NA 1HH4A 4LBVA 4HUQB 1U8ZA 2BCGY 4MYTA 1FFHA 2JJQA 5FUYA 4OI1A 1RIFA 2IHEA 4JYBA 2F52A 4GN4B 3T06B 4LV8B 3KJPA 3A1VA 3GLIE 1E2HA 1YE8A 4C3HH 4DXAA 4JT4A 4BQSA 2F55A 4LUVA 1SXJD 5J47A 4EDHA 1N6IA 1BMFD 1TPZA 4QJ4A 4Q66C 3EPHA 2C2HA 1E98A 4GOKA 4PPFA 2GEDA 1QHGA 2ORIA 3TIFA 2GZHA 3KDSE 3VNUA 2R9VA 1PUJA 5ELNA 1OLOA 2WV9A 4LX0A 2B21A 3REGA 5HY6A 5EP3A 2P2LA 2V7QA 1UBEA 3ICQB 1Z83A 4JI3Q 2BEKA 2KA7A 4TYPA 2Z4SA 1WBDA 4LF6Q 3GDEA 4Q1EA 2GWHA 5DIFA 4BLSA 5TMPA 3MEFA 4PHTA 4A93H 3S14H 5LMNQ 2ZJRA 2YNMA 1CEEA 4OK3A 3V4RA 4AG6A 1P5ZB 2D7CA 4DWJA 4PHHA 1MV5A 4JKIA 5GJWC 1FMLA 2P0EA 2IYLD 4LF8L 2KBEA 2KE5A 4RD0A 3KQLA 2D7DA 1EFWA 1EFRA 2QMEA 1BDOA 2Z6KA 2F43A 1EWQA 3B6YA 3KYHC 3BRWD 2P6NA 3A4MA 1E0KA 3CCRA 3O8DA 2IUTA 4KODA 1EFCA 4BZPA 1JB1A 1SE8A 1DS6A 1EOVA 2WAYA 2ES2A 1TU2B 2MMCA 3AB9A 1GO3E 2YWHA 2A5GA 1Z5ZA 3AV0B 4L16A 5G41A 1GIAA 2J0UA 4NYIR 2XTZA 2N46A 4HLCA 4IVPA 1D6JA 1GG2A 2P65A 4Q5IA 3ICEA 3OFNA 5B64A 4BFTA 3UDGA 1G3IA 1GRNA 3IKJA 2MSEB 2AX4A 1G4AE 1W44A 1DAHA 1P62B 1XFAA 2WIAA 2UXDL 2WMNB 4IVRA 1HTWA 4CGZA 2K4KA 4XSGA 2Q21A 4Q48A 1KI9A 3K9NA 4B75A 4KKTA 1IONA 3O8CA 4XTCS 3K9GA 3QXJA 4JSTA 2JA1A 2HF9A 1L2TA 4DC9A 4P4TA 4W9MC 2IXEA 1EXMA 2QA5A 2QQ0A 3BJIC 3CWQA 2JA7H 1J90A 1I2DA 3CRRA 3IEUA 4PPGA 3M7NA 4QC2A 3UKDA 4EPWA 4JYAL 3ZQJA 3CCJA 1QUQA 1ZIOA 4TSFA 3AFQA 4LFAL 1M1YE 1N6KA 4ZPXA 3ZQ6A 3T1YL 1A82A 4Q7LA 2YTYA 4NU0A 3GLHA 1MIUA 5C0XI 1E4YA 3J81k 2BA0A 3WP1B 3PEVA 1QJOA 1MO3A 5J40A 3R7WA 1MOZA 2OZEA 1JJCB 2R62A 1GHKA 4DSTA 2V1CC 3WNBA 3OTOQ 2H5XA 1EESA 3HOVH 5HKKD 3KUCA 2ZT9C 4WJ3M 1KO5A 2ZUDA 2Y0SG 3AVUA 1NLYA 3ZD6A 5GAEC 4JLVA 3OW2A 1E9CA 4M9ZA 1DXMA 1A2BA 1IM2A 4A3CH 1R5OA 4OX9L 4HEJA 4ACAA 2Z0MA 4LSGA 1VECA 4DDVA 1YJ5A 5LDDC 3FMOB 4AQYL 3S1QH 1US8B 1N6PA 3MWLA 5L3QB 4LJ9A 3IO5A 4UP8A 3TUZC 1UAAA 3CB4A 4O0MA 5DO9A 4XD7A 2QP9X 1VCMA 2B8GA 4DAYB 1MKYA 4JLAA 1E3MA 1EYGA 4IVQA 2E74C 1E9FA 4YXWA 1VQPA 3M4YA 2YOFA 4IDPA 2DB3A 1XCGB 3JAMi 3GLIB 3LXXA 4JSYA 3NDBB 1BYIA 2NO0A 4PQFA 1QVAA 4LGMA 5AJ3L 1XPUA 1KI1A 1DTSA 1Q1QA 1WF3A 4HUTA 5M5YH 4L5QA 1XNRL 5AJVB 2GF0A 3VHLB 5A0FA 1XEXA 4KHPQ 2ZU6A 2R2AA 2WKPA 5FPYA 4B3XA 2W2VA 3QEJA 3HOZH 1VMAA 3N5CA 4Z8YA 3B13B 3ZDQA 4UP9A 3S16H 5KUTA 3RSLA 3S1MH 1WA5A 1FP7A 5J4KA 4F38A 1RW4A 3KQNA 5JECA 1T5IA 4GNKA 4RJLA 3OEHA 2Z43A 4KMUC 1RKBA 3UDFA 4BXXH 2ZE7A 3VHXA 3G48A 4C0AC 2NO6A 2X8AA 4B32A 3SNHA 5HZHA 4FCWA 3T1TA 3A6PC 3MXNB 1MJEA 4NONA 1N8RC 2AR7A 2ZRDA 1SXJC 1H9SA 1II8B 1VQDA 2JIZA 4ZDKA 2ANCA 2ZRLA 5F9HA 2EXDA 4JLOA 5JZVA 2WWXA 2MFIA 4TMTA 4P74A 1EG7A 1ZM9A 1E69A 3ZZ0A 3GFTA 4Z8XA 1U9IA 3HOZG 4NB3A 4PSKA 2EYUA 4X6AH 1KIMA 3EAQA 3DEFA 1VQMA 2DFNA 4JZKA 1DGSA 1PZNA 2OILA 4OWXB 4M1TA 4PZZA 2A6HC 1N32L 4KITB 2R8RA 1OIWA 3ECCA 3C5CA 4DB4A 5K8UA 3AVTA 3V4FA 1PV4A 4A3JG 2NIPA 2QSYA 2FN4A 4BY7H 3TR0A 1HH2P 2JK8A 1SFOH 4JI6Q 3KQUA 1FTNA 5K8IA 1J2JA 1Z29A 2OXCA 2CLSA 2ZRBA 3AF2A 5LD2C 2NVTH 3IQXA 3PGZA 4HJ7A 4Q7JB 4URYR 4JLNA 3TNFA 1KNQA 4US2R 2J9RA 3T1OA 4FWIB 2PPBC 2HF8A 2YINC 2QEQA 2WOOA 1CR4A 4XWOA 2Q3FA 1I50H 1GKUB 3LY5A 4LJZC 1DBSA 1T0HB 4MQBA 4GKJQ 4D81A 4BRUA 2A5DA 3EZFA 1SKQA 2WVJA 3QKRB 3AVVA 3CIOA 4UJ3A 4RSGA 3FB4A 1SXJE 1OV4A 2C9YA 2CHGA 2GRJA 4CT5A 2ZREA 3HOVG 2GEUA 2GKSA 4KKSA 1L4YA 3FKSD 3LBIA 3E9HA 4UPAA 1XNRQ 2F7SA 5E4FA 5KDOA 4JMPA 3RWOA 1TQ6A 3IUYA 2W6JA 4C30A 2O8DA 3JVUA 1ZUNB 1S40A 4JBXA 4Q9LA 4BPBA 3UG7A 1FQKA 1A62A 1JXMA 2JGNA 3A1UA 1OXXK 1RJ9B 1Z6XA 2ZITA 3T1QA 3C4JA 1U99A 2ONKA 3CRQA 5JRZA 1YJWA 1I4LD 2VL7A 1FL9A 2GCOB 4A3FH 3QOFA 4LJ6A 1KXLA 2QGNA 3SEAA 2OBMA 4M9SA 2NO9A 1X3EA 4Z54A 4HLUA 3FHWA 3BH6A 4K46A 4PO1A 4GMXA 5EXSA 4I99A 3UANA 3CUEF 5C0XJ 5M3MH 4DK3C 4DR4L 1PH6A 1DAEA 1XU4A 2C5LA 3MRSA 1SVOA 4IKEA 1WOCA 4QL5A 3GLHB 4X62L 5G3YA 4B3TL 2CJWB 3RS5A 2XNSA 1PH1A 5EE1A 4PV1C 1CU1A 4A92A 4JBMA 2K75A 1KO4A 4LF6L 1G3QA 1ZNXA 4LHWA 2Z6KC 2ZAMA 3TS0A 2ZJ2A 2HT1A 2CMKA 5CJ2A 5BXQC 1Y8PB 1A8VA 4Q18A 4BFSA 5C4GB 1K3RA 1AM4D 1FTSA 5IY0A 3AEZA 4R7ZA 1OB2A 1C1YA 3HOYH 2J87A 1EQQA 4E07A 4AI6A 4RFSB 1S3GA 1U8AA 3KKQA 2PJZA 2F9LA 4B73A 1T6NA 2WJVA 2H17A 3T35A 3UK6A 3UWOA 2VP4A 4EJSC 1FVIA 4YONB 2EIFA 4PSVA 2ZVQX 3TW4A 2F6RA 4CEHB 1AGRA 2ZJZA 4YMWA 4EFNA 2W0MA 1UE6A 4LWCA 4LUCA 4OONA 4DB2A 2JA6H 3EA5A 1VQNA 2WZQA 4UP7A 1T8UA 3F3YA 5FJ8G 3SZRA 4H0LC 3M1IA 1OXUA 2O8EA 5JS7A 2G1JA 4JVMA 5JMTA 4IOAA 1TEVA 3R7WB 1UE7A 4HLQB 4EFLA 4MKFA 4UNQA 5H1YA 1GUAA 2Q8IB 1OKKD 3BB1A 4OJQA 1IXRA 4TMWA 1W36C 2ZEJA 5C44G 4DEXA 1UKZA 2DPXA 1V5WA 2CHVA 2NOAA 4W7SA 3K8AA 3ADKA 1WB9A 5JJIA 2I0QA 2W00A 4M1SA 4C2TA 3PSIA 3HWSA 2FZ4A 1KAGA 1AS0A 4GKKQ 1W4AA 2OHFA 4RD4A 4GFDA 4AYXA 1QVRA 3I61A 3U3KA 1O7LA 3SQWA 2J0SA 3B1WA 2QROA 5IP7H 3CPHA 2N49A 3I4OA 2GJ9A 4Q7KA 5EXTA 4JI3L 4NCHA 4LV5B 4DV5L 1KI4A 5FOUA 4P33A 5M3FG 1YR9A 1KAOA 1SHZA 1I94L 3ADBA 3CQZH 3C41J 1J6QA 1G8YA 1IYJB 2KENA 4JYAQ 1CJUC 1T3SA 3AB3A 2VO1A 1GUOA 2L5TA 4JVLA 4PC7A 4LJ8A 2OXRA 4L9SA 2QAJA 1MO5A 3ASZA 4V03A 4WXRA 2KJQA 3KOJA 4JBWA 1WCMG 4A3EG 3CD6A 1SQ5A 3Q5DA 1E2PA 4NKRA 5FBVB 3P4XA 2YC2C 2BKUA 1AE2A 1IQPA 5FLMH 3KB1A 5SZJA 3UATA 5KSOA 3THWA 2MMGA 2IYSA 1KJYA 1KQSA 2DUDA 3CCSA 1WJJA 3A8TA 3KJGA 4LOAA 4DV1L 3SYKA 4DKXA 3RLFA 4HJAA 4LC1A 4PO9A 4KSBA 2IWRA 3DKPA 4LHVA 1Z8FA 3S1AA 1FNNA 1IY0A 2NG1A 4UJ5A 2GJAA 2PZFA 1KGDA 5G53C 1UKEA 2PCFB 2GVBA 4Z1MD 5DNYB 3FE2A 2H16A 3KLRA 2P5SA 1YZTA 1D8LA 1PH8A 1CXZA 3P1JA 3EXAA 1HCZA 5IT5A 1X55A 4D82A 1B70B 1Z0JA 1SXJA 1LTQA 4P4SA 2WWIA 5K8LA 4MRPA 4Q00A 1XNJA 3I8XA 3QKUA 2P6RA 4B76A 4KVGA 1F2TB 3K0AB 5HE9A 2ZJPA 1NVVQ 4URUR 2IX1A 5HTKA 2MO1A 4C0QC 5FOWA 3VKGA 2OAQ1 2QE7A 1XMVA 1UJ2A 3SBEA 2HV8A 4GNXB 4POAA 2BJWA 4PAOA 2PMDA 3V00A 3SQXA 2B63G 421PA 4CW7A 1ZNZA 2FFBA 2ONJA 1IAQA 4CEIB 1E9EA 2FSGA 1LYLA 1FYCA 3EIHA 3U4QA 3MWYW 2NVQH 1Y3AA 4CEJB 4EFMA 1KTVA 3VX4A 3DVLA 4KN7C 4I81A 4O0AA 1G8HA 2FPKA 4HAUA 2D2FA 3K0FA 3VR5A 4L8GA 1FQJA 1FL0A 3QXHA 1RPZA 2DWQA 2VYFA 4IPHA 1YI2A 1QF9A 2A5FA 1K9MC 2OQ0A 3BFXA 4LBWA 4YHHQ 5FI1B 3BC1A 3QVVA 1OYYA 721PA 5IK2A 2RHMA 4Q9KA 5A35A 1YBYA 3PO2H 2WAQE 1NY6A 1E22A 1P60A 1WMSA 1EX6A 4KV9A 1CJTC 4LC0A 2LXJA 4Q03A 2ORWA 2EFDB 4BGDA 1GKIA 2REBA 3TAUA 1I6VC 4DV7L 1N6OA 4NH0A 2XB4A 3WDNA 3GPLA 5B57C 3W5JA 2ZTCA 4NYIQ 4DLWA 3LW8A 1SZPA 1HNXL 3J7A5 4UXIA 2IWHA 1GL9B 4D4JA 1Z2AA 1K8GA 5FH9A 4A82A 3RS2A 3LVQE 5KSYA 3G71A 1KDTA 3T53B 1XRJA 1VDZA 3K09A 2KHIA 4M4SA 1JNYA 4NP6A 2KBFA 4CZ2A 1E1QD 1L1OC 3CBQA 2FE4A 1IN4A 1E1OA 1SR3A 1X54A 2C35B 4BY1H 1UPTA 2JA7G 2AK3A 5AK0A 2CWAA 1K83H 2VQFL 2HLDA 1XEWX 4MRNA 2AKAB 2ECKA 5C18A 1IBMQ 2WSSD 3WYAA 4NXNQ 2R7ZG 3IIJA 2B8WA 4HZUB 5BN4A 1N34Q 1XMQQ 2XGTA 4QBIA 4DUYQ 1R0WA 2GAOA 5FTMA 1SVMA 3VMFA 4ZV4A 5AJZA 5CJPA 4AC9A 2QTVB 1GRRA 4ZI2A 2B63H 1R0ZA 2IS4A 2K5VA 1E0JA 4MGKR 5J4LA 1DPFA 1P9NA 1E24A 1FUUA 3D7MA 3CCEA 1VQ6A 2VLIA 1F3OA 3KF6B 5IF9A 2HYIC 2EQSA 4PHFA 2PL3A 3AH8A 3FDIA 1IXZA 1KZ7B 4PFSA 3W90A 3CX8A 4KO8A 3ULLA 2LKDA 3AP2A 5BYJA 4X64Q 3RABA 1VQ8A 3CCLA 1NG9A 3MJRA 3PCRB 4Q4HB 2YVUA 2RB4A 2ZJOA 3RANA 1A4RA 2E75C 2Q2IA 2PNHA 4A3MG 2C96A 2ZRCA 1XXHE 3GEEA 3OIUA 4JK1C 4TQAA 1Z0KA 1II0A 3CF2A 2JLUA 1TQ4A 4A3BH 2V54A 3Q8DA 4IQZA 5CIQA 3OOCA 1P6XA 2WJHA 2XJ9A 3EARA 4OI0A 1E32A 1OB5A 2FV8A 2ZJ5A 2QL6A 4FINA 4KBGA 1GNPA 5DI3A 1KNXA 2C8VA 2KBNA 2A8VA 4I1UA 5IWAQ 3TUIC 3UXMA 2KI5A 1H95A 1E79A 4B2LA 3QXCA 4Q4AB 1YHQA 4DSNA 3CH4B 3AEVA 4IFDI 1IL2A 1H9MA 1YNJC 3U4VA 2RGDA 3LRPA 4TVAB 5HR5A 2C95A 2EYQA 4P73A 1DG3A 4NXMQ 3T5GA 1RYFA 3GTJH 4LBYA 3IPYA 1H9JA 3M4QA 5KSZA 1NLFA 2A78A 1P7CA 2C78A 4LFBL 1ZAKA 5EZ6B 3U3JA 4KXFB 5LD2B 3WHLA 2HJGA 2ZRGA 3THXB 2GBLA 1TX4B 2FH5B 1ZC4A 2D62A 3M3YH 1N6NA 1RRFA 3FMIA 3R8FA 3PITA 2GTPA 2G83A 4A9AA 1G16A 1E6CA 2ZI5A 4MUBA 4HI0E 4PXAA 4WIAA 4A6XA 2HHHQ 2TMKA 4JL5A 4IFDJ 2BMDA 2FX3A 3DM9B 3DM3A 3EG5A 1NVXQ 5JWHA 5E7JA 1Z9FA 3B60A 2JJ1A 1G3RA 2F3RA 2CL6X 4IFBA 3AP1A 2JASA 2ZI6A 3U3MA 2GEVA 1QHHA 4DPGA 4EPYA 2ZR7A 4PZ7A 5C44H 3HOWG 1DAKA 2OLKA 1W2GA 4DV7Q 1A63A 2REOA 2VL6A 2V55B 4IXMA 4OI2A 5JEDA 2J0VA 5FTJA 3U60B 3EASA 3S24A 3GFOA 3L8ZA 1LACA 3EWAA 3THWB 3A8JE 6Q21A 4R4QA 2JJ8A 2VP2A 3TGPA 2QNRA 1OTCA 1R7RA 2Q2HA 1XTQA 2OEPA 4QGAA 5FOTA 5FJ8H 1E9DA 2AL7A 4FDBA 1CRPA 4JI7Q 4JV5L 2O0HA 3DOEA 3ZLJA 1SROA 2WB1E 3LLMA 5EZ5A 2F3IA 5FOSA 3O8RA 2O8FB 1KYIA 1TWCH 4GBMA 3U50C 4X8MA 4YDHB 4BUJA 3G0HA 1CI3M 4JYCA 4DR3Q 3EC1A 4KVAA 2ZSAA 1Z47A 1CFMA 2K5NA 1XTDA 3SGIA 3QVUA 1AKEA 1BBWA 3QKRA 1D9ZA 2PZEA 4PZ6A 2QEXA 4MGIR 2IYRA 1TTTA 2VQEQ 2K52A 1TQDA 4JBJA 1ZM4A 3TLXA 1MO4A 2HYDA 3OHMA 4A8JC 3AVXA 1G7CA 1VF7A 1E2JA 4Q4JA 3QENA 2CCGA 2VQFQ 3W6NA 1UADA 3VR6A 2HIXA 1FX0A 4V0LA 1T4GA 2J7KA 4RZUA 4MYHA 3EIQA 2RCNA 4N1AA 1E1QA 3SI7A 5E3HA 4FN5A 5DH9A 4AY2A 2WAXA 3AVQA 4PC6A 1LUZA 4R71A 5CYOA 4TMKA 2FZLA 4NPHA 1OH8A 1SLJA 2P3SA 2H5EA 2IT1A 4IOMA 4DR7Q 2I5LX 2WKQA 1KK3A 2WIBA 5G3ZA 1OW3B 2KWIA 4TMVA 4EUNA 2ANBA 2RGXA 2H92A 2F1MA 2VUMH 1LV7A 2FGJA 3LFUA 3QPVA 3RS4A 1OH7A 4G0NA 5C4JH 4LJ4A 2FEMA 1QHIA 4X8HA 2E2JH 5EUMA 5AJWA 4XVUA 1FJGQ 1QVFA 1DO2A 2ZTEA 1VG0B 1SKYE 2IC5A 3BB4A 2CJWA 4B74A 2P67A 1H9KA 1Q46A 2JLWA 2ZTSA 4IJLA 5IK2D 4O2DA 3KXIA 1DCZA 5ELOA 1G3MA 1BIFA 3D4RA 3H94A 1XNQL 1G7SA 4FCTA 2QG6A 4OI4A 3K0EA 3ZZTA 3A4LA 4QBGB 4JVSB 3Q5EA 4G7OC 1AJEA 2AKYA 2IX3A 1GKHA 1Q20A 3U4ZA 2FOLA 2GILA 2OO7A 2OV2A 5FPHA 3QJYA 4HIMA 4AIIA 3MD0A 2R6CA 5FTLA 2BDOA 3B5JA 2FMXA 1E2EA 3MWKA 3KF8B 3CCVA 1U81A 3A7AB 4ZI3A 3QG1A 2FPMA 4A3KH 3STBC 1Z6YA 4LHZA 1J8MF 1UE5A 1N25A 5TV2A 3SJBA 2AKWB 1SVLA 1Z07A 4P75A 4RD1A 3RS0A 1OH6A 3CNLA 4POFA 3T34A 1XX6A 2GDJA 2JIZD 1Z28A 4TMZA 3TQCA 4DUGD 1K8AC 1JMCA 1MH1A 2WJYA 2LKCA 2CK3A 3I32A 4A2QA 1I4TD 2GN5A 2IXGA 3VR3A 1CR2A 5BYKA 5EJEA 5LB4A 1TADA 4PC1A 4BY7G 2BM0A 3PFIA 1Z6AA 3L43A 1EIFA 4URWR 2O8BA 1F6BA 4V0OA 4H02A 1Z06A 3BFVA 1CJVC 5JCPA 1R9TH 1XXHA 1QZGA 2NPIA 4LFBQ 5FBLB 3UMRA 5JSZB 3AM1A 3IO3A 1AQYA 4AIMA 5G40A 1Z6TA 3JAMc 2VNUD 3BAFA 4V0KA 1VTKA 1YR6A 1ZU4A 4BASA 3NE5B 4AYBE 3HR7A 4F7WA 2RGCA 4L4UA 2DWOA 2JLQA 2IS1A 3K09C 1KDPA 2ZM5A 2I4IA 1E1RD 4LPKA 3EPLA 3IEVA 4P31A 3R8CA 2UXCL 3WXMA 2A6ED 3U5ZB 2CE7A 1R0YA 3A1TA 2HIVA 2G3YA 1JJVA 1B0UA 2FFQA 3NTUA 4XIGS 1X65A 4OL0A 4TYYA 3QI2A 4IOJA 4NCJA 4DV4L 4MNOA 3KZ1E 3H15A 3S1NH 1G7TA 1DAFA 1X86B 4FCVA 3DPUA 4YXWD 3LBNA 4PO8A 4GKJL 1KI3A 1QHHB 5JBQA 4DLVA 3TMKA 5AUQA 5A4JA 1GFIA 4JLBA 3R9WA 4AKIA 2VPPA 1QBKC 3X1DA 4KBFA 1H8HA 4AYTA 1WBBA 4KFTA 4JBYA 2Y0SE 3IBGA 1Y1WH 4GOPA 2V7QD 1C4OA 1P9WA 2PQAA 2K7VA 2NZJA 2OTJA 1S4QA 2FU5C 4C2UA 2PT7A 3HGBA 1KK0A 3KFXA 4RKEA 5TDHA 4DCSA 2I5HA 5F98A 4E22A 1T5LA 3OE7D 1W3SA 1X8LA 3CCUA 1IBLL 1I5FA 4Y52H 2I1QA 1W4BA 1YR8A 4QGFA 1BOFA 4HZIA 3FKIG 4DT1A 3CMEA 4A3KG 3CPFA 1LS1A 1XEXB 4PPNA 2ZJYA 1D5CA 3Q72A 2D0PA 2J59A 1LM0A 3SOPA 4AYWA 4TL8A 1N3BA 1B23P 1XMIA 2OSBA 1E96A 4DKAC 3BZKA 2XEXA 4F4IA 3CZQA 1OT3A 4DV1Q 1IXSB 3S2HH 1X3FA 1NBMD 2HDNB 3I3SR 4ZKEA 4PQYA 1M90C 2JATA 3D8BA 3L0OA 5EAYA 4GS3A 4B34A 2QENA 2JAQA 3J80c 1JR3E 4OHVA 3N2EA 4R9UC 3WMGA 5C3EH 2AN9A 2V1XA 4HB0A 5F3WB 1XPOA 4CDGA 4DLUA 3RYTC 4YMUA 3VDYA 5JEAG 4KHPL 5FUWA 2OCPA 3EX7C 1RJ9A 3W5OA 4NYJQ 1TQ2A 1PLKA 1Z7TA 2N3SA 1LW7A 1ZM2A 2BC9A 1QHNA 2RF4A 4GN5A 1B9MA 3ZS8A 3K70B 2VUMG 3EZ9A 1F60A 1NJFA 5K36G 5CYPA 1NKTA 3W3ZB 1W0KD 1ZCBA 2QGZA 1XXHB 2GZAA 2H18A 1VS0A 4DK0A 2B92A 2GVDC 4UNSA 1OFHA 2PCJA 1TUIA 2GK7A 3OYYA 2VF7A 2Q9CA 2WMOB 1JE5A 1AIPA 1KJZA 2F43B 4US0R 3REFA 1QUQB 1KMHA 4DUGA 4AKHA 3CMAA 1GL6A 4G5QA 4ASUA 1HJPA 2KHJA 5DN6D 1ZU5A 5BR8Q 1S2MA 1HTPA 3K1JA 4LWZA 4OK5A 5GJVC 3TZUA 4Y7NH 3SN6A 3KDFA 1VG1A 4AK9A 5EP1A 5IYDH 2XSZD 2J7PD 4JBKA 1E1TA 2OCYC 2R65A 4HUQA 1H9RA 4TQUS 1CR0A 4E5UA 3KQKA 3EPKA 3NVAA 4DIEA 1ETUA 2J1LA 3OTOL 3BJUA 3FFBA 4UY8C 1O78A 5CLQA 2YTVA 4LCBA 4U7DA 3LAWA 4YMVA 3KLWA 2XGJA 2OTLA 5FI0B 1EX7A 1KZGB 4RCYA 1VQCA 3VU9B 3VQTA 1XP8A 4ALPA 2DBYA 1W46A 1HV8A 2AWNA 3ASYA 1CSQA 5FPTA 1VYTA 3W34A 4B44A 4LI0A 4GOPB 4QRHA 3T1HQ 4RVCA 2QP3A 3KFVA 5LB2A 1XMJA 3HKZG 5K36H 4GN3B 3G4SA 5IP9H 1XPRA 1H8EA 2IYYA 4DV3Q 1IJEA 2ZANA 3I8SA 3NBXX 4JLDA 4PZYA 5B58C 4UKDA 5FPKA 1KOFA 4D4KA 3RRNA 3FTQA 1G291 1K0RA 3LX8A 2EVBA 4HLDA 2AFIE 3RS3A 2IS6A 1VQIA 4GLVB 3U7EB 3SYLA 4YQFA 4L5RC 3W1GA 4DV5Q 2GZDA 2EFEB 3Q7PA 4POGA 4D4MA 4R4TA 1E9BA 2O8CA 2XZPA 4ABYA 1TAGA 1NTGA 3SS8A 3NEMA 3A4NA 2FXQA 3E1SA 4Q9JA 3D3QA 3VX3A 4B33A 1WXQA 4K8OA 4C0JA 2FNAA 2W58A 3RRZA 3GLGB 4GZMA 4C3JH 1I94Q 1AA9A 3LLUA 1Q8KA 1VQJA 1VG9B 1S1CA 2EJMA 3UDIA 4BBRH 5IHPA 1GD7A 4WJ4A 1DAIA 4G1UC 3SYNA 2JE6I 2PLFA 4AWXA 4A3LH 2W6ID 3PF4A 1VQBA 1U9IC 4JLMA 4Q21A 2EFHB 4W5WA 4OQXA 4US1R 2WWYA 2AUJD 1P2SA 4A0FA 3LQQA 3MXUA 2VIIA 4NTZA 1Z63A 4URXR 3GTQH 3AKCA 1R2QA 4NCKA 5KSPA 5E7NA 4DR3L 4KFUA 1R0XA 1PA6A 1OKKA 2A2ZA 1KKLA 4F92B 4A3DH 3TH5A 4IRUB 4H44C 2B6HA 4ARZB 3C8UA 2IHYA 5AJYA 3LWNA 1E0SA 1GHJA 5IWAL 2XB2A 1BVSA 221PA 2BOVA 5TARA 1JJ7A 1E3PA 4CIDA 2IHBA 4OWWB 3SE0A 2ZS7A 5FLXc 4A3BG 3CLVA 2R7DA 3E5HA 3K9LA 3UG6A 1VQHA 3A1SA 3KQHA 1KO1A 1B8AA 1KSGA 1P16A 1E1RA 2AK2A 3K7UC 1FJGL 2XTIA 4DDTA 2ID0A 1S0UA 2NZHA 2N1BA 2QAGB 2LWIA 2UXDQ 2UU9L 2ASEA 2NVYH 1P2TA 2MQHA 3C5HA 3EIVA 2EJGC 4IJHA 2R6GA 1FZQA 1S1MA 3CRVA 3K0AA 1G19A 3M85A 3J7ZC 3PIRA 1L2FA 4NL4H 4GT1A 3KL4A 1BKDR 2CVFA 4A0HA 2QN6A 3N6RA 2Q2UA 1NVVR 1UEJA 4FMCF 3Q85A 4M1KA 4JLKA 2HHHL 1M7GA 3Q7QA 4OHYA 4DR4Q 2CQOA 1GKYA 4MRVA 1BYUA 2YHSA 1KHIA 1O7IA 3AKDA 2UUAQ 5CM8B 1WP9A 1W36B 2GBLC 2P6UA 2XNDD 5DHAA 1CS4C 4EPXA 3UE1A 3KUDA 3U4QB 1OE0A 1EIYB 2BV3A 3QF7A 4KYUA 2LXKA 1VQOA 2R7ZH 1ESNA 1S3SA 2LSSA 2VQEL 4QL3A 1E2NA 2A7QA 4K0KQ 4BEJA 5TVKA 1E2GA 4UXHA 3RN2A 1U90A 3CO5A 1PH2A 2PZGA 5AWFC 1XJCA 2DHRA 4HIKA 4LJ7A 1KMHB 4DK1A 1MABB 1SKYB 1TWHH 3S1RH 1LF0A 1YQTA 3H4MA 4N3NA 3LDAA 5J5CA 1N33L 3TAHA 4BECA 2E5LL 2ZI4A 1IY2A 2BM1A 1EQRA 4GSYA 1JALA 4D80A 1LF5A 1FUKA 4ZDIA 4BBSH 3VR4A 1N2CE 5FL3A 1V9PA 4OQNA 4YMSA 3B1XA 2Q9AA 3P4YA 4KCGA 4URZR 3SFVA 4BFWA 1HY3A 1BO6A 1G5RA 3BXZA 4TLEA 4YY3Q 1NG1A 2GXQA 2W2TA 3M4OH 2CCJA 3CRW1 3OAAD 1IN7A 2K5UA 1RE0A 4PPQA 1S9HA 3VR1A 3TQFA 5FPSA 2VZAA 3IQWA 3GTOH 3T1VA 4KYIB 3UPUA 4DR5Q 4DV3L 2P5TB 2R7FA 4TT3A 4OGQC 4L8JA 1RRPA 2VBCA 3PG5A 1DAGA 1KSJA 1FOEB 2D2EA 3FOZA 2G0TA 1ZJ6A 3MMPA 5KDLA 1N32Q 1VYUA 1JB7A 4D0LB 4JJZA 1CTMA 2E1RA 1JJGA 1XEWY 5BN5A 1DEKA 1N34L 2O0KA 3I62A 4A6PA 3NBZC 1NLZA 3I4NH 1Q3TA 1W49A 2LCFA 4Q02A 1XCPA 4ZDJA 3IIMA 1ESMA 5E7IA 3GTMH 5E95A 3DXJC 2A6EC 3ADDA 1ZIPA 1GL7A 4MITA 4C7OA 3F2BA 1Q7YC 3W5IA 3E70C 4GI7A 2G77B 4LYJA 1R4AA 2ZRNA 5HKKA 1J70A 4QIWE 1G5PA 1D8TA 3L7ZC 4MA4A 3AYHB 1JI0A 1QHYA 4DCVA 1DO0A 4PC2A 1TWGH 4LUZA 4QHYA 1ZM7A 2J0UB 3CC7A 3ONWA 4PR0A 2K33A 3H0KA 4TTQA 5GJCA 1Q57A 4M1MA 2ZJ8A 4EQ5A 1PHJA 3ND8A 3AQQA 1NSTA 2Q9BA 4A93G 4RZXA 4HB3A 4BWYA 2AHOB 1E9AA 1VYVA 3SFZA 2J46A 2GXAA 1NP6A 1GNRA 3F2DA 1XTIA 3L0IB 4W5JA 2NN6H 1UDWA 2CK3D 3AQ4A 5SZIA 3ZVRA 1Z0AA 3PEWA 3W3AA 1GZSA 3EW9A 4ZCLA 2ZUCA 3C16C 3KJHA 3RHFA 4RCZA 2B8FA 1NL3A 2F9MA 2RHSB 2NMVA 4KLZA 2A19A 2VHJA 4HDQB 4JI1Q 4DLZA 4ARZA 1XCMA 2O52A 4HZUA 4JLJA 4M9XA 3TEHB 2FFHA 1AZSC 2NPFA 4IO9A 1VQLA 1G3UA 1HZCA 1IYUA 2D3WA 5JWOA 2WPDA 1CKNA 5L3SA 4BBRG 2CFMA 4MDFA 1KI7A 3T1HL 2VP9A 2CKZB 1Q0UA 1QDEA 2REXB 2J45A 2ASBA 3HOUG 3KF6A 4RMFA 2A9KA 1IXRC 1R10A 3Q3JB 5D3QA 4NYMQ 3TBKA 1HYQA 2GCPA 3AF4A 1HZAA 4C3IH 4UNNA 3RDPA 5J4VA 2QAGA 1YZGA 1YR7A 1VQ5A 2K14A 2I1VB 4UNRA 4MZ9A 5GVRA 4YMTA 3RLNA 4P4SB 4OO1H 1VKJA 2IBMA 2CXXA 4DAMA 4O2LA 1TF2A 1IBKQ 5M5WH 3GTPH 2E9SA 3F8TA 3KTAB 1KI8A 1H8HD 1KKMA 2VEDA 4DRZA 4M2LA 5KO2A 2YWEA 4KFRA 3NHBA 5IRCD 1X9NA 1PMRA 1N5IA 1YIJA 3KJOA 4KKUA 4EJSA 4UXJA 4I7ZC 4R2IA 1NMFA 1KSFX 4CEIA 3NEYA 5DLQE 4A2WA 4B2IA 1JAIA 3S1AB 1KSHA 4M9QA
chains in the Genus database with same CATH superfamily
3HKZB 2RH5A 4L5JA 2A6HD 3Q23A 2VDUE 4IJUA 4RTSA 3LZCA 1J1IA 5KJ1A 3T1YQ 2HM7A 4REQA 3WNCA 4E4TA 1BO0A 2ZIXB 3NOOA 4UEKA 1AMNA 5G3LF 1EGAA 4ND4A 3GFBA 1IFXA 3HKSA 2WJIA 5AW3A 5ITZB 4U4AA 2EU8A 1X38A 2MYTA 4DAPA 5IS2A 3VHXB 2QRZA 1ZI8A 2ZJ1A 3NHUA 3LDHA 2BGUA 5DGXA 3GV3A 3ORFA 5FLEX 2VDJA 1H2HA 1X7ZA 2ZJ7A 2O2HA 4QYIB 5KINB 4JC5A 4LXQA 3EVAA 2A1TR 3NAQA 4XUEA 3EAGA 3OZIA 4LCEA 5IXYA 1KEEA 1E3SA 1AUXA 1LRLA 2XJ4A 1DE0A 1ONBA 1XK7A 2ZBGA 1XZQA 3FKQA 4M38A 4WLEA 5TQ0A 3TM4A 4Q93A 1QORA 1GV1A 2BMFA 3H9CA 2PGXA 4TVKA 1VCNA 2CNWA 4C2BA 1VLJA 3PCXA 1E7MA 4MR8A 2WG0A 4NYMR 4WXPA 1J8IA 3INGA 4RNDB 4UAUA 3TZBA 4ATNA 4V39A 3PKZA 2WWRA 4YUZA 5IH7A 1NJ6A 1JR3A 1T9ZA 3DAPA 4A4DA 2OXFA 4UTPA 3IIEA 5H81A 3R7AA 4JOIC 1Q0RA 3EXHA 1COWA 1DIGA 1FX1A 5KWVA 4DC1A 3H3VI 4ILWA 4QHTA 3UTCA 1MABA 4MGEA 4UTNA 4IUTA 1D07A 3QA3E 2NZOA 5FHRA 3T51B 3DXZA 4B47A 4XQQA 3ENQA 3EWSA 1MBYA 1JXOA 2GHIA 3KEQA 3CRMA 1NBHA 3WYNA 2PCLA 5BSRA 1QE6A 2XVAA 3M5CA 3HJUA 1XYIA 2R96A 1ILWA 4LF7B 4GNXC 3PQIA 2PZMA 1KIXA 1PGNA 1VQ7A 2VHTA 1F2LA 2XGMA 3KVVA 1T25A 2Y99A 5IAJA 4AJNA 2UXBL 4JV5B 1MIOA 4ESEA 1I4DD 3AFPA 4KQXA 4X1YA 3S7TA 4D41A 1Q12A 1YRQA 4DR7L 2V6JA 3LH5A 1WL8A 2DX7A 3JU3A 3DLLA 3BEDA 4R3NA 3WYCA 5JD4A 2P79A 1RC8A 1QOHA 1P3Y1 5IDVA 3QXXA 4CM3A 2Y1OA 3OF5A 5KQMA 3A9RA 3CKYA 1TKBA 2GO1A 2OE2A 3VU1A 3W8FA 4D9MA 2X6GA 1OXTA 3K9QO 3ZWYA 4FB5A 4F5DA 4DEYA 2A69D 5FDFA 5I4KA 3OW7A 1AUOA 1QE5A 1XRNA 3PO3G 3SHWA 2FPPB 3A9CA 3H2YA 3OWHA 4KPUA 3TSZA 3OCVA 4R1JA 1XQVA 4P9NA 1LH0A 2Q5JA 2GUWA 4JFAA 2F0VA 3ROMA 4AULA 4C6TB 8OHMA 1EY7A 3B3FA 3WQSB 3DNFA 3A1FA 1O94A 3B1ZA 5AXCA 5JYEA 1VIDA 4ZRZA 4OUKX 1QTQA 2BEJA 5DW3A 1YJXA 1HDYA 2COEA 5EKIA 2XZDA 1IRIA 4RETA 4AY3A 3SVTA 4S04A 3NMUF 2FYTA 4ZKBB 2X1MA 2PX3A 4W1PA 4C0LA 2VAMA 4M8NE 1BVRA 1XYYA 1KVUA 3PL5A 4FQ8A 4K1LA 4OGLA 2UUAB 1XZCA 5E6UB 3HVIA 4BP9A 1FJXA 1XZAA 3A58B 2ZVDA 4RJTA 3LVBA 3ZYZA 1DQSA 3IMKA 4PCVA 3HOUB 1N0IA 4ZVLA 4OP3A 5AI9A 1PLFA 4ND7A 3RSOA 1CQWA 5D3MA 5AJHA 2C04A 4MARA 4AMVA 4CN9A 5JY1A 3PFKA 4KR6A 2KCMA 2HREA 3OEEA 2AXNA 1G21A 2IYZA 3SEQA 2I5MX 2PZAA 2WAOA 3BMNB 3V1TC 2DOKA 3EHEA 5IBCA 4HRVA 1MC8A 4HMJA 2EDCA 3LF1A 1STYA 1PYGA 2I1LA 1QH0A 1HL7A 4ZOLF 2PE5A 2JIRA 3G2HA 1Q17A 3CEHA 3B8EA 3DTTA 5B4VA 4IKPA 4YNBA 2AG0A 4RK4A 3C45A 1NNI1 3EWNA 3HJGA 5FWYB 3TVDA 4V2IA 3HSYA 4K6FA 4JI8L 2ZBFA 5JPIA 1BFDA 1VL2A 3ZGZA 5AFSA 2PGJA 4H60A 3V34A 4RCNA 1Z2OX 2AOWA 5LYJF 1ONLA 4KMRA 2EJWA 3OMXA 3D3WA 4YX9A 3MMSA 3PWSA 3KOZA 3T9EA 3HCNA 2JA8G 3D8HA 1HKUA 3RHTA 1NF8A 1SNQA 3MB8A 4U2CA 4X3PA 1H2BA 1KR2A 1FMTA 2BGJA 2Y1FA 3E35A 2BH9A 1D03A 3LKZA 3ZV5A 1ZUIA 3LK7A 2HDOA 4A8HA 4G1EB 4LHXA 5CLIA 2I87A 2WG2A 2EQ5A 4DZZA 2V98A 3F7TA 1UPBA 3JAWB 4UM9D 3PJEA 4Q9AA 2X0EA 4JLUA 3GJQA 1CUXA 1RXEA 1OSNA 4JEIA 1P0PA 1U5AA 3AB8A 3OC0A 4ISCA 5TT0A 2CCZA 3PDIA 1GO2A 1JU9A 4XIYA 4XPZA 2O8VA 3QYAA 5FWDA 2PBFA 4BQIA 3NV9A 2AHOA 1JQKA 1CQFA 3NEJA 4WZAE 4X92A 1W48A 1PN3A 1QB7A 2NSLA 2OY0A 4LF4B 2QYSA 2FLWA 2F9FA 3FHOA 5DGTA 5F52A 3WIUA 1JDBC 3N39C 1VMPA 4MRRA 5LCXA 5DISB 4W8HA 2GS9A 5DCWA 3IURA 4QFDA 2C9CA 2MSKA 2DLNA 1E1NA 1U2TA 2VYNA 1EVYA 1ODFA 2VY3A 3RB8A 5CIYA 4I6GA 5H9VA 4Y6SA 2PYDA 5GZ3A 4ZVUA 1FXWF 1OIVA 1XAHA 1TVCA 4MVCA 5EIOA 1HFGA 3L0DA 2R93B 4LMRA 4W8GA 3WRXC 4GP6A 5HKLA 5FNZA 5LBIA 4LFAB 1FP2A 4Q1VA 5C1IA 5ESDA 1SNCA 2OQKA 3EGDA 4L9WA 5ALYA 4TSRA 2PUCA 4DOMA 3A1WA 1N2CA 3DZ8A 2JG3A 3W04A 4DAVA 2BIFA 3PX7A 4EABA 5DIZA 2YWRA 2BR3A 1NTRA 2VK4A 3EIXA 1ZUD1 4GQBA 4OHFA 3CPEA 6REQB 5LOVF 1LB1B 3CXCA 4XD2A 1GYPA 2WFWA 5LA6A 2CXHA 1C41A 2G8LA 2FSIA 3LF2A 4QICA 4ZEMA 5KYVA 5F64A 3PCOB 2OCEA 1R6VA 2V96A 4MV1A 4PZDA 1EWCA 4HN2A 5CHEA 4I66A 2B1QA 3MERA 5TPZD 1D1IA 3CVJA 1H05A 3WNVA 4YRDA 4AO7A 1TVEA 2A9QA 3PDUA 4HDAA 1EKXA 4KTAA 4A10A 3PHBE 2BCOA 2ZJQA 4A0RA 3KB2A 4OHWA 1M72A 1T5EA 3I6MA 3E9EA 3NONA 1O7YA 4J1TA 4NMWA 4RD2A 3AEKA 5M3FB 1QKIA 3NXKA 4H7EA 1ZMXA 5I9IA 1RI1A 1AZTA 2NGRA 2O8EB 2HHHB 1SBHA 4CPDA 1EXWA 5DHTA 3PHHA 1VSBA 3NP7A 4LFAQ 4D6XA 1VIYA 4BPRA 1ZQ1A 1JZSA 4M22A 2KQ3A 1D6SA 2G9DA 2RIRA 2H0RA 2E4VA 2ZE6A 4LK1C 1QGDA 3JPWA 1MQAA 3O0TA 3E2IA 2DNCA 2ZE5A 2I7XA 5BQ5A 3TYXA 1EFUA 1KO7A 4D0GA 3WMWA 2XCRB 3U3RA 1WEHA 1Z6HA 4XVRA 4PYRA 1MKHA 4DR6Q 1A9ZA 1R6BX 1YQUA 1W2BA 3OQ1A 3QOJA 2NV2B 3DOHA 3O8OA 5TLSA 3CUUA 3DO6A 3NHMA 3SQLA 1BE8A 1CY8A 1WE2A 2WBLC 3UM9A 3VZDA 3W4KA 3W7BA 4MO9A 1E4OA 2AMCB 2IHFA 1NCVA 2OG2A 3ANLA 4Q4JB 3DA8A 1C9DB 2BGWA 2G7MC 3EBEA 2XUFA 3IP7A 5GADl 1GTVA 1UJMA 4PLCA 3IUBA 3VC2A 5JSQA 5HUJA 2BGNA 4DHEA 2C92A 4ZYUA 3MPOA 5ELEA 2Q6OA 3QLVA 3P9QA 1ZIXA 2IW3A 3W2EA 3V1YA 2YZNA 3FYTA 4O4LA 5LDGA 4C08A 1EBFA 4HDKB 2EL9A 1DQPA 1KBOA 3OUUA 3SS7X 2IXDA 1E2DA 1WLYA 4AQ7A 1BHO1 2PUFA 5BQOA 4B4OA 1XTVA 4MV6A 3GTQB 1SB8A 3BIOA 4IFDG 2RC6A 5DYIA 2VHUA 2YJGA 3WLQA 4A1FA 2VXOA 1NMZA 3K7AH 3AOGA 4MV8A 4ON9A 3CLKA 4FOTA 1D2NA 1S96A 2W6ZA 2IQIA 5C4JB 2PNRC 3EDMA 4L74A 4JI3B 3RUPA 3TSOA 4OTZA 1YU6A 2N8NA 1ZCFA 1RM4A 2VDRB 1M2NA 1NDQA 1MC4A 1U2QA 3H3VC 3UE0A 2YOGA 2AVNA 2XOKA 1PYSB 1AVTA 2G4CA 4R68A 3CX7A 5EZQA 3T94A 1XEAA 1JH8A 4IJKA 4M1EA 2QD3A 4NAVA 5ECGC 4AM8A 3HS0C 1ZFNA 4PLWA 1ZMRA 4JI0B 1JECA 3CZ9A 3M5PA 3NC0C 1F4VA 1QFMA 2FHPA 5KWIA 1JOKA 1G8KA 5EE9A 3GUYA 1E59A 3BA1A 4K6GA 3NOQA 4X0EA 4ZT7A 4OAOA 5BN3A 2YFQA 5FYQA 5IH3A 3V4OA 2VWPA 4KXYA 2PZUA 2YXPX 4FU0A 5EXXA 4CHGA 1EZ8A 3U44B 2E89A 3V8NA 4LJAA 2ZUFA 1ZRMA 3DLPX 2F1IA 1OFGA 5CCDA 3U7HB 4L22A 2GFHA 1ZJ4A 4TMXA 4E1VA 5AVKA 3TXAA 4B35A 3GRFA 3NSWA 5HF6A 3W9UA 3R9XA 3VPHA 2L4NA 1JAHA 2YV1A 3HOXH 3NXSA 1LTLA 2W90A 4MIOA 2JA5G 2L2QA 3QNUA 4NJOA 4CMEA 1IN8A 4Q4AA 4E33A 5DI9A 2BFMA 1COWD 2ZI9A 1KK1A 1NHGA 1SCJA 4ZO7A 2VHVA 1SIWA 2D1RA 4KE6A 4U6SA 3K57A 1SYEA 1Q15A 1UBUS 2C7GA 2ZIUB 4PN3A 4NDNE 5TX7A 4R2LA 2BH8A 3RRJA 1E2FA 3RBXA 1FDOA 1DVRA 4MGHA 3TLKA 3S1MB 3UXHA 2OQ2A 2QSZA 1EIZA 1TIKA 1TKRA 1YC2A 2G0AA 3K5WA 3T15A 1Y3DE 2OZLA 4TXNA 1QX3A 1VRVA 4HNAB 1HFKA 4LF5Q 3UFXA 1WZNA 3M3DA 1KDBA 3ZVNA 2J4DA 4MTCA 5ILOA 3FPEA 4R9WA 4EB0A 2JJYA 3IB6A 2H1SA 4CL0A 3E3LA 1ZRHA 3ER0A 2QR5A 3QTTA 2W6JD 3EVDA 2QJFA 2CXNA 3RT7A 4A2PA 1A9XA 4AP9A 4YWKA 4G5OA 4XE5A 1JR0D 2OFOA 1HZ9A 2IA5A 2XEDA 4PANA 4TT3D 2G9NA 4FR0A 5JS6A 3G2NA 3HZRA 4LJLA 1NSFA 2QTFA 3K6OA 1WW8A 2C0PA 1Q83A 2YS6A 3QV2A 2XTMA 2OWEA 3I56A 3GTLH 1F12A 1H94A 2IYFA 4RIFA 2IS2A 3L79A 3ROTA 4JL6A 1TXYA 4NU8X 1AHPA 1B8OA 5GQOA 4GEGA 1PO7A 1A95A 3OFVA 1JW9B 3ETCA 4G1BA 1DEAA 3NATA 1D5ZC 1RWKA 3FCOA 4YQEA 4H1UA 4YRMA 1WU7A 4HXFB 3K4QA 3T7JA 1WETA 2NUAA 2C4TA 4P71A 2V6IA 4CEJA 1L4EA 4MV7A 5KKCA 4K3VA 3I52A 3F1KA 3CLHA 3ITEA 2E18A 3QO2A 4LF7Q 2JBAA 3GBPA 4ITRC 3RKSA 1WZUA 2QPLA 4B7UA 3ESYA 1NC1A 5DM73 3HG9A 4DTCA 3SICE 3S15B 1DI0A 1W0JA 2XB6A 1JHRA 2WUWE 3C7DB 1KE1A 3KSAC 2P7IA 3REQA 3ONEA 3HKEA 5D2CA 5DTRA 4B3CA 1K92A 1WMDA 6PFKA 3DM5A 5LUBA 4JUFA 4LY6A 1QIKA 2RIPA 3FHLA 4E09A 2IE0A 2EKPA 3TFQA 1T1GA 4WXEA 4G25A 1HZZA 4HGYA 4JITA 13PKA 4G5FA 5ELMA 2BMWA 4NNOA 3VPXA 1RJFA 1II8A 2FWRA 3RTBA 4AZ0B 3GLIA 1CZLA 2I2DA 1ACMA 2J5XA 4WN3A 4EVRA 1IDN1 1PXUA 2WJGA 4DJAA 1XALA 1K98A 1CQZA 2F1RA 4NY1A 3QTBA 1WUYA 3HCRA 3O4HA 3GFGA 3EN2A 4UHJA 3VR3D 3RZDH 2BFPA 2ZZKA 3DMRA 2QVXX 4AF7A 1RWPA 5EHIA 2D54A 5D8DA 3I4MH 1L5HB 1E9RA 1C7YA 1YTLA 2C83A 1JZTA 4KC0A 1FFAA 4LTNA 2EJTA 4KOEC 3E9IA 3STXA 2BDEA 3I9V1 1D4FA 3ZIAA 2VP6A 3K0XA 2Q1WA 2A1TS 4TLDA 1Q3HA 5AKXA 7MDHA 3DYVA 3NBIA 5E4JA 1KVQA 1TUEA 3V1KA 3K70C 1NMQA 3ZIUA 1IEXA 1VQ1A 3FXAA 3K96A 1YZQA 2Z56A 3C3KA 3WLMA 5CFQA 5AVQA 2DHEA 1J0BA 4DDWA 2PUEA 5HGJA 3SYTA 2QTBA 4MI3A 3DEPA 3IXLA 4G0OA 3D2LA 3EZ2A 2HA4A 5LPNA 4JN6B 4HS4A 1PH9A 3DE6X 1QILA 2YIMA 3HA3A 3KWMA 4OHXA 4JPBW 4GOXA 1P73A 1VL6A 4K2HA 4W5RA 5MGNA 3KYDA 4X1KA 1KDVA 3COPA 3G6EA 1RHRA 1B4DA 2XCLA 2QLJA 3ICWA 3VA5A 1QNFA 1IZZA 3ZDFA 1QAMA 4FLMA 3JZAA 1CM9A 5B53A 2YHIA 4FS8A 3UJ6A 2CBZA 2XB8A 4LRTB 4DY6A 5HDBB 5I6YA 4QYWA 4K0KL 3LSYA 3LQRA 3T7TA 2I2CA 1J2UA 2O2LD 1Q3KA 5AXBA 4RDHA 4DGQA 3RZOH 4X7RA 2A57A 3QELB 5A9TA 1GUWA 3R1IA 2X6LA 2EWWA 2J7ZA 4FOPA 4I4IA 2FKAA 3AU7A 4Y2XA 4BVLA 4U673 4JI4B 1SRUA 1IZYA 4Y2YA 3QEOA 5BQPA 2OFFA 3JQ9A 3B1VA 1JLHA 1VE5A 1JLRA 5E9QA 4KQIA 1AXGA 2G5CA 1SWVA 1SNPA 1WUKS 4HN9A 4OIFA 1PQWA 2CFOA 1PRTC 4GMGA 2WIFA 1USWA 3A6EA 3C3AA 3HDQA 4GPIB 3STYA 4HJ5A 3DV0A 1BF4A 5DGHA 3KYIB 5CG1A 1Y3BE 2WYUA 3FJOA 1CF2O 2XW6A 1WDLA 3VSCA 3J7AF 4DSOA 4CT0A 3LSTA 5CM9C 5AHWA 2FR8A 4G01B 4Q1DA 1C1DA 2AF3C 2GSWA 3B78A 4I2NA 3B5IA 4K7JA 3WWVA 1ASYA 1VSVA 2C03A 2P3LA 4BZWA 3WP0A 3KX2A 4NE2A 4U7FA 4IIXA 1SA0A 3D4PA 2WT9A 2XDYA 5LBUA 4BO8A 4FFBA 4RPKA 1S2NA 2IF2A 4YRQA 1FFYA 4BP1A 4IUCS 4L6IA 4BWVA 5CFPA 1LPAB 1OQAA 1MO2A 2QN1A 3SJAA 3HB9A 2W22A 1N5MA 1DLJA 2AF4C 3HBLA 4BMZA 1DCTA 3FUTA 4DA8A 4CEHB 3D0FA 2FN8A 1FNMA 4C2MH 1UM9B 2KS6A 2PJUA 4HYYA 4XB2A 4CMIB 1M2JA 2NNLD 2CVHA 1UWKA 4YJFB 4DU9A 3F5FA 3Q41A 1KXZA 4HGRA 2DFPA 2XWBF 3OHSX 3Q2OA 4P3KA 2JI7A 3V1MA 5IOCA 1W4RA 3WJ7A 1C50A 3S2GA 4DBLE 3AI3A 1D1KA 4D96A 2A0XA 2A9JA 4AX4A 1T91A 4WD3A 2KUMA 1J8YF 1YIDA 1W30A 2NXWA 4K9MA 2CDBA 2JLZA 3KHTA 1A1SA 3O3CA 3HFSA 1RE1A 4YGXB 1KFEB 5HRCA 4JL8A 1YRLA 2WYHA 3KEMA 3O8LA 4ITUA 1NBME 1QJ4A 2CWWA 3LXUX 4RJKA 1ZP6A 1IHUA 2H52A 1DBQA 1PU2A 2YYAA 5CT5A 3WOFA 2IPKD 1B0AA 3O47A 1RBMA 2G1AA 2QIOA 3A6DA 3GG2A 5CDGA 1D7AA 4URFA 4Q05A 3DZDA 4XLTA 4JQZA 1XHFA 3PRJA 4G65A 2ZRIA 4Z6KA 1L6RA 2GERA 1DV2A 1A9QA 2PGIA 1N9ZA 1Y7IA 3FNIA 4RV5A 3T5PA 1HPLA 1ZVJA 4QULA 1NW4A 4UE2A 2I4LA 5ELLA 4DBLC 4Q12A 3GEHA 3S2YA 1YQQA 1E92A 1M8AA 4NESA 1NW9B 4P86A 1W0KA 4ENPA 4EW1A 1DELA 4WPGA 2R1VA 4IRMA 2XWJB 1I6LA 1VHQA 1X70A 1JIQA 3QE4A 3OCUA 2AQ1B 2HL6A 2IEDA 5AHOA 1PWEA 2V4ZA 4KRXA 5K4AA 2PGLA 5BV8A 5M29A 3PA8A 5E3FA 2XVZA 1YK0A 4R8MA 4CLXA 2I4OA 4WSOA 4F2WA 3ME5A 1JLLA 2G88A 1QC5B 3H11A 3IHLA 4QYSA 4ZCMA 1DIAA 1EINA 4MQEB 2OF1A 1DZIA 4HDOB 1BOOA 1N92A 2WWGA 3I4FA 1EXNA 4C2TA 4G5HA 3R2TA 4KTVE 2BE5C 4A75A 2WTAA 1AKNA 2IV3A 3RC9A 3WHKA 3WZMA 5IABA 2B8EA 1U0HC 4KLRA 5FUXA 4BLOA 1P3JA 1U0LA 3DKIA 1OH8A 1ONSA 1C30A 2DHQA 2P3OA 5SICE 2N42A 2GAJA 2FMTA 2RGRA 1DKQA 3MELA 4LF8Q 3RTAA 3OQBA 1EFVA 1DJLA 3GJ0A