1OXTA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 95
structure length 352
sequence length 352
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxtA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxtA01
2Q6TA 2ZU0C 4DV5Q 2W58A 2DFKB 1TWAH 4R4TA 2J0VA 3AF0A 4TQAA 2QPAA 4EJSA 5C1BA 3P27A 4Q00A 5JSZB 1W0KD 4PZ6A 2QAJA 5GAEC 5C44H 4KFTA 2J46A 3CRW1 4JI7Q 4A3LG 1OFTA 1QBKC 3J7A5 3GLFA 1GUAA 1TEVA 1NG9A 1N5IA 4JLJA 1UAAA 3VR2A 2OILA 3KJHA 1K9MC 2XB4A 3DKVA 5KSPA 5DO9A 5JSZA 5C0XJ 4WW0A 1KMHB 2YINC 1N8RC 4EJSB 3GMTA 3I4LA 4MRNA 2QSYA 2AX4A 3U9SA 3U3RA 2QGZA 3VHXA 1H9SA 1KRSA 5JCPA 3TQCA 4ZCMA 3THWB 1O78A 2E2JH 3C15C 5FPTA 1QHHA 2ZI4A 3SOPA 4G1UC 5HGQA 1FMJA 1ZU4A 3OE7D 1PH3A 1W7AA 4M22A 4QOSA 1XEXB 1CRPA 3CPHA 3B60A 1N36L 1DELA 2DWQA 1UKYA 5AJZA 5ANRB 3FHWA 2HQLA 1VQ5A 3VX3A 1JBKA 3QF4A 3I3SR 3CQZH 3MWKA 4HUQA 3IQXA 2VPPA 4D4JA 2J0SA 4AC9A 3HFZB 4DV1L 1HT2E 1QVCA 3K09C 4JMPA 1BVSA 3AKCA 1X56A 2ZS8A 3N6RA 1DTSA 4WVFA 1X3EA 2Q2HA 3CCQA 2QGQA 4U02A 5IT9c 2ZRPA 1MJEA 4F4IA 3IEVA 3DVLA 3K8AA 4A9AA 4JOIC 4DKAC 1XMJA 2QN6A 3LX8A 3PENA 4CYMA 3TUZC 1LW7A 4OO1G 2ZRFA 4A3MH 4V0LA 2AHOB 1KZ7B 2JCSA 4HB3A 2JA5G 4DSUA 4TYQA 1T6NA 1ZYUA 4DCTA 2Z5FA 1N25A 1GKHA 4HAYA 5CM8B 4E5UA 3U58A 1FJGQ 3IHLA 2FNAA 1SRUA 1M1YE 4TL8A 4US0R 1SROA 2UUBQ 3I8SA 3W6OA 1KK0A 1KJZA 4W5HA 5DHAA 1U98A 5EE0A 2HIVA 1OTCA 1VKJA 3SYNA 2R44A 1J7KA 3IIKA 4LHYA 1LF0A 5BWMA 4QJFA 3UMRA 3B6YA 2FV8A 2IF0A 2QTHA 1PFSA 3GLHA 3L8YA 2HV8A 1YVDA 3SZRA 4Q18A 1XCPA 4DNIA 2HLDD 3F1ZA 2ZE7A 1YR7A 2GCOA 3SFVA 4YMTA 4KKSA 1YHBA 1AS2A 2WWXA 5F9HA 1XTKA 4ME3A 3TR0A 2R8RA 1HNWQ 1ZM7A 5AUPB 4Q4JB 1PLKA 5CDFE 1Q86C 3BRWD 3ICQB 4LOAA 1JAHA 1G21E 3VR3A 1W2BA 4JLAA 2D4HA 3RWMB 4UNNA 3CC4A 1EK0A 1E99A 3CRLC 1VG1A 4KVAA 2WJHA 1U81A 2KHIA 2WPDD 2RGDA 2BOVA 1OKKA 1UFQA 2B63H 2BM1A 2G0TA 4L5SA 4B3TQ 1CJTC 1XTQA 2GTPA 3NHBA 2NVTH 1TWHH 4ZCIA 5IF9A 2LWIA 1XF9A 3ZVNA 4OHYA 2O0JA 1JNYA 1E2JA 4A3EG 2RGBA 2ZVQX 2KENA 3THXA 4TYYA 1Z06A 4HATA 5FI0B 1Z0DA 2VYFA 4NYIQ 3AKEA 3K70C 2VL6A 2VEDA 3AVPA 3MXNB 4JLVA 2OSBA 3EPLA 1QHNA 1Q3HA 4DR2Q 5KOYA 5H1SE 1XTJA 3ASYA 2E8GA 2ZJQA 1NY4A 3I4NH 1IAQA 1W2GA 1ZIOA 2OE2A 3UATA 1BH2A 1HV8A 1KSFX 4CEJB 1E9AA 2NMVA 4RFSB 4DR2L 5IYDH 2F1JA 1H9JA 1OXVA 5EZ5A 4HR7B 3PIOA 1UM8A 3ND9A 3BG3A 5DI3B 3WBKA 4AKGA 2VSFA 4IDHA 1G7CA 4M9QA 2A69D 3GJ3A 2D74A 1CEEA 2ZE8A 1K3RA 1IOZA 2V6JA 1G3IA 1HJPA 3KF6B 1AIPA 2DWPA 1RZ3A 2ZRDA 4RG1A 2G0NA 4MGKR 1Z08A 3V9PA 2UZ3A 3U7HB 3OW7A 3CO5A 4MKHA 3T1HL 1AZTA 1SXJC 4M1TA 1EFHA 4PZLA 2D2EA 2ZJ8A 3W8NA 4ACBA 2FFAA 2RGEA 5B2ZA 4DEYA 5FPKA 2W6JA 3ZD7A 1GUTA 4G5SA 1YHAA 3Q5DA 4FMCB 2G88A 1R0XA 1PV4A 1KDTA 2MSEB 2PMDA 1E1QA 2GVZC 2ODBA 4U5XA 4B33A 3V4RA 2QY9A 1VYVA 2IY5B 4FN5A 1YU9A 1A7JA 4Z54A 3SQXA 2FPLA 3THWA 2MO1A 3QKSA 3M0EA 2EIFA 4B32A 4Q1DA 2CL6X 1GM5A 2IA5A 1Q3TA 1OKKD 2QG6A 5FI1B 4FMCF 3K0FB 2YKGA 2J9RA 5C0XH 1NL3A 2WMOB 1H9RA 3K1JA 1KL9A 1S2MA 2OCEA 3FPPA 3EWSA 2QPOA 2KA7A 2K5VA 2VF8A 4DV4Q 1PVOA 5IE8A 1TQ6A 4H02A 3PG5A 3GEEA 3QQ5A 1WE2A 3S16H 2UVQA 4B74A 4C3HH 3H2YA 3O8RA 2ZJOA 4RFSA 1VDZA 3BERA 4DCVA 5DE3A 4ASUD 2YJTD 4URYR 5EP3A 3BBPA 1VF7A 4Q1BA 4D82A 4Z1MA 1GD7A 1PZNA 3KQUA 4KFSA 1W36B 1ZNWA 4GS3A 1HZCA 3EA0A 1X1SA 2FSIA 2HXYA 4Z8YA 4D26A 2CWPA 1CFMA 3PITA 5F98A 1G5PA 4XTRA 4JVLA 2NVYH 1SHZA 3C7KA 1SKYB 3RR5A 4NZYA 3LXRA 3H0GG 3PUZA 4GLAC 4GI7A 3MUFA 1BS1A 4A3JG 1CTQA 4C2TA 3KJEA 1FP6A 3I32A 3FKIH 1SULA 1BOFA 1Q0UA 2N42A 4LFCQ 4NHOA 3EZ9A 5IHPA 4TWZA 3SBDA 2E87A 4AYBE 3EQLC 3C14C 3BB1A 5ELNA 4GKJL 1PA6A 2PI2A 2XSZA 1D7QA 4LRWA 1KAOA 4GFDA 2ZUDA 3BIFA 4KHZA 2A6HC 1DXMA 1CKOA 1QVGA 3K0AB 1XDBA 2G1JA 3K9HA 2HDNB 1LUZA 4TTPA 4CT5A 1RRPA 4X65Q 1QHIA 1W5SA 4A3GH 1FUKA 4BFVA 1E0SA 5FOWA 3PO3G 5GADC 2F4VQ 1RRFA 2BWJA 1VG8A 1T4GA 3ZJYA 3TVTA 3KKOA 4DR1L 1A63A 1W1WA 3NXSA 1RFLA 1S8FA 4TT3A 5FTKA 4EFMA 1N5JA 2IEYA 4QL3A 4V0MA 2GXQA 1X8JA 4WJ4A 4D6PA 5ELXA 3CCVA 1EFTA 2CJWB 3O8CA 3LWNA 4R71A 4JKIA 4C0AC 2X2EA 1R0ZA 2CCJA 1T0JB 2IYQA 2ZJYA 3BH0A 4Q1EA 5EXTA 2PMZE 2BA0A 5IYBH 3BOSA 4DNRB 4TLDA 2NQ2C 2CXXA 4PZYA 2CCGA 1E0JA 5D3QA 4JJKA 3TS0A 4H1UA 1EWRA 1P73A 4MUBA 2XXAA 1YZLA 2O8BB 2NO1A 3F2CA 4BLPA 4HLUC 1QHXA 2HCBA 3AGQA 3KXIA 2GCOB 4A93H 3AF3A 4URUR 3HDTA 3IIMA 4C2UA 1KC8C 4GOKA 1UBCA 1P4SA 4JI0L 3EW9A 3GLHE 1LABA 2R7ZG 3F2BA 2F1MA 1G8GA 3OZXA 1DS6A 4HAVA 2DHRA 3CZPA 4A3KG 2A5FA 4IJMA 3QIAA 2BVNA 3ASZA 4QNRA 3IQWA 5J3BA 1NJFA 2J7PD 4M9SA 3HOXH 4GP6A 5G41A 5CDFA 2Z6KA 3G71A 4HJ5A 2ZR9A 4P73A 1KIMA 1JE5A 1VQBA 1SVWA 3BB4A 3A58B 1S1MA 4DV0L 4OWXB 1SLJA 3SU8A 3R9XA 2V54A 4GLVB 3A8TA 4MITA 5FL3A 1VQLA 1Y1VG 1X6OA 3FWYA 4L5BA 1E2LA 4X8MA 1KNQA 1KK1A 4M9XA 3BDOA 3ADDA 3RS3A 2QI9C 3HOZG 1G3RA 3C41J 4LJYA 4KBFA 2WMNB 4JL6A 3ECCA 3EPKA 3P4XA 5DSZA 1J5EL 2OHFA 4WZBE 5FPHA 3K0FA 1JXMA 4DRZA 3QSYA 1GL7A 5LMNW 2AWNA 2P65A 4RZ2A 4DV0Q 2DY1A 4APVA 5AJYA 1Z2AA 2JJQA 4GOPC 3P32A 4LYAA 4TYPA 5JI2E 5KSOA 2MMGA 3X1ZA 1ANKA 1GUOA 5H70A 3J80c 1LV7A 1US8B 4AG5A 3OTOQ 1E98A 3P4YA 3CRVA 5JRJA 5TVKA 2BCJQ 5J4VA 4MRPA 5BYKA 4A4IA 621PA 4DSOA 4I4LA 4MGZR 1P60A 4X8OA 1E9FA 3X2SA 1BBWA 4PR0A 2K5NA 4YDSA 1HZAA 2B8FA 2R7ZH 1HY3A 3R9WA 1TPZA 1FTSA 1GNQA 1CSQA 3AP1A 4BEBA 1II8B 4A93G 3UDXA 2WWHA 2ZSAA 3ZJYC 3H0KA 4E07A 3PGZA 4PHGA 4BY7H 1SKYE 1E79D 2B3GA 3OIWA 1JT8A 1BKBA 1NP6A 3O8BA 1Z5ZA 5KHOC 4FDBA 2GNOA 2H7VA 2GBLC 5EP1A 2O5JC 4AYWA 1XP8A 3CW2C 4GKJQ 1UKVY 4ACAA 2G9NA 1JJ2A 3BD9A 1V9PA 1YE8A 2ZS7A 3LDAA 3PEYA 1P62B 4A6PA 2P2LA 4LV5B 3VR6A 4XD7D 3QENA 5DYGA 3WP1B 3HPQA 4QM6A 4YMWA 1X3GA 3OAAA 2IUUA 3V00A 5IT5A 1ZP6A 3U3KA 2O8DA 2RHMA 1VQ7A 1IY2A 2XNDA 3K80C 1P3JA 3B1VA 4DR1Q 3MGCA 4OL0A 1BDOA 2LXJA 3BU2A 5LD2C 1AM4D 2Q9BA 2RHDA 3MXUA 3EXAA 4QKQA 3A7LA 3QY0A 4BFXA 1NN5A 1I6VC 1Z8FA 1IYVA 4B44A 4UNRA 3G0HA 4DV6Q 3Q8XB 1SGWA 4LF6Q 4LFAL 3OESA 1OLOA 1SVSA 2A5YB 2BMDA 3REFA 2ZQ5A 4B3DA 2AKAB 2A1AA 2HIXA 1UJ2A 2QMEA 4PSVA 1XMQL 4AY2A 4JG2A 2VP5A 3QVVA 4F93B 4LW1A 3TNFA 4JLKA 1NKSA 1WBDA 2WB1G 1L2TA 3A7AB 2BE5C 4LJZC 1AE3A 1JB7A 1SQ5A 4II7A 2H17A 2YWHA 4DLYA 3A74A 4A75A 5EE5B 2GILA 5FOXA 3K70D 2YNMA 4A3JH 3IEUA 3H94A 4W5WA 4ZDKA 1NJIC 3RC8A 3LNNA 1SVKA 5CLQA 2A78A 2PI2E 5C3EG 1C0AA 1AKEA 3NBXX 4KLKA 2KCCA 4EIWA 2R6FA 3B8HA 3BZKA 1XJ0A 5EXXA 2JJ2A 5G3ZA 4GKKL 2VP6A 5CJPA 3I73A 2B63G 2Q3FA 4A3IG 3QKRB 2XOKD 3SJZA 2NO0A 1UE1A 1TADA 121PA 4DIDA 3SNHA 1VQJA 3S24A 1IXRC 1E69A 3CPJB 4HB0A 3CLVA 4NONA 4C3JH 3ZH9B 1GAJA 1GTVA 2OLJA 4F91B 4V0ME 5AJXA 2YV5A 4B47A 2WICA 1E24A 5JBQA 4OQNA 2RHSB 2J7PA 2ZM5A 4UY8C 1SXJD 2ZRHA 3UXMA 3U6BA 4A3FH 1G20E 2CLDX 3BB3A 3QF7A 3T61A 1QZXA 4IPGA 2VHUA 1FPMA 4TYNA 4DC9A 4JI5Q 4XWOA 3K7AH 2VSOA 1I94L 2PMKA 1E22A 1WOCA 1Z0IA 3QEOA 4HJAA 2B8GA 3AGPA 3NH6A 1Q57A 3EG5A 1GUGA 1GRQA 1YR9A 5EZ6B 2LSSA 1P2UA 2A6HD 2C78A 1H9KA 1E79A 5FL7D 8OHMA 1X6VA 3AV0B 3A8IE 4C30A 1N5LA 2GEDA 3GTPH 5C4XH 1FNNA 5M3MG 3CH4B 3W5OA 4UNPA 4DK1A 1ODFA 4DV3Q 2EWWA 2CHGA 3Q85A 2H5XA 2EFEB 2CNWD 4JI2L 1OFHA 1W0KA 2C8VA 2QQEA 1SVOA 2R9VA 2ZAOA 5JS8A 2WOJA 3T12A 4IO9A 5FH9A 1U90A 3OPOA 3FDIA 3K0EA 3QOFA 3T1OA 4DLTA 3CBQA 4UJ5A 1Y8OB 3UK6A 1X86B 2EYQA 5GVSA 3VNVA 3K7UC 2VQFL 1CBUA 1VQFA 5JEAH 3SDZA 2DUDA 1CIPA 2GXUA 4NCIA 2XGJA 3IFTA 3K8YA 5JJKA 4URZR 2OCBA 3KF6A 4B2PA 2NZOA 4R1JA 1AKYA 3CUEF 4PANA 3RC3A 1OH6A 4OI0A 4HAUA 1T9HA 1SXJB 1UE5A 1YZKA 4LF6L 1I4LD 4TSFD 1L2FA 3ERSX 1VTKA 1B9NA 4LF4L 4Q4LA 1TTTA 2QA4A 2FSFA 4Q1FA 5G3YA 2WWGA 1K8AC 4YWLA 4B3SL 4TL7A 3M3YH 5TV2A 4DCSA 4C4PA 3CCUA 4A3FG 2AK3A 4MDEA 2X1VA 2X2FA 1RKBA 3ONWA 5D3MB 4NCNA 2UUAQ 4IEEA 2AKWB 2E9SA 5FBQB 1NIJA 2B6HA 4JI1L 2ZYVX 1GVPA 2AXNA 3C8UA 3EBEA 3LQQA 4PX9A 4JI3Q 1KGDA 5C4JH 1QDEA 1S1CA 1VCIA 4JLPA 4YMVA 1YITA 1KDOA 1R5BA 3Q9LA 4Q1CA 3TREA 1IW7C 4BQSA 1PMRA 1G7RA 4A3CG 4JLOA 5H68A 1E9EA 3M4YA 3A6PC 1Y63A 2H18A 3JVVA 1UE6A 1GHJA 4DDWA 4U00A 1TU4A 2GVBA 2ZROA 3MJRA 4GOJA 3RSOA 3KDFB 3PV0A 4V0OA 1CJMA 2GBLA 4IOLA 4A3BG 3SBEA 4PSKA 2JE6I 1GITA 4PXAA 2GJ8A 1IM2A 1Q12A 3X1YA 1WDTA 2GEUA 1V43A 1W48A 3KJIA 4A0FA 1NVUQ 4F4CA 2MNAA 1W2HA 3HYRA 1W4BA 4GMXA 4LYHA 2ZRAA 1J2JA 1XPOA 5FR2A 1DO2A 1EFCA 3CPWA 1H9MA 4G3XA 2ZEJA 4A3CH 2VY3A 2VIIA 4OXPA 4LJ8A 4TLBA 4OI4A 3GTGH 1KK2A 1VQGA 3OF5A 3U7GA 1EFWA 5L3SB 1RL2A 3A8JE 1XD2B 2H5EA 3BC1A 4AYTA 4EQ6A 4U7DA 3RRYA 3KF8B 4ITRC 3NKVA 2GK7A 1X3FA 1G18A 1AZSC 3NE5B 1Z2CA 4H0LC 3PR1A 1XNRL 2RCNA 1I6HH 5EJEA 2AHOA 4TTQA 1M7GA 4PHTA 4BGDA 1AA9A 4BFYA 2WP8J 1CJVC 4JI2Q 1SMYC 3E9HA 4RY2A 4TTRA 4PC3A 4A82A 3GLIB 1L7VC 3HR7A 4JBYA 2Q0HA 2NIPA 2Q3MA 2VH5R 2PJZA 2ZETA 2A7QA 3LBIA 4OJKA 4C0HA 1JR6A 4I99A 4NXNL 3BS4A 5AJVB 1MO5A 3RZOH 4PAMA 2YTVA 2AFHE 2CHQA 4FINA 1FZQA 5C0XI 1N6LA 1TU3A 4W5JA 1DD2A 2ORWA 4Q9HA 1PH8A 2CK3A 3GP8A 1PLLA 2ORIA 2QM7A 2RH5A 5FUXA 4BPBA 3E5HA 4D4KA 3K0AA 4OGQC 5FOUA 3RDPA 1A2BA 1GRRA 1KI9A 3GEIA 3N2EA 1NMYA 2WJIA 1Y1WH 2GJ9A 1JQLB 4RJLA 1IXSB 1YI2A 4DCNA 5BXQC 4IFDJ 2BJWA 2GWHA 3T51B 5AJWA 1OF1A 1QVAA 4ABYA 4ZKDA 1Z29A 4DHEA 3PJRA 1X54A 1VQPA 1OHHA 4O0MA 3UDIA 3WNBA 3SQWA 1JPNA 4LNQA 1T3LA 1TF5A 4MKFA 3W90A 2H57A 4M4SA 3BXZA 2KB0A 2XSZD 3OW2A 3N2IA 5KTYA 4IJLA 1CKNB 4LF9L 3UWKA 2ZVPX 3A36A 1QRAA 1N0UA 3RS7A 2DGYA 1N6HA 2G1KA 5KPJA 2H8KA 4CEIA 4EFNA 4DK3C 2VP0A 1CS4C 1IYUA 3M6AA 4RD0A 3H1TA 4L5QA 1YR8A 3CNNA 4IVPA 2WAXA 4TMVA 3NH9A 4EQ5A 4BUJA 5J5CA 1WXQA 3CR7A 4Q21A 2JLVA 1U2RA 1XEFA 2F52A 3E0EA 2P5TB 4G5OA 2K5UA 5AUOB 1T5EA 2PPBC 3GLFB 4LSGA 2IHFA 5C3EH 1KMHA 4DR5L 1KKLA 3Q3JB 1ZBDA 3I92A 1P16A 2FEOA 4A4DA 5L3VA 4A0HA 2FH5B 3GDEA 4IHQA 4QM7A 1Z6YA 2P6NA 4PHHA 5LPNA 3FHOA 5BW8A 2XNSA 5JI3E 4RFVA 1IJEA 5KUTA 1FMLA 2O5IC 1KJYA 1QZHA 3AVYA 2JATA 1EQRA 1QHHB 1H8HD 2O0HA 2O8EB 1P72A 1DCZA 4L15A 2PNRC 2QZ4A 1ETUA 5HKKD 1U8YA 3U5ZB 3NBFA 4P4UA 4B3GA 3IO3A 3K81C 3OEEA 3EZ7A 2ZANA 4DB2A 2KCMA 5M3FG 2XJ4A 4Q48A 3BWDD 5FUWA 2OEPA 5LB2A 4DK6C 3S2DH 1GKUB 2QTVB 2EVWX 4MGYR 1H8EA 5F2EA 3SJCA 3DM3A 4X62Q 3RLOA 4PO1A 4Q7LA 4Q01A 4MDFA 2FPMA 2I5LX 4B3CA 2DYKA 4LF5Q 3H4MA 3QPWA 4TMTA 2CCKA 4OKSA 1UADA 3HJNA 1MKHA 4A3BH 4LJ9A 1SHKA 2GCNA 1P8LA 1HR0L 1E4YA 2BJVA 3VR4A 5HY6A 4JI6Q 3UDFA 1XMIA 1GUNA 2OM2A 2Z6KC 4N3NA 3WNCA 3X1WA 2HYIC 4DR7Q 2N46A 1E2GA 1RYFA 3IPXA 2XZLA 1CF4A 1JAIA 5G53C 1PUJA 1X8LA 3K0SA 4TN1A 221PA 1ZNZA 1RRGA 3UKDA 3LVRE 4KFUA 4JBXA 4LF4Q 2BC9A 3UMSA 1KNXA 4BRWA 2WWYA 3PEUA 5IYCG 3GPLA 1UKZA 1R2QA 2AUJD 2WJGA 3DM5A 3LRPA 2PEYA 3BE4A 3LD9A 4B2LA 3T5GA 4QY7A 4Y7NH 2FMXA 4DV2L 4HDOB 2ZT9C 3SHFA 1NLZA 1Z63A 2DB3A 4M53A 3FPAA 1YRAA 1YJWA 1E9RA 1YJ9A 4LI0A 3QJYA 4NYMQ 3UMFA 2RHQB 2J7KA 4LHZA 1P7CA 4FIDA 4MRRA 4PQRA 4UXIA 5HZHA 2CL7X 5KNBA 4LJAA 3S17H 1G3MA 1N32Q 1GP2A 1Q90A 1SVLA 3T15A 2EDGA 3A5UA 4DLSA 2JA7H 3W3ZB 1Q1ZA 4A3DH 3A1WA 3QVUA 1QHYA 5E3HA 2G77B 5HR5A 4PC2A 2BKUA 1Z0KA 4JZKA 4JI4L 3CW2A 4WJ3M 4JYBA 4QBFA 1I4TD 2ZJ2A 2IWRA 1XMQQ 3NBYC 4JKYA 1RE0A 3RRNA 1Q46A 1HQCA 1IBKQ 3RZDH 3QXSA 5JEEA 1G17A 2WPDA 3C4JA 3RS0A 2Z43A 1ZUHA 3PF4A 3DMDA 3N5CA 3AUXA 3ZZUA 3PUXA 4ZI3A 4PPGA 2PT5A 2OFXA 3GLHB 2K32A 4XH9B 4C0QC 1UDWA 3B13B 1C1YA 1F2TA 3TS2A 4TQ9A 4GN4B 2RGCA 2ZRCA 2UZIR 3RRZA 3AEZA 3B1YA 4YXWA 1PUIA 1PLJA 2Q3HA 1R5OA 2FOLA 2W2XA 3U61B 4CZ2A 3RN2A 1G8PA 1F3OA 4LJ6A 4HZIA 2JK8A 1N2CE 1H95A 4JI6L 2QP9X 1HNZQ 1M90C 1T3SA 2OBMA 4UKDA 2N1BA 1HURA 4CVNA 5DNYB 3GQBA 3T53B 1Q44A 1GIAA 2CNWA 1R9TH 5IWAQ 2ZRGA 4AG6A 1E9BA 2ZREA 3A0JA 2I5MX 2MSCB 3CX6A 3TRZA 4AH6A 3A1TA 4DPGA 3WRYC 1NY5A 2WOOA 3FVQA 3HU2A 3X1XA 1S72A 2DR3A 5EAYA 2UXDQ 3LW7A 4EDHA 2K14A 1EGAA 1K6MA 4R4IA 2DFNA 3AVVA 2NPFA 1XTSA 1ZJ6A 5IYCH 3HR8A 1MKYA 2C98A 2D62A 3DMNA 3CCLA 4IRUB 4C3IH 1HPCA 2A8VA 2PLFA 1MO3A 1IN4A 2G6BA 3D8BA 4E22A 2OCPA 1WYDA 4UP9A 2WJJA 4GNXC 3N70A 3T56B 2KBNA 3LNCA 2ZM6Q 3CX7A 4TT3D 1VQMA 3W1BA 1HA3A 1VHTA 3R7WA 2I1VB 1D6JA 3RLNA 3ZYCA 4DR3Q 4DV7Q 3ULPA 5GJVC 2IX3A 4XOIA 4IPCA 1K5GA 5H8WA 2OTJA 2OCAA 1OIVA 2FX3A 2BV3A 4CT4B 1S96A 2BMEA 2NOAA 4TVAB 1RW4A 4LFAQ 1KSGA 3T1VA 4Q7MB 1KO1A 1E2NA 4V0NA 5FBLB 4AQYL 5LMNQ 2GHIA 2O52A 1II8A 2OAP1 2FN4A 2GCPA 4BECA 2VP9A 2ZRJA 1NTGA 2C9CA 2R7FA 3KJPA 3CX8A 3OIUA 4B3XA 3H0GH 2YTYA 3BZCA 1X9NA 2GXAA 5DISB 1KYIA 3CONA 3BORA 4L5RC 2B21A 1NVVR 4RD2A 5JCZA 3A4NA 3ZVMA 4HIKA 2BH2A 4A3EH 4LPKA 1OXTA 2IT1A 3PO3H 3HPRA 5IK2A 1WCMH 2JA6G 2L0XA 3EWAA 2N78A 4R4CA 4KKUA 1XPUA 2AK2A 2GKSA 1IBML 1F48A 3I2ZA 1YBYA 3LGJA 1YVCA 4DCUA 1E1RA 4X6AH 5LMUL 4NP6A 4Y52H 3QUSA 3PEWA 2AFIE 2WWFA 4HJ9A 3AFQA 4UPAA 1D8TA 2JA8G 3RHFA 3H86A 3THYA 2Z4RA 4JLBA 3D31A 2W6IA 2ZRLA 5BN3A 3CF2A 3LO5A 2XTNA 3QXHA 1KAWA 2J41A 4M1SA 4A8JB 2IYRA 3DXJC 1GKYA 3WDNA 5DHFA 3S1AA 3U44B 2AL7A 2FGKA 2JA9A 4HLUA 5C0XG 4YDHB 3TK1A 2ZYTX 1XU4A 5DYIA 3UG6A 3I5XA 1C9OA 2BHRA 4KAXA 3AB3A 3U3JA 3RNUA 3HOWG 2HHHQ 2B92A 4B3RL 1ZYRC 1M7HA 3AF1A 3KXKA 3L0IB 3LA6A 3MLEA 1WCMG 2JA6H 4BWYA 4DBLC 3KJGA 5FPYA 2CBZA 2R93G 4FWTA 4OYHA 4P4TA 5CK4A 2E74C 3DOEA 4QGFA 2OO7A 1D5CA 2IXGA 4LF5L 1S40A 4LF8Q 4PPNA 3GJ4A 3OEHD 2C77A 4I1SA 3OFNA 5CB6A 2K5HA 2JIZA 2VP4A 3WY9A 4ZIRA 5IYBG 4K81B 4PO8A 3C16C 3AB9A 3GJ8A 3JAMc 2F3TA 4GZMA 4I7ZC 3ZVLA 1DPFA 4QGUA 1U0JA 4LPSA 3THXB 5IP7G 2CE2X 1N6KA 2XOKA 5C4GB 4KJZA 2GN5A 4KO8A 5FOVA 3IDQA 3DO6A 4TMXA 1G8YA 1TWCH 3T1HQ 2OFWA 3MWYW 1C7YA 2K33A 1CU1A 2QQ0A 1VCOA 1NBME 1JJCB 1EWIA 3ER0A 2C9YA 3WP0A 2ERYA 1Y1WG 5M5YH 3NC0C 1B0UA 1G19A 5DN6A 1VQ4A 2L15A 4A76A 5FTJA 3KDFA 1KI4A 4P32A 4NYIR 5KYKA 1NF3A 3TAHA 5JHHB 4XTCS 3LY5A 3KFXA 2MMCA 2RGGA 2LMCB 1FQJA 2DNEA 4P74A 2J0UB 4MKGA 4NCKA 2N49A 3A4LA 2XTIA 4PZ7A 2IS4A 2O8FA 1S3SA 3PEVA 4D80A 4P31A 2C95A 4KN7C 1PHJA 2ZITA 2R65A 3NHAA 2QF7A 1QUQA 4A3IH 2FU5C 1ZINA 4YLGA 1YRBA 5E4FA 4FCVA 3L43A 3FKIG 2G3YA 4DV4L 1FOEB 1U9IC 2J3EA 4M1WA 4C0JA 1ZCAA 1XEXA 1Q8KA 1CJKC 1JQJC 1M34E 3GCGA 4LV6A 2AD1A 4P0TA 4AWXA 2GK6A 4BA1I 4B3BA 3VDYA 3LBNA 4EPXA 2XB2A 1NG1A 1QF9A 1XRJA 2RF4A 1KI1A 3MRSA 4JT4A 4DV2Q 5IP7H 3THOA 4N1AA 1ELOA 4KLNA 1J8MF 1NRJB 3OIYA 2A3RA 2J59A 4AKIA 1CR0A 3E9IA 2FFQA 2X8AA 1E9SA 1EFUA 2VSXA 1I94Q 1N6OA 4MA4A 4UNQA 4WZAE 5E7IA 5FBRB 5K36H 1B70B 1IN8A 3CPEA 1XB2A 4RMFA 4JI8Q 1UEIA 3SS8A 4B76A 2G83A 5C4XG 4US2R 2CFMA 3U4QB 4PHFA 1PH9A 3ZS8A 1GILA 3D6TB 4I1OA 2A9KA 1E2VA 1K5DA 1B8AA 1XMOL 2Y0SE 4K0KL 2FEMA 3WMFA 4OHWA 3F8TA 4YCUA 4BBSG 3RLFA 3OFND 1MR3F 3SJAA 3JC66 1B23P 2GETA 5CIWA 2DPXA 1ASYA 1ONLA 4GN3B 3GTQH 1FP7A 1KHTA 1ZMXA 2IYYA 5D3MA 4A15A 1V8QA 1GKIA 1PH4A 2J0QA 1AJEA 2GF0A 4H9GA 2DCUA 4EFLA 3D3QA 4CDGA 2AR7A 2BBOA 1Z7TA 2D2FA 4UQOA 2A5JA 4BY1H 1IHUA 1N6IA 2GXSA 2HXSA 5G40A 1M74A 3LW8A 4X66L 4DUZQ 4RCZA 4A2WA 1DAHA 2VZAA 1Q22A 4HIMA 3VX4A 2OWOA 2IS1A 4Q19A 1JEEA 1XD9A 3CKLA 2IW3A 4B3FX 4CIDA 2W2TA 4FCWA 4HLDA 1TNDA 4P33A 3QBTA 4DV3L 1JJ7A 2O8BA 1AGPA 1G64A 2QBYA 4YXWD 3ZGXA 1E3MA 3QKRA 3NEYA 3M4PA 1E0KA 3CRMA 2A68D 3SFZA 1MABB 4F4JA 3B1WA 4Z1MD 1VQ6A 3AFPA 1E2FA 1G6OA 4HAWA 4NKRA 4A3MG 2IC5A 4DV6L 1TQ2A 4ASUA 4C0SA 2B7BA 1NNEA 2K4KA 4LF8L 4TL9A 1NKTA 2J87A 4IDOA 1WFQA 4NL4H 5C4MA 4LBZA 1QVFA 2ZM6L 4DR6Q 1GG2A 1KZGB 2VQSA 1MH1A 4O2RA 4URXR 3EZ6A 1XMOQ 4K0KQ 3MJHA 2GJAA 2O0KA 3L0SA 3HOUH 3F5FA 1SZPA 4TKOB 4POAA 3X1DA 4D25A 2PBRA 3WXMA 1VQCA 2RGXA 1E6CA 3J81j 4BASA 3M4QA 3I4OA 1N34Q 2NO7A 1G1MA 2KBFA 2OLKA 3AKDA 4HEJA 1J6QA 2REXB 2CHVA 4AI6A 4IFDH 1YZQA 4GT1A 4NYJQ 1OFUX 1LF5A 4PQYA 5JS7A 3CCRA 4KN4C 4D2IA 3ZZTA 3PCOB 1YIJA 4JVNA 3UWOA 6Q21A 1UWVA 2HYDA 3RWOA 3WMEA 1KQSA 4KCGA 4AK9A 1KAGA 1OB2A 4R98A 3PCRB 3CWZA 4LHVA 1MRNA 1Z6TA 1JECA 1IBMQ 1HYQA 3GJ0A 4LV8B 2A69C 2ZYUX 1KI7A 4PMWA 2V1UA 4JVSB 2R6AA 4KSCA 4PFSA 1A4RA 2YOGA 1EQQA 2F43A 4L4UA 1KO5A 4MRVA 3VKWA 4XVUA 3OIVA 1B9MA 2MSDB 5KO2A 4DV1Q 1JB1A 4W7SA 1FFHA 4P4SA 1OT3A 1N0WA 3FMIA 5JEAG 1XTIA 2P67A 2JASA 3EIQA 2V3CC 1XBTA 3E2IA 1W47A 3W5JA 1NN1A 2EYUA 2YYZA 1U0HC 2BMFA 4MQBA 3S1RH 2JA5H 2V9PA 4M21A 5A4JA 2QUZA 2V7QA 4TSFA 1SN8A 1LACA 5L3QA 1IN5A 1OH5A 3TQYA 1PH1A 4WAUA 3GD7A 3W1GA 4RZUA 2GF9A 2ZTDA 1TL7C 1GSIA 4QBGB 2I5HA 2NZJA 2RKOA 4NCHA 5TDHA 2R93H 1E96A 5IK2D 1DE0A 3UE1A 2YOFA 4HJ7A 4LGMA 3I4MG 1AK2A 3I7FA 2OFOA 1NBMA 3QPVA 4LYFA 2V7QD 4OJQA 3KKPA 1H8HA 1AH9A 2KCTA 2JIZD 4EPTA 1E3PA 4JK1C 3HOYH 2UUCL 1YZTA 3QKSB 5JWRA 4YCVA 4MZ9A 1ZIPA 4LUOA 1E2HA 1ZNXA 1DARA 1XXHA 2ZI3A 4M1MA 5KNCA 2A5DA 3FMOB 3ZQ6A 5B58C 1R8SA 3D7MA 4RD3A 4AKHA 2O5VA 1FNMA 1VPLA 4JBJA 1QVRA 3IRBA 2IYVA 4M1OA 1F6BA 4Q4AA 2GVAA 3MFYA 2J1LA 5AK0A 1XJCA 4M1YA 4X8HA 2AMCB 3A1SA 2P0EA 4JI5L 3BJIC 2ZI5A 2JLWA 2WV9A 3GO5A 1Y1VH 4J15A 2R92G 1KO8A 2QNRA 4A3GG 3IO5A 3UANA 3AP3A 1AQUA 3RRMA 4DR7L 4LHWA 1SXJE 1WP9A 3DLLA 2IL1A 2OT3B 4LWZA 4OHZA 1VQKA 1KXLA 4RD6A 5EUMA 4DT1B 4ZO4A 2B7CA 1MRSA 5DI3A 2K52A 3TH5A 5C2JB 2WAQE 4GBMA 4A2QA 3VMFA 1P2SA 2LCFA 1Q20A 1G3UA 3K53A 4Q9LA 2GESA 1FJGL 4BBRG 1Z0JA 4NPHA 3ZDQA 3U7FB 4TZ6A 4MGIR 3FMPB 3ICEA 1G9XA 4BBSH 4IFDI 2VO1A 4GNKA 3TSWA 2ASEA 3TIFA 4DDTA 2QSZA 3SJBA 2HJGA 4QBIA 2NZHA 2EWVA 4AKEA 2QE7A 1J70A 2W83A 3EPHA 1RIFA 1EIFA 4FCTA 4OQLA 3KDSE 4OX9L 2C2HA 2DWOA 1YZ6A 4DR4L 5DLQC 1WRBA 1ZU5A 2X19A 2FFBA 3CRKC 1Z0FA 1VMAA 1S0UA 2LXKA 4Q47A 3H3VI 3U3OA 4I1UA 2Z0SA 2QROA 3EPJA 5JEDA 4QHTA 5F9FA 4HB2A 2PX3A 4IFBA 1FX0A 2KHJA 1E32A 4HIOA 3AP2A 3UPUA 4B6FA 4H44C 1PH7A 2SHKA 3JZAA 1IY1A 2VNUD 4BBRH 1S9DA 2ZTSA 1W4CA 2OAQ1 1XWIA 4MNOA 3LQRA 3LAWA 4FW9A 5P21A 4BFSA 2D2CC 4GOPA 1IW7D 4OWTB 4YHHL 2ZR7A 3GJ6A 3VAAA 4C2MH 1DAIA 2ZTCA 3KZ1E 5C18A 4QGAA 4KHPQ 2C5LA 4DSNA 3PUYA 3AVOA 2JDID 3J7ZC 4Q66C 3MSXA 4M1KA 5HCNA 3W3AA 3WYAA 5GADl 2YC4C 4WIAA 4ZDIA 3K70B 2QP3A 3TZUA 2C99A 1E0AA 4GNXA 2DFLA 4EKDA 1JALA 1TKWB 2PNHA 2JDIA 4MRSA 4BZPA 2O8FB 3GTKH 2K7VA 3TEHB 1GL9B 3GFOA 5CYOA 3WHKA 1OIXA 3HU1A 5B30A 1BBUA 4JYCA 2ODEA 3TR5A 4G5RA 4NXMQ 4TQUS 1LNZA 3VFDA 3CC7A 1TUIA 3G6EA 1E4VA 4ZKEA 4JSTA 3B85A 1G8HA 3BFVA 3MD0A 4N0DA 1V5WA 1NN0A 421PA 5HZKA 4BZQA 4OQXA 1GNRA 1E1OA 3RN5A 1LTLA 1ZD1A 1P2TA 2OXRA 5IP9H 1ZW6A 4P4SB 3QPUA 1NI3A 1E2IA 2GZHA 1HH4A 4BXXG 2A19A 1GL6A 2FA9A 2UXBQ 5J4LA 4OONA 2F9MA 3PF5A 3WYGA 3M4OH 3KYHC 4LFBL 3MWLA 4JBWA 3MEFA 3FP9A 2GZDA 4GOXA 4DDVA 3NEJA 2OBLA 3ULLA 2VW9A 2IUTA 4LHXA 2RAPA 4BLSA 4L9WA 1G6HA 2A30A 1L0WA 1NY6A 2NVXH 2ZXUA 2VUMG 4NH0A 1LY1A 2A68C 2WIAA 4W9MC 2WAYA 4X62L 1QG2A 3I5YA 2BBTA 2Q9CA 3G4SA 1EFRD 4HZUB 3KLWA 3TJZA 4Q9KA 3KQLA 3TAUA 1H9SB 1UEBA 4JOIA 2RB4A 5EE3A 5LD2B 2W0MA 2GJSA 3S14H 3DM9B 5A0FA 4URWR 4OQFA 2YHSA 1LTQA 3KKNA 4Q4HB 2ZJRA 3W8RA 1UBFA 4JS0A 1TEXA 2F9LA 2VHCA 2N8NA 3BAFA 3S2HH 2IYXA 1XZPA 1K0RA 3THYB 1XD8A 3HOXG 3H3VH 4NPSA 3NELA 1FVIA 2QEXA 1QZGA 2Q2UA 4DR4Q 3S1QH 2NGRA 2QU8A 3DZDA 3G5UA 3QF4B 1FGUA 4Q7KA 4YMSA 4B3TL 1KMQA 3GJ7A 3IIJA 3FGNA 3B82A 4BE7B 4DSTA 4ESHA 3RS4A 4P71A 1WA5A 1MOZA 2OV2A 2O8EA 1VQAA 3VQTA 2CCZA 1MO6A 4ZPXA 3OHMA 2N3SA 3OAAD 2ASBA 2YZ2A 3TRFA 4XSHA 4AURA 5HPYB 5FJ8H 5C46F 4GDFA 1Z07A 3EASA 2MQHA 5FOTA 3KUDA 4R2IA 1K73C 1NMFA 3M1IA 1XX6A 1W44A 1G291 1I50H 2HLDA 4XVQA 2IS6A 3NG1A 4M8NE 521PA 2XZOA 1E94E 2KI5A 1RVDA 4URVR 3VR1A 4A8JA 5GVRA 4QQBX 1HQYE 4KXFB 4E09A 3OOCA 4RD1A 1BYIA 4ZCLA 4DAYB 4NMMA 3WNDA 1ZUIA 4G0NA 4JCVE 2JLXA 5CB8A 4YY3Q 1XXHE 3L7ZC 4BFZA 2CE7A 1KD1C 4GZLA 2Q8IB 1A82A 1W4AA 1NSTA 1ZD8A 1DO0A 2IUSA 4LF7Q 2Q21A 4QJ5A 5EP2A 5FBVB 2R92H 1VG0B 4IQZA 2ORVA 5SZKB 5IWAL 1E2PA 2UUCQ 1HEIA 1R4AA 3RAPR 2F55A 4YWMA 3HWSA 3IUYA 3I72A 5DIFA 3CRRA 1WJJA 1SXJA 3HOVG 5EE1A 3SR0A 2HHHL 2BDTA 1F5NA 1KI2A 2GVDC 4LUCA 4YQFA 1TWFH 1JJGA 1K83H 3RABA 4NU0A 1VQ8A 2FE4A 2WKPA 1P2VA 4QJ3A 2CVFA 3L0PA 1LS1A 2BIFA 3TUJC 4KLZA 1UF9A 1FQKA 5TXGA 2IS2A 1U0LA 1HUQA 1A1VA 2ZI6A 3VKGA 4S35A 1IYJB 1RIPA 1KDPA 3U2QA 2TMKA 1IXZA 1IXRA 2OTLA 1KI8A 3Q7PA 3CNLA 4E03A 4DR3L 4A3LH 1PYBA 1IBLQ 4HDCA 2EFGA 1W49A 1CUKA 4F92B 5GQOA 2GDJA 1Q1BA 2WVJA 4OO1I 4JI4Q 4IDPA 2ECKA 2R6CA 4Q7JB 3B5JA 4KITB 3SE0A 3VNUA 4AD8A 1OHHD 1XCMA 3VU9A 3B7GA 2BEKA 5FUVA 4YONB 4YWKA 1GWNA 1CKEA 2JEOA 1W0JA 5JWHA 3HU3A 4D0GA 1WQ1R 2KSQA 1E2DA 1WBBA 4B75A 1L1OB 4EPRA 2WTUA 1Q21A 4D0LB 4IXNA 5E7MA 2BDOA 1G4AE 3KQHA 5BN4A 2CDNA 3A4MA 3LH5A 4DIEA 721PA 2FFHA 3QG1A 3NVAA 1X8KA 3B2EA 3K0CC 2KE5A 4CF7A 5LB4A 4PV1C 1K8RA 1Z0AA 3FFBA 1D8LA 1Z9FA 1KSJA 5J47A 2P6RA 2ZS9A 4R2HA 1DOAA 5HE8A 1L1OA 3BJUA 1I3QH 4BA2I 4IFDG 2HF8A 1XEWY 5JLJA 1DAFA 4DR6L 1DAGA 2F4VL 4JI7L 3BH7A 5EP4A 3W6PA 4C0LA 3MMPA 1R7RA 4BRUA 1TMKA 2E1RA 3NDBB 1EUJA 1ZVQA 2CLCX 4QBHA 4R7ZA 1YZNA 4LC0A 1SVIA 2WFWA 2QMHA 1X55A 2D06A 2PCJA 4RSGA 1ZRHA 3FB4A 1EWQA 3QBVA 5AUQA 3A8KE 1IBKL 5IP9G 1JJVA 4WZ6A 2GJKA 4I81A 4IOAA 3J80i 1NE3A 4UJ3A 2QE7D 3LVQE 4Q9JA 2RGNC 4A3KH 2JA7G 3J81k 1DG3A 1HNZL 1VIAA 1XD2A 1EXMA 3DHWC 2IK8A 2LKDA 2QORA 4HLQB 2C35B 3SYLA 1H65A 4LX0A 5DGXA 4DLWA 3F2DA 4IVRA 5AWFC 2V1CC 2W2VA 2F1RA 4D81A 1KRTA 3S1AB 1GO3E 4JLDA 1RJ9B 1Z6AA 4QJ4A 4DAMA 3FFAA 1T8UA 3QKTA 1S3GA 3QXXA 4FXPA 2VQEL 2B8TA 4DWJA 1U8ZA 4JBKA 3DL0A 1KOFA 4V0KA 2AWOA 3GTLH 1YQTA 2ANCA 4PQFA 4HJ8A 3PO2H 4Z8XA 3S1MH 1O87A 3DPUA 3TE6A 2PJRA 2QM8A 1EESA 3HOWH 4LYJA 1ONBA 2R6DA 2XX3A 2ZJZA 5AJ3Q 3CR8A 4IW3B 4I1VA 1JR3D 4IOJA 2FZ4A 3CCMA 2O8CA 2J5XA 1OYYA 2HUPA 5FLMH 3H84A 2P3SA 5LDDC 4QNMA 2YWFA 4OO1H 2IYLD 4QG7A 3GTOH 4C3ZA 1MV5A 3SN6A 5GJBA 1T8TA 3ZD6A 2XZPA 2ZIAA 3B1ZA 2ODWA 1KO7A 2AN9A 5M5WH 2JA8H 1WCV1 3R20A 4RVCA 1ZKOA 5BN5A 1E1RD 1HNXL 1GOTA 3FHCB 3IHWA 4QIWE 1BMFD 3M7NA 2K50A 2OXCA 1YKSA 2NN6H 1E9DA 1XMVA 2QAGB 3AH8A 3EIHA 1XTRA 4HUQB 3FOZA 3WYFA 2VHTA 4TZ0A 1EYGA 4HIDA 1VG9B 2GZAA 2E76C 1R0WA 2BH8A 2VTKA 4OHVA 2H16A 2BBWA 4LY6A 5FTNA 1GUSA 3LFUA 1BIFA 5L8VA 1NMZA 2VHJA 4PZ8A 1E2WA 1CJUC 2EFHB 2EJFC 4JLNA 1AQYA 2QMUA 1KIXA 3ZLJA 4K8OA 2WBLC 1ZM4A 2QMOA 4PTLA 1P9RA 1YHNA 2IBMA 4OI2A 3SEAA 1A6XA 4B34A 5JMTA 2YWEA 5JJLA 3HKZG 1D9XA 2R2AA 3T35A 1VQNA 1NVXQ 3ZQJA 4F7WA 2IHYA 3U4QA 2YOHA 3HP1A 4NCJA 4DLZA 4D4MA 4GPTA 4JI8L 3B9QA 3DDCA 2JLZA 1G8FA 3NIBA 3HKZE 1S9HA 1OXXK 2CEAA 1Q1QA 3F3YA 1W46A 5KNDA 2ATWA 3QG5A 5SZIA 2EFDB 3A5ZB 4JV5Q 1P61B 1VYTA 1WI5A 4M9ZA 4PC1A 4YHHQ 2OUKA 2WSMA 4TL6A 3J81c 5A5GA 4KFRA 2ZRMA 3ZIAA 4GRAA 5LMUQ 2I4IA 2QTFA 4IVQA 1G51A 1M6NA 1XMSA 3EN2A 4EUNA 3ZIAD 3EARA 3FKQA 1DAEA 4MYTA 4LJ7A 2P6UA 1DEKA 2IX1A 4HZUA 1N5KA 1E2EA 3WRXC 4LC1A 3KKMA 3KB2A 3RS5A 1II9A 4LUVA 2E75C 3EIVA 1CR2A 4N0EA 2F1IA 1XJQA 2ZAMA 4LWCA 4OX9Q 4GSYA 5DLQE 3VHLB 1PH2A 5IY0A 2D7DA 4X66Q 2PCFB 2JAQA 2JEAI 1K8OA 3U50C 2FXQA 4MYHA 3HYTA 1IJFA 1W3SA 1F2TB 1QUQB 1Z22A 3AVUA 4AQYQ 3AVXA 4EAQA 1FUUA 4B35A 4KKTA 4GNXB 1N36Q 3GTMH 2W00A 1I4DD 1ZM3A 1N6RA 3JVUA 1M8PA 4ILEA 4AYBG 5JJIA 1E1TA 4GL2A 2PH1A 3A1VA 2XEXA 1W4RA 5M04A 3OE7A 3GLIA 1EWHA 5LBIA 4BFTA 2DBYA 2JJ1A 1K8GA 1KO4A 1T0HB 2V1XA 2BMJA 3KTAB 4GOPB 2ZJAA 3WWVA 1IBRA 5L3SA 5J4KA 4NE2A 3A37A 5GROA 1T3HA 2GA8A 4A0GA 1HR0Q 3ADCA 2PLRA 1G7SA 4NDZA 3KQNA 2B29A 1D2MA 2ZRIA 1VQ9A 1FL0A 1Z28A 2XITA 1FYCA 2RGAA 2D5DA 4Q9IA 3OTOL 2EVBA 4IPDA 2FG5A 4DXAA 4R9UC 3CNOA 2OG2A 2UU9L 1HE8B 3RNLA 2IX0A 4QL5A 2WM9B 5EE9A 5H1YA 1HNWL 4NXML 3EZFA 1RPZA 2VBCA 4YY3L 3LLUA 4OK3A 1YZGA 5CK5A 5BYJA 4BY1G 5A35A 2ZU6A 4O2DA 5HKKA 1HH2P 4ESVA 3NDPA 3S15H 3CRQA 2QBYB 4XVRA 4IJHA 4JI1Q 4KSBA 4US1R 4A36A 4EX5A 2HCJB 2WHXA 2F3RA 5CLLA 2IWHA 1N3BA 1HQMC 4XWKA 5DH9A 2CQOA 2BE5D 3ADBA 1AN0A 4EQ6B 1OXSC 2UXCL 1N0VC 2C96A 5B64A 1HZBA 1IN6A 1E7ZA 4KMUC 3PSIA 4NB3A 2IHBA 1O7LA 3MWJA 1ASZA 1QG4A 2IYUA 1VIYA 1E2ZA 4PAQA 3T34A 3PUWA 2Y0SG 1E9CA 4KHPL 2ZRNA 4V03A 4QGHA 3A1UA 1N6NA 2EJGC 2Z4SA 4KI0A 3L2PA 4BY7G 1TXYA 2BBSA 4ARZB 3PUVA 3B78A 1NN3A 3GJXC 4CEIB 4HI0E 1WMSA 2JJ8A 2W6JD 4ERNA 2AKYA 1P75A 2CJWA 2QP4A 1OH7A 3VKHA 1NBWA 4Q1AA 4KYIB 1E2KA 1EX7A 3VA7A 2PCLA 2WSSD 4IOKA 1XXHB 2FGJA 5BR8L 3CC2A 2QT0A 2E2HH 4FMDB 4IDQA 5JZVA 1NLYA 3J81i 3TQFA 4LF9Q 3NTUA 1OXUA 1KTVA 4DLUA 2C9OA 3EA5A 4CRWB 2QRNA 3S1NH 1R8QA 4HLCA 1CRQA 1JXOA 3TKLA 4LUZA 1NLFA 1G4UR 3IILA 4MKIA 4HAXA 2KWIA 1R10A 4R4QA 1Y69U 5GAHC 1HZ9A 5C44G 4NBSA 3KXLA 3GJ5A 4BLRA 3HKSA 2LKCA 1JI0A 4MYCA 4EJSC 3CPFA 3DOFA 4OHXA 4Q4HA 3RYTC 4GLXA 3AQQA 2J45A 3TW4A 4PSAA 4CEHB 2FWRA 5M5XH 1XNJA 1OPXA 3VTKA 1CULC 2F3IA 2PL3A 4BEJA 4QHYA 1EFRA 4UNSA 3STBC 4Q4AB 2IXEA 3HOZH 1CXZA 2FSHA 2QA5A 3ND8A 4XJXA 5FFMA 3T06B 821PA 1VECA 1B7YB 4B3RQ 1VQIA 4LFBQ 3GFPA 1EIYB 3CMEA 2VP2A 2VHQA 1U5KA 1U94A 5TY0A 1JR3E 3CIOA 4B3SQ 1YNXA 3H15A 1NVVQ 3JZMA 1TU2B 1KY2A 5KDLA 4DKXA 4GKKQ 4MTNA 5EUQB 3IBGA 1NJGA 4TMKA 1NMGA 2DN8A 2XNDD 2Y8EA 5CM9C 2JXMB 2ZUCA 1VS0A 2UU9Q 1D9ZA 4DV5L 1VQOA 4DUGD 2VS1A 1XCGB 4RKEA 4Y0VA 4WXPA 4X8LA 4XD7A 2ZJ5A 2QT1A 1T91A 1Z83A 1HT1E 4TLCA 3ZS9A 2W0SA 2ZJPA 4D4LA 2B8WA 1YJ5A 1G5RA 5L3QB 3I1FA 5FR1A 5CIQA 3AEVA 1UDXA 2EW1A 2WSSA 2UUAL 4G01B 4ON9A 1CLUA 1E2MA 4KU4A 5K8IA 2IEZA 1Z6XA 2WJVA 1FR3A 1OE0A 4HDQB 2EQSA 4G7ZC 3FMFA 4JL8A 2L5TA 4UP7A 3NWJA 4X65L 1MIUA 1A0IA 2X77A 3GLGE 1CR1A 3BH6A 2R6GA 3AF2A 3CWQA 2MO0A 5GAGC 2CW0C 3AUYA 1SVMA 4C0BA 1VYUA 1TX4B 3IPYA 4LDJA 4WOPA 4TYWA 1YNJC 2AD5A 1Z6HA 1ZAKA 2HEIA 1OB5A 4A6XA 2V4DA 1D2EA 2MFIA 1XJVA 4LZZA 3U7EB 1AE2A 1COWA 2J0UA 5CJ2A 2XTMA 2VQFQ 3T1QA 1L4UA 4IDNA 2R62A 2PZEA 5EXSA 1L8QA 1C9KA 1QHSA 3CMAA 1DGSA 1A5TA 3CCSA 5HE9A 3O47A 3K0XA 5FOSA 4UP8A 2R7DA 4Q4JA 5JEAJ 1N32L 1YJNA 2UXBL 1XPRA 2ZUBA 3FYHA 1IQPA 4OBEA 4ALPA 3IBYA 1UEJA 1ZM9A 1M2OB 1L4YA 3HOUG 1UBEA 1ZC4A 3BK7A 3LLMA 3Q7QA 3UE0A 3BGWA 4LF7L 1LYLA 4KV9A 2O8DB 4KBGA 3K9GA 2CL0X 4WA7A 2EQBA 1S3OA 2HT6A 5JWOA 1W36C 3GLIE 1OFIA 4B6EA 4XWAA 1XZQA 5AUNB 2ZRKA 5KSYA 1AS0A 4PPFA 3B9PA 3RSLA 1N34L 2IYTA 3AQ4A 2ZSEA 3KFVA 2NG1A 2PQAA 3ETLA 1U8AA 4G5GA 3L0OA 4O25A 1MO4A 4DB4A 2JLQA 3EC2A 4C7OB 4DUYQ 3HGBA 3QE0A 1XNQQ 2D3WA 4IEIA 4KODA 4PC7A 2OBNA 5HTKA 4WXRA 5KPDA 3PVSA 2ZE6A 4HSEA 1GHKA 2JLRA 3AVQA 3F0TA 3L8ZA 4FWIB 4NTZA 4PAOA 2HJVA 3EC1A 3C5HA 2BKEA 1Z3IX 1UBGA 3K0CA 2REOA 4QC2A 5M3FH 3TBKA 4TLEA 2V6IA 4POGA 1GNPA 2VLIA 4L8JA 1XFAA 1R5NA 2ZE5A 4NXNQ 3L82B 4UXHA 1VF5C 3UG7A 1G6PA 3KFUA 3LWUA 2C03A 5UKDA 3W9YA 5J4HA 1W0JD 4A92A 2ANBA 2Z0MA 4JIMA 1J5EQ 3R7WB 1W5TA 2VF7A 3EZ2A 1YEZA 1FTNA 2JA1A 4ZI2A 1JMCA 2C04A 4JVMA 1US8A 1YNNC 5L3RA 2H92A 4POFA 3I61A 4GZYC 1XNRQ 2VL7A 3KL4A 4ARZA 4PC6A 1HTPA 2YC2C 4MH0R 5FUYA 4EPWA 1BO6A 2QRZA 1QJOA 4FI3C 4A1FA 3TGPA 2EFCB 5IRCD 2UKDA 2BA1A 4B73A 3TMKA 4XIGS 2QPTA 1OSNA 1XTDA 2QAGC 1KDRA 1JPJA 3KJOA 4IPHA 1SR3A 1F2UA 1NBMD 1WF3A 3CP0A 4DR5Q 3GTJH 2ZSBA 3FKSD 3IGFA 4BFWA 1LS6A 3M85A 2CLSA 2CKZB 4HAZA 4ZDWA 3AF4A 4RD4A 4OWWB 2Q2TA 1AGRA 1MT0A 3QXCA 4RKFA 3SI7A 4OQMA 3W6NA 1IZ6A 2WAQG 1R6BX 2PX0A 1Q81C 2XJ9A 4D0NA 2UXCQ 3HOYG 3M9BA 2WZQA 1K8MA 1GRNA 1Z6GA 2GAOA 4G5QA 3PIPA 2NTYC 5TMPA 1H8ED 4ZDJA 1XNQL 3KB1A 2DNCA 1VCMA 3BFKA 1ZD9A 2ONKA 2RGNA 4C0KA 4BXXH 2VRWA 4P72A 4LJ4A 3T1YQ 1LM0A 2UUBL 1DADA 1Q7YC 2FF7A 4IOCA 3MAAC 5CITA 1PH6A 4DUGA 3PFIA 4A3DG 1N33Q 4B3MQ 1QHGA 2PQAB 3SC3A 2EXDA 4DVGA 1FW6A 1HTWA 2AXPA 1VHLA 3CB4A 4PG3A 2V8OA 3W34A 2ATXA 1BKDR 1P9NA 1TF7A 3E70C 3Q72A 4H1VA 1T5LA 4IOMA 4O2LA 2JEBI 5FTLA 3MCAA 1RC8A 2ZI9A 2GRJA 4B3ML 1N33L 1F60A 1HE1C 1KK3A 3U60B 5CYPA 2ZYWX 2NVQH 1ZC3A 1KJWA 2I3BA 1UKEA 1CTMA 3LV8A 3EAQA 4RCNA 3TSZA 4O0AA 4B2IA 4B48A 1P5ZB 1RYHA 2F1HA 3GLGB 3I62A 5FJ8G 4JT2A 4ZV4A 1G16A 1L1OC 2JQOA 1G5TA 4QGGA 2ZR0A 5E7JA 2ONJA 3U44A 2A6ED 2ID0A 3CF5A 2ZJBA 1IONA 1TWGH 1M1KC 1PYSB 1JR3A 1SKQA 2V55B 5JHGB 4GN5A 2Q2IA 1GZSA 1TQ4A 2KJQA 2CWAA 2REBA 2ZSFA 4LBVA 3Q8DA 1OIWA 4TMWA 4B43A 2H1LA 1AS3A 1ZUNB 1A8VA 4QXAA 5F3WB 1J90A 1U9IA 2JLUA 4LK1C 1TAGA 3REGA 4MYUA 1ESMA 4PPQA 3E1SA 2AUKA 3CH5A 3FKSA 2WB1E 4C7OA 2F7SA 2FZLA 2FJUA 2ZPTX 1A62A 5B57C 2IYZA 4L9SA 3QXJA 1J8YF 4FMDF 3MG9A 5FLMG 3CAMA 2F6RA 4RZ3A 3NBHB 4DK0A 2A5GA 3WMGA 2JJ2D 1TUEA 4LJ5A 4DEXA 4LBYA 1OJLA 3STBD 4Q5IA 1MABA 3RVBA 3D0FA 1II0A 1BYUA 4Q03A 3TUIC 4R4OA 1EX6A 1DAMA 3GEHA 3KKQA 1CSPA 4QFMA 1T5IA 3TSOA 4A8JC 2YU9H 1DVRA 4Z51A 5KSZA 1CI3M 2NN6I 2YTXA 4DUZL 1G3QA 2CMKA 2IYWA 4OK6A 1IBLL 4G7OC 2ATVA 3P26A 3OEED 5IYDG 5LMNL 4YC7A 4CEHA 1GJXA 3GLGA 2BCGY 2JGNA 1VCNA 4NYMR 3I4NG 1DBSA 1IY0A 5E7NA 5ELOA 1R0YA 3V4FA 4M2LA 3EX7C 2OQ0A 2CK3D 3TW8B 1C4OA 4O3MA 2Z83A 1KI3A 5KU1A 4S2EA 2A2ZA 2EJMA 2IXFA 5JRZA 3GLFE 2Q9AA 1EG7A 4KYUA 3C5CA 3QKUA 4JYAL 1OW3B 2XTZA 3HOVH 1IN7A 5FL7A 2IHEA 4JI0Q 2ALYB 3FE2A 4DDUA 4IXMA 3KLRA 1CP2A 1E2QA 2HF9A 2QEQA 4DZZA 3TLXA 2JLYA 1ESNA 3KOJA 1M7BA 4JC0A 2O8CB 5KDDA 1SFOH 2BEJA 2PEZA 4DLRA 3PO2G 4P75A 3B1XA 2GAAA 5GJCA 4BZXA 4IKEA 5J40A 4UXJA 1RRCA 4CGZA 2YVUA 1X1RA 4MUAA 1KI6A 2E5LL 1S4QA 4DT1A 2UXDL 2WJYA 4IFEA 3ZZ0A 2WWWA 5TB5A 5K8LA 3ULJA 3AYHB 2OESA 4K46A 3FHTA 1RJ9A 4OK5A 4JSYA 2KBEA 4JI3L 4NYJR 3T5DA 4AYXA 1YHQA 3I55A 1SMXA 1KI6B 2NO9A 4P3YA 4XSGA 1O3YA 3RS2A 1TF2A 3PIRA 3CZQA 2RMKA 2QENA 1Y14B 1KHIA 4JL5A 3I4MH 4BFUA 1Q82C 3SHWA 4FD2A 2QGNA 3P1JA 3LXXA 4QHSA 1HCZA 2JJ1D 1CR4A 4DLXA 1FL9A 3KUCA 2JLSA 4BLQA 4AIIA 3JAMi 1COWD 4Q02A 1OH8A 4G7HC 4C9BA 2FPKA 1ZCBA 2D0PA 1PH5A 1NSFA 2FDCA 4X64L 3G48A 4BLTA 4JV5L 2OCYC 1ZM2A 3LBHA 5FPSA 3UDGA 2ZI7A 1X65A 3KX2A 3OYYA 4F38A 3CXCA 1W36D 1TQDA 2D0OA 5M3MH 1U99A 2QAGA 3NC1C 3PXGA 3DEFA 4H13C 2IF2A 3LX5A 4EPVA 1G7TA 3NEMA 3CM0A 2ES2A 3T1TA 1D2NA 3G82C 4LFCL 1DG1G 1NVWQ 4WBSA 4CEJA 5FTMA 1O7IA 3NENA 2NO6A 3B6EA 1PJRA 3ZVRA 1N6PA 3CF0A 3PQCA 2XXAB 3AVTA 3SYKA 2PZGA 2ODNA 3FMCA 2I1QA 3K09A 4QRHA 1CKNA 1G41A 1LB1B 5J4YA 3QNUA 4GP7A 3QEJA 3L2OB 5E95A 2VA8A 3U6KA 2OQKA 2E5LQ 1YZUA 1LFDB 2F43B 5SZJA 3U4ZA 2Z6VA 1SE8A 3NBZC 2NPIA 1N9WA 1IL2A 1KY3A 1GVNB 5TARA 1P6XA 2GEVA 1VQDA 2WKRA 5SZHB 3T1YL 2QL6A 1KSHA 3CD6A 4V02A 3VU9B 1BMFA 2NZ8A 5DI9A 4BLOA 2E2IH 1WB9A 1VQHA 4LK2A 2IYSA 4KVGA 1Y8NB 1A2KC 5KDOA 1J99A 2K75A 5FLXc 3W5IA 4DJTA 1HR0W 4ZIRB 2PZFA 3KQKA 1E1QD 1KKMA 4JYAQ 4A0RA 2D7CA 5IDVA 1GFIA 4FMBB 4PO9A 2OZEA 3R8FA 3IKJA 1YR6A 5AJ3L 4LCBA 5AR1A 1Z47A 2ZRBA 3KTAA 2ZTEA 5EQTA 2WKQA 3K9NA 3R9IA 4YCWA 3VR5A 1I2MA 4B71A 2ERXA 4X64Q 1I2DA 5EXPA 4EPYA 5BQ5A 5JFGA 3AVWA 1OYWA 1P9WA 1Y3AA 1X3SA 3I56A 2PT7A 3ADKA 3EIEA 2DFTA 2WIBA 4HUTA 1HNXQ 4RZXA 2EU8A 4L8GA 3BFXA 1MJCA 3WBJA 4J0QA 2WWIA 3P20A 1OV4A 4AIMA 2W6ID 5DN6D 3D4RA 2BM0A 5BR8Q 2FSGA 4L5TA 1ZNYA 4HYYA 5JECA 1UE7A 3I8XA 3AM1A 2P5SA 4RCYA 3RANA 5FBWB 2NN6G 3FTQA 4A2PA 4CW7A 3CCEA 1I5FA 4TLAA 1UPTA 3U3MA 1VQEA 1V1QA 4DLVA 4HB4A 1FX0B 2VQEQ 4PZZA 3DKPA 4JJZA 4Y0AA 4DV7L 3WHLA 3CF6R 4JLMA 2XGTA 3OEHA 4GMDA 4TMZA 2ZSDA 1Q1EA 1F2UB 1NIPA 3UIEA 5GJWC 4YMUA 3R8CA 5K8TA 1CKMA 2V4ZA 4M0LA 1XEWX 3K9LA 4LBWA 2I0QA 3CCJA 2HT1A 4DNTB 4DUYL 3GFTA 5HCIA 3AKYA 1EOVA 3Q5EA 2VUMH 1LVGA 4OI1A 5K8UA 4JBMA 2A6EC 3TVDA 4L16A 3U4VA 2CVHA 3QI2A 1GDDA 2YWGA 1JEDA 3DZ8A 1NMXA 1Y8PB 5K36G 2XAUA 1DAKA 3O8DA 3SGIA
chains in the Genus database with same CATH superfamily
5L4LA 1Y9ZA 4YBZA 2ZU0C 3P1HA 3B38A 4IXTA 4P9NA 5EMKA 3WLOA 4EJSA 2FRDA 3C1UA 3FNGA 3LUFA 1X1TA 1DT3A 2CLKB 2XMCA 3P27A 5BR4A 2X8JB 2Y1OA 1W0KD 4PZ6A 3S81A 1ZI9A 3SZLA 4ZYYA 1Z37A 2EKLA 1C4QA 4JI7Q 1OFTA 3DCNA 4HRXA 4XDGA 3HP3A 5I5GA 5G1OA 1N5IA 3V33A 4EI8A 2E5LB 1UAAA 1OLXA 3N8HA 2OILA 3KJHA 3LNTA 2F8MA 2Q4DA 5JNTA 3OUZA 3P9KA 3ZZNA 4J6HA 1N8RC 2GKGA 2IEGA 2LVBA 3GMTA 3I4LA 1S2OA 2DR0A 4GF5A 4MRNA 4RPLA 4WXHA 4EW6A 3MA0A 1RTKA 3EVZA 3OTGA 3VHXA 4DMCA 5B6PA 5CG1A 4R81A 5JCPA 4Q0MA 2VPTA 2YWBA 4A1OA 2HIAA 2O48X 1K7XB 4PTZA 3PQ8A 1QHHA 5CR9A 4MS1A 3UK7A 5KSWB 2EL9A 1FMJA 4L5AA 2XRZA 1ZU4A 3OE7D 1PH3A 4U39A 3EFBA 4HSVA 3F49S 3IAHA 4BB5A 1JF8A 4BQPA 1N36L 2G25A 4JEIA 5AJZA 2C0PA 4BBZA 3WJ2A 1J0AA 1C7ZA 5IAJA 3VX3A 3QF4A 3I3SR 2QN3A 3ZK9A 4ZJZA 2R3SA 4IP0A 3U48A 1B0PA 3AR5A 3H99A 4D4JA 1UIRA 4Q9IA 5AVZA 3GLUA 4OXYA 4DIBA 1UWKA 2ZS8A 3DT6A 2AQ2B 1XFDA 1X3EA 1N4AA 3HO1A 2K01A 5IT9c 1EM8B 4R8RA 1C8BA 5BOSA 1R8JA 3DVLA 3IEVA 3K8AA 4A9AA 1E6UA 3NTVA 4CM3A 2I4MA 4IDFA 4EM6A 4CYMA 4A3MH 2P4HX 1JH9A 1DBQA 1V95A 2JCSA 3UBMA 3SXHA 5BRAA 5KYYB 1POXA 4PFQA 1V7CA 3JQ8B 3EGDA 5KJ1A 1QUEA 4RXMA 1P4HA 2Z5FA 5D14A 5DWVA 3UWDA 5A9SB 4HAYA 4B5LA 3MTJA 3U58A 1PWXA 1FJGQ 1WKVA 1CV2A 2RAVA 5J5AA 4R7TA 1T2EA 5EY5B 3G23A 1M8FA 5EE0A 3L01A 1OTCA 3AG6A 3ANLA 2R44A 5DT9A 2PPLA 4UM9D 3A3YA 3AJDA 3SYNA 1Z73A 3TP7A 2FV8A 3BVGA 2V6GA 2ZBPA 4E03A 4YLYA 4YX9A 3KQYA 1H0RA 2A0XA 4BO8A 4DNIA 1DINA 2EGUA 3F1ZA 5BSVA 3H3VC 3KPYA 4JHLA 4UTOA 3SFVA 1N5MA 2VJPA 4GH5A 3HXTA 3G0BA 1W29A 4X90A 4ALNA 3RVRA 1Q86C 2J3JA 3HDHA 1EL0A 2VT6A 4LOAA 4Q3BA 4EGAA 2BYTA 1X3PA 4XPIA 3CC4A 1EK0A 1QZUA 1W25A 4HN4B 1CERA 5COQA 4LNHA 3WDKA 5C81A 2WJHA 2NX2A 5JXWA 2RGDA 2G0TA 1OKKA 2GVDC 1HYGA 2BM1A 2QT9A 3CFYA 3LP8A 2E2HB 1NM5C 3NHBA 4A73A 4ZCIA 2V7EA 4AX8A 1XF9A 2PW7A 3LYLA 3S1LA 1JZSA 3MCWA 1C3LA 3N1UA 4KQEA 2PV7A 1FFXB 4CMBA 5ADWA 1C3OB 2GO7A 2X0EA 3THXA 2P4QA 3O4FA 5IYZA 1RBMA 4Q3DA 3EFHA 5FA5A 2DUUA 3CO0S 3C3JA 3GFVA 1FXUA 4TM7A 3OTOB 3QZUA 2OSBA 3ZE7A 4DY4A 3WRVA 4DR2Q 5IJ0B 5H1SE 2WDPA 1JDTA 3EFOB 1PRYA 3LC7O 2E8GA 2PGOA 3R0JA 1IAQA 4RF4A 2PGLA 3KOZA 2Y0BA 4YI5A 2CMFA 2JCVA 4QDOA 1HV8A 4CTNA 3HCOA 5KTTA 5IYDH 1U5AA 4N5DA 3D1VA 5I7RA 1E3LA 5MDHA 1Y8RB 4KQ6A 4DMFA 5EJMA 4RTSA 2FMUA 1UM8A 1DX4A 3IELA 1LTID 3BG3A 3JWGA 4HXFB 1YBAA 2VSFA 2W2KB 4IDHA 4B80A 2ZSUA 2IIQA 3GJ3A 1L5LA 3QVLA 1YDMA 1IOZA 3CEAA 4FQ5A 1PFNA 1G3IA 1HJPA 4JA2A 3U3KA 4X41A 1I4GA 1A9PA 2C54A 4RG1A 2O6HA 2VDJA 4MGKR 5CVTA 5AVYA 1QPGA 3RK0A 3V9PA 1BXZA 3GGDA 5I9SA 3OW7A 2YHAA 3CO5A 4IM7A 3T1HL 3U7HB 2Z9CA 1AZTA 1PL0A 1SXJC 4M1TA 4PZLA 3UOAB 3W8NA 5GONA 3EHEA 3RI3A 1K0UA 3JZDA 3O4JA 3HCAA 2EJCA 2HCRA 2W6JA 4G5SA 1NXSA 1R50A 4AO7A 1V1OA 4J0KA 1YHAA 4FMCB 2G88A 4TV9A 2PMDA 1X1QA 1E1QA 2GVZC 4IWYA 4OGGA 2G9ZA 2EBUA 3V4RA 1D09A 2ZYRA 2PSDA 2WILA 2HN9A 1WY7A 3QA3E 4FN5A 4XYGA 1N57A 4Z54A 5CXXA 5KYLA 4W7IA 4B32A 4G4KA 1F9PA 1B50A 2CL6X 1GM5A 4Q1DA 2C7VA 3EIUA 4MGHA 5I51A 2QG6A 4FDAA 5C0XH 1H9RA 1X80B 2HPZA 5BSWA 4B4VA 1S2MA 3EPPA 3NTHA 1IWBB 3FPPA 1RYYA 2QPOA 2X0KA 3BWXA 3EWSA 1UC9A 5FNVB 2D1RA 3UZUA 5JNVA 5IE8A 2FUEA 4D4IA 4Z9AA 1NONA 1WE2A 1Q84A 3AR8A 3QQ5A 4OSEA 4JYPA 3OMLA 4B74A 1SA0A 2GFHA 1WLYA 1JJAA 2DH6A 2ZJOA 3CVOA 1UAPA 4HEQA 5DE3A 4ZEOA 3UUGA 1LDYA 2BI4A 1VF7A 4Q1BA 1JEJA 2C94A 1M2KA 4P7BA 4Z1MA 3M3DA 2M9MA 2UUPA 3A4YA 4NZ9A 2RHHA 3HKDA 2C31A 1W36B 1HZCA 5AVWA 2RC6A 3ZH2A 4EEXA 5JADA 1Z2OX 4JXKA 5F98A 4XE5A 1SQFA 2NVYH 4BGIA 3IB3A 2RDFA 4X3SA 3GGOA 4BYMA 1JC7A 1SKYB 4NZYA 5AVQA 1E3SA 3V2HA 3CLSC 1SAPA 3JQ9C 4GI7A 4AFNA 2PY6A 3SX4A 3P2IA 4A3JG 1UJ5A 5F2KA 3WQQA 4DKJA 3IP9A 1AKVA 1I5OA 3FKIH 1G2OA 2ODTX 1BOFA 1Q0UA 3EQ7A 4EQOA 4OHFA 5C3XA 2O5EA 3SBDA 4LFAB 4V24A 4AF7A 4AYBE 1Z4JA 3I37X 4CMHA 5ELNA 2WV6D 1PA6A 3OZGA 1D7QA 4A0SA 1JTEA 1B6SA 3OOWA 4GFDA 4D99A 4ALKA 4DEVA 1G6KA 2RI6A 3PGMA 4XQCA 1CKOA 3PKJA 1VBFA 1QVGA 1N7JA 2YCLA 2G1JA 4M1QA 1WVGA 4CT5A 4I9UA 4ZI5A 1RRPA 1V3TA 1QHIA 1W5SA 4UMVA 4A3GH 3DHYA 1YFKA 4BFVA 4A0QA 4YV0A 3PO3G 3D8SA 1RRFA 3CISA 3G9UA 3QE2A 1GV1A 2OPHA 3TVTA 4CETA 2BTEA 2ADOA 1A63A 4MVXA 3OSOA 1W1WA 3ZY5A 4BFLA 5HM8A 3WXBA 4ZAIA 1N5JA 4URFA 2NU8B 2GXQA 5IBQA 1AF4A 1C29B 4BFCA 4CM9D 4R71A 4JKIA 1R37A 3U09A 5L3ZA 1VXRA 5F2OA 1U6KA 4MYSA 2WG0A 1M2FA 5TJHA 4EGVA 2UVPA 2HMVA 2PMZE 2XYPA 2FPGA 2BA0A 3BOSA 2HEGA 3DD1A 4UVIA 3TG8A 2CXXA 3HBNA 2Q8PA 1YVPA 2KVMA 3G7LA 1E0JA 4NJMA 1XRNA 5D3QA 5BYAA 2ISSD 2WM8A 5CV5A 4PGMA 4BY1B 4UAVA 4QQNA 4H08A 2FZWA 5I01A 5HFNA 4DAVA 2CXSA 2FB9A 2JLAA 3WDMA 4NICA 3N8IA 4XQNA 3CLTC 3E3MA 3KWFA 3CMMA 4IVNA 4A93H 4CMIB 3WLTA 4ZQ3A 3M3HA 4BVLA 1QRTA 1SD1A 2I03A 2ZCUA 5EIXA 2SNMA 2Q0QA 3R3VA 4EVIA 1G8GA 5FWAA 4CM6A 5L40A 2DBQA 2DHRA 4IJMA 1BC5A 4FXGC 3FF4A 1WMBA 2F0KA 3IQWA 4M9SA 2J7PD 4E4RA 4GP6A 4IH9A 5G41A 3HB4X 5CV8A 4PLGA 2PPVA 4P73A 4X6YA 1JE5A 1VQBA 2H2WA 2VB3X 2H9YA 4YT5A 3UV7A 3VPSA 3ECSA 4BN5A 4EG4A 3SU8A 4FJ0A 1LDEA 2R1TA 5LQUA 4R2WA 2VDMB 2V54A 1QK4A 2Y4NA 3A8TA 3KD2A 3F2VA 3OFSA 1Y1VG 1X6OA 3HKZB 3RRXA 3EHDA 3ZKWB 3ADDA 4ME5A 3LPAA 3RS3A 2H0AA 4XD2A 3J81L 4DR2B 5DHPA 4L6CA 4KBFA 2WMNB 4BBPA 2GYYA 3EPKA 4LA4A 2QDBA 3EGCA 1LW6E 3P4XA 2OHFA 2JFZA 2WTAA 3E0XA 3K0FA 4WZBE 5FK9C 1MF7A 5FPHA 3WK8A 5JNUA 3BMOA 3L7CA 1UH5A 1U1GA 1XZCA 3AR7A 4RBNA 1HYHA 2AWNA 4RZ2A 2BHSA 5HQJA 1KMIY 2Z8ZA 3H1GA 3KHTA 1TIPA 4OA8A 4KEAA 4D43A 4D8UA 1Z2AA 2JJQA 4UDOA 5JI2E 4TYPA 4BMZA 5KSOA 4FLFA 3X1ZA 1YZVA 5H70A 2IW1A 4AG5A 1AMOA 1US8B 2GYUA 2QTLA 3P4YA 3F6SA 3R3WA 3RYIB 4BNUA 1ATIA 5EPJA 1GXSA 2CLLB 2BCJQ 4Y30A 5BYKA 2C2MA 621PA 5L45A 4DSOA 4D3XA 1LCIA 2K2QB 1J39A 4Q4DA 1E9FA 1L5SA 4TKUB 4ZMRA 1TUGA 1BBWA 1RHMA 4PR0A 3NNSA 3QEMA 2FDXA 3JQ9A 5EIBD 2ZYIA 3WGLA 1CSQA 4UQPA 3KVYA 3AB8A 1VHDA 2C7BA 4BE9A 1YC5A 4QSMA 4WUTA 3UDXA 1GGMA 3B20A 1DTEA 1SYGA 2JIRA 2NXJA 5DW0A 4D98A 4E07A 3V7NA 1JRLA 1SKYE 2DPGA 4MW2A 1T0PA 2IUEA 1Z4QA 3OIWA 3LQ2A 4EQ6B 1L1QA 2HLHA 2P9CA 3IH5A 4RV5A 2NVUB 3R4VA 4FDBA 3TLCA 6LDHA 2H7VA 1TRHA 2GBLC 4JVOA 2O5JC 4MR7A 2EERA 4PR3A 1JKXA 5HZMA 4F56A 1L5KA 1UKVY 4PZ9A 3UM9A 1ML0D 1QBGA 1U2GC 2K05A 1JJ2A 1PFMA 3FDXA 2OHOA 3EAFA 4N8EA 1UDBA 2NTTA 2P2LA 4LV5B 5A6SA 2WFLB 1GZUA 3QGMA 3WP1B 2VHWA 4YMWA 4F5WA 3LKZA 2IUUA 3V00A 4BV8A 5LQJA 2ZB7A 1MGOA 1QO0D 4E3WA 1Q91A 2I67A 3IQGX 5AKYA 3K80C 1IC6A 1DWPA 3B1VA 3MGCA 5CNIA 4MHOA 5HDBB 4D7AA 3ESAA 5KTSA 3A7LA 3QY0A 4BFXA 4FVMA 3K58A 3O75A 1SYEA 1IYVA 1PFUA 2X5JO 2ZBRA 4UNRA 5LJLA 1M6HA 3WZLA 2AVDA 1YT5A 4LF6Q 4IIDA 4CDNA 3OESA 1HSOA 2BMDA 1LQTA 5K6AA 2UYCA 2R97A 3DMFA 4NIMA 3GU3A 4MCHA 3RE1A 4B3DA 1AQNA 2V7WA 2RI0A 2HIXA 1GTG1 1MPTA 2FFJA 4TTAA 5AW6A 1Z9BA 1CSEE 2W4MA 4O4LA 3AIMA 3QVVA 2AJDA 3HJRA 3G68A 3K5OA 2PWYA 3TNFA 1NKSA 4B85A 4A93B 2WJAA 1CRLA 4ZCKA 1A1SA 2GYWA 2V74B 3EZYA 1L2TA 3EODA 3O84A 2OGTA 3OC6A 3RM3A 2KQ3A 1CUEA 4I6GA 1J2EA 4G37A 2GNAA 4MCAA 4DLYA 1P1BA 2GILA 4NBRA 1MNQA 4ITVA 2F0UA 3RTAA 4JSRA 4LQCA 2BM9A 2ZQZA 1KDVA 1SVKA 1DKLA 4I8IA 5B1DA 2A78A 3EEQA 1C0AA 2MWMA 3UJ3X 3NBXX 4JUCA 4EIWA 1IY9A 2WU0A 3B8HA 4C7MA 1T15A 5I4CA 1UBLS 3HYCA 2JJ2A 3RVSA 4GI2A 1ODCA 4GKKL 3E8MA 5DBFA 5CJPA 3JQAD 1A9QA 4OQYA 2KHSA 3I73A 2B63G 2Q3FA 3QKRB 4K1LA 1NT4A 1A3UA 1LDGA 1OXKB 4DGSA 4CR8A 1UE1A 4C3IG 4MHEA 2PX4A 1QYXA 1HEUA 1VQJA 3F3SA 3F8SA 3CPJB 3AU7A 4HB0A 4C2AA 3P0RA 4CV1A 3M33A 1GAJA 5LQSA 1MENA 4G4SP 1Z6QA 5AJXA 2A92A 1E24A 1EDZA 1F8XA 2COUA 2W6QA 4F1WA 1G20E 1IU9A 1M1YB 3BB3A 3FF1A 2GGSA 3A3OA 1ID8A 4QUHA 4IPGA 2VHUA 4KE7A 1FPMA 2FG7C 4CM8B 4TYNA 1VI5A 1HNZB 4CT0A 4YY3B 1PIWA 4IJUA 2WB2A 1I94L 2PMKA 1WOCA 4IHAA 1P29A 4KXUA 5EZ6B 3W4KA 3EG5A 2DHCA 3P2MA 4PGAA 3WGVA 4FGLA 1FUEA 2LSSA 3QHAA 4CIXA 3G5TA 2GCEA 3OPYA 1NNSA 4WBXC 5FL7D 5KU7A 5DEOA 1EVIA 3A8IE 2W2LA 4DVGA 4UNPA 1WSDA 4BVKA 1L1FA 4FC7A 4RIEA 1U31A 4U0JA 3WIDA 4OLBA 4DV3Q 4K9PA 2B83A 4F4UA 3PZRA 3IERA 2EFEB 2CNWD 1OFHA 2C8VA 2R9VA 4PCVA 1SVOA 2F0SA 5FLXL 1DRUA 2WOJA 3AUJB 1SE4A 1F9QA 3T1OA 5DVZA 1MA0A 4UJ5A 3OE5A 3ZI0A 4EMTA 1Z0SA 4RTRA 1OBCA 3BA1A 3O82A 3ANYB 3HZHA 5JEAH 3SDZA 2NXEA 4JQSA 4LE0A 4AP6A 3K8YA 4URZR 3OMGA 3O21A 1TYZA 4W9NA 1NWCA 3B1KA 1UE5A 1YZKA 4M7OA 5HURA 1E3JA 3CN7A 1L2FA 3ERSX 4RJJA 1I4HA 5LUAA 1VA4A 1VHWA 2R6HA 1L4EA 2QA4A 1BQQT 2W6PA 3HI4A 2JGFA 2LKVA 2PUHA 4PCAA 4FLMA 5JD5A 4M8AA 1MEEA 3OQMA 1LX6A 2DJ5A 4TL7A 2Z58A 4DCSA 3M3YH 1W73A 1MBYA 4FBMA 4QUGA 1WPQA 4IALA 3FVRA 1C9DB 1D5ZC 1F0PA 3CLRD 4AECA 1DOKA 4Q4CA 3ONWA 4N65A 4C3JG 1CZWA 3FCEA 1WL8A 2EYHA 5B37A 4QYXA 4MVJF 1PTOH 1LJ8A 2NTJA 5JY6A 4RWSC 4JI1L 1BCPB 3EBEA 4R83A 3RT9A 3TLEA 2C7QA 2I33A 3LPDA 1D0IA 3BL5A 4YRAA 1QDEA 2EZ8A 4JLPA 3FUWA 1UUPA 3Q9LA 1PLFA 4Q1CA 2AQHA 1PJTA 1L5NA 3O8NA 1G7RA 4PG6A 3GNLA 3ZI7A 1IUNA 4G1VA 2JIOA 1TYDE 1NMEA 1U3FA 2EEPA 3GF4A 1UK9A 3K1TA 1OWNA 1AU9A 1Y63A 2JD0A 4QOIA 4DUPA 4EH1A 3HXQA 2FSSA 2LIVA 2ZYSA 3DXXA 4UCXA 4EGQA 1TU4A 7MHTA 1PCXA 2YXEA 5FPYA 5LBUA 3BWYA 3HGMA 4H60A 1CJMA 1I5RA 1WD5A 2GBLA 4A3BG 2BGTA 3AEUB 2JE6I 3C3XA 3K5MA 3VSDA 1GITA 3NORA 4PXAA 1IM2A 1DAPA 1BEUB 2Q07A 3HP4A 2X4DA 1GXDC 1Y4AE 1PTOB 1W48A 3KJIA 1VP9A 4R9RA 4R1LA 4H7PA 3HYRA 3EGXB 2KYRA 2YN0A 1J2JA 1XQ6A 1XPOA 3K9BA 4F5YA 3LUCA 3ZXXA 2H4OA 2IOFK 4GZ6A 4U0KA 2VY3A 1OVMA 2OCXA 2NU8A 5EEHA 4AL4A 1S4ZA 1VQGA 3U7GA 4MQEB 5L3SB 1RL2A 1RZUA 2I6TA 3CZ4A 1E59A 5IXJA 4U7DA 3EBLA 3UHAA 2P1DA 1K5HA 1THTA 2V5VA 4LNAA 4DSAA 1QTIA 2WU3A 3H2JA 1DG9A 3PIO3 5DTMA 5LHY1 2JEYA 1UAGA 1GAQA 4H0LC 1TXGA 1V5FA 2Z5LA 1GJRA 3GG2A 3IAXA 3PUIA 4R3WA 5AYVA 5A71A 4LGYA 3VGJA 4AJOA 1IL8A 2H7CA 4AJ1A 2AHOA 5JRDS 1TCBA 2C8KA 3F67A 1E6MA 1N2CA 1KGSA 4PHTA 2C7PA 4BFYA 3CURA 2WP8J 1PGPA 4GYWA 4X1IA 4JI2Q 2F0PA 1SMYC 1PWZA 2H48A 3N28A 1ZMRA 3OY7A 4PC3A 4RY2A 5HA5A 3RF6A 1L7VC 2AMFA 3HR7A 4Y1RB 2VH5R 2PL9A 2GMWA 2LD4A 3OPVA 4YROA 3HKBA 4DDHA 2E2JB 2PJZA 5U9CA 1L5FA 1JR6A 4I99A 5CC4A 1HTLD 4GQAA 1MO5A 3ZCVA 2WQ7A 3RZOH 3EF1A 2YTVA 5LR6A 3MBOA 5AKEA 2Y1FA 3GLKA 5H3HA 4FINA 1PJQA 4LSZA 1P7ZA 1N6LA 4TRRA 4W5JA 4Q9HA 2ORWA 3W5SA 3L49A 2CK3A 1X32A 2QM7A 3TFQA 4QXRA 4K7JA 1LTBD 3PTAA 1GZDA 3K0AA 3UXMA 1UBRS 5FI5A 5K3SA 3LF1A 2M6RA 3RDPA 1Y1WH 1G8ZD