1OXTA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
352
structure length
352
Chain Sequence
b'MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 95
structure length 352
sequence length 352
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxtA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxtA01
2IC5A 4NPSA 1HE1C 1S9HA 1U8YA 1RRFA 1LW7A 2UXDQ 3N2IA 2G9NA 2ATXA 3THYA 5CYPA 4FWIB 4DR3L 3QXJA 1E9RA 3AB9A 2H17A 1QHYA 2IL1A 3LNNA 3AP1A 1OH7A 3PUXA 1JQJC 1UBGA 2W00A 4LZZA 1AIPA 1P72A 4HIKA 4D2IA 2FMXA 5J4KA 4R98A 4GN5A 1G17A 1S2MA 4FMCF 4C0KA 3JAMc 3NEYA 3UMRA 2B7BA 5JJIA 2Z43A 3C15C 3LWUA 2A69C 4QGHA 3KXLA 4PC3A 3VAAA 3PUVA 3EN2A 1OH6A 4GOPA 4I1UA 4X64Q 2WIAA 4KV9A 1UBCA 4HAXA 1Z0JA 3KJEA 3SNHA 3S1AA 3VKHA 4L9SA 1DOAA 1V9PA 1AGPA 4PZ8A 3FMCA 4QGUA 2ZRNA 5D3MA 1SQ5A 3RZOH 3K9HA 4J15A 3FHTA 1CR1A 1DAEA 4RD1A 2ZS7A 5FR2A 2PI2E 5EXSA 3NC1C 4UNRA 5L3QB 2IYLD 2ZXUA 3CPEA 5G3ZA 1E3PA 2QZ4A 2HDNB 4D0LB 2O0JA 3FMOB 3B1WA 4E09A 2C78A 3CXCA 3AKEA 1DAHA 1YJ9A 4GOJA 5LB2A 2QENA 2VHUA 4QHYA 4W5WA 2F1RA 4DPGA 3IUYA 1PUIA 5DISB 3CB4A 2IX3A 1UEJA 1KDTA 1Z2AA 2F4VL 5JEAG 3F2CA 4HIMA 1L0WA 3GLIB 4EX5A 4TQ9A 1FUKA 1QUQA 5G53C 4AY2A 2VYFA 3QKTA 4BBSG 1E2QA 2Q3HA 1MJCA 5C4GB 1JR6A 1UDXA 1XJVA 4HR7B 2OE2A 1SMYC 4NONA 4GKJL 2Q2IA 3I4MG 4A3KH 4OBEA 4V03A 3PF5A 1N6PA 1CIPA 2CNWD 2VSXA 1KI3A 3QKRA 1X1RA 3RS5A 1F2TB 2ZJRA 2FH5B 4JI1L 5M3MH 4KO8A 4NYIQ 4QG7A 3I4NH 5UKDA 1WE2A 4O3MA 1JB1A 4CEIA 2IBMA 1P16A 4IPHA 4HB3A 4AKHA 2Q0HA 2JIZD 2JLWA 521PA 4IKEA 4DR5L 3KF6A 2IUSA 3F0TA 2RHSB 3U44B 2CCGA 5TVKA 3QY0A 4JV5Q 2ZAOA 1PYSB 1DBSA 1YU9A 2ZU0C 3UG7A 2H57A 2W6JA 1N0WA 4QBHA 1IXZA 1N33Q 1N0UA 4X8LA 1HH2P 1KJZA 1PLLA 3CO5A 2PZFA 4PZYA 3UK6A 1KDRA 4QKQA 2GVAA 5IWAL 1UWVA 1H9KA 2VQEL 2NVTH 1SKYB 1C1YA 4TTQA 5KYKA 1G1MA 3WMEA 3CZPA 1Q3TA 4BLQA 2YOFA 4IHQA 1GL9B 3K0CC 1WJJA 2Q6TA 3VKGA 3CCUA 5AJVB 3G6EA 2O8FA 2J0UB 2JLSA 3NENA 3OTOL 2QSYA 1ODFA 4UXHA 3V4RA 2MMGA 3IQWA 1E2VA 3S15H 4AH6A 5IT9c 4DR1Q 1HQYE 2H18A 2P2LA 4EPRA 3BS4A 1HUQA 3PEWA 4B3MQ 1R7RA 2VW9A 1UKZA 3CX8A 4ESHA 5CB6A 2IUTA 1O7IA 1KY2A 2BM1A 2QT1A 4A8JC 4K0KQ 1K5GA 2JEAI 2GJKA 1TWAH 1G8PA 4WZAE 1E1RD 4GPTA 4OO1H 5FPSA 1YHBA 1CULC 4WA7A 5FUYA 1QHIA 3Q9LA 1OXUA 1UE7A 4FIDA 4PTLA 3QQ5A 4TLCA 4KITB 4LSGA 3GLFA 1W2BA 1IN4A 4QGGA 4Q9JA 4AQYQ 4FN5A 1KHIA 5E95A 1M1KC 4CEHA 3TREA 1WB9A 2E75C 1YRBA 2RB4A 1Q86C 2I3BA 2I0QA 1EFRD 1VKJA 3KKNA 4PPQA 2KCMA 2PL3A 1E0JA 1KIXA 2ZE6A 3CRVA 1ZMXA 4PQFA 4O2DA 1JR3A 2GBLC 2VL7A 4DEYA 1E9EA 2WWXA 4YMVA 2CCZA 3M7NA 2VEDA 4MNOA 2E76C 2FFQA 3QENA 4FWTA 2A19A 5JWRA 4DNRB 3QG1A 2OTLA 5BN3A 1TQ6A 2P6RA 1AKYA 4UNSA 1R9TH 1W1WA 1A1VA 4V02A 2JK8A 3SHFA 5J3BA 1UJ2A 2G0TA 2YTXA 3BB4A 2JJ1A 1UADA 3FHCB 4G7HC 1WMSA 3ULPA 4IFDH 4W9MC 1IBML 4JOIC 3QG5A 3HPQA 1GSIA 2QTHA 3H0KA 4ZPXA 1NKSA 4QBIA 1D5CA 1GRNA 2IK8A 2RGGA 2ONJA 1G16A 5IYDG 1Y1WG 4IEIA 5IK2D 4NL4H 2F3TA 4URXR 2F1JA 2WP8J 3NEMA 1GWNA 2J0SA 3VU9B 2CWPA 2XNSA 1I4TD 4BLOA 1FW6A 2VP4A 3JVVA 2ONKA 3AUYA 4BFXA 1DO0A 1WYDA 1PH3A 2GETA 2ZRMA 3FE2A 2KA7A 4LFCL 1B9NA 1WCMH 4X66Q 4PHTA 3OIUA 2Z6VA 2GVZC 4RD3A 1Z63A 4GNKA 1Y69U 2AD5A 4DSTA 4JI3L 1XDBA 2RAPA 3K09A 4DV0Q 1MO6A 4LC1A 3T15A 3TRFA 5EXXA 3VR2A 3PO3H 2QE7A 3CR7A 2HJGA 3L43A 5FOUA 5TV2A 3TE6A 2B29A 3J7ZC 1HZCA 1KZGB 3BFKA 2R7ZH 1U8AA 2Q2HA 3KYHC 3A7LA 1SE8A 4PANA 2GAOA 1DGSA 3R9XA 1EFUA 2IF0A 2E2HH 1U0JA 2C96A 3HJNA 1QVCA 4JYCA 5M5XH 4LYHA 4V0ME 5IHPA 3CCSA 1S3GA 2WKQA 3F5FA 4NU0A 3R20A 3TR5A 3HFZB 2OBLA 3SEAA 2QROA 1P61B 3U7HB 1V1QA 4TYQA 1DARA 4NB3A 4ON9A 5EP3A 3W6PA 1JNYA 4MUAA 2A5FA 4DSOA 1UPTA 2WWHA 4EQ6B 4OGQC 3UXMA 2V3CC 1YHAA 4KKSA 4HAYA 3DHWC 1CR4A 3MGCA 1XTKA 1QJOA 1XCGB 4GT1A 4A2PA 1VQHA 3DKVA 1QHXA 4FCTA 1D2MA 1P7CA 3EC1A 1KYIA 3T53B 4MYTA 5LD2C 2ZM6L 1ZM9A 1TMKA 2IYSA 3VR4A 3ONWA 3SQWA 4IO9A 1KRTA 2R7DA 1QHGA 4OHWA 2IUUA 4US2R 3RLFA 3W1BA 3IIKA 1W44A 4LJ5A 1S1MA 2R2AA 2UZIR 5TXGA 2OV2A 1KC8C 2HCJB 3N5CA 2AWOA 4C0LA 3H3VI 2FDCA 4MKFA 1S9DA 4WJ4A 1VPLA 2WJYA 4DLZA 2PNHA 4B3DA 4JBWA 4QQBX 1X8JA 2GJAA 4Q1DA 3TUIC 1ZKOA 3M4PA 4LFBQ 4Q01A 4X8OA 2ZE7A 5EE9A 1GHJA 3AVOA 1FTSA 2C03A 4NCIA 1A2KC 3CRRA 3IEUA 3MD0A 3MWJA 2QI9C 4V0KA 1Z08A 2Z4SA 4BFZA 3PENA 3QKUA 5C0XG 5G41A 4A6PA 4EJSA 6Q21A 1UEIA 3B1XA 2DBYA 4DDTA 1YRAA 2HXSA 3B1YA 3OESA 1K0RA 3TS2A 5FBQB 1KK1A 2OUKA 4HUQA 1LACA 4XD7D 1W36B 4JKIA 3U4QB 2X1VA 2CNWA 4AD8A 4DK6C 4A3LG 1ZJ6A 2ECKA 2FG5A 3CZQA 4BLPA 2ZM5A 2GJ9A 3K70B 3IEVA 2NMVA 4O2RA 4UNNA 3ND9A 5FJ8G 4IFEA 1Q1EA 2CKZB 3I56A 1T5LA 2EFGA 3OE7A 3I61A 1BOFA 3I5XA 2L5TA 3CX6A 2JIZA 3M4OH 2QT0A 1ZNYA 1YNJC 2AN9A 4AKIA 2F7SA 1PMRA 2J87A 3NBXX 1T91A 2BM0A 4IJMA 5DLQC 4KKTA 1NBME 2V4ZA 1UKVY 4IDOA 1PH4A 3LFUA 3Q85A 2QPAA 3MEFA 2ZRHA 1P4SA 3O47A 4JI5L 2QM8A 4C0SA 2QBYA 5CK4A 2P0EA 1XNRQ 5E7JA 3TUZC 3HU2A 2BVNA 1NTGA 4MRSA 3ADCA 1H9SB 1F60A 5GVRA 4J0QA 4FMBB 2XZOA 1E2FA 3DOEA 4F38A 4BGDA 1GOTA 1L7VC 1SXJD 4CT5A 1U81A 5FH9A 4GNXC 4RD4A 5IYBH 5GAHC 4PXAA 1FMLA 3P26A 1WRBA 2LCFA 5JCPA 4KAXA 2YVUA 1Z6HA 1DO2A 3B78A 1JJGA 1W4AA 4DK1A 4C0QC 5FBVB 1E1RA 2ZRGA 4JSTA 1E2EA 5C46F 3FWYA 2NG1A 4HAUA 3KQNA 3S24A 2ZRIA 4LF9Q 5IDVA 3ICQB 4AIIA 2BBWA 1FX0A 2OCAA 4LYFA 1MABA 4H1VA 3WMGA 4F93B 1IXRA 4JBKA 1T8TA 2B8GA 2G1JA 1M2OB 2GEDA 1EFRA 2QPOA 4N0DA 4A76A 2RGCA 1E1TA 2ATWA 5JI2E 3DM3A 4DR2Q 3GTLH 1GKIA 4JG2A 3EZ7A 1ZD9A 3TR0A 3OYYA 2QTVB 1R0XA 2VBCA 1XP8A 4GS3A 2QN6A 4A3GG 2AR7A 2PZGA 4TL7A 1RIFA 2D62A 4MTNA 1VG0B 2I5LX 4IPDA 2P5TB 5FUVA 3FPPA 3UWKA 5GROA 2MSEB 2A9KA 1VQ8A 2D3WA 3LLMA 4D4KA 1CS4C 2BA1A 1X8KA 4DLXA 3AVVA 1CKEA 2E1RA 4LOAA 4OQFA 2OLJA 1Y1VH 1I4LD 2F9MA 4Z1MD 3WP0A 1P9NA 3SR0A 4R71A 2CFMA 3GMTA 1OYYA 2KHJA 1W0JD 3ZLJA 1F2UA 4R1JA 5IK2A 4BFUA 2OCEA 1KO5A 1EIFA 3GPLA 2FE4A 4C3JH 2EQSA 3WMFA 1G6PA 3D7MA 2ZRLA 3NBHB 2IYWA 4PSAA 2VA8A 2R7FA 1P2SA 4B3TQ 1E2IA 4PV1C 4DCTA 2R9VA 3BB3A 5SZHB 5LMNL 2ZSDA 5C1BA 1GJXA 2UKDA 4R4TA 4JLDA 1X55A 3SQXA 5GJBA 2QORA 2EJGC 4G5OA 3ZD7A 1SGWA 3CONA 1EQQA 2ZEJA 4TYYA 3GJ0A 3PCOB 3CAMA 1EQRA 1IBRA 4LF6Q 2YNMA 1ETUA 3NIBA 3KKPA 4KFTA 2CJWB 3NDBB 3BB1A 2ZTEA 1P73A 2GXAA 4MKGA 4HAWA 3K8YA 5DYGA 4US0R 2CW0C 3E9IA 3A36A 3WDNA 4JVMA 5DHFA 4YQFA 4N1AA 1AZSC 4FMDB 2F55A 2A68C 4DR7Q 3RRNA 4MGZR 2ATVA 1BBUA 5KO2A 1OFHA 4OWXB 4LJ9A 4GOKA 2G88A 3AVWA 4TMWA 2AX4A 1QZGA 1Z6YA 4R4QA 3UE1A 4DV4L 2H5EA 5DI3A 5FTKA 1FNNA 2WM9B 3TKLA 2O8DA 3FHOA 1EIYB 3FPAA 3FMPB 4DIEA 4JL6A 3EA0A 4RFSB 4QJ4A 1A8VA 3D4RA 1FL0A 5BR8L 3PVSA 2PLFA 2WWYA 4WIAA 4X62L 2ZIAA 1XMQQ 2O5IC 4JVLA 1DG3A 1E2KA 3CR8A 5C4XG 4HJ9A 2AMCB 5JSZB 2YHSA 5DE3A 4A3DH 4Q7LA 1KI9A 3GLHE 3K0SA 1NF3A 1X6VA 2YTYA 2FGJA 3HOYH 4DCVA 2ZU6A 2YC2C 2QNRA 1J90A 2QSZA 3QKSA 1KJWA 1OB2A 2NVXH 3UG6A 3GTQH 4ME3A 5B30A 3OAAD 2HIVA 3EARA 4OK6A 3V4FA 1AQUA 1AK2A 2ODEA 2MMCA 5FOSA 1K8AC 3CRW1 3LD9A 2ANCA 4M1YA 1ZRHA 2VP5A 3SHWA 2OZEA 2AHOA 1ELOA 1L1OA 1DCZA 1UBFA 4JI4L 2L0XA 4AI6A 2A6EC 4XD7A 3VQTA 2A6HD 3GLFE 4R9UC 4HJ7A 3AP2A 2HJVA 1A5TA 2P67A 4ZI2A 4TYNA 1JXMA 2ZSEA 4P74A 5ANRB 5FUXA 5JWOA 3EAQA 4IVPA 4E03A 1NY6A 3AH8A 3FKQA 4P4TA 4PAMA 2RGNC 1JMCA 1XMOL 3CWZA 5M04A 2NN6I 4Q1FA 3FKIG 3BBPA 4B3CA 3AGQA 4TZ0A 3LY5A 1TQ2A 2HCBA 1JR3E 1E4YA 4CYMA 1P75A 1R5OA 4OX9Q 1ZCAA 4EPVA 4LHYA 1VF7A 3CCEA 3NBYC 1PZNA 4I1SA 5CDFA 3C5HA 3OOCA 5FI0B 4W5JA 4DDWA 2VUMG 1E6CA 3CMAA 4DUZQ 4HDQB 1G6HA 1WF3A 4FD2A 1SVMA 4UP9A 2Z0SA 3SJZA 4YCUA 4UNQA 5KPDA 1B70B 1VQAA 2R93G 2X77A 4EFNA 3RLNA 4PAOA 1VCOA 1O78A 4C3HH 4JLJA 3RABA 1W2HA 2KENA 3B9PA 3HU3A 1OFIA 2BMDA 1YZ6A 4YY3L 3QEOA 4Q7JB 4DHEA 4DSNA 5BWMA 3L0PA 4YHHL 4HLUC 2VLIA 1SXJA 1YIJA 3R9WA 4TQUS 2PBRA 3PO2G 2RHQB 4H9GA 4OK5A 4PHGA 2K5UA 5GJCA 4RKEA 1E2HA 1V8QA 3KFUA 1GP2A 4DEXA 1XWIA 3K09C 4DT1B 3W6NA 1EESA 4OXPA 3T1VA 1LFDB 3AKDA 3NH6A 2OESA 3W3AA 2FPMA 3MLEA 1JEDA 5JZVA 1FVIA 1DG1G 3QE0A 1HR0L 4AYTA 2O8CA 1COWD 4C7OA 2C99A 3K0XA 4D4MA 5CM8B 4DV6Q 1YR8A 2KBFA 4A8JB 1IN7A 4FMCB 4JYBA 2MSCB 3WHLA 5JHGB 1R0ZA 5KHOC 3AVPA 5AWFC 1E1OA 3M6AA 1N34L 1FJGQ 3GTPH 1IJEA 1Q57A 1OSNA 2VHTA 4RFVA 1Z06A 3A74A 1ASZA 3KXKA 1II0A 3RVBA 2F1IA 2PX3A 1UAAA 1G3RA 5BYJA 2FFBA 3HKZG 5FLMG 1PLJA 3HYTA 2EQBA 1GKYA 2REOA 2G0NA 2CK3D 1JQLB 1XXHB 3T06B 4IFBA 2NIPA 3K70C 2FXQA 2K5NA 1N36Q 4A3BH 1XTQA 3KKOA 3KQLA 5EZ5A 3M4QA 4M1SA 4NDZA 2GXUA 4B3RQ 1XTRA 1KMQA 3AB3A 2BKUA 4A3IG 2PJRA 1EYGA 2UU9Q 1NY5A 4Z1MA 2R44A 1QDEA 1D9ZA 2E5LL 4LF7Q 3A58B 1N6LA 3OEHD 5SZJA 4JI7Q 3WRXC 1W0JA 5K8IA 4GRAA 2QA5A 3Q5EA 1BBWA 4G7OC 2QMUA 4URYR 4A0HA 3IBYA 3KZ1E 4CEJB 2K5HA 4LF4L 3HOWH 3K9GA 1RYHA 1EWQA 3PGZA 2WPDD 4UKDA 1DAFA 3RYTC 1KSHA 3LQRA 1JXOA 2ALYB 4YWKA 1ESMA 2B6HA 2QQ0A 3L8ZA 4JZKA 4LF5Q 1VCNA 2H8KA 4TLAA 5FPTA 4JI6L 3RHFA 1M7HA 3O8BA 3AFQA 2D5DA 821PA 2UXDL 1N6OA 2NTYC 2JLRA 3HOVG 2UXBQ 1M1YE 3TH5A 4A3JH 4GZLA 3ETLA 2V4DA 3R8FA 1LVGA 3EWSA 4LDJA 5HZKA 1TEVA 1OXSC 2NZHA 3EC2A 3N70A 2Z4RA 3RWMB 3VFDA 1H95A 1NLYA 1PH5A 2R93H 2J9RA 4GP7A 2V6JA 3WNBA 4EAQA 4ZIRB 1OXTA 1W2GA 3QEJA 1TU2B 3RZDH 4C0HA 4BA1I 4LJ4A 1AS3A 1QHHA 3U3KA 2EFDB 2HYIC 3U58A 3NVAA 4Q7KA 3K0FA 2FFAA 4GZYC 1W5TA 2DY1A 5HGQA 4A93H 1J70A 2BMJA 5EP4A 3OHMA 2KI5A 3EQLC 2DWQA 3UMFA 2K14A 3ZVMA 1K83H 1Z6TA 4PQYA 4QNMA 2RKOA 3B6EA 1Z83A 5C4MA 1E2PA 4TMZA 4ZDKA 1F6BA 4EQ5A 4BXXH 1KIMA 1YITA 4YDHB 2WOOA 3RS7A 3U3JA 4LV5B 3KL4A 4B44A 2A2ZA 2GILA 2QMEA 4JLKA 4WOPA 1UBEA 4OQMA 3FP9A 1GL6A 1G7CA 4EFMA 1JJCB 4U5XA 2ZRFA 4Q5IA 3SN6A 4LK1C 2BH2A 5AUOB 1YZNA 3AKCA 3ASZA 2GHIA 1NBMA 5E4FA 5BN4A 4PQRA 5JS7A 1SR3A 3ZJYA 5CJPA 3OPOA 4JS0A 4AG5A 1KY3A 4A2WA 3W6OA 4XSGA 3MFYA 1KJYA 2FJUA 4GN3B 2MO0A 4O0AA 1XB2A 1VQ7A 4LPSA 1EFHA 4M4SA 4WZ6A 5FLMH 1RVDA 4QFMA 3OAAA 2P65A 1ZU4A 5JI3E 3C14C 5D3QA 5IP9H 4IJLA 1D7QA 3PV0A 1I6VC 3M85A 4NCKA 2EVBA 2QA4A 4Y52H 1TAGA 4JL5A 4TYPA 1GTVA 3PXGA 1MRNA 4EPXA 1NJIC 2CL0X 4LJ6A 5FR1A 5FL7D 1I3QH 2CLDX 2WKRA 3O8RA 5C2JB 2PNRC 1KD1C 1SHKA 1JJ2A 2P6UA 1JAHA 4LPKA 4DDUA 4JV5L 1Q20A 1HNZQ 2O0HA 4GFDA 4LC0A 1QZHA 3L0SA 4QNRA 4A4DA 4KMUC 4ZDIA 3SC3A 1IW7D 3H94A 1N33L 1G8YA 2LKDA 3HYRA 2JA6H 2H1LA 2JXMB 1Q21A 4IFDJ 4IPCA 4TN1A 2V55B 3MWKA 3IIJA 1UEBA 1VYVA 4A3CG 2IHBA 3KUDA 5GQOA 4BLSA 2JJ2D 1YZLA 4RCYA 3SU8A 2G77B 4Q1AA 4A3MH 3D8BA 4HZUA 2JATA 1DADA 1I94Q 4PPGA 3WRYC 1PUJA 5IP7G 4YWLA 3HOZG 4IDHA 2YKGA 1ZUHA 3TRZA 1AQYA 5C44G 2PT5A 3VX3A 4D26A 3PSIA 4DCUA 3AF1A 1FQKA 3AF0A 5L3QA 3DVLA 3CD6A 4D6PA 4B3ML 3W8NA 1FQJA 1C0AA 4BFVA 1XEXA 4Q19A 3THXA 4BY7G 1J7KA 1ZNWA 3MCAA 5E7MA 2QAGA 1E0KA 4LGMA 2XXAB 5ELOA 3V00A 221PA 5DO9A 5B58C 4L5SA 5C18A 5AUNB 4X8MA 5BW8A 4DUYL 2BCGY 1CRPA 4APVA 1S0UA 4GNXB 3LX5A 3GLIA 1XX6A 4A1FA 2YTVA 4AQYL 1KO4A 3U4ZA 3MSXA 2CVFA 1CXZA 3CCMA 4EUNA 3T1YQ 1COWA 2I1QA 2Q21A 4NP6A 4RD2A 1TWHH 4YCWA 4DV3Q 1JAIA 2VF8A 1W36D 2WSSD 3IFTA 1CJTC 1NMYA 1E22A 1NN5A 4UPAA 1ZD8A 3CRMA 3DMNA 4CZ2A 5EJEA 2EU8A 2MSDB 4I1VA 1UKEA 4Q9HA 5F9HA 2CCKA 2P3SA 1Z22A 3QXSA 2PEYA 1F2TA 4HB2A 4GI7A 4PG3A 1DD2A 2WKPA 2ZR7A 2CVHA 3IPYA 1QHSA 1P8LA 2WJHA 4KBGA 4YC7A 4UP8A 1X3FA 1SVSA 1E32A 4G5RA 2CK3A 3SE0A 3CF5A 4OHVA 4DK0A 1OYWA 1RKBA 1Z0DA 1SMXA 4JLAA 3U44A 1Y14B 2K50A 5JJKA 2EJFC 1OXXK 4OO1I 1E2DA 2R92G 3I2ZA 1NMXA 1PLKA 5C3EG 4D82A 2H16A 2YWGA 2AXNA 4KFUA 3CC2A 1ZC3A 2UXCQ 1TUIA 3CW2A 3STBD 3S1AB 4P73A 2UUAQ 3HWSA 4LF8L 3QF4B 4II7A 3JC66 1N6RA 1VECA 5TDHA 3D31A 2DFKB 1OW3B 3OEHA 4NYMR 1KL9A 1EXMA 1AE3A 1DELA 1N25A 1N5LA 2BMFA 2J46A 4MRPA 2DFTA 2QGZA 5TB5A 1VG8A 1OKKD 2ZVQX 1Q8KA 2I5HA 4CVNA 1S96A 2BC9A 1EFWA 1QBKC 4C2MH 2WPDA 3QBVA 4P72A 4IW3B 3BORA 1RRPA 3DO6A 3EIEA 3OW7A 4BA2I 1PJRA 3GJXC 4ACAA 4ASUD 1NVUQ 4P3YA 2HQLA 5LMNW 2N3SA 2DYKA 3IKJA 2VHJA 1HY3A 4DR6L 3J80i 5JBQA 2RGBA 2C04A 2NGRA 4IFDI 2IHYA 4NTZA 1QUQB 1DAMA 3GLHA 3U9SA 1OXVA 3MXNB 1RIPA 4JI0L 1VQIA 4A3CH 1TPZA 1MJEA 1MKYA 3LLUA 4JLNA 3VKWA 4Q4LA 4MYCA 1XJ0A 1XJQA 3QVUA 1CJKC 4NKRA 1G7SA 3IIMA 1LNZA 3HOZH 1J2JA 4HB0A 2ZSAA 4NCJA 1E9BA 3D6TB 1O7LA 1UDWA 1N6HA 2ZSFA 1QF9A 1CKOA 3QKRB 1Z07A 3T1HL 1A0IA 4A92A 4RCNA 3T34A 2F1MA 2WMOB 5KSYA 2R6FA 4NXMQ 2XZPA 2ZUDA 4V0OA 4QXAA 4L16A 5IF9A 1P2VA 3QPWA 2HT6A 2QP9X 3VNVA 4XWKA 4DR3Q 5CDFE 3KF6B 2BDTA 1TQ4A 2PT7A 2JAQA 2GEVA 1WBBA 3J80c 3HDTA 3IO5A 2Z6KA 4XIGS 2GTPA 2HYDA 3LBHA 3RS0A 5GVSA 1CRQA 3GJ5A 4OK3A 5JJLA 1L8QA 1MO5A 4OL0A 4WW0A 1LABA 3T1OA 2QPTA 1E2MA 4JLBA 1YZUA 3TAHA 1CR0A 2F6RA 3AEVA 1FUUA 2BKEA 4WAUA 1GG2A 1IONA 2ZROA 2ZJ5A 2MNAA 3T56B 4UJ5A 4PZ7A 1W46A 4DCSA 3PR1A 3DDCA 4LFBL 2ZS8A 3GJ8A 1T3HA 2F52A 2ID0A 3FDIA 3NWJA 1GVPA 5DGXA 4H44C 2V8OA 4Y0AA 1SXJE 4BLRA 2D2CC 1PH7A 3PQCA 5LPNA 1G8GA 5JECA 1E7ZA 1Q3HA 5JEAH 4A9AA 2P6NA 1NMZA 3H4MA 4PZZA 2XB2A 4CW7A 2RHMA 4BBSH 2MO1A 1XD9A 4ACBA 1AGRA 2X19A 3TEHB 1Q46A 1KOFA 4DLTA 4JJKA 2Q8IB 1VTKA 3I4MH 2XEXA 4LJ8A 5CIQA 3TQCA 2RHDA 4TL6A 2OEPA 1G64A 1IBKQ 2WMNB 4IQZA 3TZUA 1QVAA 4QL5A 3BGWA 3HR7A 5AK0A 5FL7A 4ILEA 2QRZA 4AWXA 1RW4A 2JLYA 1KAOA 4IOLA 4NYMQ 4PO9A 1U9IA 4AYWA 1VS0A 1LTLA 3EPHA 2V7QA 4RD6A 2BJVA 1GUTA 2R6CA 3BERA 1GUAA 3W5JA 1ZC4A 2ZS9A 3AVXA 1N6NA 1BYIA 3LVQE 1IQPA 4KYUA 4R4OA 1TTTA 2EFEB 1YNNC 4PC6A 2I5MX 3TSOA 3BIFA 4IOMA 2FGKA 2R6AA 1AA9A 1ZNZA 1NN1A 2WAYA 1JT8A 4PC2A 1HYQA 4GSYA 5FI1B 1TADA 3I7FA 4BZXA 3SBDA 3J81i 2JJ2A 2W0MA 3EZ9A 4HDCA 1FR3A 4L8JA 2AK2A 1FZQA 2BEKA 4AIMA 1VQ4A 2PEZA 2ZE8A 5EXTA 3THWA 2HF9A 621PA 3MG9A 1NLZA 2A69D 1IY1A 2R62A 4DR5Q 3SYNA 2WWWA 3Q8XB 1VCIA 2IEZA 1E2GA 4BZPA 2EFHB 2JCSA 4ZDWA 1ZINA 2WTUA 2VPPA 4JLMA 2FV8A 1VG9B 2ZRBA 3B7GA 2JGNA 1BMFD 3BZKA 1CI3M 1IAQA 2SHKA 2VQEQ 4NH0A 2GXQA 4WXRA 3T5GA 1FGUA 3WYFA 3OW2A 1NSFA 1XMJA 3V9PA 2WJIA 1ZU5A 4JVSB 5AJWA 2ES2A 2ERXA 3OTOQ 2FN4A 1EK0A 1IOZA 1HR0W 1P9WA 2JJ8A 3F2DA 3M3YH 4I81A 1W49A 4GBMA 3QUSA 3QJYA 4JBJA 3R7WA 3RRZA 4CIDA 1KSJA 3SGIA 4E5UA 4KN4C 4JI2Q 2YYZA 4DR2L 4G3XA 4MQBA 2WSSA 3ULJA 4YONB 3ADBA 4O25A 2OFWA 3B1ZA 4Q18A 3KQKA 1R8SA 3BH7A 1GDDA 2N42A 1RRCA 2ORWA 4IOKA 4OJQA 1HT1E 3SYKA 4EFLA 5DI9A 4GLAC 4MH0R 3NE5B 1I50H 1XCPA 2IW3A 1HT2E 3P4XA 1E9AA 3LBIA 5H70A 4EDHA 3RC3A 4DV5Q 2AXPA 4OI1A 3C41J 3CP0A 4QGFA 1C9KA 4P4SA 1J8YF 1KO8A 3TQFA 5AJXA 1RFLA 4CT4B 1RE0A 3CPJB 1KI1A 2E87A 2WWGA 3LA6A 5KSOA 3JZAA 1Y63A 3Q7QA 2OHFA 4JI8L 4M2LA 3VR3A 2XGTA 4MKHA 4HEJA 1SHZA 2JA5G 3RRMA 4DB2A 1G51A 2O8BB 5GJWC 4F7WA 1Y1WH 5IYDH 1OHHD 1GUNA 2NO0A 1DXMA 3SYLA 3Q3JB 3LO5A 5FLXc 2V1XA 3U6KA 2KJQA 1OKKA 4TVAB 3C4JA 1G3IA 2HLDD 4B3TL 1EFCA 1KDOA 4TSFD 3RS4A 5JHHB 2GCNA 4ARZB 1NVVR 1G41A 1DAIA 4B6FA 3U3OA 1GKHA 1HNXL 1Y8NB 1VQNA 1YQTA 2QQEA 2GN5A 4POGA 2G83A 4ASUA 4A36A 1US8A 2BJWA 1XTDA 4DV1L 4LF6L 3OIYA 4P75A 5F2EA 4RSGA 1E98A 4A3FG 1OV4A 1NBWA 2IXFA 4NE2A 3GLGA 4K81B 5KTYA 1CKNB 2AD1A 2DCUA 4F92B 1KXLA 5KNDA 1ANKA 4X6AH 5CYOA 4A0GA 1RC8A 4RJLA 2DPXA 4LFCQ 3PCRB 4DR7L 3CRKC 4LWCA 5H1SE 1X9NA 4IDPA 2W6ID 4KSBA 3E0EA 4Q4AA 1PHJA 3WYAA 4U7DA 4HUQB 4GMXA 3NG1A 3K0AB 4A0FA 3U3MA 2OAQ1 4JBXA 2ZJQA 3K9LA 3GO5A 2KSQA 4HIOA 1M6NA 2KCCA 2OCBA 2WJGA 4B3FX 1K8MA 4DV7Q 4LFAL 4P4UA 2VO1A 2DUDA 3VTKA 4B2IA 3H3VH 5GAGC 5L3SB 3R9IA 1CEEA 2PMZE 4IOAA 1NLFA 1IYJB 3I73A 3WP1B 1OE0A 1U2RA 1Z0FA 4WVFA 2A78A 1KI8A 3GP8A 2DFNA 2FOLA 4KCGA 5KUTA 4P0TA 3H15A 4I99A 4IVRA 2REXB 4DXAA 3T12A 3TSZA 1XTSA 4JCVE 4NXNL 3A4MA 4GOPC 3AVTA 3TNFA 1W47A 2FEOA 3KTAB 2QAGC 1U8ZA 3AVQA 4G5GA 5H1YA 2FSGA 4HSEA 3TIFA 5BN5A 3BAFA 3LXRA 4I1OA 4IOCA 1R5NA 4AC9A 3KQHA 3H0GG 2ZT9C 1PA6A 4Y7NH 3AKYA 1B23P 2ZM6Q 1AS0A 2LKCA 2WFWA 2K7VA 5C0XH 2QU8A 2Z0MA 2ZJBA 4POAA 4OHXA 1LY1A 1T8UA 2QUZA 2IHEA 4M1MA 1PFSA 1RJ9B 2A5GA 3GLIE 1I2DA 1VQKA 3J81j 1AKEA 1GRRA 1KMHA 5FFMA 1FYCA 1XU4A 3ZVRA 5FBLB 3BU2A 4Y0VA 4M53A 3A1TA 2NZOA 4A3LH 2B63G 1G5PA 2CJWA 1G291 4Q1BA 4D25A 1VQDA 4OYHA 1FX0B 4JIMA 3TS0A 5FJ8H 1MABB 4OX9L 2QEQA 2GCOA 5BXQC 3FVQA 1G6OA 5H8WA 4FDBA 2K75A 2HV8A 1TNDA 1WA5A 4KN7C 4L5QA 3SJAA 3GJ3A 4OHYA 1GUSA 5A0FA 2Z83A 4BECA 4DUZL 1IY2A 4YLGA 4GP6A 1NVVQ 2QGNA 4LJZC 1XMIA 5KNCA 1VQEA 2PCLA 3KXIA 3UMSA 4DLYA 5IT5A 3SBEA 1CF4A 2ZUBA 1G9XA 3EXAA 3UDGA 3F3YA 1R8QA 2VF7A 4QC2A 1N5IA 4QOSA 1FFHA 3HOUG 4NPHA 3W1GA 4NZYA 2DWPA 4Q66C 4RFSA 3U7EB 4B74A 1B9MA 4A3FH 3D0FA 1XNQQ 1WBDA 2O8FB 5IYCG 1XTJA 2VL6A 2V54A 1X3EA 4FW9A 4OI4A 4Q4JB 3PIRA 2IS1A 1V5WA 1L2FA 2CHVA 3A1VA 3CRQA 2RGEA 2C9OA 2ZTSA 2OXRA 1F2UB 1JJ7A 1XZQA 4PHFA 1BMFA 3LX8A 2XTNA 1XTIA 3L0OA 4CDGA 3S1QH 3BJIC 2GJSA 2GVDC 3UE0A 4KLZA 5DSZA 2FX3A 4RZ2A 4DR4L 4M1OA 3K81C 2DR3A 4R4CA 2BE5C 3A8JE 4AYBE 1II8B 1GHKA 4DV6L 4PMWA 4PZLA 1P6XA 1AE2A 1B0UA 2JA7G 4Q4HB 4I4LA 2VHQA 1BKDR 3MRSA 1SKQA 2EW1A 1W4CA 1FJGL 4NMMA 4QJ5A 2DFLA 1E24A 2MFIA 1KQSA 4URWR 3IRBA 5HE9A 1NIPA 2D0OA 3EW9A 2C2HA 2DHRA 2UUBQ 3EASA 4DV2L 3AVUA 1I4DD 3LGJA 2NZ8A 2GK7A 3UANA 1CTQA 1DTSA 2OT3B 4Q02A 1W7AA 3OIWA 4XVQA 2REBA 4A3GH 2WAQE 4C9BA 5K8UA 1SVWA 2NN6G 4B3RL 1HTPA 3ZVNA 2Q2UA 4U02A 2IHFA 3AM1A 5L3RA 2QP4A 3I72A 2R6GA 5GJVC 3KDFA 2UU9L 2VNUD 3ZZ0A 3EPKA 2VP0A 3CCRA 4LUCA 4LF7L 4PSVA 3RRYA 3U3RA 2C98A 3BJUA 2BEJA 4LBYA 1X8LA 4O0MA 1SFOH 2O8DB 1JPJA 1EWIA 1YVDA 4BFTA 1ONLA 3BFXA 1NG9A 1ZM4A 2IY5B 2ZI5A 1J5EQ 2CLSA 1HZ9A 2OILA 3K7AH 2N8NA 5HY6A 1OHHA 2F43A 4LBVA 1S3OA 4UQOA 3S14H 4C30A 4PPFA 4QY7A 4PC1A 5FPHA 1OIWA 4TSFA 2ZSBA 1GKUB 3CQZH 2HLDA 3J7A5 2OBMA 4LBWA 3CMEA 1D2EA 3CH4B 4EPTA 3KKQA 5J40A 1HQCA 4XSHA 3W8RA 3LVRE 1WCV1 3KKMA 3K0CA 2XAUA 3OEED 3T35A 3NHBA 4BY1G 4UNPA 2JEOA 4ZDJA 3M4YA 4Q1CA 3QKSB 4B43A 2J1LA 1A2BA 2J7KA 2E9SA 1T6NA 3AV0B 4FI3C 2EXDA 1UFQA 4KHPL 4AG6A 1XBTA 3W5OA 1NN3A 3GFOA 2CQOA 4TTRA 1EX6A 5AUPB 3TQYA 1HE8B 3J81k 1A63A 4URUR 1U9IC 2AHOB 1NRJB 4A8JA 1L1OB 1N32L 2WV9A 5LMNQ 2W6IA 1ZM7A 3QBTA 4TT3D 1WQ1R 2OCYC 3G5UA 4OQNA 2PQAB 1GRQA 2JEBI 1YJ5A 3KX2A 1A6XA 4DNIA 1KI4A 2O8EB 1KI2A 1UM8A 2AFHE 3SZRA 4X65Q 3E9HA 4DLWA 4Q9IA 4GKKQ 5A4JA 2FPLA 1XXHA 1KK0A 2C5LA 4XTRA 4H0LC 4POFA 4XWAA 3O8DA 1WDTA 5J47A 4BZQA 4QM6A 2D4HA 3K1JA 1K5DA 3KDSE 2OAP1 3B82A 2GBLA 4V0LA 5JRJA 4TMXA 1LF0A 5CK5A 3GTGH 3M9BA 1Z9FA 2YU9H 4A3EG 3KFVA 5C4XH 2Q3MA 1TU4A 4DDVA 3T61A 4DV4Q 3QIAA 1GUGA 5EE5B 1E2WA 5LBIA 5CB8A 1YI2A 5AUQA 1GFIA 1Z2CA 5JEDA 4JOIA 5LMUQ 1DAKA 1YZKA 2FF7A 4CEJA 3NKVA 2NO6A 1SXJB 3SFZA 4A6XA 2LMCB 4TTPA 3A4LA 4CF7A 3PEVA 2HHHL 2Y0SE 4N3NA 4MUBA 5FOTA 1KSGA 3SOPA 3ZQ6A 3PUYA 3BH0A 3T51B 1Y3AA 2R6DA 3A8TA 3C7KA 2F1HA 3LH5A 1M7GA 1XZPA 4PFSA 4URZR 3GEHA 1BVSA 2G6BA 4ERNA 3JVUA 1BIFA 4Q9LA 1MKHA 4ESVA 1RPZA 4D81A 4A2QA 2O8CB 3UDIA 4MDEA 1U0HC 4B75A 3ZS8A 5SZIA 4H13C 4RCZA 2J45A 4JKYA 1HH4A 1NI3A 4Z54A 3FKIH 4MGIR 4B3SL 4BASA 2D2FA 4EJSC 1MO4A 5HE8A 4ZIRA 1BH2A 2ZITA 3G48A 5FTLA 2VZAA 5FUWA 4BEJA 1L2TA 3U7GA 2XITA 4DLSA 4P33A 1HQMC 3MAAC 4R2IA 4TL8A 3B6YA 3CCLA 5FPKA 1CJMA 3UDXA 2VP2A 3FFBA 1S4QA 1ZCBA 3QPVA 2VUMH 4M9ZA 1A82A 1P62B 4NBSA 4DVGA 3DKPA 4BRUA 3PIOA 2A68D 5BQ5A 4LW1A 1Q1QA 2WJVA 1G18A 2NO9A 2ZYWX 1NP6A 4H1UA 3UWOA 3EPLA 1FP7A 4C4PA 2QGQA 1DEKA 1NSTA 1K8OA 1M90C 4ZCMA 3RN5A 2WJJA 2ASEA 3K9NA 2QP3A 3TK1A 4DIDA 4X64L 4PPNA 2ZJ2A 1IHUA 1OB5A 1R4AA 2ZRKA 1NKTA 1XNJA 5C4JH 3FKSD 5AR1A 3PITA 3RANA 1M74A 4QL3A 1GL7A 3A5UA 4DAYB 3U2QA 3JZMA 3PO2H 3CRLC 1JEEA 3A1SA 1ZW6A 3AGPA 4OI2A 4KBFA 3GTOH 1ZM2A 3EBEA 5J5CA 5JCZA 1KGDA 2XSZD 2QRNA 1T0JB 3CCVA 3WBJA 3EIVA 3I1FA 1U90A 3FFAA 3WXMA 3CNNA 3U6BA 2N1BA 1KI6B 1E2ZA 2B8FA 4DV3L 1E94E 4YHHQ 1GUOA 4NHOA 3EX7C 1EWHA 1L4UA 2IA5A 1IYVA 1OFUX 4R4IA 5KSPA 3GLGE 2WWIA 1JE5A 1VHTA 3B60A 1K9MC 1XEWY 4QBGB 5M5WH 2GRJA 1CP2A 4UY8C 3G82C 2A8VA 3RS3A 3L7ZC 1E2NA 5GADC 2W83A 1Q82C 2FPKA 4M21A 3A4NA 1YHNA 2NVQH 3G4SA 4M9QA 4XVUA 1HR0Q 4LHZA 5TMPA 1Q90A 2UUCQ 1IZ6A 2A6ED 3GTMH 1D6JA 1OFTA 5J4YA 1E1QD 1FOEB 3W90A 2R65A 3A1UA 4K8OA 2UUAL 1IXRC 2VH5R 2NO1A 4BFYA 3KJOA 4A3IH 1QG2A 4US1R 2J0QA 4O2LA 3A0JA 3N2EA 4FXPA 3S2HH 4G7ZC 2VSFA 1XPRA 3K53A 3P27A 2YZ2A 3F8TA 3AF2A 3PG5A 5FOWA 2VY3A 1EGAA 2UZ3A 1E0AA 2E8GA 4QJFA 1XD2B 2IYQA 3TSWA 4YMTA 4H02A 5JEAJ 1RRGA 2FZLA 4UXIA 5AJ3Q 1P60A 3HR8A 3VR1A 1C9OA 2ODNA 2BBOA 5M3MG 2ORVA 3I4NG 1ASYA 1TUEA 3N6RA 2GWHA 4JLPA 4MRVA 2W2VA 4NYJR 1DPFA 5DN6D 2JQOA 2E5LQ 5P21A 1SVIA 3OEEA 3PEYA 4OJKA 1Z6GA 4DNTB 2ZTCA 4KXFB 4TLBA 2ZJZA 4KODA 1Q1ZA 3AYHB 3HOVH 3DPUA 3ZQJA 4C3IH 1ZP6A 1BS1A 3EZ2A 3TGPA 4DR1L 5FBWB 2MQHA 2GCPA 1NL3A 2A5JA 1Y8OB 4MRRA 5EP2A 4BFSA 1JB7A 4IOJA 2IWRA 3LDAA 2JLUA 4KKUA 4HATA 4PC7A 2ZJ8A 1YZGA 1JALA 2ZRAA 4K0KL 3NXSA 4MGYR 5CJ2A 3A5ZB 2J3EA 4JI6Q 4XWOA 4RZXA 2H5XA 3EG5A 2GA8A 3Q7PA 3H86A 2BDOA 2FSHA 2KB0A 2NZJA 4BRWA 4TZ6A 4KJZA 4B3BA 2LWIA 5FBRB 2BMEA 1Y8PB 3DEFA 1A4RA 1ZNXA 2R8RA 3VMFA 4QJ3A 2OG2A 4JVNA 1PVOA 1KO7A 2PCJA 2PZEA 2GJ8A 5E3HA 2XGJA 1FNMA 1W4RA 3ZD6A 3CPWA 1MRSA 1NN0A 2WZQA 3NC0C 1WXQA 2GVBA 3LXXA 1U94A 4IXNA 2ZETA 4OO1G 4LV8B 3THYB 3WBKA 2V1UA 3MWLA 3U4VA 4HLDA 4AKEA 3K70D 1CSQA 2WB1E 3QF4A 1LF5A 4HZUB 1G21E 1HNWQ 2A3RA 3FHWA 3NTUA 4B2PA 1CUKA 2FA9A 2XTMA 1BDOA 3CUEF 4CGZA 2PMDA 4GMDA 5IRCD 2PX0A 4HJ8A 1XMSA 5FOXA 3CNOA 4QBFA 2BV3A 2VP9A 1IYUA 2YWHA 4N0EA 3A8IE 1EOVA 1GVNB 1XPUA 1XEXB 4GOPB 2H7VA 3NDPA 3THXB 2OQ0A 2QAGB 1X65A 1LS6A 2F9LA 2WSMA 5D3MB 1JBKA 1WI5A 1KI7A 4RZUA 1IL2A 4Z51A 5L3VA 1IBKL 1TWGH 1CBUA 3C16C 1G5RA 1X6OA 2IYVA 4IFDG 3DLLA 3S16H 1XJCA 3AUXA 2H92A 3CF0A 2J0UA 4X66L 1XMVA 3B85A 1YR9A 3DM5A 3P20A 3I8XA 4EKDA 1N2CE 3S1NH 4JMPA 2A30A 4QGAA 5J4HA 1YBYA 2IX0A 1N0VC 1Q0UA 3W9YA 4DV0L 1CJUC 1NVXQ 4C0BA 1G19A 1EG7A 2JA9A 1JPNA 1L1OC 2IYZA 4YMSA 4LUOA 2KE5A 2E2JH 3KJIA 2VQFQ 1H9JA 1WCMG 1UF9A 3H84A 3OE7D 5KNBA 4NYJQ 5JLJA 1VYUA 3RAPR 1M34E 2K33A 4JYAQ 2QY9A 2YOHA 5HR5A 4E22A 5JS8A 4S35A 2K5VA 2HT1A 5IP7H 4OKSA 5AJYA 3WNDA 4LUVA 5B64A 1UE5A 1VIYA 5CLLA 5C44H 3PO3G 3KFXA 3U60B 2IXEA 4YMWA 2EVWX 2IX1A 3EZ6A 3T5DA 1IBLQ 2R7ZG 3I92A 4DJTA 3THOA 5GAEC 4HJ5A 4CEIB 4LBZA 3FKSA 3KJHA 1N5JA 2C77A 2CMKA 4RD0A 4BY7H 1H8HD 2EJMA 2XB4A 2YWEA 4HZIA 5HCNA 1AS2A 5KSZA 2L15A 3CF6R 2Y8EA 3WY9A 2KBNA 4LCBA 4TQAA 1PV4A 1Z28A 4JLVA 4AK9A 2AK3A 1TXYA 1SLJA 3PIPA 3ZZTA 3B9QA 4C2TA 2XSZA 2BBSA 1M8PA 1GNQA 1YR7A 1CKMA 3MJHA 3GJ7A 3IHLA 8OHMA 4C2UA 4HYYA 3CC7A 3KB2A 2J41A 3Q72A 5HCIA 3I5YA 2HXYA 4JI2L 1SXJC 1F3OA 1HEIA 3X2SA 4LHXA 2Z5FA 2F3RA 1NVWQ 2ZRPA 1Q81C 3ZZUA 1P9RA 3IQXA 2K4KA 5E7NA 2JA1A 1VQOA 2XTZA 2RCNA 1TU3A 3FGNA 3BDOA 3GLHB 4DKXA 4XOIA 2A5DA 2Q3FA 4PO1A 1KAWA 1KHTA 3VU9A 2IF2A 4F4CA 4DUYQ 2GZHA 3S1MH 2EFCB 2O5VA 4Q47A 1P2TA 3SJCA 4DV5L 3U5ZB 1SRUA 1PH2A 4M0LA 2B3GA 1T5IA 3W34A 4F4JA 1E2LA 3EWAA 2YV5A 4RG1A 1VQMA 4A82A 4C0AC 1S8FA 4MZ9A 1ONBA 2K32A 2CLCX 3EZFA 1E0SA 1W0KD 1OTCA 2LXKA 3GJ4A 4Q9KA 4A15A 2D7DA 2W0SA 4G0NA 1O3YA 1E1QA 3A6PC 1R6BX 4UJ3A 2R92H 3EIHA 1QHNA 4X8HA 5C3EH 1MV5A 1XXHE 3LW8A 2RGNA 2CHQA 1VDZA 5DHAA 3VX4A 4LJ7A 1GIAA 3L2PA 2F4VQ 4YDSA 3TMKA 4G5QA 1HCZA 3K8AA 3GLFB 1GO3E 4CEHB 5EQTA 3E70C 5FTMA 1ZYRC 2ZAMA 3ZDQA 4HUTA 3LV8A 4GKJQ 1IN5A 4L5RC 1FPMA 2Q9BA 2ZREA 2CXXA 4QHTA 4F91B 2XZLA 1VQLA 1XNRL 5C0XJ 3K80C 1VQCA 1P2UA 2CE2X 2ODBA 1NY4A 5EUQB 1M7BA 4EQ6A 4IDNA 5KDOA 4ALPA 4LF8Q 1J99A 2C95A 5DN6A 4JI1Q 5K8LA 3L2OB 2ODWA 1QG4A 5M5YH 1TF7A 3U50C 2AKYA 2GF0A 1G5TA 2HUPA 2RGAA 2JA8G 4XJXA 2OM2A 1NIJA 3BRWD 2IYUA 4GZMA 4HLUA 4LX0A 3KJGA 3OFND 3VHLB 5HKKD 1OH8A 1LV7A 5FTJA 1LYLA 4UP7A 4NCHA 5EXPA 1NE3A 2JASA 3PEUA 3MMPA 4HI0E 3BWDD 3DZ8A 4G1UC 1G4AE 5KU1A 2VSOA 3ZVLA 2XOKD 2QEXA 4GOXA 2JDID 2ZI3A 3REGA 2EDGA 4JC0A 5IWAQ 5JMTA 4DV7L 1OLOA 1MOZA 4DR6Q 2B8WA 1Z0KA 2VIIA 4LK2A 4LYJA 5DH9A 1F5NA 2PCFB 4IRUB 3MWYW 5KDLA 4DB4A 4LF9L 1D2NA 2A5YB 4FCWA 4JI0Q 1BKBA 2LSSA 1CJVC 5IYBG 2O0KA 1ZYUA 2WAXA 3QF7A 4HDOB 5G3YA 1NNEA 2RGDA 3QPUA 4R2HA 3J81c 3IGFA 1VYTA 2VS1A 3FMIA 3TAUA 1KDPA 4K46A 2ASBA 4QM7A 1W48A 4RKFA 4TMTA 5EZ6B 1NMFA 1S72A 5TY0A 3NBZC 3U4QA 2EIFA 4GN4B 3T1HQ 2ZYVX 3IBGA 4LRWA 3RN2A 1KKMA 4RMFA 1U0LA 2OFXA 2JJQA 4DC9A 1E99A 3ER0A 1MR3F 1TX4B 3THWB 4B3GA 2O8BA 1Z0IA 3FOZA 3SFVA 2XTIA 4KSCA 3UIEA 1AZTA 1TWFH 4L5BA 4ARZA 2OTJA 2ZJYA 2QG6A 2IYTA 1L4YA 2BCJQ 2GF9A 4TMKA 1G4UR 1W5SA 3KB1A 2OBNA 1VIAA 1EUJA 2C35B 2D06A 5FOVA 2IS4A 4MKIA 1YJNA 4PAQA 3W5IA 3ZJYC 2KCTA 1H9SA 1FMJA 2ZYTX 5HPYB 2ZPTX 3AP3A 1CKNA 1Y1VG 3TBKA 3X1ZA 3ADDA 4MYUA 2OFOA 1KZ7B 2WICA 1NJGA 4B32A 5JRZA 3R7WB 4DBLC 3KLRA 1IBMQ 4OHZA 4AYBG 1ZVQA 3VDYA 4KI0A 4P32A 2XX3A 3K0AA 3ECCA 1NJFA 3F1ZA 3TUJC 2AFIE 4ITRC 4BPBA 3ERSX 1X1SA 4F4IA 2BOVA 1K73C 1IN6A 1MH1A 3H1TA 1VQ5A 5C0XI 3TVDA 3RC8A 3KLWA 2CL7X 2A6HC 3NEJA 3D3QA 4W7SA 5CM9C 4EJSB 1E96A 1YEZA 2VRWA 1XNQL 4B35A 1ZBDA 4P4SB 4L5TA 5L3SA 2JA8H 4LYAA 4WXPA 3L8YA 1CSPA 4EIWA 2ERYA 4PSKA 1OPXA 1ZUNB 1U98A 1I5FA 5SZKB 3UPUA 2E2IH 1ESNA 3GD7A 2WAQG 1J6QA 4FCVA 2TMKA 3CBQA 4JI3Q 1ZM3A 2VQSA 4OQLA 5DLQE 1HZAA 2F3IA 4AKGA 2IT1A 1IN8A 1CLUA 4JT2A 4DK3C 2NOAA 2B8TA 1OIVA 4HAVA 3X1YA 3B5JA 1W4BA 2ZQ5A 3KTAA 4D80A 1T9HA 1H8HA 3VNUA 2ZTDA 1XMQL 2YINC 2D74A 3ND8A 1WP9A 2HF8A 2P5SA 3CH5A 4OONA 4KLNA 1QRAA 5CLQA 2ZI7A 4Z8YA 3M1IA 2O8EA 2G3YA 1E4VA 1VQFA 1X3SA 2EWWA 3QNUA 1SZPA 5F3WB 2AKWB 1Z6AA 4BBRG 3DOFA 2QAJA 1US8B 2NO7A 3ZH9B 2GDJA 2QBYB 5EE1A 1RJ9A 1HA3A 4PZ6A 2PMKA 2CWAA 1K3RA 4ZO4A 2UUBL 1F48A 3GLGB 2ZJAA 2N46A 2N49A 1AN0A 1N6KA 1OIXA 1Q22A 1RYFA 2XJ4A 3C5CA 3MUFA 4DUGD 4IDQA 2N78A 3PUWA 4HIDA 4HJAA 1T5EA 3EA5A 2DNEA 3DM9B 4IEEA 1CR2A 4A3DG 2IYXA 2ZR0A 1T3LA 1V43A 1G7TA 1XEFA 2AL7A 3NHAA 4Q4AB 3TVTA 4BWYA 2RH5A 1VG1A 3HOYG 1Z5ZA 2OO7A 4OWWB 3IDQA 4IPGA 1W0KA 2A7QA 3FTQA 3B8HA 2D2EA 4LI0A 1YJWA 4D4JA 4LJAA 3M0EA 2AWNA 1XRJA 1J5EL 2ZRDA 2LXJA 1OT3A 1YZTA 2GESA 4JL8A 2JA5H 5FTNA 5JWHA 3P32A 3SI7A 2W58A 1K8RA 2EYQA 1UE6A 2GAAA 4I7ZC 2ZYUX 4DAMA 1H8ED 5DYIA 3ICEA 2QL6A 3K7UC 1ZAKA 1OH5A 1TWCH 2BWJA 4Q4JA 4CRWB 1A7JA 1K6MA 4RY2A 1IJFA 4JI8Q 2B7CA 3Q5DA 2OQKA 1KAGA 1P5ZB 1Q1BA 3CW2C 1TF2A 1CFMA 3CC4A 4BE7B 3RNUA 3GTKH 4M22A 3A37A 3RSOA 1Q7YC 2V6IA 4KHZA 1FP6A 2PPBC 3BG3A 4JK1C 3B13B 1X56A 2JLZA 3I32A 3CLVA 3LWNA 3X1DA 4B48A 2V9PA 3OFNA 1II8A 4EPYA 5HKKA 5FL3A 1SKYE 3AVYA 1PH9A 3RDPA 1JECA 2DNCA 2PI2A 1E9CA 3Q8DA 2IXGA 3CF2A 1Z7TA 4Q4HA 5JSZA 1HNXQ 1HV8A 1KMHB 2B92A 2XOKA 4JI5Q 4MITA 1YZQA 1XD8A 2GZAA 2JDIA 3E2IA 2Y0SG 3PJRA 3P1JA 4X65L 4DV1Q 2PJZA 3AEZA 4L15A 1VHLA 5JFGA 5IE8A 4GKKL 1OJLA 1G3UA 2OCPA 4MGKR 1C7YA 2BH8A 2GNOA 2RMKA 3SJBA 1JI0A 2GCOB 4YXWD 3HGBA 5EE3A 1C4OA 3REFA 2K52A 4WJ3M 3NBFA 1O87A 3UATA 1SN8A 3KOJA 4HAZA 1VF5C 1MT0A 5A35A 3CCQA 1E2JA 1NG1A 2ZRJA 3ASYA 3ZGXA 1G3MA 3A1WA 1FTNA 3AQQA 4BBRH 3IO3A 1N8RC 1P3JA 4B33A 3KQUA 1KSFX 2G1KA 4LFAQ 2O5JC 1Z0AA 3WNCA 2XNDD 4C0JA 2ZJPA 2NQ2C 1N36L 2J7PD 1N9WA 5LMUL 4IXMA 3H2YA 1N5KA 5EE0A 3QSYA 3A7AB 4ZCLA 3G0HA 3B1VA 3T1TA 2Z6KC 3DL0A 2JLVA 3H0GH 2X2EA 4IVQA 2AKAB 2OWOA 5EAYA 1G8FA 1E79D 1TKWB 1I2MA 5DI3B 5F98A 1NBMD 3ZYCA 1GILA 1KTVA 1G7RA 1D9XA 1XEWX 4JI7L 2PH1A 3E5HA 3PFIA 5B2ZA 2WOJA 4LY6A 4P71A 1QVGA 1VQBA 4NXNQ 1SVKA 4A3BG 1TF5A 2QTFA 3LBNA 3TW4A 3F2BA 4ZV4A 3O8CA 2Q9CA 1GITA 1R0YA 4JLOA 2IS6A 5DIFA 1IXSB 1GNRA 1VQJA 4TLEA 2PLRA 3P4YA 1YVCA 2B63H 421PA 4W5HA 3OZXA 1H9RA 4LF5L 4M1KA 1N3BA 4Q00A 3I4LA 3CCJA 2D7CA 5FPYA 3RNLA 3BOSA 3ZIAD 5L8VA 1QVRA 4QHSA 2GK6A 3ZS9A 3U61B 3AF4A 4LJYA 4ABYA 3BZCA 2UXBL 3UKDA 2PQAA 1HZBA 4OWTB 2ZI4A 4TMVA 5CITA 3HOWG 2VTKA 2W2XA 3ULLA 4OQXA 4KVGA 4YMUA 4DT1A 3VR6A 2QF7A 4B76A 4D4LA 4DRZA 1VQ6A 1LTQA 3GEEA 4DKAC 1ZIPA 1AJEA 1KNXA 1PH6A 3NELA 3BXZA 3HOUH 1U5KA 5E7IA 4XH9B 4B2LA 4D0NA 2D0PA 3C8UA 2I1VB 1G20E 1DAGA 1E9SA 2FSFA 3KDFB 2IYRA 4TWZA 4Z8XA 2YC4C 4C3ZA 4AYXA 4TYWA 1DE0A 1FL9A 1HTWA 3QXCA 1J8MF 4A3JG 1MO3A 5IYCH 2GZDA 4LUZA 1H65A 5TARA 1H9MA 2WIBA 1IW7C 2UVQA 2CBZA 1YHQA 1VQ9A 1T0HB 2W2TA 2YWFA 4QRHA 2WHXA 2ANBA 3U7FB 4IJHA 1Z47A 2CDNA 3BC1A 1MIUA 1N6IA 2V1CC 3BK7A 2F43B 3FMFA 3FYHA 4TLDA 2HIXA 1Z29A 3R8CA 1SROA 3WHKA 4B34A 4OI0A 3S17H 2GXSA 3T1QA 3CM0A 1VQGA 4GL2A 4RVCA 3PF4A 3KUCA 4NCNA 3I4OA 4A93G 4MA4A 2IWHA 3WYGA 3TW8B 2GKSA 5CIWA 2YOGA 1G3QA 2ZVPX 1GZSA 3KF8B 2JA7H 2QM7A 3A8KE 1Q12A 1E69A 4A0RA 4LHWA 3DXJC 3X1XA 1R10A 4D0GA 1S3SA 1UKYA 3HOXG 1U99A 5K36G 2Q9AA 4BXXG 2C9CA 3EIQA 4U00A 2CL6X 5H68A 4B47A 3UDFA 2RF4A 2NPIA 2ZI9A 5EP1A 4LHVA 4DR4Q 1W3SA 5BR8Q 2WWFA 4L4UA 4DUGA 2NPFA 2UUCL 4X62Q 2WBLC 1IM2A 2OSBA 4Q7MB 121PA 2KHIA 1GD7A 4URVR 5LDDC 1KK3A 4KVAA 3CX7A 4BQSA 3MJRA 5J4VA 5K8TA 3TLXA 4EPWA 4B73A 3LNCA 2NN6H 1PH8A 3IILA 2CE7A 4JBYA 1TQDA 1VCMA 3CKLA 2JE6I 3RS2A 2ZR9A 1SVOA 1KKLA 1XPOA 1G8HA 1XFAA 3HU1A 1W36C 3WWVA 2FWRA 2ZE5A 4JT4A 4M1WA 3QI2A 4DV2Q 3GJ6A 2BHRA 3PUZA 4M9XA 2I4IA 4C7OB 2C8VA 3KJPA 1HNZL 2DWOA 2HEIA 4DLUA 1HPCA 5IP9G 4BUJA 2ZRCA 3GFPA 5AJ3L 4HLCA 4M1TA 2EWVA 3VHXA 1H8EA 1YR6A 4V0MA 4KYIB 4JI4Q 1CTMA 1VQPA 1EX7A 5LB4A 1A62A 5J4LA 1LM0A 1WFQA 1YNXA 1I94L 1KNQA 4E07A 1IY0A 4A75A 1ZUIA 2XJ9A 5JEEA 1PYBA 3STBC 3VR5A 4LNQA 1LUZA 3S1RH 4BY1H 1R2QA 2KWIA 3QXHA 4B3XA 2NVYH 2Q2TA 1E9FA 4DLRA 2WB1G 5M3FG 1XMOQ 1Z6XA 4JBMA 2JA6G 4FMDF 5G40A 2ZUCA 3CWQA 2W6JD 2VP6A 1EFTA 2J5XA 4DLVA 5HTKA 3RSLA 4KFRA 4FINA 5KOYA 1KI6A 1D8TA 1GAJA 5F9FA 1LB1B 3AQ4A 3RWOA 4JJZA 1X86B 2B21A 2X8AA 4A3MG 4DSUA 2J0VA 3LRPA 4KFSA 2CHGA 4RZ3A 2EYUA 3VA7A 3HP1A 5DNYB 5ELXA 2DB3A 5BYKA 4HB4A 1HURA 2FU5C 2BE5D 1XF9A 2FNAA 1D8LA 2VHCA 4G5SA 4PO8A 4L8GA 4XTCS 2O52A 4UXJA 1Z8FA 1B8AA 3BE4A 4ZKEA 2JLXA 2YJTD 2BIFA 2ZANA 1CU1A 5EUMA 3SS8A 1SVLA 2A1AA 5KPJA 4MRNA 3T1YL 4KHPQ 4WBSA 4YY3Q 2DN8A 1YKSA 3ADKA 3K0EA 3OF5A 1TEXA 4G01B 4TKOB 4YXWA 4B71A 1QZXA 1S1CA 4MYHA 1Z3IX 3BD9A 2BA0A 4YWMA 1KK2A 1T3SA 1B7YB 3CPHA 3L0IB 1N32Q 3LW7A 1GM5A 3CNLA 4DCNA 5GADl 1DVRA 2JLQA 3GEIA 3EPJA 1X54A 5A5GA 5B57C 4DWJA 3QVVA 3TJZA 4YCVA 1HNWL 4TL9A 2E74C 4A3EH 3GCGA 2OLKA 3I3SR 3FB4A 3GFTA 5IY0A 3AF3A 4P31A 4AURA 3HKSA 2XNDA 2AUKA 4V0NA 1R0WA 2J7PA 2IYYA 3HOXH 5K36H 2X2FA 4LWZA 5AJZA 1X3GA 3B2EA 3I62A 1K8GA 4KLKA 1QHHB 2FZ4A 1XD2A 4ZKDA 3K0FB 2IEYA 1Q44A 2BBTA 1JR3D 3OIVA 2UXCL 1BYUA 2FSIA 3DMDA 4Q21A 4S2EA 3S2DH 3X1WA 4B6EA 1ZIOA 1HJPA 1N34Q 1E79A 3QOFA 3G71A 3RLOA 2FEMA 3I55A 2J59A 5LD2B 1S40A 3LAWA 4M9SA 1UE1A 1WOCA 1EWRA 4HLQB 4JSYA 2JJ1D 4Q03A 1GNPA 4PHHA 3BH6A 1KO1A 1II9A 3BFVA 2OXCA 4R7ZA 4A3KG 3MXUA 1BO6A 2CEAA 2DGYA 1JJVA 4GLVB 5ELNA 1DS6A 2RGXA 3DZDA 3GTJH 2QMHA 3IPXA 3W3ZB 1NMGA 1ZD1A 1QVFA 3HPRA 2QMOA 1YE8A 2KBEA 4PR0A 1TL7C 1KRSA 4NYIR 4BLTA 1XCMA 1PH1A 2IS2A 4LV6A 1RL2A 2AUJD 2HHHQ 1VMAA 3L82B 3ZIAA 3IHWA 4PX9A 4ZI3A 4MDFA 3CPFA 3NH9A 1T4GA 1R5BA 4M8NE 1AM4D 5HZHA 4A4IA 1AH9A 4L9WA 2XXAA 3RR5A 2WVJA 4GDFA 2VQFL 2CCJA 5KDDA 3JAMi 4WZBE 4DZZA 2GEUA 1SULA 1E9DA 1LS1A 3E1SA 3I8SA 4Q48A 4JYAL 1RZ3A 1I6HH 2C9YA 3SDZA 4GNXA 1OF1A 3LQQA 2ZJOA 4LF4Q 4XVRA 2V7QD 4KU4A 4ZCIA 721PA 4Q1EA 4BEBA 4QIWE 2ORIA 3AFPA 5M3FH 3CIOA 4B3SQ 3GQBA 1E3MA 3QXXA 1IBLL 2QE7D 3HKZE 4BFWA 2FFHA 4TT3A 2ZI6A 4NXML 4GLXA 3GDEA
chains in the Genus database with same CATH superfamily
3N2IA 5CYPA 4FWIB 3WFZA 5CG1A 1L4MA 3G2MA 3FWHA 2B7BA 1Z7WA 4INPA 2M1ZA 1V9PA 4J15A 1DAEA 2ZS7A 5FR2A 3N2YA 5TQ0B 2BZSA 1CA6A 3UZUA 3CPEA 3DDWA 2IX3A 2F4VL 4J49A 4YK7A 1FUKA 4CKYA 4BBSG 2C07A 1P0IA 3TZKA 1TS2A 5HURA 3HJGA 2WHYA 2ZBVA 2Q2IA 4Q3EA 3HRZC 2DLNA 2VSXA 3CUVA 3I4NH 4CEIA 5DXJA 3VV3A 3BE8A 4JV5Q 6REQA 3TSSA 4QKQA 1Z75A 3GJQA 1EUYA 2P11A 5K0EA 3QA9A 3WMEA 5CCBA 1GL9B 3OWEB 3IOEA 3DBIA 5DSXA 4ARIA 5CB6A 3HDGA 2R79A 4COKA 3GLFA 9ABPA 1FQWA 3TREA 2E75C 4J9UE 3UJ9A 5EPLA 2I0QA 1EFRD 1PTOD 2C7PA 3FJYA 4YLEA 1E9EA 1HE3A 1RCUA 1R9TH 1V16A 5EJ4A 1QH9A 1YAHA 3RVOA 1C9EA 4FGZA 3R0VA 1GRNA 5CAEB 3DG9A 3S6JA 1NM5C 3TLMA 4BVFA 1FW6A 3LCVB 2G09A 2OKCA 3G0GA 3L3OC 5AXDA 1UMDB 5L7WA 1UAPA 3TRFA 3EIOA 1KEPA 4WK6A 4V39A 1X7ZB 1T2NA 4DEVA 1JLLB 4B6SA 3GRRA 3LVBA 4ZYYA 4EQ6B 1FFCA 1XTKA 3K0BA 4MYTA 4HQRA 2XGGA 3D81A 1TMKA 4EYGA 4MHSA 3RLFA 4WK2B 3EXEB 2PY6A 2IOYA 3IEUA 1Z08A 1QO0A 4RTLA 2P2SA 4K05A 3K2BA 3DC7A 5FBQB 1B00A 1JPUA 4LWOA 1CUGA 5MHTA 5I7FA 4R84A 1TM2A 1PFGA 2VT3A 4YT8A 4TOIA 3SQLA 1SYFA 1PGPA 2HRBA 1Z0SA 2XVXA 3GO4A 1PBTA 1LVUA 1I4WA 5IYBH 1JDSA 5HILA 5BOSA 3NRJA 4MUYA 2WWVD 5FNVA 1E1RA 4JBIA 3O9MA 3DE0X 2P5YA 5A62A 1MABA 1D4AA 4CHTA 5HG0A 4NXMB 3MCWA 3TR0A 3FVTA 1ECBA 4M9UA 1V96A 2N9UA 3FPPA 2OLJA 3TOSA 4RQBA 1LH0A 3DCNA 1DZ3A 2KQUA 3SR0A 3BJMA 5DNUA 1OYYA 3N7AA 4QASA 1ZY2A 3AFIA 3GPLA 4B85A 5AESA 2VYCA 4Y0NA 5BWNA 3TDMA 3NVKI 3RSQA 3ZD7A 1C0KA 2PBLA 2ECFA 2HMUA 1P2GA 2VSQA 3K8YA 2O2CA 4IO0A 1B53A 4B9WA 2A68C 3A25A 1E92A 3CG4A 3SY8A 4YAIA 3MXGA 2C4VA 1KF0A 2WM9B 2VCHA 4CQMA 2Z8YA 3BA6A 4OHUA 1J23A 4YUZA 1B3BA 3NDIA 5FJIA 5BMVA 1ZA2A 1O5OA 1PFMA 4EG1A 1ZG3A 4Z4QA 3R77A 3CRW1 2B5WA 5EHGA 4YJ3F 4GQBA 5FUXA 3EAQA 3G0CA 3WGTA 2ET6A 2R00C 3BBPA 4B3CA 1UJ5A 1F20A 5ALNA 3KQSA 2RC5A 1UNSA 1O96A 4ENTA 1E6CA 1PTJC 4HDQB 1KP2A 1VQAA 1W2HA 3TM4A 3LP8A 4L08A 4CKXA 1YZ6A 1ET9A 1WB4A 1HE5A 2VLIA 2NYUA 4QYXA 3QY9A 3KCNA 2ZAIA 2HL6A 3NH6A 3K71B 3EXFA 4NJMA 1DQRA 3RI3A 4TM8A 3TNJA 1COWD 1JA9A 1NUPA 3IT2A 3Q9UA 1JG1A 4MR8A 4HWPA 1EFPB 1YI1A 4N0MA 1ASZA 3H8JA 5FNVF 2GBIA 1S7GA 4TQGA 1GKYA 4FFSA 3R2JA 3JRXA 5A2QL 3A58B 5ICMA 2QA5A 3VU1A 3E82A 4CEJB 1Y33E 3OKAA 4IH9A 4I4NA 3RYTC 1Y3DE 1TM5E 1ESMA 1U2PA 1WTXA 4ALMA 5FPTA 8GPBA 4X0EA 1LVGA 3KHUA 2Q50A 3RYIA 1PNTA 1JEQA 4H7KA 1XYGA 3ZVMA 2HK6A 4TMZA 4ZDKA 4QELA 3KYJB 5LUAA 3WSVA 1VXOA 1E0BA 1K3BC 4JI5B 4LK1C 4G4JA 3ASZA 2JZCA 4JZYA 4I65A 3H6KA 1KJYA 5FLMH 2QV0A 1RVDA 4QFMA 2PFGA 2SNIE 4QUFA 2P9QA 1ZI9A 2WV6D 1SCNE 5ITVA 3JY6A 3FTNA 2FUNB 3OY7A 5K6AA 1JG2A 2JA6H 4TN1A 1ZXLA 3Q8MA 1VYVA 3MWFA 1T1GA 2PZBA 4B9AA 1C3EA 2HSGA 4RETA 2XNKA 4KSYA 3CD6A 5DLEA 3N2NA 4MV7A 2FOXA 4LGMA 5BT9A 2UUOA 1U7WA 3W78A 2PNFA 5CR3A 2QDKA 4YCWA 4DV3Q 4ZMSA 3ROMA 3OWOA 5EQDA 1AHIA 1W36D 1SAPA 4UPAA 5EJEA 5E9QA 3N8GA 2PEYA 3PC8C 3S2GA 4QDJA 2WJHA 3G8YA 1RYBA 4QOIA 4DK0A 1OYWA 3U44A 3HMKA 4F3CA 2EJFC 1VJGA 2FPXA 3FN4A 5ITSA 5KJEA 5JO0A 4C07A 4WJKB 5TDHA 5K0CA 3MJSA 1J9EA 2G36A 3R3SA 3B52X 3GL9A 2QGZA 1OZFA 5BR8B 4ZICA 1B41A 5E1BA 4BA2I 1Y8QB 4QUDA 1ECLA 5LMNW 2PYKA 3IKJA 3BJRA 1HY3A 1XTTA 1L8OA 3BS1A 2HGZA 1OXVA 2SICE 3LLUA 3WKDA 3G59A 3DJYA 4TMYA 5T64A 4MCHA 5KSYA 4NXMQ 3VC3A 2V58A 3EVAA 4QXAA 5CDFE 3P0FA 3KF6B 4TWRA 2J3QA 2KQ3A 2IOFA 2O4XA 1CRQA 4MUXA 1MO5A 1ZK2A 1E2MA 3PTLA 1PJCA 2MNAA 3ET5A 1QCYA 5I01A 3DDCA 4FKBA 4H44C 3NB0A 1Q3HA 2PGJA 1EJ2A 1PJSA 5C5IA 2AE1A 1XWFA 1EK2A 3TOVA 4UD2A 1T6XA 2MOKA 1SKBA 2QRZA 4OXRA 3L07A 3N39C 1GUAA 2FW1A 2WM2A 3T6KA 3Q7SA 2E4WA 2RJNA 3Q0IA 1FR3A 1PN3A 2BEKA 2JAOA 3JU3A 4IHJF 3ECSA 4Y6RA 4ZDWA 1ZINA 4MLDA 2WFLA 3UENA 2SHKA 3T5GA 1X1DA 2E37A 3WLPA 5AH0A 3SXHA 4GBMA 2FMCA 4BP8A 4YONB 4Q18A 1WTHA 5H5JA 4GLAC 2JA2A 4PR3A 3WGVA 4OI1A 2VK1A 1HMYA 4IXTA 2W71A 1NXWA 3LA6A 1SUCA 3MIZA 3Q7QA 5L7YA 3P9YA 1A69A 3IMKA 3VTAA 4F7WA 1Y1WH 2NO0A 1XI2A 2DHEA 2V1XA 1W34A 1KDOA 5EMMA 1GKHA 4DF7A 1BHQ1 1SHTX 4J1TA 4ZKCB 2AUTA 1WKCA 1ZL0A 5KNDA 4A0GA 3CINA 2YY6A 1VP9A 5CU7A 2AYZA 4Q16A 3H5OA 2EKBA 1WTAA 2R25B 3H3VH 1EE2A 3ZWQA 3HUEA 5FK9C 2D3TA 3CG0A 5CXXA 2JAHA 4W8HA 4IVRA 1L5HB 1NNXA 1CQWA 3NHLA 3IALA 5IJZA 3CCBA 4GWGA 3EH2A 4V0RA 3CLKA 3IIIA 1E6EA 2LKCA 4NIMA 1IRXA 3C6BA 3TLAA 4M1MA 3CEMA 4DMCA 1BKSB 1XCJA 1DFIA 2FQYA 2IZZA 1GCAA 3GARA 4QARA 4OX9L 1U3FA 4NY1A 2G1UA 4L5QA 5A0FA 1SA0A 3D0KA 4LJZC 1XMIA 3OEWA 5DTQA 3J7YW 1MHWC 2VP3A 1XWWA 3VVMA 1G21A 5T6MA 2NU8A 4TRDA 1SD5A 3HZZA 2GBCA 3D8HA 3DVRX 3IUQA 1T9GS 4ZYUA 4DV6L 2VPIA 3UFXB 3AERB 3VZRA 3MRSA 1CQFA 2Q5CA 2FWAA 5C1DA 2QYSA 4EKEA 2DBZA 3IRBA 4YREA 2Z2ZA 3AVUA 1JSZA 4OGWA 2W4IA 1BJRE 1EM6A 3ZVNA 4CE6A 4G63A 4U7PB 1KEVA 2IV7A 4PSVA 2VJOA 3BJUA 3OPYI 3G0OA 2ZT6A 1HZ9A 3UYLA 1YJBA 4ALNA 3W8RA 3AUAA 3OEED 2NU9A 4BY1G 1OWMA 5F35A 1QG7A 3LS2A 2F64A 4NV1A 4U7JA 3GFRA 1ZFNA 4TTRA 1T43A 3MSCA 3ZYYX 1NRJB 4O4HF 2A0FA 2WJAA 1F3LA 5K3SA 1CK4A 3GFQA 3ILSA 1K4YA 1XZKA 2L1BA 1MEOA 5J1TB 1YNSA 4FOOA 1YA6A 4B31A 3B7WA 3DDHA 2VPQA 5C4HA 4JSRA 2DQZA 3U49A 1RTOA 5A1JA 3O3MB 2VDNB 1YI2A 4G65A 4X97A 2WM3A 5L6LB 1B3AA 3A8TA 4ERNA 3INTA 2Q99A 4D81A 2B5OA 3HJBA 2D5IA 5SZIA 4H13C 4L3OA 5EYPA 1BCPB 4YT2A 1JZQA 4P33A 4CNQA 5FPKA 1ZCBA 3D2BA 5KNBD 4BRUA 3PIOA 2HBZA 3GUHA 2A68D 3QUQA 3IUSA 4UULA 5C3EB 1BOSA 1RXVA 1YS9A 3ERCA 4LOJA 1B2TA 4TV8B 2PUJA 4YP7A 4MVJP 3DDOA 3D1LA 1KH3A 4UUPA 1F06A 2R7KA 2N1BA 4YI5A 1EWHA 3Q2OA 1OFUX 5GGXA 1YFJA 4DSZA 1K9MC 4QBGB 4OLAA 5MDHA 3K6SB 2QKIC 4M9QA 4OEMB 1JDPA 4LHZA 4DA4A 1Q90A 3F8SA 3R0XA 9MHTA 4NU5A 4FGKA 2JFNA 1J8DA 5ESWA 2QX7A 5ICFA 2L4NA 1JH9A 1O5TA 4QQRA 3STUA 1XDDA 2HA6A 2YZ2A 2UZ3A 4P4LA 4U6QA 2IYQA 4H02A 1RRGA 1QE6A 1STAA 2BBOA 5T3YA 2OHIA 5E9JA 3RSGA 5DN6D 3MJTA 4YCDA 4PV7A 1D1QA 1TLFA 3PIIA 1Y8OB 1JDTA 3Q98A 1SBZA 1GVHA 4TZ6A 1X38A 3KYDB 4LQ4A 2F0IA 4C7JA 2P6PA 4DUZB 3EYAA 4LV8B 3JAML 3E7FA 1XA3A 3W5VA 1B6RA 4LI3X 2AF4C 5IRCD 2JRCA 1AA6A 1JBKA 1AK1A 1TWGH 3II6X 2PZAA 4UVHA 2ZJ7A 2DAPA 3S1NH 4CQJA 1YB6A 1LLFA 3UH1A 4OA5A 1ZH0A 1BDMA 2R8XA 2LKVA 3HA2A 4NYJQ 3QWHA 1CRLA 2XVYA 3LUGA 4G4SO 3RAPR 3MQ2A 5HR5A 4S35A 1RHKA 3FTCA 1D5MC 3COWA 3ZDAA 4E12A 2V6GA 2YWEA 2B2WC 1L0BA 4OJNA 4ZYLA 1SLJA 5DM63 1XHFA 1D2RA 1TWCB 1YR7A 3CC7A 2P9TA 4BNZA 5ESRA 3SF0A 4KPYA 2JA1A 1GNLA 5GAJA 1A9XA 2IF2A 3SJCA 3PXCX 3U5ZB 3LPAA 2MR5A 4MV5A 4LCJA 2CLCX 3U81A 1OTCA 3P2JA 5FV4A 1MJFA 1IQ0A 4NBRA 2D1FA 1K7YA 5JAMA 4EO4A 5FTMA 2MYTA 2HPAA 4BBRB 4PIVA 4RFBA 4OFBA 1O8BA 3V4SA 2IOHA 4AAYA 1QG4A 2GF0A 3DOCA 2B34A 5ALZA 4ZVSA 2GPAA 1F2ZA 2HD3A 3G3EA 1DTEA 4PZUA 3SPXA 3TOXA 4DB4A 4FCWA 1BKBA 1KP3A 1NNEA 2EJTA 3EULA 3QPUA 1WD7A 1ESFA 3FPHA 4XYOA 1WW2A 1T35A 4RKFA 1M8FA 5MN4A 1PFVA 1QYXA 4JB8A 1G1AA 5SYAA 1CY2A 2O14A 1BQ4A 3WLIA 4L5BA 4XSVA 4CBVA 4I4CA 4OX9Y 1OFGA 1IHPA 1EUJA 2C35B 5JNRA 3TBHA 4NATA 1H9SA 2KW5A 4E5YA 4KR9A 1Y1VG 5JRZA 4DBLC 3KLRA 3EHDA 3IQDB 2P8JA 5E8JA 3V2HA 4ARSA 3F1ZA 2AFIE 1LDYA 2IL8A 3VR6D 2R61A 3KOXA 1TS4A 2X23A 1O95C 2ERYA 1U98A 4RPIA 1DJQA 4XM1A 1CLUA 1B0ZA 4P82A 1T9HA 1WVIA 3RROA 3DNMA 5GQSA 2ZI7A 1ZN8A 4D3YA 4P36A 3M4XA 1LO5D 3FCCA 4FFLA 2O2EA 2C2YA 1HUMA 4RVHA 1G7TA 5K0ZA 2AL7A 3DJFA 4RV4A 1Z5ZA 1P18A 1AUXA 1EVZA 2VJMB 1LT6D 2Q5HA 1HYEA 3EIXA 3M0EA 1WLYA 3IPRA 4MUGA 4QSMA 1C9JA 1PTOB 5IMSA 4A3EB 2X9QA 1TLLA 3I70A 4EJ0A 2O07A 1ST3A 2RHTA 4QTZA 4IWXA 1RPTA 5FL3A 3RDPA 5HMMA 3GVCA 1IK4A 4WFJA 3E2IA 2X0IA 3P1JA 2A9QA 3LZDA 3RJ9A 2K52A 3ASYA 3TYXA 1U63A 1FVFA 1X1TA 1KQOA 2G1KA 2XYHA 1N36L 4NMLA 1SCAA 3ACBA 2HU8A 4X3KA 2BMAA 1NJSA 4EY5A 5EAYA 2D1SA 1H6AA 2PH1A 2D2IA 5C34B 4CCYB 3TOZA 1GITA 1PSZA 3JVDA 5CJJA 3I4LA 3CFYA 4NR0A 5BQFA 3RZOB 2GK6A 3SOZA 4PZCA 3C3PA 4XCQA 2WFMA 4OQXA 4DT1A 1WOMA 5LZ9A 3GEEA 1AJEA 1PH6A 2Q1YA 2D0PA 3C8UA 1G20E 1A7UA 2DT8A 3QXCA 1IW7C 1MXHA 5D00A 3L9AX 4ZQFA 2F43B 3WHKA 4RVCA 3PF4A 5A2QE 1HT0A 4LMRA 2DLCX 3EXG2 3BWYA 3KF8B 2C7RA 3HOXG 1R6UA 1HQKA 4Q7MB 5TT1A 2HRDA 2NVTB 4IMPA 1NW9B 1B74A 1YI8A 1LK5A 2WILA 4RVOA 1JTVA 1AHHA 3WS7A 5DYNA 3Q3VA 3P9PA 1QKKA 3A6DA 5IP9G 3WGQA 1K3UB 3PDIA 2WFZA 4JI4Q 4FUTA 3TN2A 1YBAA 4CF6A 3T38A 1O57A 5M3FG 2YFYA 6PFKA 2J5XA 2K4MA 3PNQA 3P94A 3W04A 3HP7A 4ZEXA 1SKAA 3AJ8A 2ZIFA 2J0VA 1XF9A 3VPSA 2A14A 4Q24A 4OJYA 3N6VA 4MP3A 2QX6A 1B7YB 4YX9A 1Z3CA 5JZMA 2E74C 4DM4A 4PYQA 1LV9A 3DXYA 5K36H 3VBCA 1T0BA 3UGJA 2FZ4A 3PDUA 3PO3B 1TKRA 3H0CA 3S2DH 1EGMB 2I6GA 2IIPA 3C6MA 3OQNA 2F0FA 3LAWA 3JWHA 4HADA 2DKNA 1YHZA 4FONA 3RSHA 5ELNA 1E77A 1P7YA 4YJFB 2IS2A 3MEQA 1VMAA 2P27A 1RR6A 5BVGA 2PUEA 1AM4D 5HZHA 4L9WA 3RVQA 4MQFA 4NZMA 2J85A 3MF4A 3AVTA 1CY6A 2ZJOA 1NJ5A 3G8DA 4FP9A 1RBYA 1T8YA 3CW9A 1AB6A 4JU9A 3UXEA 1A5BB 3GDEA 1FDUA 3LOQA 3E05A 1MJHA 3B6ZA 3R6TA 3OPVA 1T9DA 4ZOLB 5FP0A 1UL1X 1OY1A 5CA0B 1FY2A 5CYUA 4HC4A 1Y6FA 4H17A 2Z9HA 3UJAA 2NVUA 2OYRA 4UNRA 2IYLD 5G3ZA 1RAFA 4B84A 2EEZA 2Q62A 2GPSA 4BN4A 4GOJA 5DISB 3GLVA 5JEAG 4X65B 3H19A 2A86A 5DTEA 4NONA 1CYDA 4OBEA 4V03A 2KS6A 1Y6RA 2IBMA 2JIZD 1AUPA 1MLDA 3F3KA 3HXPA 4I55F 3CUUA 5KHLB 1JOQA 3CEHA 2XQIA 3UK6A 5IWAL 1TYCA 4TTQA 5B7GA 2XV1A 5AJVB 4BNVA 5HGTA 2BF7A 1UKZA 2QT1A 1PGOA 4X94A 2E4UA 2BFCA 2HK9A 1CULC 2VNKA 3ZEIA 4BMSA 5G4KA 3T7JA 1CUCA 4P22A 2PL3A 2IHJA 2VUIB 1A88A 2Y0CA 3A28A 5CW1A 3CV3A 1UPCA 3ZH2A 4QBIA 4LRUA 5D3KA 1I4TD 2VP4A 2Q6LA 3BDLA 4KE7A 3T3PB 1KERA 5TEWA 1S4ZA 1BMTA 3E3NA 2QE7A 2Y1OA 3GTQB 3TE6A 4PX2A 2VPZA 3FJ1A 1HNZB 1P4RA 3P0RA 3A70A 5T8KC 4MROA 4B79A 2GF2A 3LUBA 2VDVE 3OD5A 5F2OA 3QOLA 5IASA 1KRTA 1OLXA 1P3DA 1S1MA 2HCJB 2FDCA 2YXLA 3EODA 2N1MA 3QWBA 2P0YA 4AN0A 1DXQA 4AMUA 2ZE7A 2A0UA 2H8GA 1UWLA 4FB4A 2JW5A 3N3BC 4BNXA 4AN1A 1YBHA 1YIDA 2ACEA 1W36B 1UKAA 4MUHA 4X63A 2NMVA 2OV6A 4UTRA 3I61A 4F2DA 2PH7A 4PICA 2BM0A 2UYOA 1PH4A 1DBIA 5AVOA 2QM8A 5CK4A 4D6YA 3AFGA 4LKOA 3JZIA 4MRSA 4EQPA 3ADCA 1GR0A 3DOEA 1PFKA 1I0IA 2YXEA 4RGBA 3WMRA 4IJQA 1W85A 2C0QA 3OC6A 1Z5GA 4WJLA 1MFPA 1BCRA 4JSTA 3G79A 3K8ZA 2C7BA 3N0TA 4HQ0A 4WY8A 2RE8A 2X9LA 1WMBA 2B9EA 2ATWA 3DM3A 1MAUA 5DT9A 2DF8A 4WUTA 4IPDA 5FUVA 3UWKA 3FCSB 2D3WA 2RB5A 2DR0A 4OQFA 4Z1MD 4DMRA 1JDNA 2OHHA 1W0JD 1EIFA 1SQGA 1YCFA 1MN6A 3L8DA 5FNZA 2A9OA 2FVYA 4KV6A 3WBFA 4AS1A 1QK4A 2ZEJA 1YL6A 5PNTA<