1OXVA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
353
structure length
353
Chain Sequence
b'MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 98
structure length 353
sequence length 353
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxvA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxvA01
3TIFA 2KHJA 1XZQA 4X66L 2ZI6A 1G7RA 1G21E 1E69A 3CX8A 4JI6Q 3KQKA 5IYDG 4JCVE 1JXOA 4JI5Q 4LPSA 3K1JA 1EFCA 3H0GH 2BM0A 2V7QA 2O5VA 4RZ2A 4DLVA 1E1RD 3A7AB 3FMFA 4LBZA 4IFDI 1UWVA 4DSTA 1NF3A 1KDRA 3X1YA 5J4VA 3R8FA 2LXKA 5GAEC 4JBJA 2IS4A 3J80c 4EFMA 5CB8A 4G7HC 4APVA 2HDNB 4IJLA 2JA5H 1KY3A 2NOAA 2RHSB 2ZJZA 4HIOA 3NTUA 2V1XA 1QF9A 2B3GA 4Q9JA 4GPTA 3X2SA 3ADDA 1GG2A 1NL3A 1YZGA 3ZGXA 1N6OA 2J59A 4QGFA 1U8ZA 2D7DA 3WP1B 1XEXA 4D4JA 1DPFA 5TB5A 5D3QA 2IBMA 1U0JA 2NO9A 2Q3FA 5DYIA 4OX9Q 3FHCB 3UANA 4JSTA 4A3EH 2G6BA 1XMIA 2X2FA 1CI3M 1HQMC 1HNXL 2FEMA 1L0WA 2Q2UA 2GEDA 4P3YA 4TQ9A 2ZQ5A 2F1IA 3LY5A 3SGIA 2NO1A 3AEZA 1Z2CA 2IYTA 3CNNA 3QKSA 2CE7A 3ZD7A 2NMVA 2B63H 2FH5B 4WJ4A 2FG5A 3UG7A 3RWOA 4IOKA 1W2GA 3B2EA 4POAA 3UMFA 2CVFA 1W48A 1RFLA 3ZD6A 2O8EB 3TSZA 2XTNA 1EWHA 3U7FB 5AUNB 1I2MA 3H0GG 3KZ1E 1XCMA 1E1OA 3TQCA 3OOCA 1BH2A 4KVGA 4DXAA 1IBRA 2QNRA 1YITA 5FLXc 4TYYA 3ND8A 1KNQA 1U8YA 1CSQA 2PQAB 5H1YA 3K0SA 2JEBI 2AKYA 1OKKA 1JE5A 3NVAA 1VYTA 1OFTA 3AVWA 4PXAA 2D5DA 3CP0A 2CHGA 4TYWA 2A69D 3RS3A 4AG6A 4TKOB 4CEJA 2GJKA 1X6VA 3QENA 3CPFA 3U3OA 2EFEB 2VQSA 3SJZA 4OKSA 3CH5A 3NBZC 1IXRC 1NVWQ 3B9PA 1A5TA 2H17A 4S2EA 2BBWA 2J0SA 1SXJB 3SS8A 2EFCB 4JYAL 1JJGA 2QPAA 1Q46A 1Z0AA 3MLEA 3I56A 1D2EA 3Q85A 1P7CA 3RANA 3MGCA 1NBWA 4DR2L 5LPNA 5BYJA 1KDPA 4JC0A 4GS3A 5C0XI 4DV1L 4LFAL 1HQYE 2R65A 4OHWA 5EZ6B 1JPJA 4PC3A 3GTMH 1JR3D 1NRJB 4QOSA 2WAQG 1IJEA 1Q3TA 1N32L 4M22A 4QJ4A 3RABA 4Q9KA 3PR1A 3T1YL 2K75A 5CITA 2EVBA 3BS4A 5KNBA 4B71A 1IONA 1OKKD 4UY8C 2HJGA 4LHZA 3PUWA 4LF4L 2RHQB 4BLOA 2R7DA 1R2QA 3NBHB 1E1QA 4IOCA 4YC7A 4DEYA 3A36A 4B75A 3J81k 3N6RA 2WJYA 1Z3IX 4PO1A 5CK4A 1X56A 1ZNWA 4JI0Q 2MMGA 4WBSA 4DUGD 3D4RA 4DKAC 3GLHA 3CCJA 3HOVG 1AQYA 5L3QB 1UFQA 2QQEA 1XJVA 2N42A 2Z6VA 5JSZB 2ZTCA 1AZSC 1KO4A 1Y8NB 2I5LX 5JJKA 1CJUC 2VSXA 4Q18A 4PHGA 4AD8A 1G16A 2EWWA 1J6QA 2DFLA 4OJQA 3CW2C 2I0QA 2AHOA 3OAAA 2JEOA 3BGWA 1LTLA 1DE0A 1BYUA 1KK3A 1UM8A 3SHWA 2GXAA 4GOPB 2RGEA 1MKYA 1OJLA 2PX0A 1K0RA 1E1QD 2EVWX 1QZGA 1G291 3MEFA 3ZLJA 1E96A 1JEDA 1P6XA 4DSUA 1RZ3A 3O8DA 5CIWA 1CKEA 2W6JA 3BH0A 4KODA 5FBWB 4BFZA 4ZI3A 5IK2A 1VQ5A 2GDJA 2EU8A 4G5RA 2FMXA 3MFYA 2PT7A 2IXEA 3IHWA 4LHVA 1ZKOA 3ND9A 2OQ0A 2UXDQ 2QE7D 1UAAA 1NKSA 3ER0A 4L5RC 4UNSA 2K4KA 1W0KA 2I5MX 3T56B 1BBWA 3WP0A 4X8HA 1DGSA 1F2TB 1CF4A 3CC4A 2ANBA 2ZVPX 4B47A 3K53A 4PPNA 4HIKA 3IQWA 3QVUA 2H57A 2ASEA 3CR7A 4EIWA 2C9CA 1VQGA 4NCHA 2W6JD 4DV2Q 4G5OA 5EE0A 2QTFA 5IK2D 1NKTA 2DYKA 1B7YB 4NCKA 4MGKR 5HCIA 1JQLB 4O0MA 5DN6D 3TJZA 3E5HA 1FL0A 4A0RA 4F92B 3QKSB 4YONB 3GJXC 5C1BA 2WWIA 3RDPA 4LDJA 4L9WA 5BR8L 3OFND 3OIYA 2VQEL 1FW6A 4HAVA 3CO5A 4GMXA 4QRHA 3RSLA 3WYGA 1S9HA 5L3VA 2VHQA 1XB2A 2X8AA 3F5FA 2BV3A 3NHBA 1CLUA 1YHAA 3VR6A 1QZHA 1XNRQ 4BY7G 3BE4A 4MKHA 3AH8A 2D62A 2GXQA 2JLYA 4IJMA 1SFOH 1E7ZA 1GZSA 2R8RA 3DM5A 4Q4JA 1E0AA 2ZYWX 2QROA 4B3BA 1ZNXA 1H9RA 1OXVA 2GEUA 3LQQA 1HTWA 4JVLA 2R44A 4OBEA 3EIHA 3E9HA 4WXRA 1T4GA 5DE3A 2WWFA 2H7VA 1IBLQ 2FSGA 2PEYA 2WJJA 4LYAA 3EPJA 2P6RA 3QE0A 2QM7A 1OTCA 1NY6A 2PNHA 1QHIA 1T8TA 2IYWA 4WZAE 5EXTA 3AUYA 1H9SA 1DBSA 2G9NA 2W83A 2JCSA 2X2EA 3OW2A 4PC2A 2ZREA 8OHMA 4AIIA 2BEJA 1G4AE 4LF5Q 1P3JA 5DI9A 1E4YA 2YOFA 2KBNA 3WRYC 4DR1L 2YJTD 4OQFA 3K70C 4DPGA 2R93H 3EPLA 3B78A 3THYA 4GBMA 4JVSB 2IHYA 5F9FA 3GTKH 1FMLA 2WV9A 1ZC4A 3E1SA 3KB2A 4NCNA 5FOUA 2ODEA 4KVAA 2NO7A 4W5HA 3UWKA 3O8RA 1UPTA 3NDBB 1BO6A 2O0KA 3WY9A 2B29A 1IN6A 2Z4SA 1RRCA 4NXML 2OCEA 3GLHB 1COWD 3DVLA 1PH2A 1RVDA 2N78A 1NJIC 1G3UA 1ONBA 2Q3MA 3TAUA 1AGRA 1NSTA 1FTSA 2PCLA 1KZGB 4NL4H 1E2GA 4PZZA 2GBLA 4OHXA 4US2R 2AHOB 3QBTA 3EZ9A 3CX6A 4MA4A 3TW8B 4C0AC 1K8MA 3DXJC 2QMOA 2GZDA 4PG3A 1N0UA 5ANRB 2XTZA 1DAEA 2V1UA 2WZQA 4NYIQ 4K46A 3TSWA 1MV5A 4Z1MD 3DM3A 3H84A 2CMKA 2CLDX 4QNMA 4A0HA 5JEAG 2LCFA 1DAFA 1KMHB 4LV6A 1PUJA 1E98A 1ZUHA 2CK3A 3FYHA 3WNCA 4OQLA 1XBTA 2PLFA 4F4JA 2NVQH 1S4QA 2WP8J 5EP4A 4JLDA 2P2LA 1NN0A 3PITA 4EUNA 4AQYL 1IL2A 1HE1C 3PUVA 2OG2A 5EQTA 4ZO4A 5CM8B 4DSOA 3A1SA 3TR0A 5GVSA 1N33L 2A68C 4JLPA 5SZKB 2RGCA 3WBJA 1SROA 2W2TA 4WJ3M 1EQRA 3K0EA 1PFSA 4PTLA 3M1IA 3F8TA 3SFZA 4A93G 1J8MF 3W5JA 4KHPL 4HDCA 1J5EQ 1P73A 4A82A 3CRMA 2F6RA 2GF0A 2MNAA 2UZ3A 3AP2A 3LBNA 4PANA 3CAMA 4RZXA 4JJZA 4RCZA 2PLRA 3GLGE 2KENA 4K81B 4JI7Q 2CK3D 4KFRA 4TLDA 2EQSA 4ERNA 5IWAQ 2AFIE 2BCJQ 2NIPA 1Z9FA 4HZUB 4DV4L 5AWFC 5EAYA 3FE2A 4Q00A 2VHUA 2Y0SE 1W4CA 4GKJQ 3U4QA 1OXTA 4DLSA 2GHIA 4UNNA 5FOSA 1CJMA 1SVSA 2IX0A 2G77B 3SJAA 4JOIC 2GWHA 1XEWX 1EOVA 2MSCB 1JI0A 3LBHA 3PJRA 2QEXA 4YMWA 5TARA 2NZJA 2IYVA 1Z63A 4B3SL 1ZUIA 3VKWA 1KZ7B 1P2SA 1S8FA 3ZVLA 3IIMA 2E8GA 5M04A 1Z47A 4V0OA 5L3SA 1K3RA 4PPGA 2ECKA 3WDNA 2A19A 1XXHE 1E9FA 3CPHA 1N5IA 2EYUA 4Q4AA 4JLNA 1P2TA 1NBMD 3KKOA 2PL3A 4TLBA 3W6OA 5K8IA 2QA5A 2ZUBA 2XNDD 1K5GA 2Q9BA 2WJIA 4JBXA 3Q72A 1DELA 5B64A 5DISB 2FFAA 4CEHA 1HNWL 2OLJA 3RRMA 2GA8A 1P9NA 1U9IC 3ADBA 1OXSC 2N1BA 1NI3A 3V4RA 4DIEA 2W0SA 1DAKA 4D0NA 5JZVA 5KDDA 4FMBB 4NHOA 3AGQA 3A1UA 1AJEA 1BDOA 2E1RA 4CW7A 2BH2A 3QXXA 3BC1A 3PV0A 2DGYA 4DUYQ 5SZIA 3IGFA 4P4SA 4AYWA 2C99A 4QM7A 3RLNA 1Q1EA 4CIDA 2BH8A 3MXUA 3THXB 3I92A 2GXSA 4HUTA 2Q0HA 3L0SA 5C2JB 4DR3Q 1PH4A 2F52A 2GZAA 2O0JA 2QRNA 1NN3A 5AJYA 5HCNA 3I62A 4MKFA 1DG3A 4I1SA 4EPXA 3MSXA 4MYUA 1NLFA 1S2MA 5C4JH 1KNXA 3A6PC 1I50H 2XSZA 4DR4L 2A69C 2A5JA 4R98A 4MRPA 2ZRIA 2ZTDA 3BORA 2QMEA 3W3ZB 1A6XA 4OJKA 3HPRA 3P32A 2JEAI 1L8QA 2VTKA 3KX2A 5C4MA 3O47A 1CSPA 4P72A 3STBD 2UVQA 4MYTA 4QJ5A 4JLKA 1N36L 1HV8A 2HYIC 1R5NA 2X1VA 4A3BG 2UUAL 5EE3A 2IL1A 4IFDJ 3CBQA 1E2IA 4JI1L 3GO5A 4MUAA 4AY2A 1F48A 4Q4HB 2FX3A 3T1OA 2K33A 3LDAA 4LUOA 3MXNB 1DOAA 2OEPA 4HI0E 1PH3A 4PO9A 4B3TL 1TUIA 4R9UC 4KAXA 4DV0L 4K0KQ 3M9BA 3BERA 3NG1A 1HTPA 1KJYA 1BOFA 4D25A 2AXPA 1VDZA 2JLQA 3ETLA 5CJPA 4RY2A 1GL6A 1N6KA 4M1TA 3KFUA 2QAGB 4BXXG 3BB3A 1S3OA 1YBYA 4LJ5A 4URZR 1VQFA 3W1GA 5CIQA 1ASYA 1Z0KA 4BFXA 5K8TA 4V0NA 1PYSB 5DIFA 2UUCQ 2ERXA 3GLGA 3EAQA 3UE0A 1D8TA 3QXJA 1SR3A 2NZOA 4GZYC 1OH5A 4Q1FA 1UBCA 2MO1A 2ORWA 4FINA 2CCKA 2QEQA 1US8A 1IXRA 3IPXA 3CCRA 2HXYA 3FPPA 2R7FA 1Z6GA 1EX7A 3M4QA 1TQ6A 3V4FA 1DCZA 2ORVA 1TTTA 1E2FA 4BA2I 3CNOA 4JJKA 1Y1VH 5FUVA 4M2LA 3SI7A 3I7FA 1S72A 4PC6A 1IN7A 2UU9Q 1KQSA 1CULC 1S3SA 4GLAC 1SLJA 4L9SA 2WWGA 4URWR 3R7WA 2F43A 3I4NH 1FTNA 3HDTA 2ODNA 3W5IA 2WB1E 4LUZA 1G8FA 3AKEA 3CRVA 1XD8A 2LKCA 4GP6A 1Q0UA 3X1ZA 2YNMA 4DLWA 4B48A 4HJ5A 1CIPA 4HDOB 3SEAA 4AYBG 5CB6A 3MG9A 3KDFA 4PZ7A 4I4LA 3REFA 1B70B 2CKZB 4GKKQ 1N6LA 4M9ZA 4UPAA 4LNQA 4XSGA 1U99A 2CJWB 3G4SA 1JMCA 3EZ2A 1XP8A 1Y8OB 4Q4AB 4PPFA 4ZI2A 4QGAA 3PENA 1CRQA 3TAHA 2GCOB 2J0QA 3HR8A 4Q01A 3CW2A 1P4SA 3ZVNA 4D4MA 3FOZA 3CRRA 4CT5A 2KCMA 3FB4A 3OEHD 3WNDA 2UXBQ 3FKSD 4DVGA 2JLVA 3WHLA 5C0XJ 4H1VA 1VQIA 4WZBE 4JLVA 1EWRA 2IX3A 4ESHA 4QNRA 3NBYC 3H4MA 2C5LA 3NEYA 3E2IA 4XH9B 1XMJA 1OFIA 1VIAA 4DEXA 1M90C 4TT3A 2ZROA 1M2OB 2E76C 3CXCA 1E2KA 3EC2A 5SZHB 5J40A 1T0JB 1ZIOA 2FPMA 5AUPB 4II7A 2CWAA 1K8GA 3ZH9B 4P4SB 1IBMQ 4JG2A 1SZPA 4D6PA 4CYMA 2WJHA 2WKPA 4FWIB 1FQJA 4IOLA 3SBEA 3KJPA 1YZUA 2EYQA 1R5OA 1P61B 2OZEA 1M74A 2ZJ8A 4RFSB 1OE0A 4X64Q 2DUDA 1X3FA 2IYRA 1HNZL 3J81j 4LK1C 4IVPA 1E9SA 5A4JA 4NKRA 3CMEA 3I4NG 1OW3B 4MKIA 5FUWA 3WMGA 1UE1A 3QEOA 4UJ5A 3PGZA 3K9HA 3QKRA 2QU8A 4AIMA 2E74C 4ZV4A 4URXR 1L2TA 4NYJQ 3ASZA 2BE5D 2IYSA 1NNEA 5ELXA 3K0AA 4ZIRB 1VG0B 1NMZA 2H8KA 4Y52H 4TT3D 3G6EA 4GRAA 3BBPA 4HLCA 4IDNA 4TLAA 2Q9CA 2VP5A 1G8HA 4JVMA 5AJZA 4A3LG 1X1RA 2WWWA 3QPUA 5FTJA 4LHXA 4LRWA 3KB1A 4KN4C 4RZUA 5IYBH 3I73A 3EZ7A 1Q57A 1N6RA 4D81A 2J0UA 1W44A 2QT0A 4UP8A 2REBA 1GITA 4DCTA 3GJ6A 2XX3A 1MOZA 2F4VL 2AMCB 2HLDD 4JI3Q 3A58B 3CWZA 1B9MA 1I3QH 1XD2A 4PQYA 1I2DA 4EFNA 4NH0A 3FFBA 3HOZG 2IWRA 4LF6L 1OB2A 4RG1A 2XJ4A 4LSGA 5H68A 4C7OB 1HZCA 4IOMA 4BFSA 4KBGA 1UBEA 1ZM3A 4DK1A 1DAIA 4HDQB 3F2DA 4PV1C 3JZAA 3IPYA 3KL4A 3MRSA 1VQDA 1FX0A 4R2IA 3GDEA 4A0GA 2C9OA 1DAHA 1QUQA 1IBKQ 4S35A 2A2ZA 4B3ML 1W36C 2FA9A 3AVOA 4D82A 1PLKA 2ATVA 3U4VA 2ATWA 1JQJC 2GTPA 2ZRGA 3VNVA 1PA6A 4DAYB 1QVGA 2XJ9A 2E2JH 1DS6A 4LJAA 4HAYA 3CCLA 1X3EA 4URUR 4YY3L 5AJ3Q 1X86B 2J9RA 3VX3A 3PO3H 1WDTA 1P16A 4KYIB 4GP7A 3TQFA 4NYMQ 1NTGA 1Q20A 3A1VA 3SHFA 4DDTA 5ELNA 2A5FA 1VCIA 3F2CA 1XPRA 1LM0A 2G0TA 2ZRJA 4QQBX 4DJTA 3PO2H 1H9JA 2ZRDA 5IYBG 1E9CA 4BFTA 1W5SA 1I94Q 4JI6L 1XTRA 4N1AA 3V9PA 3PQCA 4QL3A 2GBLC 3CF2A 5M3FH 3GJ8A 4X65L 5D3MB 1NVUQ 1K8AC 1KSHA 1ANKA 4A36A 1XFAA 2W2VA 2NG1A 3ZDQA 4RSGA 2DB3A 1E22A 1HA3A 4XWOA 1W2HA 3VNUA 1SN8A 2CW0C 3HGBA 1VG1A 3B9QA 1X3GA 1TXYA 4NPSA 5HE9A 4Z54A 5EE5B 3M4OH 3T1TA 3VKGA 3HKZE 4M21A 3OPOA 3GLIA 1SKQA 4LI0A 2IYLD 1TU2B 3CCSA 1NSFA 4FIDA 1FFHA 4AC9A 3EPKA 5FLMH 1WOCA 4EQ5A 1KO5A 2HEIA 4YLGA 1PHJA 4C3HH 1JJ7A 3DKVA 1WFQA 1W3SA 2QZ4A 4OK5A 4TN1A 4BFUA 1XJQA 3I2ZA 1ZM4A 4PHFA 3KF6A 3KFVA 2HCBA 1G1MA 1H8HA 2YWEA 3L2OB 2V6JA 3LWNA 4XVQA 5FBRB 3TE6A 3HOYH 1ZYUA 2KI5A 3K0FA 1MT0A 4A2QA 2WPDA 1T9HA 1ZIPA 5GADl 4E03A 3DL0A 2XGTA 1TQ4A 2FSHA 2IS1A 2Y8EA 5KNDA 1KI9A 5IHPA 3AFQA 1C1YA 3C5CA 5LB2A 5KPJA 1IAQA 2YTXA 2JJQA 2IYQA 2W6IA 4RJLA 4F91B 2F3TA 2A5GA 4KKSA 1I6VC 1WCV1 2AK2A 2JJ1A 3AP1A 3JVVA 2EJFC 4Q47A 4L5TA 3LD9A 4Q21A 2XZLA 2D3WA 1NJFA 3UDXA 1EYGA 5DHFA 4IHQA 2O8FA 3UDFA 1QHYA 4ZDJA 2WMNB 3EXAA 4TTPA 3N70A 2DY1A 1WJJA 3PO2G 1YZTA 4QG7A 2E2HH 1G41A 3ADCA 2YTYA 5KHOC 1NLZA 4QBIA 1KSFX 2PI2A 5M3FG 5LB4A 1JECA 2XB4A 4KI0A 1GRRA 2ZAMA 3AF2A 4C4PA 1F6BA 1NIJA 4HJ7A 4TL7A 3OTOQ 2A3RA 2J0UB 4NYIR 3KQUA 3ICQB 2KBEA 4DR7Q 4XOIA 3SR0A 1FJGQ 1SKYB 2JJ1D 3PEWA 2QBYA 1PZNA 1FNNA 3CPJB 4HB3A 1HR0Q 3DLLA 4M1OA 4DR6L 1KI1A 2PX3A 1QJOA 1GKIA 1Z08A 3I4OA 3FKIH 1S40A 1P2UA 2VP6A 4A9AA 1FOEB 1PH1A 2F3RA 5HR5A 1T6NA 3I8SA 3JZMA 4OQMA 4JI8L 5JWOA 3BFVA 1KGDA 1K6MA 1KRTA 4M53A 1XMQL 3VR1A 5J3BA 1XZPA 3CZPA 3A74A 3CMAA 1FX0B 2J5XA 3CX7A 1DO0A 4OO1H 1VQBA 3M7NA 4B76A 1G5TA 1F2UA 1GL9B 2IXFA 3HOYG 4HUQA 4L15A 3CRW1 1X1SA 4QBGB 3GLFB 1WB9A 3LW8A 2WJGA 1D8LA 5M5XH 2VNUD 5FPTA 4HR7B 3HR7A 4Q7KA 1E1TA 3U58A 4OK6A 2QP3A 2QMUA 3I72A 1BMFA 2I1VB 3B1VA 4WW0A 5G40A 2ZM6L 3AKYA 3NELA 4L5BA 4B33A 1VG8A 1PH7A 2CFMA 2ZSBA 3GEIA 3STBC 3A5ZB 4X6AH 2IT1A 5DI3B 3AVQA 3PFIA 1GUSA 4JS0A 2H18A 5EUQB 3SYNA 1U9IA 2GVZC 5KSYA 2IUSA 5LMUL 4DV7Q 5IT9c 1X55A 4MQBA 3K70B 4FMCF 1A0IA 1EIFA 2CXXA 3OIVA 5FTLA 5IT5A 5G3ZA 4Q1DA 1WA5A 4KITB 3DKPA 1ZM9A 2O8DB 4MRSA 3HOUH 4E09A 4R4IA 4IXMA 2XOKA 2D2CC 5KNCA 2CBZA 1GKHA 2QY9A 2PMZE 1BMFD 2FV8A 4R2HA 3W8NA 3VKHA 2ZI3A 3EC1A 1X8KA 4JLOA 4IFEA 1P62B 4UXHA 3EZFA 4ZKDA 2RHDA 1IW7D 1OT3A 5K36H 4TQUS 2AKWB 2VPPA 2B6HA 3SE0A 4DV5Q 3I8XA 4V02A 3FKIG 1GO3E 3W9YA 2ASBA 2GVBA 3F1ZA 1WE2A 4Q19A 3SNHA 3NEMA 3NE5B 2VQFL 4HIMA 2HV8A 3KXKA 4DDWA 5TY0A 1BBUA 1Q86C 5F98A 3U9SA 3LO5A 3GLIB 2GJ8A 1PH8A 1AA9A 4ITRC 2RB4A 1H65A 2ZTSA 1AS2A 4A6PA 2IXGA 3W90A 2F1JA 4DT1A 3GEEA 3PXGA 2G1KA 2XOKD 4YHHL 1AN0A 1W4RA 3LXRA 1K73C 3L2PA 3OZXA 2NVTH 1KI3A 3KF6B 2IEYA 4KBFA 3D8BA 4N0EA 3L0IB 2N49A 2A78A 4JMPA 2ZRNA 2B8WA 1JR3A 4LOAA 1VQEA 1LFDB 2AXNA 4DV2L 4C0JA 1XPOA 5JJIA 2OBLA 2HHHQ 4B3GA 2NQ2C 3S2DH 3NKVA 2AL7A 3KXLA 4UJ3A 4BLRA 3TREA 4WOPA 1NJGA 2JA5G 5DSZA 3WXMA 3J7A5 1L1OA 4DV6L 4KSCA 1C7YA 1XU4A 3SFVA 2OO7A 2YU9H 1I4LD 2YHSA 4DUGA 4Y7NH 3NENA 2BM1A 1W1WA 3KTAA 5LDDC 1KI4A 3BB1A 4FN5A 3RNLA 1UE7A 3K80C 2E5LL 3CIOA 4ZCMA 4TMTA 5HY6A 2QGQA 3AP3A 4B3RQ 1L4YA 1VQCA 4A3MH 3CZQA 2DHRA 1E0KA 4PPQA 2XB2A 1XNRL 2A9KA 4HB2A 1ZD9A 1X9NA 2C8VA 2ZYUX 5F2EA 4C3JH 3M85A 5K36G 3CM0A 2ZJ2A 2HT6A 5JRZA 4L5QA 1LS1A 5C4XH 2G3YA 4KFTA 1ZC3A 5JCPA 3J81i 4A3EG 2JIZD 5TXGA 1A4RA 3KJHA 3OYYA 1UEJA 3C16C 2C35B 4DV3Q 1IBLL 3A4MA 4DLXA 1TPZA 5DO9A 1QVCA 4AWXA 1X54A 1VQMA 1R9TH 2B63G 2AKAB 2FDCA 3U3KA 2EDGA 1HZ9A 4B3CA 1N8RC 2NO0A 4KFSA 1NE3A 1GRNA 5JS7A 2FFBA 5CK5A 2QE7A 1UKZA 4BE7B 1P72A 4DBLC 3WBKA 2BOVA 1BIFA 4LF5L 2Y0SG 3O8BA 4DB2A 1D9XA 4QHSA 4X66Q 2JA7H 2EJMA 1NMXA 1IZ6A 1SVWA 1CKNA 1AM4D 2A6HD 2GAOA 2RHMA 4URYR 2BA1A 2F1MA 1NIPA 1RL2A 3G82C 3EA0A 3KKQA 3W3AA 1CKMA 1KMQA 1W2BA 3B1ZA 3RS5A 2BE5C 4B34A 4BFYA 4M0LA 4TTRA 3B82A 1QVAA 1V9PA 3GFPA 2D2FA 1YNJC 2VF8A 2WBLC 3T1HQ 1YHNA 2JA1A 5J4KA 1KD1C 2P6NA 1T3SA 2OSBA 4LF9Q 1UEBA 1CU1A 1LV7A 5FPSA 2MMCA 5J4HA 4QHYA 4LF8Q 1S3GA 5KYKA 5DN6A 4R71A 3H3VI 1JALA 3K7UC 1KI2A 4C0QC 2OQKA 2BDTA 5C44H 3SZRA 2KE5A 1YJ5A 2VW9A 4QIWE 4LJZC 3LAWA 4A3GH 5JEAJ 1KTVA 2KJQA 3OFNA 4P31A 3JC66 3TR5A 5EXXA 1I5FA 3K0XA 1MR3F 3P27A 4L16A 5H1SE 3IO3A 3QF7A 4C0BA 1VHTA 1XEXB 4AKGA 3BAFA 4HJ8A 2YOGA 3A4LA 4AK9A 3CRKC 1NVXQ 4UP7A 2ZE6A 1G19A 3LH5A 4M9XA 2GK7A 4WIAA 1PH9A 1HH4A 4PHHA 1LS6A 1W0JD 2WAYA 4DCNA 1KI6A 3CCVA 3QEJA 3GMTA 5E7JA 4HSEA 5LD2C 1O7LA 3NC0C 4MYCA 2N8NA 4MKGA 2BKEA 1O3YA 1NBME 5C3EH 1G5RA 1W4AA 2ZVQX 3WRXC 2A1AA 3X1XA 3TKLA 1VG9B 4MDEA 1E32A 3IQXA 4XJXA 3VMFA 4DNIA 1VQNA 1R5BA 5EE9A 4FMDF 3SQXA 2ZETA 1P60A 4LBWA 3F0TA 3AM1A 1IJFA 2WSMA 4G3XA 4GT1A 4YCVA 5KUTA 4O3MA 1EG7A 3W5OA 1O78A 4JI7L 3K81C 5GAGC 3L43A 5IWAL 5CDFE 4RCYA 5J4LA 3B60A 4JKYA 4YXWA 1N34L 1JXMA 4CEJB 3P1JA 1QBKC 4MYHA 4M1WA 4GKJL 2XGJA 4AYTA 4YQFA 1B9NA 1GNQA 4X62Q 1XTJA 2PT5A 4I1UA 4DCUA 1TKWB 1J2JA 2RF4A 4R4TA 4JYAQ 1MJCA 1COWA 1R7RA 3KTAB 4A3GG 1E9EA 2PH1A 3TZUA 1TU3A 2ZR0A 3PEYA 3TS0A 2AWOA 4LFAQ 3BB4A 4M1SA 4NYJR 2WJVA 2LXJA 3D0FA 4O2DA 3GTOH 3CH4B 2L15A 4ME3A 5FL7A 1SRUA 2BHRA 2VEDA 1J99A 2JLSA 4HB4A 4TYPA 1SVMA 2ZSFA 4YDSA 2JAQA 3CPEA 4Q1BA 2JA8H 1DAGA 2R6FA 4HLQB 1KSGA 4YXWD 1LUZA 2WIBA 2OTLA 4Z1MA 3RS0A 3I3SR 1XCGB 5JEDA 2QT1A 5CJ2A 1KHTA 1N3BA 2UZIR 5KO2A 1Z6YA 4DNTB 4RKFA 2CLSA 2ZR7A 3WHKA 3KKMA 3LVRE 2YWGA 1FZQA 3HU1A 3EZ6A 3SU8A 2EFDB 3I1FA 2JLUA 3H15A 1W36D 2ZSEA 2GK6A 3PEVA 4EPRA 4C2UA 1MO4A 4OK3A 3KQNA 5FL7D 1TMKA 1E0SA 1ZAKA 4IJHA 2BMDA 1V43A 1DADA 3DO6A 1YJWA 3K09A 1Q3HA 4IEEA 2IF0A 1I4DD 3FHTA 3C14C 4DUYL 4OI4A 4C3ZA 1TUEA 5A5GA 2WB1G 4D4LA 2UUBQ 1RIFA 2REOA 2BA0A 3AVVA 2ZJRA 3F3YA 4LC0A 3GTQH 2DFTA 2GETA 4TZ0A 4YWKA 1VKJA 5E3HA 3CLVA 1TWHH 1WXQA 4DC9A 2BBTA 2ZT9C 3ZVMA 4A92A 5IP7H 2OCAA 3U6BA 2Q2IA 4NU0A 2PZFA 1NY5A 3GTGH 2HF9A 4I7ZC 2QSZA 4NYMR 4QBHA 3VHLB 2R93G 3T15A 3THOA 5JMTA 3VDYA 3LFUA 4LJ6A 2JA8G 4PR0A 1AKYA 2AD5A 1M1KC 3CB4A 3ZS9A 2AK3A 3DOFA 4OONA 2CCJA 4ZCLA 2K32A 3NBFA 4PHTA 4U5XA 2CHQA 1A2KC 1SMYC 4EQ6A 2V9PA 3SQWA 1II0A 1CJKC 4C0SA 4DUZQ 721PA 4BEJA 1GNRA 4BPBA 1A1VA 1KI6B 2ZRBA 2ZANA 4K0KL 2L0XA 3H1TA 1GL7A 4JL5A 1GFIA 2AUKA 1MO5A 1R10A 1VHLA 2JQOA 3MAAC 5AK0A 4RKEA 1XNQQ 1Q1ZA 1NBMA 4HLDA 4G0NA 3J7ZC 1KJWA 2WIAA 2QN6A 1FYCA 2VUMH 3QIAA 3AF0A 5B2ZA 1UKEA 4RVCA 1P9RA 4URVR 2XNDA 2Z0MA 1G8GA 4LW1A 3TRZA 2K50A 3A8TA 3X1WA 2ZU6A 2UUCL 1PMRA 1YZKA 5LMNQ 1XEWY 1E79A 3K8YA 2QTVB 1VQOA 2Q3HA 2YC2C 2ZI9A 3Q3JB 5ELOA 4MUBA 4GL2A 3WYAA 2W2XA 5CDFA 4LUVA 1TU4A 4Q4JB 3LX5A 2G0NA 2GCPA 4LCBA 5EP3A 2R6GA 1TF2A 2HQLA 1Z5ZA 3RRYA 4YWLA 1G8YA 1E2MA 2FN4A 1XTKA 1HY3A 1T91A 1BS1A 2DPXA 5IP7G 2ATXA 2BEKA 2LWIA 4GNKA 4I1OA 4JLJA 2UU9L 3S1AA 4YDHB 1N0WA 1IW7C 4JBKA 1NVVQ 1H9SB 3BRWD 1Y3AA 3RS2A 4FXPA 3RN2A 1RJ9A 2EWVA 3WNBA 1C0AA 1VQ9A 1IQPA 3GJ4A 3AVYA 2VP9A 2MQHA 4TVAB 1AIPA 1E79D 2QMHA 5FJ8H 4QGUA 1GTVA 4OI2A 4GOKA 4Q02A 1N5KA 2D0PA 3THYB 2ZRAA 3G5UA 3M0EA 1N6HA 3SOPA 3QF4A 1LTQA 1Q44A 1OB5A 3HP1A 3FHOA 2ZE8A 3U3JA 3ZS8A 3NHAA 1IYVA 1OIXA 4GOPC 1TWFH 2ODBA 2ZJOA 4TYQA 1GKUB 3FVQA 3V00A 1E2VA 1A82A 2WMOB 4UQOA 3B13B 1LF5A 4LZZA 1CXZA 1TL7C 2MSDB 3DEFA 2GVDC 1KC8C 1YEZA 3ZJYC 2OHFA 1WI5A 3AUXA 2CE2X 1R0WA 5DGXA 3VU9A 5GQOA 4GLVB 2ZTEA 1CJVC 2A5DA 3D6TB 1OIWA 2IA5A 1AZTA 4TMXA 3SYLA 1Q8KA 4MRNA 1T5LA 3S15H 3HWSA 4DR5L 1IOZA 2H1LA 3GQBA 2N46A 3R8CA 5HZKA 2D4HA 4TTQA 2BBOA 2RGAA 4DSNA 4GLXA 3OEEA 3A8KE 4PZLA 2NN6H 4BY1H 4JI4Q 2NVYH 1EIYB 2OT3B 2ZYTX 3MJRA 3LBIA 5BXQC 2FU5C 5BW8A 5GJBA 2H5XA 1CBUA 2O5JC 3FGNA 4NTZA 2O52A 4JLAA 4Q7LA 4EJSA 1K5DA 2VHJA 1Y63A 4X64L 2O8BA 2K5HA 2KWIA 3IFTA 1DVRA 1E2JA 4PSVA 4WVFA 1CR0A 1CP2A 2IEZA 1TADA 4HAWA 4TYNA 2VLIA 4AKIA 4NDZA 4GN5A 3VTKA 4DNRB 4IDPA 4JYCA 4C0KA 2PPBC 4IPCA 3H2YA 1AH9A 4GOJA 1LABA 1N33Q 4BLQA 3IUYA 1WCMH 3RR5A 2I4IA 5FJ8G 3AGPA 1L1OC 2WM9B 3C7KA 3N2IA 4I1VA 4O2LA 3VR5A 4B6EA 3OEED 4F4IA 2Q6TA 5DHAA 1XX6A 3HKZG 2B7CA 1W5TA 4KHPQ 1KDOA 1QG4A 4MGZR 5JJLA 1NMFA 1Y1WH 5EP2A 5FPYA 1ZNZA 1KO8A 5G3YA 5FI0B 3EX7C 4CVNA 1OH8A 1G6PA 1HJPA 3BK7A 3LWUA 4WXPA 2DFKB 3LLUA 4DV4Q 1IY0A 1YVDA 4JI3L 4CT4B 2ZJPA 2A6HC 3GTJH 2R92H 1T0HB 2HJVA 3OE7D 4P0TA 4JZKA 2JJ8A 4M1MA 4XTRA 3MWJA 3U4QB 4Z51A 5TMPA 2ERYA 2A6EC 4PAQA 4LPKA 4N3NA 1G6OA 4HJAA 1EFHA 3I32A 3K0CA 3OHMA 4BLSA 4Q9LA 3CD6A 1KAWA 2NTYC 1GNPA 4A3IH 3DZ8A 2XXAA 4W5WA 3B85A 4XSHA 3OEHA 3T61A 1G3MA 3FKSA 2C2HA 2C98A 2E75C 1D2MA 2CVHA 5AUQA 4B3SQ 4MRRA 1D7QA 4QM6A 1Z8FA 4HAUA 1LVGA 1WP9A 4UXIA 4ARZA 1UDXA 1ZM2A 3LW7A 4Z8YA 2NVXH 2IF2A 2OCBA 3AKCA 2ZI4A 4EDHA 5L3SB 1E2QA 1PLJA 3IEUA 1LY1A 1XXHA 3IDQA 1OV4A 1ZUNB 4OQXA 1O7IA 1MO3A 2JA6H 2D7CA 1EX6A 2JLWA 4IFDH 1MIUA 2K14A 1WCMG 5AJ3L 2GEVA 4R4OA 1B23P 3ULLA 3KOJA 3S1QH 4CEIA 3TLXA 3U44A 3OIUA 5E4FA 2RCNA 2A5YB 2C9YA 4FDBA 1HNWQ 4AYXA 1PYBA 1IHUA 4CEHB 2EFGA 3LQRA 3CF5A 1XMVA 5JBQA 2H16A 5JLJA 3UMRA 4IVQA 4YMSA 3QXHA 4A3DH 4JV5Q 1ZYRC 1ZNYA 2AD1A 2DBYA 2GJSA 4P74A 2AX4A 2J41A 2TMKA 1U8AA 2ZEJA 2ZUDA 3LA6A 3N5CA 4V0KA 4TMVA 2AWNA 4G01B 2G83A 2BC9A 3EIVA 5TVKA 4FW9A 1M6NA 5FUYA 3THWA 4DK6C 5DH9A 4OXPA 5M3MH 1SQ5A 3GJ5A 4Q4HA 3RS7A 2O8CA 3UE1A 1NMYA 1Y1VG 3JAMi 1W46A 3VU9B 4LFCL 1KXLA 2PMDA 4I99A 4LJ9A 3PF5A 1XTSA 2HLDA 5DLQE 5BQ5A 3ZIAA 5H8WA 2FFHA 1HPCA 1A62A 4A3IG 3CF6R 3GEHA 2ES2A 3R20A 121PA 821PA 4DR4Q 1E94E 4JI2L 1E2WA 2B7BA 1ZMXA 2FNAA 5P21A 1G5PA 4FMCB 3LNNA 4L5SA 4Q1AA 3NC1C 4NMMA 4GN3B 3EPHA 2Z6KC 5IP9H 3FP9A 1VYUA 2NGRA 1YR7A 4MDFA 4JT2A 3SBDA 1JAHA 2ZXUA 4BBSH 1Y14B 3GFOA 2CDNA 1RW4A 2D2EA 2A8VA 3PEUA 2OFOA 2JA6G 2Z4RA 2LMCB 4B3TQ 3K9NA 1ZD8A 5E7IA 2OAP1 3ZIAD 2DCUA 4Q4LA 2JJ2A 3K9LA 4BZPA 3EASA 1JJVA 1YI2A 1GD7A 3ZYCA 1S9DA 1AS3A 1SXJE 2GKSA 2J87A 4LYFA 4X8MA 3ZZTA 1WBDA 4RMFA 4YWMA 1TWCH 2K5VA 1IYUA 2F3IA 3NBXX 5A35A 1XF9A 3S2HH 1UJ2A 1X8JA 4IPHA 1MABA 1MKHA 1HT1E 1M8PA 2QTHA 1N6NA 4J0QA 1L4UA 1Z2AA 3GLGB 5CM9C 4HJ9A 4V0ME 1VF7A 3OTOL 5C0XH 4DR7L 1SULA 4ASUD 2VL7A 2GESA 2OTJA 1US8B 2RGBA 2CWPA 3QJYA 3RAPR 1HR0L 2JJ2D 2WWXA 5EZ5A 4TLEA 1LACA 2CL7X 1U94A 2JDIA 4UNQA 3WMFA 1XMOL 2JGNA 2ZJBA 3EA5A 3MWLA 1D5CA 2OCPA 5EJEA 1XTDA 1TF5A 1YE8A 3LGJA 4KO8A 2K7VA 4XVRA 3R7WB 4P4TA 2GZHA 2F43B 1CTQA 4IPGA 1ETUA 3DPUA 2ZE5A 1MRSA 2AUJD 4E07A 4LFBQ 3QXSA 1DEKA 2R9VA 3G71A 1YJNA 2AFHE 3TS2A 4UKDA 3CRLC 1E9AA 1YVCA 2QGNA 2WOJA 1K83H 2BBSA 5JWRA 4JI5L 4C2MH 4U02A 2JLXA 3KDFB 3GTPH 2FPKA 3ZQJA 3D31A 3LRPA 4CF7A 1KL9A 5FUXA 4OWWB 5IYCH 1FPMA 3KUCA 1ZRHA 1XXHB 2PCJA 2JDID 3K09C 1Q21A 1UEIA 4R4CA 3Q7QA 4TSFA 2GF9A 4KFUA 3IRBA 1Q90A 1WBBA 4UNPA 3CRQA 3LX8A 4CEIB 1ZW6A 1DD2A 1NY4A 2SHKA 2BMJA 1SHKA 3MMPA 3ZQ6A 2VP4A 4LBYA 3B7GA 1XDBA 1JB7A 4NXNQ 3M3YH 2LSSA 4IFBA 3AEVA 3CUEF 4DCSA 2V55B 4AI6A 1IXZA 4YMUA 4JSYA 1L2FA 2YV5A 2ZS9A 1G3QA 3DZDA 4JYBA 4DB4A 4FD2A 1UE6A 1FNMA 3KKNA 4LBVA 2OILA 3T35A 1C9KA 3BFXA 3D7MA 2ZI5A 2GJ9A 3I4LA 2C03A 5FBLB 5HKKA 3NH6A 2YZ2A 2YYZA 3HJNA 4OX9L 1XTIA 5KDOA 4TSFD 3IIKA 2QI9C 1HNZQ 1A7JA 5HPYB 5JRJA 2ZITA 3H0KA 4ZDIA 4PZ8A 3FDIA 2OE2A 3PO3G 1HUQA 2ZRKA 1CRPA 1ASZA 4A6XA 3DHWC 4C3IH 2YINC 5JI2E 3RZDH 4POGA 3QKRB 2OFWA 2W0MA 1W47A 2IUTA 2AN9A 4H1UA 1JEEA 4RD0A 2O8EA 3UK6A 1AK2A 3K0AB 2BCGY 3EIQA 4IEIA 4I81A 2P0EA 2D74A 3KKPA 4GI7A 4LX0A 1YHBA 2RAPA 1CTMA 4P4UA 2QAGC 1VF5C 5HKKD 2PQAA 5IYDH 4UNRA 4TL8A 3I4MH 1PH5A 4A4DA 2HHHL 2PCFB 1VQJA 5HGQA 1NG1A 2A30A 2Q21A 5LD2B 1VTKA 3B1XA 2DWOA 4L8GA 4OHYA 5GJCA 3RWMB 2YWFA 2VYFA 4H9GA 1E4VA 1XD2B 5G53C 2XTIA 4GMDA 1GILA 2CCGA 3VFDA 1XRJA 1Z28A 3J81c 1SXJA 3TMKA 3TNFA 4DLUA 3C4JA 1VQAA 4RCNA 1SMXA 5FLMG 2J46A 1SVOA 2VBCA 3PCRB 5E7MA 3Q7PA 1UE5A 3Q5DA 2KB0A 4KJZA 3FFAA 2FE4A 1FQKA 1P5ZB 4BWYA 4JIMA 1QUQB 1YRBA 4V0MA 4Q7JB 1ZBDA 3PUXA 4ALPA 1F5NA 2RGNA 3RC3A 4JK1C 4QY7A 4YCWA 3REGA 4FMDB 4QHTA 3UDIA 2DFNA 2HCJB 1TEVA 1N6IA 1CS4C 3U50C 2UXCQ 1YRAA 2FFQA 1WF3A 4DV3L 4GFDA 4PQFA 1IN5A 2REXB 4LHYA 3P20A 3PIPA 4TWZA 2ZRCA 4OL0A 2ZJQA 1E2LA 1GDDA 1OFUX 4JI0L 1SXJD 2K5UA 2ZJYA 3GLHE 1ELOA 4BUJA 5B58C 1RYFA 5JSZA 2JLZA 1X6OA 1YHQA 4G5GA 4B44A 5L8VA 4QC2A 1Q1BA 1XTQA 1IY2A 2H92A 1G3IA 1CR2A 1R6BX 2ORIA 1X65A 2CNWA 2ZJ5A 2WICA 4ILEA 5K8LA 4GOPA 1YNNC 3W1BA 3I4MG 3KLWA 2IW3A 4Q5IA 4X65Q 4Q9HA 5G41A 4XVUA 4G5SA 1E99A 4HB0A 521PA 1G7CA 2J7PA 2YKGA 1AE2A 3SN6A 3ZJYA 4FWTA 1TX4B 1FMJA 3A37A 3WYFA 3Q8XB 4QJ3A 1QZXA 2QP4A 3FMCA 3T1HL 4N0DA 3UKDA 4C0LA 2K52A 2OWOA 1RC8A 3T53B 1DARA 2V6IA 4LF9L 2HIVA 3L82B 3UDGA 2UXDL 2WFWA 4LF8L 1JNYA 4EJSC 3I61A 1GVPA 3IIJA 1PH6A 2F7SA 1Z6AA 4B3FX 4OO1G 1AE3A 1V1QA 1HZAA 2BWJA 1NVVR 3QG5A 3OF5A 2F55A 3B6EA 1F2TA 4LF7Q 2V7QD 1IYJB 4D2IA 1JB1A 4NONA 4DAMA 1PLLA 2Z43A 1N9WA 2J7PD 2P6UA 4LWZA 2YC4C 4PC7A 3SJBA 3K0FB 3TBKA 3AVTA 1HR0W 1W49A 6Q21A 1Z22A 1IN4A 1HT2E 3KJOA 1G17A 4LJYA 2XZOA 2V8OA 2W00A 2JIZA 3AVPA 4XWKA 4GDFA 3BZKA 4BGDA 2CL6X 1OFHA 3AF3A 1ZCAA 3HYTA 3PUZA 3QOFA 4LK2A 2RMKA 4A0FA 4AG5A 4P73A 3GPLA 1VQKA 1R4AA 1S0UA 1YQTA 2O8FB 3HOVH 1IY1A 2CL0X 4TMKA 2JXMB 3ULPA 3ZZ0A 1XJ0A 1JJ2A 4CDGA 1U98A 1FL9A 2B8FA 3HOUG 2BKUA 4JLMA 4HZIA 5KSOA 1DAMA 1QHSA 3SYKA 3VHXA 4BFWA 1H9KA 4D80A 3K0CC 3EG5A 1VECA 2IUUA 5KSZA 4RD4A 3UG6A 1Q81C 4F93B 3G48A 3BG3A 1XPUA 1BKBA 3AB3A 4V0LA 1H95A 1PUIA 3MD0A 3C41J 4JBWA 3PVSA 1J90A 1EFWA 1XCPA 2QBYB 2B92A 1FR3A 4DR6Q 1HEIA 1Z7TA 1F60A 2PNRC 2CLCX 4QJFA 5GAHC 2R7ZH 1V5WA 3EIEA 3U3MA 5BN4A 4X62L 4A1FA 4XD7A 3F2BA 1NLYA 4JI8Q 1I4TD 2QUZA 3TH5A 3U6KA 4J15A 3RN5A 1XMQQ 5CLLA 2WTUA 2H5EA 3CR8A 1E9DA 1E0JA 4QGHA 2ZR9A 1ODFA 2E87A 4G7ZC 4HUQB 1F2UB 1G4UR 1GWNA 3AVUA 1AS0A 3U61B 3G0HA 3FMOB 3AB9A 3GD7A 5LBIA 1P75A 3NIBA 4OI1A 3U60B 2VSOA 3W6PA 2P65A 3ZVRA 1VQ8A 2A6ED 2ZM6Q 3RC8A 3LXXA 3QI2A 3RLOA 3EBEA 3SC3A 4D0LB 1G8PA 1JAIA 2NPIA 4IW3B 4LYJA 4XD7D 4HATA 4EKDA 3U7GA 4OI0A 4HIDA 3T5DA 1BYIA 1JPNA 2A7QA 3RNUA 4PMWA 2DWQA 2JLRA 4A8JC 2XEXA 1ESMA 2WKRA 3EWAA 4JT4A 1RRFA 1W0JA 3ICEA 2G1JA 5LMUQ 2BMFA 4Q7MB 4IVRA 3S17H 4IOJA 4A75A 3CNLA 3RS4A 4B43A 2W58A 2WSSA 4A3MG 4GSYA 4UP9A 4HEJA 4LV8B 5DNYB 4POFA 1A2BA 5AJVB 2VF7A 2FGJA 3AKDA 4RD1A 5CLQA 4P32A 3ONWA 4DLYA 5JCZA 3CC2A 2Z5FA 3EWSA 5C4XG 3J80i 3KF8B 3FMIA 4PAMA 4AKEA 4BY7H 2O5IC 1Z07A 1T3HA 1FP6A 1GIAA 1II9A 4G1UC 4MH0R 2YWHA 2QENA 2ZS7A 2UUBL 1KMHA 1X3SA 4UXJA 2R7ZG 1H8EA 1CJTC 1E2PA 1KK0A 1KO7A 1Z06A 2PBRA 3KJGA 4KU4A 4B2LA 1NN1A 1XMSA 4O25A 1HNXQ 2VQFQ 2YVUA 2DWPA 2P3SA 2GXUA 3TW4A 2C96A 4OWTB 3BD9A 2MSEB 3R9IA 3AQQA 1OLOA 1X8LA 1Q7YC 1E2NA 4M4SA 2NPFA 2WSSD 4KKUA 1DXMA 1HZBA 1Z6TA 3CF0A 3OAAD 3VQTA 1QHHA 2Z6KA 4B35A 3L0PA 3CCEA 2GJAA 2JA7G 2IYXA 5FTNA 4B73A 4BLTA 3K9GA 4DT1B 4YHHQ 5AR1A 4DDVA 2GN5A 4BLPA 5JI3E 3BDOA 1R8QA 1ZVQA 2GAAA 3AF1A 3HFZB 1T5EA 4M1KA 1J5EL 3UWOA 1K8OA 2WVJA 4GNXC 3TGPA 3BH7A 4PSAA 1A63A 1AGPA 1H8ED 2J45A 4OYHA 2FSFA 5CYPA 4MRVA 2XAUA 4DUZL 1QHGA 4HZUA 4C30A 2IS6A 3E70C 4A76A 5TDHA 5FOWA 4W7SA 4DV6Q 1L1OB 3RHFA 4IOAA 1YZQA 4H0LC 1W0KD 4EPTA 3BH6A 5K8UA 1XNQL 1Z6HA 2GILA 5FBVB 5C44G 1ONLA 1BVSA 1AKEA 4Q48A 3A1WA 2XZPA 2QPTA 5AJWA 4EAQA 4JBYA 2E5LQ 3T06B 4KN7C 2WAXA 5GADC 4DR2Q 2FZLA 4BZQA 1T5IA 4DV1Q 4MGIR 3AFPA 1EQQA 1KYIA 3OESA 5LMNL 1EFUA 1N32Q 1RRPA 2YOHA 3ECCA 4NPHA 2WKQA 3T1YQ 4PO8A 4Q1CA 3GTLH 3IHLA 4Y0VA 4YCUA 4BFVA 4LF4Q 4CZ2A 3U3RA 5JEAH 1OF1A 4ACAA 3K8AA 1VCMA 2OBNA 3HOWH 2ZSDA 4NCIA 2HYDA 4OO1I 2JE6I 4C9BA 4CRWB 3VR4A 1GKYA 3MCAA 2FOLA 5C3EG 1QDEA 2G88A 4LGMA 2FF7A 1Z0IA 2OBMA 2D0OA 4A3KH 4XWAA 2ZS8A 3RRNA 2ZIAA 1E6CA 4GOXA 4F38A 3U2QA 4HAZA 5F3WB 4A3JH 2CEAA 3Q9LA 2ONJA 2KSQA 2IWHA 4RFVA 1CKNB 2CHVA 4KHZA 4ZPXA 3FHWA 4A93H 1D2NA 3HU3A 1R0ZA 2RKOA 4FI3C 4TL6A 4DDUA 3QY0A 2V1CC 5C18A 1RPZA 4C2TA 1Z0JA 3THXA 1KK1A 4W9MC 4NE2A 4LUCA 3NDPA 1D6JA 2KA7A 4YMTA 2ZSAA 4L8JA 5M5WH 3I55A 4DR3L 5FBQB 5JS8A 5IRCD 3QXCA 4D4KA 4JLBA 4QBFA 1QHNA 1IXSB 3KJIA 4IDQA 3T34A 5HTKA 4KLZA 4D0GA 3ULJA 4LV5B 5DLQC 4EPVA 3VA7A 2OV2A 3QG1A 2BMEA 4OHVA 1P8LA 4GN4B 3FWYA 4BQSA 2I3BA 4JI4L 1FVIA 1EFTA 2D06A 2ZRHA 4HLUC 4V03A 2ZU0C 2OCYC 1W7AA 2PEZA 3EQLC 1GVNB 2DR3A 1GM5A 5FOXA 4ABYA 3B6YA 4X8OA 3BJUA 1U2RA 1VQLA 3HOWG 2QG6A 1QG2A 2WOOA 1KSJA 3KDSE 2DN8A 2I5HA 4PSKA 5EUMA 2WHXA 1LYLA 3BZCA 1C9OA 2F9MA 3GJ0A 3QVVA 5KOYA 2XNSA 2WAQE 1E2ZA 5IF9A 4A3KG 1N2CE 2JK8A 1R0YA 1S96A 4LJ7A 3TSOA 1JR6A 4WA7A 1E9BA 3KUDA 4MZ9A 1QHHB 4PC1A 5BR8Q 1ZD1A 1U81A 2VQEQ 4A3JG 4QKQA 3T12A 2QAGA 1T8UA 2JASA 3UMSA 4DIDA 4F4CA 1CEEA 1SXJC 4EFLA 2J0VA 2Z83A 1EWIA 1EESA 1Y69U 4MNOA 1VQ4A 4DK0A 1SGWA 5FPKA 1E2DA 1CFMA 4IDOA 4NP6A 1XJCA 2JA9A 2VP2A 2YTVA 3CWQA 2IK8A 2E2IH 2C77A 4FCWA 5FI1B 4ZDKA 1GAJA 3DDCA 2R6AA 3TUIC 3S14H 3K7AH 1N0VC 1MO6A 2RGNC 3BOSA 1N34Q 5KDLA 2WWHA 3FKQA 4NZYA 1SVKA 4Z8XA 1ZCBA 3EW9A 3S1RH 4R4QA 2GRJA 4JBMA 4JL8A 2ZAOA 1VCOA 1TQ2A 5HZHA 1Z0FA 4O2RA 1E24A 1OXXK 2RGDA 4QXAA 2J7KA 3BWDD 1GUGA 2QPOA 3DMDA 4EPYA 3HU2A 1FUUA 2R6DA 3QQ5A 1W36B 1RKBA 2DNCA 2BJWA 4ZCIA 5J4YA 2OM2A 3CKLA 3I5XA 1KIMA 4DRZA 2IYZA 4W5JA 4DR1Q 1G20E 2FXQA 2BVNA 2GCNA 1LF0A 3QUSA 2IYYA 5FOVA 4KV9A 1XD9A 2QP9X 1QVFA 3IILA 3IEVA 4A3BH 4GKKL 2RGXA 3L8ZA 2OESA 4C0HA 4DKXA 1RRGA 1VYVA 1KO1A 2CJWA 1EXMA 2IYUA 1EUJA 4ON9A 2IHBA 1NN5A 2VO1A 4WZ6A 4DHEA 3PF4A 2Q2TA 4NXMQ 2KBFA 1TWGH 2ODWA 2GCOA 3M4YA 1GOTA 4NBSA 5FPHA 5J47A 5FR1A 2QM8A 2QRZA 2VUMG 2I1QA 3S16H 3QKUA 2ID0A 4M9SA 5BWMA 1FUKA 1ESNA 3BJIC 2UXBL 4AURA 4A2PA 1OYWA 4OQNA 2FSIA 2ZRFA 1N5JA 3S1NH 3JAMc 3A7LA 5E7NA 4PQRA 4YMVA 4EX5A 1VQ7A 4BXXH 3EN2A 4OGQC 1M7GA 3T5GA 2XITA 5KU1A 4JV5L 3A0JA 2VHTA 3RRZA 4B74A 3KFXA 1EGAA 4F7WA 2OXCA 5UKDA 1TF7A 1G9XA 1HYQA 3GCGA 2PJRA 2JATA 1G6HA 1IBML 1KHIA 2VL6A 4DK3C 4Q66C 4OHZA 4RFSA 621PA 4A3CH 2ZRLA 4H02A 1CR1A 1P9WA 2ZM5A 4XTCS 1J70A 1KOFA 1MJEA 4MGYR 2L5TA 3T1QA 4KKTA 1JT8A 2HT1A 2NZ8A 3RYTC 4A15A 3PUYA 4IQZA 4AQYQ 5BN3A 5CYOA 2X19A 1KAOA 4LWCA 3OE7A 3A1TA 1N5LA 1KJZA 1VCNA 5FR2A 1ZM7A 5LMNW 4FCTA 4ZIRA 2ZRMA 2IHEA 2ZRPA 1BKDR 1GUAA 1R0XA 1GUTA 3AV0B 1TEXA 4M9QA 4EPWA 2ZUCA 1UF9A 1JJCB 4R7ZA 1M34E 1Z0DA 3QPWA 2PJZA 4BZXA 3S24A 4BECA 4KCGA 3KXIA 4AKHA 3SJCA 3X1DA 3KYHC 1GSIA 3TUJC 2BJVA 3E9IA 4EQ6B 3WWVA 1LB1B 3HKSA 2F1RA 2Q9AA 1SKYE 1RIPA 2O0HA 2OXRA 4KXFB 3FTQA 3LV8A 3NEJA 3BXZA 1M7HA 4LC1A 4B3DA 4TQAA 2XTMA 2QORA 4JKIA 1N6PA 1YNXA 1RYHA 3D3QA 2XSZD 4IKEA 3B1WA 1J7KA 1GHKA 5KPDA 3MUFA 4C7OA 3BU2A 2AR7A 5EE1A 4B32A 3TUZC 1A8VA 3LNCA 3JVUA 2ONKA 4BRUA 1DTSA 1S1CA 1KDTA 3CCMA 2Q2HA 1OYYA 2VH5R 3IBGA 3O8CA 2NN6G 2V4DA 4BY1G 5TV2A 4KYUA 1CR4A 2RH5A 1HE8B 4U7DA 1IBKL 3GLFE 3CQZH 2X77A 4LHWA 1II8A 3MWYW 5KSPA 1EFRA 3GP8A 1M7BA 1WQ1R 3UXMA 1H9MA 1G51A 2PZGA 5AJXA 4A3CG 1C4OA 1WRBA 1E2EA 4RZ3A 4ESVA 1VS0A 4DLRA 3AF4A 5J5CA 1OH7A 4PFSA 1G18A 1YU9A 4HAXA 4KLKA 1MH1A 5JEEA 4IRUB 1P2VA 1Q1QA 1OSNA 1GHJA 1FGUA 1YJ9A 1IM2A 1KKMA 2B8GA 1UBGA 2Z0SA 2VIIA 1KAGA 3RSOA 3WMEA 1Z83A 1UBFA 3S1AB 2DNEA 2IY5B 1N25A 1YZLA 1WYDA 3TQYA 1Q82C 1GUOA 4LFBL 1G7SA 3OW7A 1RJ9B 2EFHB 1MRNA 2FWRA 2QL6A 2P5TB 3BIFA 3TK1A 1HQCA 3UPUA 1HURA 1E2HA 1YR6A 1Y1WG 2R2AA 3B1YA 2B21A 1EFRD 1B8AA 1I94L 1DG1G 3QSYA 2HUPA 5D3MA 4A3LH 3QF4B 2EJGC 1F3OA 2ZE7A 1TAGA 1HCZA 1QVRA 5FFMA 5B30A 4XIGS 3R9WA 1XEFA 4A8JA 4M8NE 2R92G 1KI7A 3T51B 2QAJA 2CNWD 1KK2A 2QSYA 5AUOB 3I5YA 1ZJ6A 4NB3A 4A3FH 4DWJA 4A4IA 4OWXB 4QFMA 1GJXA 3HOZH 4DLZA 2NZHA 2VHCA 5BYKA 3GLIE 1L7VC 4NXNL 3DOEA 1QRAA 4B2PA 4CGZA 1VMAA 4IPDA 3Q5EA 2LKDA 3EARA 3NXSA 4DR5Q 5L3RA 5JHHB 3A4NA 4TZ6A 1VIYA 2QF7A 2V4ZA 1NP6A 1QHXA 2PMKA 2GVAA 3OIWA 1NMGA 4GZMA 3HOXH 5SZJA 3UATA 4MTNA 1N36Q 4ZDWA 1UKYA 1UKVY 2IC5A 2C78A 2UUAQ 4H44C 3QKTA 1CKOA 4JI1Q 2VRWA 1Q22A 3FPAA 3GFTA 2VS1A 4DZZA 4PX9A 2GNOA 2EW1A 3LVQE 5GJVC 3VAAA 4QGGA 1DO2A 4EJSB 2O8BB 1V8QA 3ZZUA 4ASUA 4KSBA 4IFDG 3U5ZB 1Q12A 4QL5A 4DV0Q 1KI8A 3GJ3A 2VY3A 2J3EA 1YZNA 2FEOA 3H86A 4HYYA 2J1LA 2FJUA 1XNJA 1Z29A 4BEBA 1UADA 4PZ6A 3HPQA 3VR2A 2R62A 1PVOA 4GNXA 1GP2A 1VQHA 4BA1I 4A3DG 1YKSA 1M1YE 5IY0A 1PJRA 4Y0AA 3C8UA 2Q8IB 2PI2E 3RZOH 1NG9A 3CPWA 1VPLA 4E22A 3KQHA 1YIJA 2HIXA 3W8RA 3VX4A 3SDZA 2OLKA 4G5QA 4US1R 5M3MG 1XWIA 3QPVA 2V3CC 4AH6A 4A3FG 1PV4A 1FJGL 4Q1EA 2F9LA 4H13C 1ZU4A 1K8RA 2HF8A 1U0LA 1ZINA 3T1VA 2PZEA 4A2WA 4B6FA 5IDVA 3PG5A 5C4GB 3U4ZA 3RLFA 1S1MA 1KIXA 2EXDA 2ZJAA 3CONA 4RD3A 2IHFA 3HYRA 2KCCA 4P75A 3HOXG 5GVRA 5H70A 4TLCA 3E0EA 1SVIA 5IP9G 2XXAB 1EK0A 3GLFA 1U5KA 4IXNA 4MITA 5FOTA 3VR3A 4KLNA 4U00A 4BBSG 4LY6A 1II8B 1SVLA 1OPXA 3KJEA 4ARZB 4LYHA 5C46F 1VQPA 2QQ0A 3PIOA 3L8YA 4K8OA 2BDOA 2UXCL 3LLMA 3CCQA 4KMUC 1OH6A 2IX1A 5F9HA 3IBYA 3AQ4A 2N3SA 2ANCA 4P71A 4TMZA 5DYGA 1OIVA 5DI3A 1J8YF 5E95A 1KRSA 1I6HH 4E5UA 1YZ6A 4BASA 3PIRA 4O0AA 1IN8A 1CUKA 2QA4A 2P67A 3U44B 1UDWA 5GJWC 1TNDA 4DV7L 3QNUA 3A8JE 3Q8DA 1G64A 1TQDA 4GZLA 1JBKA 2KHIA 3TRFA 4Q9IA 2O8DA 1G3RA 4Q03A 3W34A 3P4XA 3H3VH 1VQ6A 1WMSA 5C0XG 1LNZA 5JHGB 4P33A 4DCVA 3KQLA 5JWHA 3B5JA 2B8TA 3AVXA 4ZKEA 4G7OC 1AQUA 2FGKA 4BBRH 4X8LA 5FTMA 5KTYA 2VZAA 4TMWA 4R1JA 1YR9A 4A8JB 4JVNA 3ASYA 4PAOA 4DV5L 4BRWA 3THWB 4FCVA 3QBVA 5A0FA 1EWQA 2O8CB 3H94A 1TWAH 3W6NA 3L7ZC 4LFCQ 1D9ZA 1KKLA 2F1HA 2FPLA 3K70D 2VP0A 1FP7A 5IE8A 2NN6I 1OHHA 2KCTA 3BFKA 4IO9A 4JI2Q 4US0R 5EP1A 2MO0A 2EQBA 4HLUA 5JECA 4L4UA 3C15C 1Y8PB 3ERSX 1O87A 4LF7L 1W4BA 2VSFA 4PZYA 5HE8A 2BIFA 1ZP6A 3NH9A 5FTKA 2OAQ1 2OFXA 2RGGA 421PA 3DM9B 4WAUA 5FH9A 1B0UA 1RE0A 5IYCG 1K9MC 3TEHB 2HXSA 1JR3E 2QGZA 1E3PA 1GRQA 3NWJA 4TL9A 3TVTA 2ZPTX 3A8IE 2EIFA 2E9SA 2R6CA 5EXPA 1KY2A 3M4PA 2V54A 3A5UA 2F4VQ 2OUKA 2P5SA 2VA8A 3CCUA 2C95A 2ZYVX 3CC7A 4D26A 2MFIA 5FL3A 2WWYA 1E9RA 3ADKA 2CCZA 4LJ8A 5JFGA 2CQOA 1LW7A 3B8HA 1OHHD 4M1YA 3TVDA 3UIEA 1YR8A 4LF6Q 4DLTA 2IS2A 1E3MA 3P26A 2K5NA 4AYBE 4B2IA 3FMPB 1G7TA 5B57C 1U90A 4GNXB 4JL6A 5M5YH 1H8HD 3U7EB 4ACBA 3IO5A 3M6AA 2FZ4A 4B3RL 1MABB 1ZU5A 2WPDD 4LJ4A 3PCOB 3L0OA 4BBRG 4B3MQ 2C04A 5GROA 4IDHA 1OXUA 5BN5A 3GJ7A 5EXSA 1SHZA 3PSIA 2W6ID 2ALYB 2ZI7A 1SE8A 4RD6A 3S1MH 3RVBA 2A68D 3KLRA 1E1RA 3C5HA 4JOIA 2UKDA 1GUNA 1XMOQ 1Z6XA 1U0HC 1T3LA 3AYHB 4RD2A 3MWKA 221PA 3DMNA 5L3QA 4YY3Q 2NO6A 3P4YA 3U7HB 1R8SA 4NCJA 3MJHA 3N2EA 3R9XA 1HH2P 4B3XA 3IKJA
chains in the Genus database with same CATH superfamily
2V9ZA 1P6UA 4QVIA 4IFDI 3RTBA 3I12A 5AI6A 3VYSB 3LUPA 2JA5H 4N6GA 5BOSA 5DBGA 5ESXA 2Q3DA 5BV0A 4BNJA 3HOWB 4ZXFA 4Z1OA 4NH4A 4OTZA 3L02A 1DC6A 1CJSA 1TTHA 4RYDA 2GEDA 3ZNOA 3WLNA 1U31A 3CNNA 3OTQA 2H9AA 3UG7A 5B5SA 4HNAB 1V4BA 3FR8A 2RGRA 2QNRA 4QJIA 1PRTF 1JE5A 3MTJA 4TKOB 1X6VA 4WHMA 4JFAA 2DC1A 4G0ZA 2RJ3A 5BYJA 5C0XI 5DK6A 3PU6A 3ABSB 2FR8A 1V5FA 3ANLA 3BM5A 3H9QA 3UXEA 2QTGA 3RK4A 4JI0Q 1BE8A 1KRWA 4MUHA 4TV8A 6ADHA 1B0ZA 2VSXA 5GQSA 4UUOA 1JHYA 5K8JB 4LVUA 1KK3A 1FYFA 1GQQA 3O8QA 3HFRA 3K73O 2QVXX 3BWYA 1FYXA 4ZZ2A 3ER0A 3HNPA 1QCCA 4HN9A 1CUJA 3JWIA 4X8HA 3QR8A 4RTPA 4MWSA 2C9CA 1M10A 1QHFA 1RI2A 3KS9A 3GFVA 1SNYA 3RNOA 2B2TA 1U65A 1XK7A 3G13A 4F92B 2EX1A 3GJXC 2QLNA 4OBBA 4LG1A 4H4EA 4OLFA 3RF7A 4FE4A 2ZZNA 4NMWA 1U9CA 3DFFA 3DM5A 3A55A 3RAFC 2F1OA 4NNPA 1K06A 1X9IA 3P0HA 1RBZA 5LL6S 1AUVA 3OLQA 1H66A 4HNRA 2G9NA 4FI3F 1BMQA 4ZV7A 3P94A 2TSSA 3DBIA 5IAOA 2J9FB 1UPTA 7AT1A 4GQAA 1UQRA 3WKAA 1ULBA 5LN1A 4QU0A 1XJWA 3PFGA 2PE5A 2C4KA 3IT2A 2PCLA 5KIXA 2R1VB 5AI8A 3GEPA 3TQOA 3GJQA 2A9QA 2XMPA 1XA3A 3D64A 1YSCA 3CO0S 3DCNA 1DAFA 3SIWA 1PJ3A 1J23A 3D4IA 3FYHA 4IIBA 3PZRA 4ZVNA 4F4JA 3S29A 4FM9A 1NN0A 4G65A 1TECE 3A1SA 2ZUTA 2LW7A 2W2TA 3K0EA 4ETWA 5GGYA 3VPGA 4M83A 2YVKA 5A2GA 4CQNA 3TQTA 4CKXA 2Q2WA 1MV8A 4Q00A 5LZ7A 1RWPA 1DBQA 1TKAA 2RDHA 4HBZA 2I4RA 2OB1A 5J2TB 4R9RA 3IIEA 5K6RA 3PXUA 3K0BA 3A7DA 4AIRA 1SUDA 4DV2B 4WZAA 1GD1O 2V5UA 5ER6A 4Q39A 3BTOA 4CEHA 4DV6B 4W1RA 3SS7X 3K31A 1NF8A 2VDOB 4TWIA 1EIWA 4ZYLA 2BH2A 1G5FA 1TVEA 1F14A 2VAPA 4I2VA 1IB6A 1T2AA 2P2GA 3HCAA 2HWYA 5KHLB 2AG1A 1GGHA 1I3KA 4K1LA 4RK1A 4XT3B 3BORA 4TVSA 2JEAI 1PGQA 4QJ5A 2UVQA 2XYVA 4ZAWA 1GZ5A 1T2NA 2P77A 1U02A 4R9UC 5CBEE 4KLRA 4M9RA 1KJYA 4D25A 1CIVA 3CZAA 1JHPA 4U6QA 2EOTA 2RHCA 3ILHA 2W6MA 4OXYA 3OQNA 1CY0A 2OCXA 1PQWA 4Q1FA 1IXRA 1LPMA 1E2FA 3HKCB 3I7FA 2OYSA 4L9SA 3I4NH 3H7IA 3HDTA 1G8FA 3AKEA 1XD8A 3EODA 3WAKA 3UYLA 4PPFA 3ONEA 5H02A 1P4JA 5SV2A 4KR7A 3UCXA 2XCSB 4UMVA 3NEYA 1PFMA 1RJTA 1QIMA 3VO1A 5K3FA 2Q6IA 3A9RA 2HPHA 1R5OA 2IYRA 1Q0HA 4J2HA 3VKVA 3H9BA 4YN3A 1UE1A 3L7JA 3IAS6 4URXR 1BCPD 4G9GA 1I36A 4RZUA 3D4WA 2KCNA 4K6DA 2HLDD 4PHCA 1B9MA 5IEJA 1I2DA 2ZIFA 2WAQB 3FFBA 4LF6L 5CCXA 2QTWB 3QVWA 4BYGA 4N54A 1JR4A 1TMGE 2REQA 2EERA 3DMRA 3ZV3A 3M9LA 5HX7A 1PRTB 5GONF 3ROEA 3GVPA 2E2JH 2R8XA 4R9VA 1ZH8A 3CIFA 3PO2H 1DC4A 3V9PA 4KXQA 1DOLA 1K8AC 1KSHA 3WQSB 1XDSA 3PXCX 3CT6A 1YDHA 3ASUA 1VG1A 2QQ5A 4ARAA 2Y2UA 4YWJA 4MV8A 3OPOA 4HWTA 1WPGA 1IUPA 3V8EA 3QPDA 1ZM4A 5FBRB 3TE6A 4XVQA 2EGGA 1V5GA 1ORVA 1KI9A 4UBLA 1GA1A 4OKNA 2B3DA 2PRYA 2XUIA 3BHMA 5M3FG 3UC5A 3U48A 2PS3A 4Q6WA 4C4PA 3R7FA 3KQUA 1PZNA 2XIWA 2YICA 3PGXA 3L06A 5ELBA 3BVGA 1JZQA 1RAGA 1XZPA 2WUWE 2J5XA 1JILA 4OO1H 1VQBA 1VPDA 3CRW1 1HRDA 2P9CA 4Q93A 3U58A 1QIKA 3MJCA 3T4PA 2ZM6L 1QE6A 3FPLA 5IT9c 3OIVA 1MH9A 3SKXA 2XD9A 3HOUH 1GKHA 3KHUA 3R2JA 2ZYDA 4KC0A 5COYA 1LI7A 1SJ9A 5TY0A 3U9SA 4WN3A 1Q6YA 1DPGA 1QP4A 2F1JA 3OZXA 3VH2A 5JD5A 2P62A 3VUFA 1HFKA 3L1KA 2YBEA 2NQ2C 3WIOA 3PNKA 4TRNA 4BLRA 1L1OA 2NXCA 3SFVA 4FT2A 2A0UA 3AP3A 1XNRL 2A9KA 5KZMB 2BGJA 1JA0A 4KE6A 4UUAA 3MRTA 4A3EG 2FEXA 1BDMA 1CHNA 2C35B 4DV3Q 1OXBB 4IG9A 1TCAA 3GLSA 3N8DA 2DCMA 4QAQA 4B3CA 4GGPA 3S14B 2NO0A 1GRNA 2XCIA 2QE7A 4QUJA 4KAFA 3ZHSA 3U62A 2D2FA 3FFXA 4L51A 4DR7B 1A2TA 1PT9A 1HA5A 1YJ5A 4K9RA 4KLCA 4NJEB 4KTVE 4J43A 4AKGA 4DXHA 1SWVA 4AK9A 2GYWA 5C81A 3ZNQA 4MW2A 4JR2A 3C0KA 4FEYA 1X87A 2K5DA 4KR3A 4MDEA 3ZQUA 1P60A 3DE6X 5EWLB 3WKDA 5C4JB 4J3FA 1EG7A 1JXMA 4GPZA 2YHBA 2XGJA 1KYZA 5EJFA 3LK7A 1KC3A 4AO7A 1SBIA 4NNOA 2AX3A 3FNQA 2LXJA 4O2DA 2L15A 3MTEA 3M4NA 4MO9A 3HG7A 1IDN1 1NLUA 3JY6A 5TSDA 1FZQA 1ZX1A 1K92A 5D7NA 3I2HA 5DB4A 2J3JA 3DO6A 3W0LB 3ZLTA 4IIXA 4PZ0A 5HKBA 4F4DA 4ALMA 1VKJA 5H0IA 5E3HA 1B1ZA 4DC9A 4L08A 4A92A 1SYBA 3U6BA 3HU5A 4NYMR 4QBHA 1YDEA 2EYFA 2IH2A 2XKAA 1II0A 5IGBA 1UFRA 4LN1A 1KI6B 4JL5A 3MAAC 3MT9A 4RKEA 2WIAA 4G37A 2B1IA 5ABPA 3QE2A 2Z0MA 3CXUA 5IDWA 3EXEA 5BSGA 3BQ9A 2GO7A 1PJSA 3T4XA 2AF3C 2YC2C 1NXWA 2A6PA 1G8JA 4WY5A 3AWIA 3A3PA 4JOCA 3CPSA 3C7DB 2B83A 5L3ZA 5AESA 1IW7C 1NVVQ 2D1SA 1H9SB 2QMHA 1LK5A 2WG2A 1NTRA 4EG6A 1R9JA 4H31A 5K20A 3UO8B 2OHFA 3GV3A 5GONB 2DQ4A 3UJNA 2F3WA 3MMZA 1C3XA 1Y1SA 3K58A 1ZXBA 1T5LA 1Y5IA 4TTQA 2ZRQA 3OEEA 3T7EA 3NVDA 4B83A 2FHPA 3KSAC 4PQEA 4Q7LA 2K5HA 1PF7E 2RHJA 4EUEA 3AETA 4HAWA 4AKIA 4RGNA 1V7QA 1TIID 4IDPA 1YUBA 3ANNA 2WM9B 3OEED 4Y6QA 4KOEC 3K16A 4IQ8A 4YJDA 1SUIA 3DEAA 4PINA 1Y7PA 2HCRA 1GZ7A 1K7EB 4DV4Q 2EBUA 4D42A 2R92H 3WWDA 2UUBB 2QR5A 4G84A 4NLLA 1YC5A 1KAWA 2Z1MA 2C2HA 3KPJA 4P6VF 3SZUA 1RYYA 4W8GA 5L3SB 1JEQB 1PLJA 4IY1A 1XO1A 4DUZB 3I2JA 1KOGA 1SBHA 1PQUA 4IVQA 1TIBA 1JDVA 3LA6A 4R7TA 2Z1DA 1Y1VG 4GR9A 2JFWA 4XWGA 4LJ9A 1XTSA 5H8WA 3ZHXA 3OTWA 1SYFA 4W82A 1UBJS 4L5SA 3PUHA 1K9VF 3NU1A 4KVFA 4YJ2A 1JAHA 3I9LA 3V7NA 2FJ0A 3OOYA 4B3TQ 2BM9A 4UHVA 2WIDA 1GV1A 4X8MA 1O94A 2EKPA 5GOZA 1XF9A 1KORA 3AV3A 4X54A 1QRUA 1L4UA 4BU1A 1Z2AA 1VF7A 3GHHA 3T9EA 1MJFA 1ECFA 3RPEA 1HKUA 5CT9A 3K20A 3HXQA 1LTHR 4N3CA 3AZPA 1O94D 2YX1A 5EJEA 2YIMA 3AG6A 2F43B 2WHQA 4LFBQ 4ZJPA 1SSOA 4JB8A 5D86A 3DXXA 3M4XA 4CF7A 5FUXA 5IYCH 1F9AA 3TEJA 3FPSA 1MOSA 1RQLA 4PSUA 2C5HA 1ZW6A 5LNK1 4NXNQ 2LSSA 4KY7A 1R9TB 3QMVA 4MA5A 3M6VA 1SIOA 4J7XA 3RTCA 3HJNA 4QUCA 1SD2A 2IOFA 1A7JA 3DLBA 1KTIA 4LRTB 1PXUA 4UTNA 2PYZA 1GPDG 3INRA 3ZY5A 3KWMA 2ZB4A 3E9DA 2W4QA 1IOVA 1J24A 5IJ9A 2HF7A 2VWPA 3PTLA 1NG1A 1VTKA 3NRBA 3IMKA 4BB9A 2XTIA 1RZRA 2VAWA 1P7PA 2O2ZA 3ZOZA 2CNDA 4RCNA 4J1MA 2EIHA 4KJZA 1YD7A 5A5VA 2B2WC 4QDOA 5LVAA 2H9IA 1G2SA 3A32A 1NHGA 3K2IA 4QY7A 5E4JA 3RJZA 3IQGX 1AURA 1XHEA 4OJNA 1VKNA 2OXIA 5AQEA 3IUSA 1Q1BA 5K8LA 2ORIA 3JQGA 4GOPA 3I9V6 4QICA 4Q9HA 2G1PA 4KO4S 5F4ZA 4U7GA 1DARA 4EY7A 3HL4A 4BIIA 4LF8L 2R60A 4ZQFA 3I61A 1J07A 4LJRA 2FXVA 2OV3A 1DCFA 3V6LA 5ICMA 5AKYA 1S7GA 4BRSA 2EFYA 3WK5A 5JVG3 4NZMA 4K6FA 3NAGA 5JIBA 4Y1RB 3RVMA 4RGYA 1XJ0A 1FL9A 4P34A 1DAMA 1DBVO 5KSZA 3LQ2A 3RODA 3ZHOA 4RGBA 1DRJA 1NOKA 3U3MA 1YH3A 2IHNA 1PRTC 2HBRA 3I0NA 3CUTA 5IKPA 5CG1A 4TZKA 5KYUA 5K8VA 3FMOB 5EJMA 3U60B 3EDMA 4IJ6A 4XYQA 3OPQA 2ZSHA 3ETDA 3GXOA 1GDTA 4FFBB 3MTSA 4KNVA 2JG3A 2POQX 4Q7MB 4D3YA 3D6NB 3MF4A 1FP4A 2FGJA 2DT5A 3X3MA 1WVMA 3AUAA 3OICA 1II9A 4ZI2A 1CJTC 1VKOA 4O25A 3JQFA 4CODB 1QH1B 3AQQA 1RJFA 1Z6TA 2H1SA 5GPBA 4GPAA 2GN5A 1OGJA 4NMLA 5B7PA 3HFZB 1E6MA 1BU5A 4GBJA 4WNAB 3RW9A 1DCTA 1K63A 4CKCA 4PNHA 1A3UA 2NV0A 3SE7A 3VYRA 1Z6HA 3RRFA 4CMHA 1BVSA 3GF4A 2QPTA 3RAGA 3DEKA 4MGIR 4ER5A 2G06A 4JQSA 1O4VA 4KO3S 5FLYA 4BFVA 4LF4Q 2VRBA 1T2FA 4ACAA 3HOWH 3PHLA 2Q3JA 2XMDA 4Z7JA 2RQXA 4Q3LA 4GOMD 2WM3A 3FY4A 1PG2A 2CEAA 1HNNA 1QFSA 4FI3C 3MIIA 5C18A 1IRIA 2YV3A 5I4BA 4W9MC 1UMKA 3KZVA 3QXCA 3EDOA 4QBFA 2PIDA 4ENVA 1EINA 2GLTA 1YJAA 1QLJA 3GLTA 1B00A 2ZRHA 3SWWA 3EQLC 3GAZA 1GM5A 5EUMA 4JK3A 1I51A 1I4EB 5KMGA 1C9OA 2IITA 5KOYA 5ED0A 4B3HA 2X4IA 4BNZA 3BRWA 4H7PA 2F0GA 1R3UA 1W4ZA 4UAGA 5FI1B 4ZDKA 3OHXC 2YRXA 1S4ZA 3BOSA 4ZI7A 1ZCBA 3RTAA 3ROMA 4WGGA 1WZUA 1NZFA 1FUUA 2FX5A 3LCVB 4O4IA 4W5JA 4DR1Q 1P0IA 2J6CA 4KV9A 4JELA 1XD9A 3PC2A 4A3BH 3L8ZA 4FF4A 4DKXA 3L7IA 1RLJA 3M4ZA 2KBFA 1ZMBA 3M6WA 4E6EA 1PFQA 1WXWA 2I1QA 4M9SA 5BNTA 2N0SA 2R4QA 1QMGA 4OGQC 3WKEA 3LWEA 2G9QA 3RRZA 1R6TA 4DR2B 1TF7A 2GF2A 3FVRA 1JQKA 1NPTO 3I2KA 1N2XA 2GCGA 3QMWA 4MGYR 2ID9A 4PIMA 3ZNPA 3PUYA 3QQPA 1L3IA 1ESCA 2EG5A 4FCTA 3JYQA 2E37A 3M4OB 2WT4A 4UE3S 1A88A 3O9MA 1A9TA 2H2FA 4ZYVA 2QXYA 3KYHC 5A62A 1MC4A 1BG6A 1O6BA 4JKIA 3PKJA 3D3QA 4YRRA 1UZMA 5EE1A 1XNHA 3TUZC 2I33A 5FEMA 3UHJA 3S9WA 4XM0A 4DAYA 1G42A 1MIHA 4MQEA 1KKMA 4FDMA 2IY5B 1BNZA 5CXUA 1HURA 2AOUA 2ZE7A 4ZRMA 3GDHA 3ZJUA 1VJ1A 5M5XB 1R6XA 4R2LA 3ZE1B 3DZHA 1U2DC 3N9IA 5ERGB 1D4ZA 2NZHA 5JYEA 3F8SA 4KQIA 4G1MB 5G0WA 1QHXA 3GB9A 1B4DA 4TS9A 1OROA 1CKOA 1C4QA 2FEWB 3DJFA 4HXEB 1XNJA 2XHEA 2I1LA 3NTHA 1A8PA 2IIQA 3J80E 4LYDA 1HQRD 5CT4A 5G1OA 2R2GA 4Q1EA 3RSQA 1QWOA 2CT8A 1RDFA 2VJMA 1W5BA 2HSJA 2BHNA 5IUKC 3PIOA 1HHVA 2VHEA 3TG8A 4TMZA 4GICA 4CQMB 4C3JB 3BVPA 1HPLA 3DQPA 1LBQA 2DUNA 3QEAZ 3PXAA 3DO5A 1COZA 4Q9IA 5FXMA 5IZCA 3WJ7A 1VQ6A 5CR3A 2AKEA 1UMDB 2L82A 5IGEA 1HDOA 1D1IA 4NY1A 1E0DA 1GHTA 1SCUA 1TWAH 3O4HA 1QC5A 2FPLA 4IO9A 3GBPA 4RA8A 4LF7L 2QR3A 5CB4A 2OFXA 2RGGA 1NQAO 5CVDA 1KY2A 1IQUA 2F4VQ 1T1IA 1UK7A 3TVDA 3K0HA 2OHHA 6NULA 3I01M 3UK0A 5BRJA 2ECFA 4PPYA 4GNXB 5M5YH 1NVBA 2NWQA 4JUDX 1TIKA 1KEWA 3FETA 4ZGWA 4KQKA 2GN9A 2QE6A 4JI1B 221PA 3DMNA 1U0FA 1DX4A 2WIFA 5T67A 4HPXB 4NCJA 1H22A 4EFDA 1XRLA 3AGPA 1OO9B 3RIYA 1DBRA 4GE3A 5KYXB 1SK9A 3IODA 2V7EA 2RGWA 2QTRA 2OORA 3ZQ4A 5T8KA 1YI0A 2GT1A 2ZJZA 1GUDA 4HIOA 4BYMA 2GBFA 4I2NA 3FJYA 2CMHA 1ES9A 4RE6A 2ZWIA 2Q7XA 2V7TA 2VFAA 2NMVA 4AMUA 1YR3A 3ZD6A 1B44D 1ORDA 3I0MA 2JEBI 3QIVA 3UGJA 1C1HA 3SJZA 1H1LB 1NVWQ 4Y9TA 4P1ZA 3VPHA 3E7WA 1XZGA 3I56A 3DOUA 1TVMA 1P7CA 1DWOA 2R65A 3U13A 4PC3A 4FXGC 3S44A 3DWPA 5ES4B 3CG0A 4NI5A 1D2RA 3IAS1 4NG4A 2X4LA 4BCBA 4BB5A 4G0VA 1ODSA 3EXIB 2ADOA 5EESA 1CY1A 2I5LX 1G16A 4ISCA 5E6SA 5H9WA 4MQFB 4GNRA 1XELA 2V6GA 2RGEA 2Q4DA 3FWNA 1G291 1JEDA 4DSUA 1CKEA 2XV1A 1NUUA 1B4OA 2CSUA 4LHVA 3IV6A 2BF4A 3W9BA 2VJKA 4YP6A 5D3DA 1E8NA 1ONOA 1U63A 4RJKA 2QTFA 1NKTA 5DLEA 4OPMA 1C3OA 3D7KA 1FW8A 1KH3A 4N3GA 3HGQA 1XB2A 3F5FA 5T4BA 3JWPA 5COQA 1FVOA 3P9NA 1RLUA 2I71A 1E7RA 3JAKB 3EGWA 3LQQA 3DAHA 3EIHA 3HWWA 1PW7A 3UJHA 1LT4D 3EXG1 3UWPA 1FD7D 1A69A 2NN3C 5H3CA 3VM6A 4H7HA 4KZKA 5HQJA 4LMQD 4OELB 4PYIA 3OW2A 4PC2A 8OHMA 1JVBA 4LF5Q 1KWKA 4CTMA 2KBNA 1CIJA 1XE3A 5EGNA 1X7WB 4E46A 2R11A 2SKCA 1BO6A 3WY9A 1DLIA 1U7XA 3QBTA 1XNGA 3P0IA 3ISVA 3FF1A 3QI7A 2GZDA 3V80A 2XB8A 1XP5A 1LVUA 1S4QA 5GAJA 3GCDA 1W0CA 1N33L 2FKAA 2PKRA 1AXGA 4C01A 1TYBE 3SFZA 3HXTA 2XCRB 3DC7A 2MNAA 1FSFA 1Z9FA 3A7EA 3EGXB 1DGQA 2Q0XA 5JCOA 3KAPA 3ZN2A 1R18A 3BDIA 3KT8A 4N9TA 4DLKA 4B3SL 1Q7RA 1P2SA 2I6XA 2AT1A 2E8GA 3UH1A 2IELA 1VPWA 2PWPA 4JLNA 3W6OA 1NW3A 4DBLE 3KLOA 5E9AA 1XPJA 4WINA 1Z6PA 4OUDB 3UQZA 1G1AA 2RK3A 4BGEA 3RRMA 2K7FA 1U9IC 1KY5A 2W0SA 5JZVA 3AEUB 1KP2A 2P3QA 3WK8A 2QL9A 3JASA 3OC0A