1OXVA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 98
structure length 353
sequence length 353
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxvA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxvA01
1VQ5A 3GLFE 3I8XA 1W36C 4ITRC 4TYYA 4JI2L 1KDTA 4WAUA 3ONWA 1VMAA 2J7PD 3U60B 4MYUA 1B70B 2ZJRA 2GRJA 1J8YF 3BB4A 3B13B 4B3SQ 3CRVA 3RHFA 2ZTCA 2ASEA 1ZUIA 2DWOA 4LUOA 3RN2A 1IBLQ 4LF7L 1LF0A 1D9ZA 3QF4A 4PAQA 4V0ME 4B3ML 4JVSB 2A8VA 2XZPA 1GO3E 3LLUA 4A0RA 1KTVA 4J15A 4TKOB 3AP2A 4LUZA 4LNQA 2QENA 2D0OA 4XIGS 5M5XH 1CU1A 1OYYA 2H5EA 5KOYA 1JR6A 1DXMA 1P9WA 4LJYA 1IBLL 4LF7Q 5K8TA 3A4NA 1XPRA 4OX9L 2JA6G 2WIAA 1J6QA 1P73A 1XMQQ 1M34E 5KYKA 2BBWA 1VQLA 4EQ5A 2R93H 2JGNA 5GADl 1I4LD 4IOMA 4BFSA 2ZEJA 4Q4JB 4IDQA 3THYA 3IPYA 5IWAL 4URYR 2CWPA 1EGAA 1N32Q 1ZD9A 2NQ2C 3ECCA 5JEEA 4Q9HA 1VCOA 3K8YA 2VP5A 2PL3A 1VHTA 1X86B 1Z47A 4NBSA 3NEMA 4AC9A 1H9SA 4NCHA 1MO5A 5KU1A 4P31A 3NBYC 3S15H 4KI0A 3ULLA 2GAOA 1E9BA 2E8GA 3JAMi 4Q66C 3IEVA 1GDDA 3H0GG 2ALYB 3OAAD 3ADDA 1XTQA 4B2IA 3OE7D 5KDDA 1FFHA 1BOFA 4BY1H 3PQCA 4DRZA 3N2EA 2QPOA 1IBKL 4Q7MB 4RKEA 5DO9A 5IE8A 1WE2A 4A6PA 1N0UA 4U00A 1JBKA 4E5UA 4JI7Q 4AK9A 2AWOA 3I4NG 3IQWA 4JLBA 3KL4A 5CIQA 3NWJA 3E2IA 4RVCA 3KKNA 3M7NA 1JI0A 1H9MA 5E7IA 3NEYA 3HOXH 2QF7A 2DFNA 3U58A 1DEKA 2Q6TA 2ATWA 3RWMB 4AWXA 1IN4A 1OH5A 4URZR 2PEZA 4H9GA 1NLFA 4ARZA 4KFUA 2V1XA 4R2IA 4LF8Q 1VIYA 2ZANA 4KYIB 1MO6A 1XZQA 3GLHB 4IFDI 2VQEL 4IDHA 4W5HA 4D0GA 1D8TA 3CKLA 2XXAA 2LXJA 1TQ4A 4LV8B 3A5UA 1J5EQ 1VHLA 3UMRA 4C2UA 1JR3D 3PCRB 3DKVA 4HZUA 4KFRA 4UXHA 1OV4A 4TSFA 2O5IC 3ZVLA 5GVRA 4DCNA 5HKKA 2ZJQA 1YJWA 2FPLA 2JA7G 4LPSA 2JA7H 2ZI7A 4HAYA 5FUVA 1VG8A 2BC9A 2EYUA 2ZM6Q 5LMNQ 4BXXH 2YNMA 5C1BA 2DY1A 4LWZA 5JZVA 2EQBA 1E99A 3I4MG 2OEPA 4RFSA 3UDXA 3FMIA 5AWFC 5FOXA 3QI2A 4ZCMA 2GVZC 3ASYA 4F4JA 4V0LA 5JJIA 4AD8A 1T3LA 2F43A 2V55B 2YTXA 1IBKQ 4O0AA 3W5OA 4A3LH 2I1QA 4DR6Q 1MO4A 4EDHA 1E2DA 2JEAI 1ZUNB 4OK3A 4H1VA 2ZSAA 3GO5A 1KO7A 2ERYA 2VZAA 4C3HH 1KI2A 5M04A 3BAFA 3T1VA 4A3DG 3GLGE 1RIPA 4FIDA 2WSMA 2ODEA 3A1WA 1G8PA 4BPBA 2B29A 2QA4A 5LMUQ 1N6NA 1R8SA 1US8B 4BA2I 1XD2A 2H5XA 1M2OB 2IYZA 3BJIC 3ZQJA 1NE3A 3BOSA 3J7ZC 3Q7QA 2B8FA 2K33A 4GLXA 3GCGA 2EQSA 1XTDA 4IPGA 2XOKA 4IVQA 4CEJA 3LQQA 4DLVA 1S0UA 3CPJB 1E1QD 3DMDA 2PMDA 3CF0A 4GP6A 3S1RH 3PJRA 1E9RA 3AF2A 3K70D 3N70A 3S1NH 2FSIA 2RGGA 2RGAA 4FMCB 1FJGQ 5HCNA 1RRFA 4M9SA 4FWTA 2GXSA 3CONA 4A3MG 4DV6L 3R8FA 1ZRHA 3FKIH 1DAKA 2YJTD 3P4XA 3GLGB 5KO2A 2KBFA 3CNNA 4XTRA 4DV7Q 4U02A 1Z0JA 4GPTA 5LD2B 3WP0A 1OFHA 4ZV4A 1QBKC 1JJGA 2AD5A 3U7GA 2WKRA 3GJ4A 1A4RA 1ETUA 2BJVA 2UU9Q 1OXSC 3QKSB 5FOUA 3PCOB 1BKDR 1GRQA 2EVBA 3W5IA 1J70A 4JI8Q 2ZI3A 1VQOA 4B3CA 2R6DA 4UY8C 4B32A 2E76C 4M2LA 4KBGA 4PAOA 2Y0SG 2B21A 1OE0A 4FWIB 5FOTA 1FOEB 2BMDA 2R92H 4FMDF 4PSVA 4WZAE 1Q90A 3H3VI 2FNAA 1NBMA 2V7QA 2Z6KC 1RZ3A 4XD7A 1VQ8A 4ZIRB 2X8AA 5C44H 1QHHB 1GILA 5CLQA 3CAMA 4Q4HB 4DEXA 1KK2A 3UG7A 4DR7Q 1GOTA 4IXNA 4MGIR 4JV5L 5DLQE 1LYLA 3I3SR 1HR0L 1HV8A 3ZQ6A 4BFTA 4FXPA 4OO1G 2NN6G 3AYHB 2F3IA 1G6OA 4OHZA 2NO0A 3OE7A 5F3WB 2VTKA 2AXNA 3RRNA 4DCUA 3K9NA 3BBPA 5BR8L 2UUBQ 2IYRA 3FKIG 3RS7A 1L1OB 3QVUA 3LVRE 1PLKA 4QJ3A 3EC2A 4Q4AB 5KSZA 2GBLC 2VBCA 3M85A 1NSTA 2WJGA 4NL4H 4X65Q 2FMXA 3FYHA 1WRBA 1CJTC 2BBTA 1Z7TA 5GAGC 4A0GA 4M8NE 2RGEA 1E9AA 1OIXA 1S72A 4QGFA 5BYKA 1GD7A 2DWQA 1G21E 4M1MA 1N2CE 1R4AA 1QHYA 4ZCLA 4ESHA 2OLKA 5JRZA 3C8UA 3W1BA 1QZGA 3LWNA 4X65L 4EFNA 2A5YB 1JEEA 3S1AA 4O2DA 2IYUA 4RKFA 4KJZA 2J9RA 3K81C 5HY6A 4A0FA 2ERXA 4AG5A 1VQHA 3A4MA 1VG1A 2KBNA 2QM7A 4KSCA 2G3YA 3CBQA 2I5LX 2F4VL 2MMGA 3SN6A 1E32A 1KDPA 3MJHA 1HZ9A 1RC8A 2ONKA 5B30A 4DUZQ 2RHDA 3TREA 4PR0A 5K36H 1QUQA 2CL6X 2NIPA 4BRWA 1F2TB 5UKDA 1W2GA 4DBLC 4U5XA 4PSAA 5C0XH 4A92A 1W36B 5AJVB 4OK6A 1K3RA 3Q9LA 2ZETA 2C9CA 4P74A 1Y1WG 1T6NA 5TV2A 5CK4A 4BFZA 3CRLC 3EA0A 1KJWA 3KQHA 2P65A 4OWWB 3UDFA 2A30A 4I81A 3W6PA 1X8KA 1GITA 4L5BA 4IOJA 4MRNA 3FPPA 4H44C 2WSSD 1I6VC 1MABA 4V02A 3U3OA 4UNSA 2ZYVX 3KX2A 4IPHA 3ZIAA 1CKEA 3CCRA 2ZTDA 3VDYA 3PFIA 2Q8IB 4DAMA 5BN4A 1E96A 3KJGA 3LBHA 2VHJA 4G5SA 4R1JA 4P4UA 1I50H 2OAP1 5FUYA 5K8UA 4G5RA 3U6BA 2EJGC 5EE3A 1RJ9B 2GN5A 5FUXA 3T1TA 2QQ0A 5DI9A 4A3GG 1WP9A 2IS4A 4DR4L 4H1UA 2XZOA 4AIIA 1W0JA 2A68C 2O8DA 2QPAA 2CNWD 5DN6A 2AK2A 1EK0A 1WBBA 2HDNB 5CITA 3EQLC 1S3SA 3BIFA 1TWGH 4Y0AA 4YY3L 1G64A 5C4JH 3GFOA 4E07A 1WMSA 1N0WA 1UKVY 3AP3A 2I0QA 2OWOA 4A3BH 1NMYA 2UUAL 1Z6YA 3ADKA 4PHGA 1L2FA 1MIUA 2QMEA 2I3BA 1VQDA 4YLGA 3TQCA 1G51A 3X1ZA 4OHWA 1DPFA 1SHKA 3KKOA 3H84A 2ZSEA 5IWAQ 5IHPA 3U9SA 4TQUS 4TWZA 1VQBA 3PIRA 1P2VA 4YONB 4C7OA 4KLNA 3CH5A 3HKZG 2QMHA 1A7JA 4BGDA 1NBWA 4LF6L 1UE1A 3ICEA 4MNOA 1H8ED 1S4QA 2CHQA 2PPBC 1KI6A 2XB4A 3AF3A 3D8BA 3PXGA 4CF7A 1Y69U 1UE6A 3K7UC 1GP2A 2AD1A 3Q7PA 3CUEF 3RRZA 2IYWA 2VHTA 4LBVA 3UK6A 2XTZA 1IBML 3C5HA 4P4SA 3R9WA 4NTZA 1RKBA 2G88A 5K36G 4RCYA 4DVGA 5AK0A 1N9WA 2A7QA 1Q44A 2AHOA 4RG1A 1G7TA 2HCBA 4BBSH 3UIEA 2QSZA 4W5JA 4DDVA 4KKTA 1RVDA 1TF7A 3MSXA 3QVVA 4MUBA 4TL7A 5AJZA 3W6OA 2PI2E 1H8HA 2DCUA 1MOZA 2WJHA 3TKLA 2D7DA 1EFRA 4EJSB 2CCZA 1G1MA 4L8JA 1P7CA 1WCV1 1OKKD 2OBNA 2ZSFA 4UNQA 5A0FA 2BCGY 4A3IG 5CB6A 3CRKC 3KXIA 3IKJA 3I5XA 2CMKA 2OG2A 2YOGA 5TY0A 2NPFA 4U7DA 4M22A 4NYMQ 3SJAA 1YZUA 4YHHQ 2JQOA 1NLYA 4DV4Q 2FV8A 3AB9A 2CK3D 3BG3A 4D4KA 5IF9A 2ZITA 2A5JA 3RABA 1CR0A 3L0OA 1AJEA 1M74A 4L5RC 1HYQA 4ZDKA 3G5UA 4TYQA 4ZDIA 1Q81C 5B57C 2XGTA 1XEXA 3H15A 2EWVA 3K9HA 4AKEA 1GUTA 1XD9A 2DFLA 3WYAA 4G1UC 1UJ2A 2NG1A 5J4LA 1HT2E 2ZI5A 3JC66 1W2BA 1VDZA 3GJ3A 3G48A 5HTKA 3SOPA 2WWYA 2RGNA 4NYJR 3KB2A 3O47A 2HHHL 1BVSA 1TUEA 2RHSB 2HXSA 1W49A 3KJHA 3M0EA 3BS4A 5JJKA 5JECA 3K0AA 3ZVNA 4JI7L 4QG7A 2UXBQ 1Z0KA 2MFIA 5H1YA 3CO5A 2AKWB 2VP2A 1SVWA 4KKSA 3EIQA 4GZYC 3DL0A 4OXPA 4WXRA 3FMPB 4HB3A 3RS5A 4M9QA 5IYCG 4CEHB 1SMXA 2F1RA 2MO1A 1JJ2A 2ZS9A 1QVRA 4LJ6A 2VY3A 4IJHA 2YU9H 1NY5A 1JB1A 1V5WA 2ZTSA 2XB2A 4DK1A 4JLAA 2K14A 3E0EA 4URWR 2FPKA 1HTPA 1FQJA 3U4VA 1LFDB 4QJ4A 1FUUA 4S35A 3HOZG 3Q8XB 3SFZA 4XWKA 1I2MA 4CRWB 4DLZA 2R44A 4M4SA 2WM9B 1VYUA 4DV4L 3R7WA 4PG3A 3VX3A 4B73A 1ZKOA 1W47A 1X1SA 1KSJA 3ULJA 1I2DA 4G5QA 2WWGA 1BO6A 1DAGA 1Z3IX 5IK2A 1XFAA 3J81j 1NN0A 1JEDA 5HZKA 3U7EB 1YBYA 4BZPA 2VSOA 2WVJA 5AUPB 2JA5G 5KSOA 4IJLA 4HLUC 4KXFB 2CCKA 3G0HA 3CW2A 4NPHA 2B63H 4EQ6B 1VG0B 2ORVA 1E69A 2QROA 2F3TA 3F0TA 1IY0A 1B23P 3I2ZA 3T1HQ 1C7YA 1HY3A 2Q2HA 1UBGA 1VG9B 1YJ5A 1E79D 3KFVA 2JLWA 3CCMA 4IVRA 2D0PA 5BYJA 1K73C 4PZYA 4K0KQ 5AJ3L 2O8FB 4JVMA 4DLXA 3S2DH 1M1YE 3DO6A 4EJSC 4QM6A 4TMKA 4KYUA 3P1JA 3B5JA 2OTLA 1Q3HA 3NBXX 3WBKA 1NMGA 1JT8A 4LUCA 3VKWA 3AKDA 3Q72A 2CCJA 4KU4A 1F2UB 1E2HA 4JI6Q 1Z0FA 2QA5A 1W4AA 1HURA 4MKGA 4DLYA 1K8OA 4KHZA 3MCAA 1XCMA 4NYIQ 4UJ3A 2IX0A 2IYQA 1WJJA 1P4SA 4MYTA 2E5LL 1M7GA 3LD9A 4H0LC 4DV0L 2O0JA 4KVGA 4RZ2A 1KO4A 4EPYA 1OXXK 1U0HC 3E1SA 2C78A 3QKRB 1HNZL 3FFAA 4M0LA 4Y52H 1NL3A 3AP1A 2ZI6A 3OHMA 4DEYA 4AQYL 1MO3A 3NKVA 4EQ6A 2PEYA 4HZIA 1QHXA 3S14H 1K5GA 1RRGA 3MRSA 4HLQB 3RRYA 1T0HB 3PIPA 1LTQA 1ESMA 3JZAA 2NTYC 4URUR 3UWOA 1G41A 3AVOA 3D3QA 4AYWA 2QNRA 4A6XA 4P0TA 2JK8A 4WJ4A 5TVKA 2RGDA 2AR7A 4RD1A 1JJVA 4QGAA 3OIYA 3P20A 1N34Q 1II8A 1KMHA 1E2KA 2WAXA 3J81c 3GLIA 4GLVB 3ZS9A 1Q8KA 2HUPA 4DR2L 3A5ZB 3RS2A 1MJEA 4D4LA 1J99A 4HI0E 4C0QC 3BH6A 4E03A 2UXCQ 2N78A 3PO2G 3GJ8A 2R7DA 5JWOA 4JI1Q 2FF7A 3IO3A 4BLTA 1XEFA 4NPSA 2BM0A 1GKIA 1C1YA 3W9YA 3HOVG 2N49A 1GWNA 2KWIA 3S1QH 2WAYA 4CEHA 4D25A 3RZDH 4R4IA 2OQKA 3BFVA 2IS1A 5M3FH 3TSWA 2QEXA 4JI2Q 2ZJAA 1XXHB 2F1JA 4JLDA 4D4MA 2QUZA 2OV2A 2P2LA 1G5TA 4OHYA 2VW9A 1BBUA 4RCZA 3B6EA 4LYHA 3D31A 3VR6A 4YCWA 4P32A 2E2IH 1CEEA 1O7IA 3KFUA 1L1OC 2VQEQ 4TLDA 2D3WA 3ASZA 5GJVC 3SHWA 1VQGA 2DWPA 3AEZA 4BEJA 2BA1A 4BZXA 1J90A 1IN8A 3ZVRA 4DLWA 1XMIA 1QZHA 4D0LB 3L8YA 1DG1G 2C99A 3BJUA 3A8KE 1CBUA 3PUVA 4TLCA 5DSZA 1OT3A 3IQXA 3U2QA 3AEVA 1SMYC 2E2HH 2VO1A 4Q1CA 2J0SA 2F9MA 1ZM7A 3QJYA 3ULPA 1TU4A 3A36A 5HPYB 4PX9A 1OH8A 2ZRFA 2N3SA 3L82B 1R7RA 1UEIA 2EW1A 4A3FG 2OHFA 2ZJZA 4FN5A 2YYZA 4C30A 2IHEA 4BFWA 2BOVA 4DR5Q 1OYWA 2ZS7A 2FEMA 3ZIAD 3GTOH 1JR3E 3K8AA 1AIPA 3O8DA 2I1VB 2NN6I 1N33L 1T5IA 4L5QA 2FZLA 2JIZA 4JLOA 5CJPA 5DHAA 2AHOB 3RANA 3AQQA 4PPFA 2V1CC 2FXQA 2A6ED 4DUYL 4GKKL 2MSEB 2ZAOA 5M3MG 1G5RA 2GTPA 3SYLA 5CDFE 2J5XA 1W46A 5H70A 3IIKA 3RDPA 4R98A 3HDTA 4I99A 1K9MC 1ESNA 4JMPA 1GG2A 4Q7KA 5B64A 4B76A 2K50A 3I5YA 1VQEA 3T12A 1VQ6A 4NZYA 2ONJA 3WYGA 1ZM3A 3QIAA 4BXXG 5JWHA 1UAAA 2P6NA 1JE5A 5D3MA 1ZVQA 4C7OB 1KGDA 1X9NA 2ODNA 3RLNA 4FMBB 3RAPR 2UUBL 3W3ZB 1CJVC 2ANCA 2CE7A 3LNNA 5EE1A 2H1LA 2X1VA 1NMXA 4TMXA 1FNNA 5GJCA 2EJFC 1O87A 1N36L 1W0KA 4GMDA 4X8MA 4C0AC 3IILA 2FPMA 3M4PA 3C15C 1PH5A 1Z6XA 1W3SA 2ZJPA 1IONA 2BBOA 4C9BA 4JLJA 2A2ZA 3UDGA 4AURA 1XMOL 4NDZA 3OOCA 1FR3A 4TSFD 3OTOL 3KUCA 5FR2A 3LO5A 4JLVA 3VNUA 1WB9A 1II8B 1KMHB 4D4JA 3ZS8A 1YE8A 5FTNA 1YVDA 4LF9L 2KI5A 2IXGA 3LV8A 2RF4A 1FX0B 1H9RA 5BN5A 2ZJ8A 3K1JA 5EE0A 1LABA 1YEZA 1ZIPA 3CR8A 3RVBA 1VQJA 3FHOA 1C9KA 3LX8A 3PV0A 3LBIA 3PUWA 1DO2A 3OIUA 5FR1A 2CVFA 2WMNB 1CJKC 1E4YA 2FWRA 2XZLA 2QP9X 1EWIA 1P62B 2I4IA 1VYTA 1N34L 4DNRB 1KC8C 1OB2A 1SE8A 2YINC 4OJQA 4KKUA 1NTGA 4A93G 1DAEA 3TW4A 2CDNA 4IFDH 4MKIA 3WMGA 5FOVA 1N6RA 1ZM9A 2VP0A 2D2CC 3GD7A 4JK1C 4JS0A 4MGZR 5KTYA 1M6NA 3SHFA 3U7HB 3WMFA 1WBDA 2D06A 3KB1A 3SU8A 3EX7C 2KCCA 3Q8DA 1YZNA 2AFHE 2R8RA 3CX7A 3TRFA 4BECA 4TQAA 4DDWA 4US2R 2VRWA 5J3BA 3W90A 2JA5H 4CGZA 3WDNA 4G3XA 2CK3A 2DHRA 4G5OA 4A0HA 1GRNA 4LF8L 5TXGA 4TTQA 4IW3B 4PMWA 2K75A 1YR8A 2ID0A 2WP8J 3UG6A 2WWHA 3TLXA 1TWCH 4EFMA 1BS1A 2GWHA 3F1ZA 4ON9A 2K7VA 3NBHB 2ZR9A 4DR3L 4A3CH 2P5TB 1VQIA 1Z29A 4TYPA 2ZRHA 4AQYQ 2JJQA 2QE7A 2XJ9A 3NDPA 3T35A 4B44A 2O8BA 4HAXA 2V4ZA 4HSEA 4ME3A 3LW8A 2VL6A 2IS2A 1NBME 3CPEA 4MGYR 4JKIA 1R0XA 3OF5A 2KJQA 2FDCA 5FTKA 2JA8H 4AKHA 4DC9A 3SDZA 2C9OA 4JOIA 5B58C 3JAMc 4II7A 4RD3A 2ZR0A 2FE4A 5CB8A 2BDOA 2W0SA 3A1SA 1WDTA 5F98A 4CT5A 4KN4C 3BU2A 3QBTA 3R9IA 5AUNB 1U8YA 2CL0X 3BB1A 5G40A 3NEJA 3T1YL 1IYVA 2NMVA 4HIKA 1S40A 2JLSA 1AM4D 2K5NA 4LFCQ 3F8TA 2G0TA 5BQ5A 1DGSA 1UBEA 1XEWX 2HYDA 5EXPA 4P73A 1VECA 3Q5EA 5LMNW 1EFUA 4NMMA 4G0NA 3PEYA 3TH5A 1H95A 1P2SA 4OI4A 4B74A 2VL7A 3GPLA 2Y8EA 1N6PA 2IY5B 5DYGA 5P21A 4AYXA 5ELXA 1AS3A 4LWCA 1DE0A 1II9A 2EJMA 2BDTA 3Q5DA 1Q1BA 3LGJA 1NJIC 3F2CA 1CLUA 1DS6A 1NJGA 1YITA 1XJQA 5FLXc 1QHHA 4YDHB 421PA 2HLDA 1AA9A 3NELA 3GJ7A 1NN5A 2QN6A 3GJ6A 4BLPA 3T34A 2K5VA 4MZ9A 4J0QA 1QJOA 3A74A 2ZJYA 2WHXA 1HNXL 2ZRGA 1TF2A 1YZ6A 4POFA 4WA7A 1XD8A 3VU9B 1DOAA 1QHSA 2OFOA 3C7KA 3H86A 621PA 4OL0A 3BC1A 4GNXC 5LMUL 3QY0A 2ZVQX 2OCYC 4V03A 1GTVA 3NHAA 5K8LA 1CTMA 4C0JA 1XEXB 4IFBA 3K09A 3QOFA 4OGQC 4HLCA 1ZCBA 4PHFA 1WI5A 2JDID 3UWKA 3S16H 5B2ZA 1T4GA 2QQEA 3L2PA 1ZNWA 2JASA 4B34A 1O7LA 4NCJA 2B6HA 3LBNA 2GCNA 2NVXH 1EIYB 3VR1A 4HDCA 1D7QA 4LV5B 4ABYA 1FGUA 1TQ2A 3BXZA 1G3RA 1X8LA 3BH0A 4B43A 1TUIA 5L3QA 2VQFQ 1KI9A 2REBA 1E0KA 2R92G 1NG1A 1E24A 3J80c 4LFCL 4C3IH 3LLMA 3WYFA 1N8RC 4C3ZA 4D81A 3AF0A 4LF4Q 4OQXA 3IBGA 3HR8A 1XPOA 4TL8A 1IHUA 1JXOA 4MA4A 1W44A 3CB4A 2F1HA 1EUJA 1T3SA 4IOLA 4XJXA 4O25A 5KUTA 2FH5B 1E9EA 2ZRAA 4A8JB 5J4VA 4N0DA 3RSOA 1AE3A 3PENA 2QTHA 5H1SE 1MRNA 4JL6A 3T06B 5A35A 4IFDJ 1JR3A 1KAOA 2VLIA 3A0JA 3WNCA 3S2HH 4GLAC 1GNQA 4NXML 5C46F 3U44B 2IL1A 3TK1A 1GHJA 4FD2A 4Z1MA 4XH9B 4IEIA 1BMFD 2QPTA 1Z07A 2YWGA 2UZ3A 5FBVB 1NIJA 1P6XA 4CT4B 4DK3C 1G3MA 3FTQA 5SZHB 2G0NA 2FX3A 2R65A 3GMTA 2ZUCA 2KE5A 4QHYA 2BJWA 4I7ZC 3CMEA 5E95A 1U8ZA 2PMZE 2Q3FA 3CCEA 3T15A 2BA0A 1RYHA 3GTKH 1Z83A 2ZRIA 3HKSA 2BE5D 5DN6D 2GCPA 1TKWB 1PJRA 1R6BX 1BMFA 4HB2A 3VKGA 4JLNA 1CSQA 3HOWG 5IT9c 1OHHD 4NYIR 3WXMA 3L0SA 3ZZ0A 721PA 3PF4A 3GLHA 3THOA 3ND8A 4PO1A 3PVSA 1XF9A 1SXJB 3GLHE 4TT3D 1CR4A 4ERNA 2HT1A 2VHUA 1ZU5A 1ZM2A 3L2OB 4I1SA 5E7MA 1T5EA 4OWTB 1ZIOA 4M21A 5C44G 2FG5A 2RB4A 1E2MA 2ZJOA 2QMOA 2R6AA 1MABB 2B8GA 1S3OA 4BLOA 4DXAA 4X64L 4WZBE 2E75C 2NGRA 3BFKA 5IRCD 3HOYG 4RJLA 1AE2A 3B8HA 3JVUA 1NNEA 3NE5B 4JT4A 1ZUHA 3EPHA 5FFMA 4D82A 4OWXB 2FJUA 3CX6A 1P9NA 1XMOQ 4MKHA 3TMKA 5FJ8H 4DR1L 4HAZA 4AH6A 5JJLA 3HKZE 4I1UA 1CS4C 4D26A 2QAGC 3DZ8A 5LB4A 2DPXA 1W36D 1E9CA 5EZ6B 3BGWA 1Q57A 3IBYA 4LDJA 4IPDA 4MYCA 2O8CB 3PO2H 1AZSC 2ZT9C 2IXEA 2CKZB 1EYGA 2X77A 4LYAA 1LTLA 4JBJA 3CH4B 4L16A 3CWQA 3THXB 3ZH9B 2RCNA 2CHGA 4X8OA 2W83A 2PQAA 4GN4B 1KI4A 3L8ZA 4A2QA 4B3GA 4IO9A 5C4GB 1NY6A 2IYXA 4IDNA 4DT1B 4DT1A 2IC5A 3C41J 5FTLA 4FCVA 4DV3Q 1Q1ZA 3ERSX 4NB3A 1VS0A 3LVQE 4Q7LA 3ZD6A 2JCSA 3N5CA 2GVBA 1KSGA 3W1GA 1PV4A 1ZBDA 3MXNB 3EC1A 1TU3A 3RWOA 1JQJC 1F6BA 4DNTB 3IRBA 2UKDA 2ZRCA 1G17A 2QT1A 1KSHA 1E0JA 2OCAA 3NIBA 1N33Q 1FZQA 4UXJA 4AKGA 4IFEA 2JJ1D 4HB0A 1E2ZA 1XU4A 1YZTA 2JDIA 1R0WA 5CYOA 5EXSA 2GEDA 3RNLA 4A3JG 2J41A 1IBMQ 2V4DA 2ZYTX 4LBWA 4QRHA 3CLVA 4Q4AA 2UUCQ 2J46A 2PT5A 4ASUA 1QZXA 3E70C 1PUJA 3EZ2A 5E7JA 1EOVA 4ZI2A 3EIVA 2NVYH 1R5NA 2GHIA 3TZUA 4KLKA 1A63A 4XOIA 1ZP6A 2GJSA 4AYBG 1YHNA 3KTAB 1G7SA 3CXCA 1OB5A 2P5SA 3J80i 4DK6C 1HE1C 2YWFA 4GRAA 1Q82C 1W48A 4FMCF 4IXMA 1HQYE 2G9NA 2UUCL 3AF1A 1XTKA 4JL8A 1KKLA 2VHCA 5CM8B 3RC3A 1TWHH 1NG9A 3I4MH 5H8WA 1PFSA 2FGKA 2WBLC 2K52A 2OLJA 3TR0A 1PH8A 5KSPA 4CYMA 1KIXA 1OSNA 2HXYA 1ONLA 3CNLA 1GNPA 4HUTA 1K8AC 4DDUA 2QGZA 2VF8A 2WKQA 5FPYA 4GOXA 4B3SL 2NZHA 1NMZA 1CI3M 2AX4A 1ZC3A 4PPQA 4QBHA 3M6AA 3WP1B 1WFQA 1P9RA 4OI0A 4ZDWA 3RS3A 3T61A 3R20A 4BUJA 3HOUH 2DUDA 2GXQA 4X8HA 3TSZA 1SKQA 2WTUA 2ZE8A 3D0FA 3C4JA 1ZYUA 1XNRQ 1J5EL 2C03A 3EA5A 2IWRA 2VA8A 4LFAL 4UJ5A 4DKAC 3UKDA 3GLGA 3I55A 2N46A 2GVDC 1GUSA 2J45A 3QEOA 4PZLA 4BY7H 1GL7A 2Z83A 4JBWA 3ETLA 1FUKA 2YC4C 2R6GA 1PH3A 2ZUBA 3AB3A 4TZ0A 2F1MA 3MWKA 1ZJ6A 2BBSA 4MRVA 5C4XH 1YRAA 4GOPC 1U9IA 4TMWA 1HJPA 4PO8A 4YMSA 4HEJA 2PNRC 1Q86C 4I1OA 3TQFA 3FOZA 4P33A 4A8JA 2WAQG 3SJCA 2FFQA 4Q1DA 1KOFA 1D9XA 1X3SA 2QP3A 4P75A 2K32A 1US8A 1XD2B 1FPMA 1UADA 1JJCB 3KKPA 4ZDJA 4RSGA 4PPGA 4V0NA 4MGKR 4QJFA 1P72A 1I94L 4LJ7A 4NONA 4PC7A 2NO1A 5L3QB 3D7MA 4H02A 1XTJA 1FMLA 4A3DH 1Z5ZA 3TQYA 2Y0SE 1LM0A 4OK5A 3EPLA 4H13C 4RY2A 2GVAA 4C0LA 4LRWA 2LMCB 1MKHA 1TEXA 1N36Q 1R5OA 3A58B 2VQSA 4LF5Q 1TPZA 4MKFA 4US1R 2F55A 3VFDA 2YOHA 3X1DA 4JBXA 3UANA 3VR3A 3FPAA 3GTMH 3MGCA 2DFKB 4HIMA 3IEUA 3SZRA 3AGPA 3CM0A 2WJIA 3NBFA 3TUZC 4JYAL 5C3EH 1KY3A 1NF3A 2V6IA 1DELA 4GBMA 4LF9Q 2EFDB 5G3ZA 1RFLA 3KQNA 1L2TA 3I4NH 2V1UA 4DB2A 1WXQA 1FMJA 1PLLA 2HJVA 4QBIA 4D6PA 3QEJA 4A3FH 1DADA 1E2NA 3CF6R 4HZUB 1DAFA 521PA 1E0SA 3MUFA 4JZKA 2RHMA 3A1TA 1VQ7A 3ZD7A 4RMFA 1T8TA 4NCKA 2XXAB 1KK1A 3FVQA 4MITA 1XXHE 4A3BG 4ARZB 3I72A 4Y7NH 1Y8OB 2ZQ5A 4M9XA 3ZYCA 4BQSA 1XBTA 1E1RA 3ER0A 4EPVA 2PZEA 3IGFA 3BERA 1X6VA 3EW9A 3L0PA 3V9PA 3KTAA 1TNDA 1XP8A 2OT3B 3TNFA 4BFVA 3KQLA 2ZRKA 2K4KA 3QXHA 4GOKA 1B8AA 2QTFA 2GF9A 4HDOB 4AIMA 3OIWA 5EXTA 4DJTA 5KPDA 2EU8A 3DLLA 2QEQA 4GT1A 2NVTH 4LC0A 4K0KL 4HATA 1COWA 3G82C 1G6HA 1X56A 3TS0A 2FSGA 1VTKA 3NC1C 1E1RD 1PVOA 4JLPA 3RS4A 3SGIA 3IDQA 3MJRA 4A36A 1ZNZA 2CCGA 3GTPH 3J81k 1E2GA 1HE8B 2WKPA 5DE3A 1KNQA 1AS2A 4QHTA 3HOYH 2E5LQ 2WJVA 1H9SB 1SULA 2GJKA 2Z6VA 2G83A 3U3MA 1E22A 2C8VA 1QVGA 1FL9A 1GVPA 1MV5A 1G4UR 3TVDA 5KDLA 2E1RA 3CCSA 4A4DA 1PA6A 3EPJA 3THYB 4Q4JA 2QP4A 2OCPA 2X2FA 4X64Q 1IQPA 2PQAB 3M9BA 1PH2A 3FDIA 4F7WA 3B6YA 3THXA 1A5TA 3TBKA 4LCBA 3VR2A 4B35A 4DIEA 4DNIA 1DBSA 2O8CA 4TYWA 2A6HD 1EWRA 5EE9A 3B2EA 4UNNA 1KIMA 2OBLA 3CIOA 4W7SA 2L5TA 1VCMA 2CLCX 3SEAA 3I7FA 4QFMA 3GEIA 1P2TA 4Q1FA 2AMCB 1SXJD 3V4RA 4JLMA 5AJWA 1U0JA 1NP6A 1VQKA 2OFWA 3KJIA 1IJEA 4RCNA 1YJNA 4O2RA 4O2LA 5EQTA 1GKUB 2ZE6A 1ASYA 2GILA 4NE2A 3AVQA 2ZRNA 1CJUC 4DV3L 3ZZUA 3LNCA 4Z8XA 2OM2A 2CE2X 2WZQA 2A69C 2QAJA 3B9PA 3HYTA 4I1VA 4NH0A 2IUSA 3AUXA 5GAEC 2KSQA 4EKDA 1N5KA 1W0KD 1SXJA 2DFTA 2QT0A 4US0R 5KPJA 1OLOA 2LXKA 1E3MA 5FOWA 4DSNA 4JG2A 2QZ4A 1KK0A 1HR0Q 2WPDA 3B1XA 4MRPA 1Y8PB 3DOFA 3EN2A 2PH1A 3FP9A 2PZFA 4FCTA 4LC1A 4LJ9A 3TAUA 4L9WA 1LV7A 1XMSA 3MLEA 1NN1A 4QQBX 4FI3C 4Y0VA 4HAUA 2Q9BA 3DOEA 2PJRA 1PYSB 4JOIC 3QG1A 1YR6A 3BE4A 1X65A 1G8FA 4XWAA 1WF3A 4XD7D 4YMVA 2XNDD 4GOPB 4BEBA 1JAHA 1JB7A 2ANBA 1VIAA 1W4RA 2ZR7A 3B60A 1UE5A 3KJEA 5CM9C 4ZKDA 3FWYA 3QE0A 1D2MA 1GNRA 4OQFA 2R62A 2KHIA 5BXQC 2NO6A 3CX8A 1YNJC 4I4LA 2UUAQ 3K70C 1DAIA 3U44A 5C0XJ 3MAAC 1XJVA 3K0EA 5TB5A 5BWMA 2YWHA 4R4QA 2BEJA 5FUWA 1E2IA 1PHJA 2Q9AA 3C5CA 5AJ3Q 2GBLA 3B7GA 3D6TB 4NCNA 4UXIA 4CDGA 4B47A 1GKHA 1G5PA 2EIFA 4MYHA 3RSLA 1KJYA 2REXB 4PC3A 1I3QH 2KENA 5GADC 4LF6Q 4MRRA 1GIAA 2YKGA 3AKCA 5FTMA 3ND9A 1PLJA 3O8RA 1Q12A 1XPUA 5FTJA 4JI4Q 1MR3F 2ZTEA 1JPJA 1Z8FA 3OEEA 3PGZA 1V43A 4LYFA 3KFXA 3TSOA 4N1AA 3B1ZA 2ZPTX 1Z0AA 1Y63A 1YHAA 1A2KC 1KO8A 3LH5A 3WY9A 4UP8A 2PCJA 2CFMA 1TQDA 4DV1Q 1CKMA 3VMFA 1U8AA 3ICQB 4IOKA 1HNXQ 4YXWD 2J0QA 2Z6KA 5EUQB 3STBD 1VQ4A 4R2HA 1ZNXA 4BFUA 4YY3Q 4IPCA 2OO7A 2Z43A 1X3EA 4NYJQ 2W6ID 4HUQB 4YMTA 2BKEA 2JLZA 2ZSDA 1IBRA 4Q5IA 3AVXA 1DD2A 4QGHA 4TZ6A 1GUAA 4KV9A 3WHKA 4DSUA 2P67A 3K09C 1IW7C 1XTRA 3GLFB 1RW4A 1S9HA 4R4OA 1YIJA 3CCVA 1N6KA 4HAWA 1IAQA 1UKZA 3W6NA 3OIVA 4M1OA 3B9QA 5DIFA 3SQXA 4YXWA 2CL7X 3KJPA 2ZM5A 3VU9A 3HU3A 4DR2Q 4K46A 4GZMA 1I94Q 2Q9CA 4R4TA 4NYMR 4LJAA 4EFLA 1AKYA 2W0MA 4W9MC 1YZQA 3I56A 4B3BA 3HPQA 1WOCA 1K6MA 2HCJB 2OCBA 3TRZA 3KXKA 1QVAA 3NTUA 4FINA 4OI2A 4PHTA 5BW8A 2PT7A 1G16A 3OEHD 2PBRA 3OFND 3SYNA 2OSBA 2D74A 2J0UB 3WWVA 1MKYA 3IFTA 2PJZA 4DCSA 1PH1A 2IT1A 2VUMG 5HZHA 4GL2A 4X66L 1SZPA 3QPWA 4DUGA 1YHBA 4LFBL 2R93G 1DG3A 1UDXA 2CNWA 3KKMA 5JCPA 3EPKA 1IXSB 4DAYB 3HGBA 2B7CA 1GM5A 2XSZA 5LMNL 1XDBA 1X3GA 3HU2A 4XSHA 8OHMA 1XNRL 3H4MA 4ZPXA 2NO7A 2JAQA 3BD9A 3SFVA 1JJ7A 4DK0A 1AN0A 4X66Q 1Q3TA 3I32A 5AUOB 1QG2A 3KJOA 4A3KH 2AFIE 1I4DD 3ZJYC 2HT6A 4BBRH 4IHQA 1G8HA 4MDFA 2QM8A 3K0CA 3X1XA 3AVWA 3T53B 2Z5FA 5TDHA 1DARA 2QU8A 4DUGD 2JLRA 1YU9A 4PC6A 6Q21A 2R7ZG 2VSFA 4JBMA 2ZYUX 4MDEA 3SYKA 2V6JA 2UXDL 1OFTA 2O8BB 1XWIA 1OH7A 5F9HA 1RRPA 3K80C 2BMFA 1O3YA 2WOJA 1M7BA 4DR5L 4C2MH 3KDFA 1UF9A 2WWIA 4LX0A 1F2UA 5L3SA 2JJ8A 3VR4A 1TL7C 3P26A 2ZUDA 4JSTA 1G3IA 1Z06A 4F92B 3HOXG 2PLFA 4APVA 1VCNA 5HE9A 1KJZA 1PYBA 1YZLA 2F6RA 3EZFA 4LJ4A 3VTKA 3LRPA 1EFRD 2O8FA 3QF7A 3K9LA 2CBZA 1HT1E 1LF5A 1GUNA 5IP9H 1D5CA 2C77A 2HEIA 4QL5A 3N2IA 3BRWD 3T5GA 4Z1MD 1J2JA 3L43A 3VX4A 1KI1A 1UPTA 2H57A 5IYBH 1Q0UA 3WNBA 1NSFA 2B8WA 2O5JC 4JI0L 4NXNQ 3OESA 1HPCA 2ZVPX 1Z9FA 4A3KG 2AWNA 2REOA 4JI5Q 3C14C 4D80A 1YKSA 2K5HA 3GEHA 3KUDA 1S1MA 4B3MQ 4YCUA 1OIWA 5FBRB 3CC4A 1EIFA 1N6IA 3K0SA 2VS1A 1AK2A 1UKYA 4TMVA 1IYUA 5JI2E 4M1WA 2DBYA 1IXRA 1T3HA 1P3JA 2MSDB 1FX0A 3I4LA 3OEED 5DNYB 2XX3A 5FBLB 3ZZTA 2NVQH 2WJJA 2NZ8A 4GNXB 1E2WA 4HIDA 4JSYA 4KO8A 4FCWA 1E2PA 1MH1A 2A3RA 5DLQC 2CWAA 2W6JA 3R7WB 4OO1H 2FZ4A 3EG5A 4YDSA 5JS7A 3FKSA 4WVFA 2B7BA 1KL9A 4N3NA 2ZU0C 4F91B 1KK3A 4E22A 4R71A 3CRW1 3B85A 2A5DA 1M90C 4C0KA 3MWJA 3RN5A 5FPKA 3CD6A 2NPIA 4TT3A 3L7ZC 1R10A 2JLQA 4Q47A 3HJNA 2E74C 1IN7A 4TN1A 5EP2A 1SVIA 4Q1EA 1P75A 1E1QA 2JA9A 4OJKA 3ZVMA 2V3CC 5L3VA 1A6XA 5D3MB 1U94A 3CF5A 4TQ9A 4LHVA 3H0GH 4ALPA 3BWDD 1UKEA 3QXJA 4RZUA 4EX5A 5IY0A 3E9HA 3DDCA 4EAQA 4FMDB 5EZ5A 1XMVA 1VCIA 4EPXA 1EFWA 3C16C 4QKQA 1GZSA 4YHHL 3KXLA 4DV2Q 1LNZA 3OW7A 4X62Q 1W7AA 3GJ0A 2FOLA 3VKHA 5K8IA 2IA5A 2NOAA 3QSYA 3B78A 2DB3A 4PZZA 2WFWA 4KITB 2RKOA 3JVVA 4LHXA 1ZC4A 3NH9A 1P60A 2BH2A 2EFEB 3AVPA 4UP7A 2A6HC 1U99A 4WJ3M 2LWIA 1W5SA 2BV3A 2R6FA 1GKYA 1HR0W 1KKMA 1L4UA 2DR3A 3WRXC 2IYLD 1HQMC 5KSYA 4TLEA 2RAPA 3FHWA 1IYJB 1W1WA 4TYNA 4UP9A 5F9FA 3IUYA 2C04A 1N5LA 1YRBA 1VF7A 4AYBE 1SVMA 4A93H 1M8PA 2Z0MA 4JYCA 4XSGA 3WBJA 2HIXA 1ZW6A 3E9IA 1EWQA 5CYPA 3QQ5A 5GROA 1E79A 3P27A 4PC2A 5E7NA 2A69D 3W3AA 4EJSA 1SRUA 1UM8A 1D2EA 2YHSA 4PQFA 5D3QA 4YWMA 3GTJH 4RZ3A 4XVRA 2C98A 1PH4A 3DEFA 2NZJA 4YC7A 4A3EG 4AYTA 2A19A 4AY2A 2D7CA 1X54A 4O3MA 2BEKA 2IYYA 3OPOA 5LD2C 3A37A 3WRYC 1CRQA 3AUYA 5CIWA 4Q9JA 4DZZA 1PUIA 3FHTA 1D2NA 3JZMA 1BDOA 4P3YA 2CJWA 4OHXA 1KI6B 1UEBA 2I5HA 4PO9A 4DSOA 2B3GA 1XXHA 3IO5A 2YV5A 1LB1B 3T5DA 3SBEA 4GSYA 4IRUB 2WOOA 3ZLJA 1EQRA 2A5GA 2WB1G 4QIWE 4NXMQ 4YWLA 2ZS8A 2R7FA 3HP1A 5DI3A 1IZ6A 1XCGB 4HB4A 2HQLA 4M1TA 2QBYA 4B75A 1SVKA 4LPKA 2C9YA 4Q21A 4QNMA 4TL6A 4TL9A 2Q2TA 1IJFA 1BKBA 2BCJQ 3F5FA 3AVUA 1UBCA 4C0SA 2WICA 4QY7A 4BY7G 3K70B 2XTMA 1HNZQ 3T1OA 1H65A 2FFAA 4LBYA 4PANA 2AXPA 3GLIB 1T9HA 2C35B 5FL3A 1NN3A 1Z2AA 1KXLA 3LWUA 4GP7A 2CW0C 1ZYRC 3CNOA 4DR1Q 1NRJB 2AK3A 3LA6A 2VF7A 1E9DA 2ECKA 1RJ9A 3QXSA 4WXPA 2AL7A 4C0BA 4DLRA 1NKTA 2AN9A 2ZYWX 4AI6A 5CDFA 3M4YA 5EP1A 4QC2A 1YHQA 4JI3L 3AKYA 5CLLA 4EPTA 5E4FA 5IP9G 4GFDA 1C9OA 2A68D 3CPHA 1IN5A 5FBWB 1CF4A 4TVAB 2GXAA 1EFCA 2GK7A 5FLMG 1KO1A 2W6JD 3QKRA 2WSSA 2ZREA 1Y1WH 3K7AH 4UKDA 4UNRA 1EFTA 2C95A 4ACAA 2UXCL 4KMUC 3T1QA 1Q20A 3QNUA 4LK2A 2VH5R 4X8LA 3STBC 1YR7A 1N6HA 2DYKA 1G8YA 3EXAA 3G6EA 1KHIA 1T91A 2FU5C 2IYVA 5L8VA 2IS6A 4Q19A 5JSZA 3F3YA 4CVNA 3FMCA 2F1IA 3SNHA 3U6KA 1YR9A 4F4CA 3TW8B 1TTTA 1RE0A 2J1LA 2GNOA 1QUQB 2ATVA 2H16A 3BDOA 1OPXA 1Z0IA 2N42A 5G53C 4GNKA 1NI3A 2EWWA 5GJWC 4HJAA 3SR0A 1I5FA 5DGXA 4JCVE 2O5VA 4V0MA 2B8TA 3LDAA 3OYYA 5J4YA 4JI0Q 4DV1L 1GJXA 1Z22A 4P72A 2P6UA 3QUSA 4PZ6A 1UFQA 2D2FA 1QDEA 1OXVA 4A3MH 4OX9Q 3FKQA 4MQBA 3MFYA 1S1CA 4BWYA 3HR7A 3A7LA 3S1AB 1JALA 3OAAA 1JQLB 4CEIB 1C4OA 3ZDQA 1T0JB 1EFHA 3MMPA 5LBIA 1L0WA 4HAVA 4LSGA 4BASA 4C4PA 1N3BA 2QAGA 5J4HA 3UDIA 5C0XG 2BHRA 5J4KA 121PA 2ASBA 2LKDA 4HYYA 4L5SA 1SHZA 3VR5A 2FA9A 4A76A 1T8UA 2X2EA 4JI3Q 3AKEA 3A4LA 3MG9A 3NC0C 2R6CA 2UXBL 1EX7A 2OBMA 2ZIAA 1FYCA 1IL2A 1FP7A 2FGJA 4HIOA 4OQLA 4ZCIA 3U7FB 1SLJA 3DVLA 1E2FA 4M53A 1WA5A 1DO0A 1KAGA 3U61B 1P5ZB 1H8HD 3AQ4A 4Q9LA 1ASZA 5ELOA 1E2QA 2QRNA 1SR3A 1KHTA 2GDJA 3DHWC 2PX0A 2A78A 2F7SA 5FPSA 4ZIRA 4ESVA 4KODA 3PIOA 4L4UA 1KRSA 4CEIA 3V4FA 3PEWA 1PH6A 4C3JH 2GESA 1N32L 2FSHA 4OQMA 5CJ2A 5FJ8G 5EE5B 5C4MA 4OONA 2FN4A 2VPPA 4JBKA 2J87A 2GZDA 3PUYA 4C2TA 1R2QA 2PCLA 2GZAA 3K0AB 1Z28A 3W5JA 2XJ4A 1NY4A 3EZ9A 1AQYA 5FL7A 1PH9A 1KDOA 2WJYA 2JJ2A 1R9TH 1YNNC 3DXJC 4A3LG 2F3RA 3LAWA 2FFHA 1DTSA 4Q48A 3F2BA 2F52A 4TTPA 5A4JA 2ZI9A 4BLSA 2JJ1A 5LDDC 2MO0A 3A6PC 1ZINA 1VQNA 4Q1AA 2JA1A 1FTSA 1N6OA 3T51B 1IW7D 4JI5L 2GCOB 4R7ZA 4XWOA 4LYJA 1SXJC 3K0FB 4UQOA 2ES2A 3SQWA 1PH7A 4WBSA 1CXZA 4HJ9A 1XMQL 5KNCA 1OXUA 4RD4A 3OTOQ 2GEVA 2VP4A 1SVSA 3E5HA 2PLRA 2VP6A 2WWXA 2IK8A 2EFHB 4ZKEA 3GDEA 1U0LA 2IX3A 2C5LA 5C2JB 1JECA 1YVCA 1CKNA 1Q1EA 4X62L 4IOCA 2G77B 2ZI4A 4KVAA 4QGGA 4A9AA 2W2VA 4B2LA 1A1VA 1X6OA 4JYAQ 2GF0A 4B3TL 2MSCB 3K0XA 4LZZA 3A8IE 1A0IA 3U3JA 3A8JE 3U3KA 3EIHA 4ILEA 3EWSA 3OZXA 1TWAH 2CHVA 3TS2A 3KLWA 2H92A 4HJ7A 2V54A 1BYIA 3PSIA 3A8TA 3BB3A 4P4SB 4G7HC 4NXNL 3RR5A 1II0A 5ANRB 1L8QA 4ACBA 1CFMA 1E4VA 4DDTA 3DZDA 821PA 2DGYA 1CR1A 2EFGA 2PX3A 1NJFA 3EBEA 5JEAH 4LFAQ 2XAUA 2ZJ5A 4LK1C 1VQ9A 1G7RA 3LY5A 3WHLA 2QBYB 1NVUQ 2L0XA 5DI3B 4LV6A 3TUIC 3IHWA 3REGA 4B33A 3CP0A 4DV2L 2R2AA 1G291 3CQZH 4R9UC 4CIDA 3CMAA 5KNBA 4HLUA 2HHHQ 1E94E 1U90A 4MH0R 3GTGH 3X1WA 4GMXA 1KZGB 4DCTA 4LHZA 1UWVA 3X1YA 4PQRA 5CK5A 221PA 4M1SA 4A15A 2CJWB 3DKPA 4XTCS 1G18A 1AGRA 1NVXQ 1Z2CA 4URXR 3AF4A 4WZ6A 4DV0Q 1IOZA 4BLQA 1E9FA 3PO3H 2WIBA 1XTSA 3SI7A 2JE6I 2O8DB 4Q9IA 1X1RA 1U81A 2OESA 5E3HA 2H18A 2IUUA 4GN3B 1WQ1R 4BRUA 3H94A 5FI0B 4A75A 2A1AA 1HCZA 3UE1A 4K81B 4IEEA 4L5TA 4QBGB 4GDFA 1VQPA 1NBMD 2V7QD 1ZD8A 1EX6A 3EWAA 2DNCA 2CVHA 4JYBA 1L7VC 4QOSA 4B48A 3B1YA 3GJXC 4V0KA 3VHXA 1KD1C 4YMUA 1CKNB 2NZOA 4LW1A 2HLDD 2W2TA 3AGQA 3GJ5A 2IEYA 3TIFA 5EAYA 4QL3A 4P4TA 2QI9C 4HLDA 1E7ZA 2HF8A 4PAMA 3U4ZA 3H0KA 2JEBI 2BH8A 4Q00A 2Q2IA 3PF5A 3CRRA 3U3RA 2H8KA 1FTNA 4PZ8A 2UZIR 4POGA 3R8CA 4DSTA 2SHKA 3K0FA 3CCQA 2MNAA 2GCOA 3QKTA 5C4XG 4GKJQ 5GJBA 1DCZA 2ODBA 2KCMA 2BMJA 1EESA 5M3MH 2ORWA 3I1FA 3J81i 1F2TA 1L4YA 1SKYB 4PSKA 4Q7JB 3KYHC 4YWKA 1RPZA 2ZSBA 2VUMH 1Q1QA 1EQQA 1VQCA 5DHFA 3D4RA 3K9GA 1QVFA 5LPNA 2OQ0A 5DYIA 1KNXA 3MWLA 2AUJD 3F2DA 2N1BA 5LB2A 4DHEA 4MTNA 1AQUA 1QG4A 3HOWH 1G8GA 1Z6GA 2CXXA 2JEOA 2PZGA 4XVUA 4GN5A 1HNWL 2Q0HA 4DWJA 1G19A 2EFCB 2VHQA 3P4YA 5EJEA 2PI2A 1AS0A 4PXAA 4TMZA 4QM7A 4LFBQ 2JJ2D 4A1FA 4QBFA 1F48A 1B9MA 2GK6A 4BBRG 2QTVB 2J0VA 1JNYA 1Y1VH 2UXDQ 2QSYA 3CZPA 4Q03A 3RYTC 4KHPQ 5JHHB 2GEUA 5EXXA 3AM1A 1KYIA 1ONBA 4DR4Q 3ZJYA 1Z63A 1QHGA 4LI0A 4JIMA 3HOVH 1G9XA 1SKYE 2RGXA 1IXZA 3SBDA 3IIJA 2BWJA 1XRJA 4Q1BA 5EUMA 2AUKA 5GAHC 1XJCA 4GZLA 4ASUD 4BBSG 1FL0A 4PHHA 1COWD 1GFIA 2EVWX 1L1OA 1ZNYA 1BYUA 2NO9A 3VQTA 5JBQA 1R0YA 2XITA 1VQAA 1O78A 2IHFA 1X8JA 2ZE5A 4LF4L 3A1VA 3J7A5 3LW7A 5HKKD 3AV0B 3VAAA 1E1OA 3FFBA 3T1YQ 3FGNA 2YTVA 1Q21A 4V0OA 2WB1E 1MRSA 4QNRA 2OCEA 4JI4L 4A4IA 2RH5A 1T5LA 3U5ZB 4OQNA 3RLOA 1XTIA 2QAGB 5GQOA 3HOUG 4JJKA 4Q4HA 4JKYA 1TX4B 2VEDA 3HOZH 4W5WA 4HR7B 4DV7L 3SE0A 1TU2B 5IYDH 5G3YA 4B3XA 1V1QA 1RIFA 2XGJA 2BIFA 3NHBA 2PMKA 1X3FA 2A6EC 2W00A 2ZRMA 1YJ9A 4JI6L 4FW9A 3CCUA 2Z4SA 5IP7H 3GFTA 5JCZA 2QGNA 3B1WA 4IFDG 1FNMA 4LOAA 4M9ZA 2HIVA 1XZPA 1F5NA 3TE6A 5C18A 3AFPA 1HA3A 3W34A 1E3PA 4LBZA 3SJBA 1NVWQ 1R0ZA 2GJAA 1IN6A 3DM5A 3QKSA 1CKOA 4CW7A 3CCLA 3X2SA 4IQZA 4UNPA 4A3CG 2WAQE 1AZTA 2JIZD 1E2JA 1X55A 3HWSA 3T56B 5EP3A 1FVIA 4FDBA 3CPFA 2G1JA 5JSZB 2YOFA 3KDFB 2BVNA 2HYIC 3QXXA 3AFQA 2XOKD 1OFIA 3SS8A 4E09A 3CC2A 3KLRA 1W0JD 1N5JA 1Y8NB 2BE5C 3LXXA 3VNVA 4DR7L 2EYQA 3A1UA 3KF6B 2BMEA 1CR2A 2IF0A 1YQTA 2DNEA 3NG1A 1M7HA 1YI2A 4WIAA 4B71A 2D5DA 3P32A 4RFVA 2QMUA 1LACA 1VQFA 4LJZC 1E2LA 1E9SA 3A7AB 1TXYA 3KF8B 1CTQA 2KHJA 5A5GA 2PCFB 4EUNA 4A2WA 3G4SA 4M1YA 4HJ5A 1VF5C 2N8NA 1NVVQ 3TJZA 4KSBA 1B0UA 2OZEA 4Q02A 1F3OA 1NKSA 3BORA 4DUZL 3LFUA 4CEJB 4WOPA 1Y1VG 3CRQA 4TLAA 3I8SA 5J5CA 1HNWQ 5JS8A 3BZKA 3H1TA 2ORIA 2JA8G 5FI1B 5SZIA 2QGQA 4DB4A 4DPGA 2V9PA 2QY9A 4QXAA 2CQOA 1MJCA 1SFOH 3QPVA 3HYRA 1G3UA 4LJ8A 1RL2A 4MRSA 1H8EA 1XNQL 2IHBA 2P0EA 1Q7YC 3M3YH 5H68A 2GETA 1K8GA 2AKAB 2QL6A 3NBZC 2IUTA 4UPAA 4GKJL 2J0UA 2F43B 4PPNA 3O8BA 4YQFA 4NHOA 2JLYA 2YWEA 3DMNA 3NVAA 4RFSB 5GVSA 3THWB 3ZGXA 1SN8A 4OKSA 3DM3A 2CLSA 2G6BA 1HQCA 4QGUA 5BN3A 1E98A 1OKKA 5M5YH 2B92A 4Q18A 5JRJA 4KLZA 2JLXA 5IYCH 4DR3Q 1SGWA 5JFGA 4B6EA 1B9NA 1TMKA 5FH9A 2FSFA 3O8CA 1OIVA 2ZROA 1AKEA 1Z08A 1Y3AA 3ADBA 4Z51A 1E2VA 1YZKA 1I6HH 1SVLA 3EASA 4N0EA 4POAA 2MQHA 1E1TA 1KQSA 3S1MH 4OHVA 2RMKA 2W6IA 5JEDA 1U5KA 1KMQA 3QBVA 5FPHA 1VYVA 4OBEA 1FJGL 1A2BA 1BIFA 2C96A 3FHCB 3Q3JB 4IKEA 4IDPA 1LY1A 2V8OA 4LY6A 2LKCA 1RYFA 1XNJA 2IHYA 5HCIA 3UMSA 5FPTA 2YZ2A 3PO3G 2VYFA 5IT5A 2Q3HA 1P61B 4A3JH 4JLKA 1TAGA 1GSIA 4ZI3A 2C2HA 5HR5A 4ZO4A 3G71A 4NKRA 1HZBA 1N5IA 2WV9A 1KY2A 4LHWA 3T1HL 4A2PA 2ZE7A 4JJZA 2GXUA 4OO1I 2W58A 2JATA 4L15A 3WNDA 5JI3E 2ZRDA 1CULC 5AJYA 3REFA 3EZ7A 2VIIA 3DPUA 4JV5Q 1CJMA 1KRTA 4D0NA 2ZAMA 3PUZA 5IYDG 3CR7A 4BA1I 2OTJA 3M4OH 1A82A 5HGQA 1TEVA 3I61A 2EXDA 2HV8A 2ZRLA 4NP6A 5C3EG 2FEOA 1VKJA 3LXRA 1SQ5A 1WCMH 4JL5A 4QJ5A 1YZGA 2X19A 4URVR 1SXJE 4PTLA 5M5WH 4L8GA 1S2MA 1ODFA 2E9SA 4A3GH 3NXSA 3TR5A 4GS3A 2W2XA 3KKQA 3TAHA 5JHGB 1KO5A 2OFXA 1OTCA 1CSPA 2R7ZH 3CZQA 1TF5A 5IK2D 4GOPA 1U9IC 2OXCA 2XSZD 5JMTA 1Z6TA 1TQ6A 4G5GA 4TLBA 5AJXA 1E0AA 3OEHA 2ATXA 1Z0DA 4B2PA 4B6FA 1G7CA 3QPUA 2YVUA 1PMRA 1H9KA 2IEZA 3LX5A 2WWFA 1GRRA 1HZCA 3BZCA 1JAIA 2D2EA 3AH8A 5IYBG 2YTYA 1A62A 1OJLA 3TVTA 3NENA 1NVVR 3K0CC 1IM2A 2OAQ1 3EZ6A 2Z4RA 2MMCA 1W4BA 3KDSE 4RZXA 3QF4B 4PV1C 3B82A 1LVGA 5FBQB 1SROA 1B7YB 4DCVA 3FMFA 2QRZA 4GNXA 1XCPA 1OXTA 4IJMA 5DH9A 3I4OA 2ZM6L 5TMPA 2HJGA 1D8LA 1QF9A 4JVLA 3WMEA 4B3TQ 1EG7A 1LS6A 5TARA 3TGPA 2GA8A 2BM1A 3QG5A 2JLVA 1GUOA 2UVQA 3KQKA 3W8NA 4KAXA 3RZOH 1KI3A 1XB2A 1HZAA 1KI8A 1F60A 1UBFA 2NN6H 4TMTA 3UMFA 3U50C 4BFXA 2O52A 3I92A 3K53A 1G20E 4QHSA 1MT0A 4KN7C 2OILA 4DUYQ 4GKKQ 5AR1A 4LUVA 5FLMH 4DR6L 2AKYA 4P71A 4F93B 1W2HA 3PUXA 3R9XA 2E2JH 1ANKA 4AKIA 5JEAJ 1FQKA 1W4CA 1QHNA 1N0VC 2G1KA 3KOJA 5SZKB 2RGCA 1U2RA 3V00A 1N25A 2J59A 3EIEA 3OW2A 1ZU4A 4G7ZC 3Q85A 5JLJA 2XNDA 3S24A 2XTNA 4Q01A 1N6LA 1KSFX 1GL9B 1XX6A 2KBEA 5F2EA 5L3SB 2J7KA 1J8MF 2H7VA 1CRPA 1OF1A 4AG6A 4EPRA 1GVNB 2QG6A 1TADA 2E87A 3B1VA 1IXRC 4L9SA 3GLIE 3GTQH 1OFUX 2IYSA 4B3RL 3CRMA 3ADCA 1M1KC 4B3FX 4KBFA 1Q46A 1H9JA 1XEWY 4RD6A 4BZQA 1EWHA 1HTWA 2WWWA 2VP9A 4B3DA 3FKSD 4LF5L 2IX1A 1S9DA 3MD0A 1D6JA 1W5TA 1P2UA 4IDOA 4BE7B 3HPRA 1KDRA 2GJ9A 1V8QA 2ODWA 4S2EA 1FW6A 1VQMA 2IYTA 3FB4A 1JMCA 1ZAKA 2OUKA 5G41A 1Z6HA 3M4QA 2UU9L 4KCGA 4PFSA 1AGPA 3PEUA 3EARA 4G01B 2PNHA 2VQFL 2A5FA 4IVPA 4NU0A 3RS0A 1EXMA 1S96A 1IY1A 4RD0A 1OHHA 2LCFA 2P3SA 1ZD1A 5KHOC 3GP8A 1DAHA 2OE2A 2F9LA 1P16A 5FOSA 2GKSA 2RGBA 1BBWA 2CLDX 3H3VH 2IW3A 2O0KA 4OI1A 5JEAG 3RRMA 4A3EH 2O0HA 4KHPL 4F4IA 5SZJA 3VHLB 1GAJA 1S3GA 2O8EB 2KCTA 3HU1A 1OH6A 3RC8A 2L15A 4YCVA 2ZJBA 3U4QB 3CPWA 1GL6A 1J7KA 2TMKA 1CUKA 4D2IA 3TEHB 1HH2P 4DV5L 1ZCAA 1GHKA 3N6RA 1CP2A 2JA6H 4O0MA 1BH2A 3AVVA 1SVOA 4BY1G 1VPLA 3M1IA 4OYHA 4B3RQ 1HUQA 1LS1A 1KAWA 2D62A 2ZU6A 1V9PA 2B63G 4JBYA 2VSXA 4HDQB 1Y14B 5M3FG 5ELNA 3PR1A 1C0AA 4Q4LA 5IDVA 4HJ8A 4M1KA 3VA7A 4RD2A 3GEEA 3GLFA 3QXCA 1QHIA 3CWZA 4TTRA 4DV5Q 3TUJC 3IHLA 3L0IB 1UEJA 4Q9KA 1QRAA 2R9VA 3U4QA 3H2YA 2H17A 3THWA 1JXMA 1G6PA 4JI1L 1HH4A 1ZMXA 3BH7A 2O8EA 3EAQA 3OFNA 2BKUA 4HUQA 2D4HA 2RGNC 3NDBB 3S17H 3GFPA 2JXMB 1UE7A 2FFBA 3PG5A 4GI7A 4YMWA 4PZ7A 3BK7A 4NCIA 1I4TD 5AUQA 1ELOA 4DV6Q 4R4CA 1RRCA 4JT2A 1G3QA 4XVQA 1TWFH 2RHQB 3NH6A 3I73A 1AH9A 3AVYA 3IIMA 1A8VA 1K0RA 2WPDD 5KDOA 5IP7G 5FL7D 1XMJA 1K83H 2DN8A 1WYDA 1K5DA 1LUZA 4K8OA 3RNUA 1XNQQ 1DVRA 2IXFA 4LGMA 3CC7A 2GZHA 4DIDA 2F4VQ 5J47A 3W8RA 1Z6AA 3MWYW 1IY2A 3AVTA 2K5UA 2XEXA 5BR8Q 2J3EA 3PITA 1G4AE 4JC0A 4A3IH 2Q2UA 5EP4A 4F38A 1NIPA 4BLRA 2ZRJA 2IF2A 3GQBA 1KI7A 2A9KA 2EDGA 3HFZB 3LQRA 3KQUA 4CZ2A 3UPUA 2WMOB 1U98A 1CIPA 1QVCA 4DLUA 4DLTA 2ZRPA 4WW0A 2KA7A 1HEIA 1LW7A 1XJ0A 2XNSA 2VNUD 1K8RA 1NLZA 1R8QA 4KFSA 4Z8YA 2IWHA 3KF6A 2GJ8A 4Z54A 2LSSA 3QKUA 2CEAA 4PC1A 3CF2A 4JVNA 3IPXA 1K8MA 3FE2A 4MUAA 2Q21A 1FP6A 1WCMG 3PEVA 3DM9B 2GAAA 2HF9A 2QORA 3UXMA 2I5MX 5HE8A 3RLFA 5J40A 3MEFA 4A8JC 2XTIA 1R5BA 2JLUA 3MXUA 3CCJA 1GUGA 3CW2C 5C0XI 4PQYA 3UATA 3SC3A 2KB0A 4KFTA 1PZNA 1YNXA 1OW3B 4LJ5A 5DISB 1JPNA 5KNDA 3BFXA 4GOJA 2J7PA 3KZ1E 1ZM4A 3I62A 1P8LA 4IOAA 2ZJ2A 4A82A 4DKXA 3UE0A 2OXRA 2QE7D 1S8FA 4BFYA 4C0HA 2ZRBA 5JWRA 2ZXUA 2P6RA 2IBMA 4JI8L 3FMOB 3GTLH 1UDWA 4LHYA 1DAMA 2YC2C 2Z0SA 4DLSA 1KZ7B 4EIWA 3QENA 1NMFA 4X6AH 3SJZA 1Q22A 4EPWA 4G7OC 5L3RA 1E2EA 2Q3MA 1E6CA
chains in the Genus database with same CATH superfamily
2JIMA 3TP5A 1NASA 1WY7A 3G8AA 3I8XA 1HDCA 3C1EA 3GLFE 1VQ1A 2X5XA 3SWWA 5G0SA 2NW6A 1JN0A 3Q3EA 1GSHA 3GEPA 3WJ2A 1QNKA 2FP3A 1VMAA 3ONWA 4KRFA 4CDDC 3AUTA 2F4VB 1J8YF 1IULA 2OO5A 4JJIA 3RHFA 1Z2DA 1ZUWA 2ASEA 2DWOA 3QLVA 3HKCA 4X8OA 3EOAI 4KN9S 2Q1XA 1D9ZA 5AO9A 3ZWBA 5D85A 4NFYA 4S24A 4UAIA 3OJOA 2IYPA 1KR2A 2A8VA 3F97A 3OT5A 3SSMA 4MWZA 4TKOB 1L8AA 1U02A 2CD9A 1JA9A 2HZ7A 2ZUTA 2QENA 4LNQA 3DMTC 4JFRA 1JR6A 4DG8A 1LWNA 4NS1A 3GJSA 1IBLL 1ZWLA 3NFRA 3A4NA 4LJYA 1O97D 2D1FA 1MAUA 4TUYF 3DSRA 1N9KA 1XMQQ 2QKIC 1GU0A 2B99A 2HO5A 4GVPA 5JUWA 1YCDA 1FA9A 1KC1A 2NN3C 2VQ3A 3NGMA 4JUDX 4N0PA 1M2JA 2W9XA 4RPGA 5IAKA 4XIYA 5EBCA 4ZYXA 2D1YA 1JSZA 4Q4JB 5GM2A 4Y2QA 4CMIA 4FB5A 5IWAL 9GPBA 1EGAA 3O0TA 4ECAA 5KQGA 2YY7A 3W9SA 3IRVA 1RQPA 3LT1A 1K5HA 1P2DA 4D1YA 5KS2A 1VCOA 1IEQA 1ZS9A 3K8YA 3Q87B 3W05A 1VHTA 4AROA 3MEHA 1KMCA 3NEMA 2NU9B 4AC9A 4ZEOA 3QEMA 5KU1A 3SM3A 1XQ6A 3JQGA 3WISA 2XCRB 4E32A 1OU4A 1YJCA 1GQSA 1ESEA 1GDDA 2BHLA 3OJCA 1RAEA 5KYWB 4HS4A 5KDDA 1O0BA 3PQCA 1SUAA 4L95C 3UUEA 4Q7MB 1JILA 1W19A 2QTWB 2Q5JA 3CLUD 2VBFA 3IV6A 4RIGA 3HA7A 3S2UA 1JR4A 3LWBA 3MJEA 1N0UA 4YPFA 2K01A 3G2NA 1MHTA 4DU9A 4OXXA 4Q3DA 2AWOA 2DGDA 2GEFA 3IQWA 4K9RA 5DX8A 3MMZA 5B4UA 3A6LA 1I7SB 1CY4A 1E2BA 2HOQA 2ZBEA 3E2IA 5AQ1A 3KKNA 3BWEA 3GFVA 1KPGA 3L5OA 1JI0A 1R4QB 1QK3A 1B3BA 3GLUA 3QVLA 1E1DA 4UMDA 1SD5A 1E4EA 3U58A 4QPCA 4R8KA 3RWMB 1IN4A 4PBSA 4FXDA 2PEZA 3F8WA 3PQ3A 4R2XA 4ARZA 4KFUA 5LWQA 2NU7A 2V1XA 1ZEJA 4OP3A 4R2IA 2JLAA 3OZFA 4DNOA 1HOTA 5C4IA 5KYXB 4ZVVA 1KABA 2RH9B 3IOMA 4LV8B 1F77A 4C4TA 1JFSA 1J5EQ 1XZLA 1KRWA 1Z13A 1HLFA 4UXHA 4HZUA 4YALA 4IZ6A 4TSFA 2O5IC 3F1KA 3ZVLA 3W8FA 1C3VA 4TVKA 2JA7G 1PS8A 2IP1A 2JA7H 2FKAA 2MSWA 3DS8A 1U7HA 1EGVB 2BC9A 2FW6A 3A05A 1TCVA 2EYUA 4H0NA 2QQGA 5LMNQ 4L9AA 1ISMA 3UMJA 3O8NA 2QCPX 2YNMA 5C1BA 4LWZA 3OJWA 4J0KA 2EQBA 1ZJ4A 3LHFA 3OIDA 2OEPA 3Q11A 5G1OA 3H8VA 4DMMA 1ZGGA 5AWFC 4N8EA 4Y7CA 5FOXA 3TLEA 4PMBA 4X24A 5CD1A 4AY6A 1GKKA 4IUVA 1WP4A 3O31A 5JJIA 4V0LA 5FD8A 4AD8A 2BZGA 4OVKA 2YTXA 4O0AA 3W5OA 1PQWA 5EKDA 4ZAYA 3U4CA 2QX8A 4BIIA 2C1XA 2JEAI 1IZZA 3OQIA 3QSGA 4GPBA 2XWBF 4U8HA 2O2GA 3WHIA 3GO5A 1KO7A 3ZIUA 3CCBA 4C3HH 4Y2XA 1MPXA 4JEUA 4NBWA 1RIPA 1BX0A 1LDGA 3FPEA 4EF5A 2WSMA 2YN0A 4KXLA 3ZTYA 1YCGA 2GPYA 4BPBA 5LMUQ 1N6NA 2GZ2A 2VF5X 5GOTA 4ZK6A 4BA2I 1X39A 4TS9A 5K0LA 2VP3A 2Z95A 3ZQJA 4Y1FA 4MVJI 5TEVA 4DMUB 1F8GA 4B8YA 3OWFA 4Y8VA 1YZFA 1TY2A 3CPJB 1CY7A 1E1QD 1X1AA 1XIVA 3DMDA 1N7IA 5HEKA 1E9RA 1RXIA 3AF2A 1S7GA 3N70A 1D0SA 1Y3IA 2RGAA 3DFKA 1OD6A 1HZZA 3V55A 2B63B 2DR2A 4F85A 2LFNA 1VFPA 2QVLA 1TW3A 5I7RA 2XZLA 3HDJA 3CONA 4E15A 3VOBA 4ZC8A 2VXBA 1ZRHA 3FKIH 3UA3A 2YJTD 3P4XA 2MHCA 1MEEA 2KBFA 1U31A 3CNNA 4WV3A 5BUSA 4QIHA 2O14A 1EQTA 2F4IA 3OOHA 1GOZA 4YAIA 2B30A 4BXOA 1T8SA 3EVZA 2IDJA 3GJ4A 4XQNA 3OWEB 1GTMA 3CJQA 8GPBA 1VL1A 2BJVA 4AMYA 1FD7D 3I01M 1KFJB 3O83A 4JI1B 4P82A 1U2DC 1OXSC 5SYNA 5DNAA 3HN7A 2O2JA 1BKDR 1GRQA 1F8FA 1JHMA 1YQGA 3FNBA 3IVAA 4GI2A 3O4HA 1UPCA 4HSGA 4X65B 4AU1A 4I5GA 3C3AA 1ZJZA 4KBGA 1WSWA 1WVMA 2B21A 1CG6A 1OE0A 1IHOA 4A3MB 3I9FA 4MR9B 5EIBC 1ECJA 2WVHA 1XZJA 2CLOB 3IAM1 4DIFA 3INGA 3U7IA 1GR0A 3GLQA 1NBMA 4ZCQA 2Z6KC 1RZ3A 2GMWA 3DEAA 2KJXA 2FXVA 4RFLA 1QHHB 1RS0A 1DXQA 3PD7A 2X4IA 1GOTA 4RHCA 3URYA 4JV5L 2YS7A 3I3SR 1HV8A 3KFLA 4X45A 2VDQB 4FXPA 4KQJA 1XKLA 4CKYA 1JV2B 2RHWA 1KYYA 2CJPA 1Z2NX 4AUKA 5IXJA 1EOTA 2AXNA 4DCUA 5F3WB 3ESRA 1DPGA 3Q12A 4FT4A 2IYRA 4ZEMA 3RS7A 1KY5A 5CFLA 3F47A 4X6XA 1HTLD 1C50A 3EC2A 1U2EA 2QIPA 4Q4AB 2VBCA 1DEAA 3M85A 2WJGA 4E30A 1YR2A 2Z6QA 2H4HA 1CJTC 1Y8RA 4Z2YA 3DE6X 2CNNA 5CVEA 3O21A 1MD9A 3PKZA 5LYJF 4RVHA 1NDHA 2X9VA 4LJKA 2QZZA 4BGIA 1CY1A 1GD7A 2DWQA 1G21E 2PYDA 3ABZA 4RE6A 1R4AA 2GUGA 3PLNA 4R7TA 1QHYA 4ZCLA 3V2GA 2OLKA 3FUWA 5M3MB 3V2UA 3C8UA 1XJWA 2RGRA 4X65L 1ADGA 3OU7A 4MARA 4EFNA 4CLXA 5IU6A 2QN1A 2F3VA 2R6HA 4FYDA 2J9RA 4KJZA 2CXQA 3NVDA 5HY6A 1S3IA 4BBSB 3B6MA 4AG5A 1TYBE 3A4MA 1JB9A 2D5AA 2ZSHA 4C4OA 3G3EA 1O94C 2O8NA 3KPYA 4XGIA 2PQ2A 2MMGA 2RFLA 3M6UA 3IOBA 4GPZA 3FOAA 1RC8A 2LBPA 5DXJA 3GUVA 2UYHA 4PR0A 4GSLA 2CL6X 4NX2A 5TIIA 2ZUVA 2ZBDA 3HEMA 5UKDA 2NUAA 2AQ3B 5ICGA 2RK4A 4LKRA 4MUEA 3CZ4A 4H31A 3WK6A 2G5TA 3DZKA 1W36B 3DLTA 2PXCA 3VYWA 5A4MS 5C37A 5HX7A 3GXBA 3H8SA 4MXDA 2EFYA 4Y1RB 1KQPA 3LSYA 2C9CA 1L3IA 3HRHA 1ZL0A 2B0CA 2IGBA 4BFZA 5CK4A 5B7PA 1BEUB 4IY1A 3HXKA 2ONZA 2X58A 3R40A 4TROA 4TRMA 2C7OA 5DNDA 1KU0A 3D43A 1TCBA 3P0FA 1XA3A 2R4TA 3W6PA 1T5TA 4DLNA 4WGGA 4L5BA 4CM9D 1I6VC 2R6JA 5LQRA 2W4QA 4FR5A 1I32A 2RARA 5AJTA 5E1DA 4BVKA 3KX2A 3PWTA 2ZTDA 5IGBA 5KQRA 2Q8IB 4NOLA 5P8WA 5FUYA 4P9NA 4CQNA 2OAP1 1P45A 2PX5A 3U6BA 4DV1B 3G7SA 4R9RA 2EJGC 3D4OA 4EYQA 2VPTA 5KTRA 2I62A 1VP9A 4TX1A 3C6BA 2XGOA 5DI9A 1C7ZA 1WP9A 2UVPB 4LJRA 2VZ0A 3WQRA 3VVMA 3FH0A 5BNZA 1WZCA 2P1DA 4HMJA 1W0JA 4AIIA 2O8DA 4PNPA 1X92A 4TSSA 4HXFB 3HBMA 2J3LA 2ZXRA 1MTZA 3BHNA 2PO7A 1Q6ZA 2IDMA 3BK7A 3O9ZA 4PHGA 4ZCIA 4QDTA 4A3BH 5DVZA 4EYOA 4YLGA 2I3BA 4JQYA 1G51A 3FCAA 4MPRA 4OHWA 4PR3A 4Y7NB 1MJGM 1SHKA 3JWHA 5KI6A 4ZZ0A 1DMSA 5LBTA 2JAOA 1P7PA 1PX0A 3AHDA 1XTTA 3MJDA 5IHPA 4TQUS 4MHSA 5TRTA 3IAFA 4ONEA 4ISBA 3WK9A 6ADHA 4C7OA 2BM9A 4KLNA 1TQOA 3IVXA 4QYXA 3LKBA 4KXQA 4NULA 3W78A 3V9AA 3HKZG 3CLSC 1A7JA 1O9HA 4JA2A 1NBWA 4LF6L 1OFGA 1X2EA 2GZ1A 3AI2A 3H2KA 4RY8A 5J43A 2CHQA 1V9SA 4CMAA 3VU8A 4MV8A 3FCOA 3TRJA 3K7UC 4MIUA 2AD1A 2CNLA 5LJLA 3CUEF 1TZMA 1FFAA 4G9BA 3ROFA 3TVYA 3UK6A 3R0ZA 4AQ7A 3EOBI 3R9WA 4OHFA 4DVGA 2JH8A 2NUPB 2AHOA 4AWAA 5FFFA 1G7TA 2HCBA 4DA9A 5BUQA 1HO3A 1RVDA 2VJDA 3DXXA 1PR1A 5AJZA 3HL4A 3QJGA 4R05A 1PR3A 3P9CA 2ZTVA 3VU1A 1UMCB 2ZSIA 3H9QA 4IINA 2BFDB 2FWBA 2WABA 3IUMA 3O7MA 4ABTA 1CNFA 1JH9A 1DWUA 3EIWA 4TLMB 3P2JA 3V8EA 4EITA 3KWJA 3G7LA 3AR4A 3DZIA 1JR0D 2X0DA 4IJ5A 4NYMQ 2JHPA 4YY3B 4P3PA 3CR3C 4P2GA 1XAIA 2IYAA 4L78A 4LISA 4BO0A 3AB9A 2CHEA 3BG3A 1DEXA 5ALTA 5A4IS 5IF9A 2CB9A 3AOEA 2F0PA 1HYQA 2JFYA 4ZDKA 3G5UA 1L5SA 2QSUA 4HJRA 1YMUA 2IOFK 3DZCA 3LQ1A 4Q34A 5FLXE 1XEXA 1R0CA 2EWVA 4M0EA 2CNDA 4AKEA 4KL8S 3STYA 1UINA 1VBMA 4NW2A 2QMZA 3P7JA 3PXDA 4G1UC 1IXYA 5A6VA 1U3UA 3JC66 2XQGA 3V1KA 3GJ3A 1BHSA 1SIOA 5HTKA 1XZNA 3SOPA 1JMVA 2RGNA 3MJCA 3O47A 5HURA 4RLSA 4QZVA 4LFAB 1JWAB 1TUEA 3RMHA 3DQQA 5DB4A 5M9OA 1D2GA 3RODA 2OC4A 1NXOA 3K0AA 3E7WA 3PZRA 4PYIA 4QG7A 3L1HA 4RH0A 1ADYA 1BJRE 1Q17A 1DFHA 1V71A 3A54A 1VKHA 1ZXLA 1TGYA 1U0TA 2JZCA 2QTGA 2VT3A 3CO5A 1NVTA 1YNND 2W6NA 2WHEA 3EIQA 4MQEA 3KLSA 2WSYB 2J4XA 1OROA 2FP4B 5E3FA 3FMPB 1NP7A 3E1KA 4M9QA 3AU9A 5IYCG 1HWYA 1EJ6A 4L85A 1SA0A 2MO1A 4DGZA 3NPMA 3TFQA 3KVOA 1Z82A 4AJIA 1ORVA 3IQEA 1NY5A 2F3PA 3A4TA 3VOSA 2YNMD 2WT4A 5AVSA 4RGVA 1IUKA 3MTAA 4MGEA 3GMSA 4BEVA 1VI6A 1HTPA 2E7ZA 4XWKA 1LFDB 3SFZA 1NDUA 1N9GB 1RZVA 5JMPA 1TWFB 5BVHA 4AO7A 2XE4A 2XMQA 4LXGA 3UYLA 2R44A 4DLZA 2QMYA 4UM9D 2ZWOA 4RJKA 3ZG6A 2PSHA 3LE8A 4B73A 1WXEA 1W47A 1GV0A 5FP0A 1VSBA 4IV0A 5TQ2B 3CTPA 3L0BA 1I2DA 5H5JA 4L5AA 4N5NA 1DAGA 1HOXA 4E5DA 1QOPB 3GWZA 4FOSA 3PGKA 5HZKA 1W96A 1K4YA 3BXGA 4IHJF 3SJ7A 3FRJA 3MC1A 4C07A 3CZMA 4IJLA 3T1YB 4B9WA 1Y7PA 4N41A 3G0HA 2CEKA 3CW2A 2YRXA 1JR2A 3MRTA 3LI2A 3D8TA 1ZSVA 4CHTB 1BXRB 2YQ5A 1MC4A 3FBGA 4HWGA 2F3TA 3F0TA 5D5HA 3ZUGA 2WB2A 4FFWA 5ARCA 1PWHA 1YJ5A 3KFVA 3IRUA 1BWQA 1LLFA 1U7PA 2EG5A 3PBKA 2R8YA 2ILTA 4IVRA 4KW7A 3N05A 4MUKA 5BYJA 5T4BA 4JVMA 4BMCA 1VDMA 3OPMA 2PR2A 3DO6A 4UBMA 4E5YA 4EJSC 1M4VA 1G5FA 1JI3A 2OTLA 1RAAA 2PKQP 1L7NA 4BCDA 2R2GA 5K99A 1NMGA 1NLMA 3Q72A 4EHNA 3TS1A 1E2HA 4HQRA 1CC1S 1UBJS 3MCAA 4KHZA 1PTJA 1XCMA 3FCYA 3JQAA 1L5VA 4UJ3A 4YI5A 1Z5UA 2IYQA 1WJJA 4YT2A 4RZ2A 3LD9A 3EWNA 3VJRA 4DV0L 4EPYA 1U0HC 1JXAA 2DFDA 4WFQA 1HNZL 1GPKA 2OFPA 3IXLA 2CXNA 5IJ9B 1M2EA 1EFPA 1NWHA 4AM8A 1C1DB 4DEYA 4IUTA 2A1IA 3NKVA 4UPDA 3EA4A 5E9JA 1QHXA 1K5GA 1T0IA 1RRGA 1Z56C 4LOIA 2QVCA 1XRLA 4ZYLA 1M8JA 2I2DA 2ACEA 3QTLA 3SKVA 1CEYA 3ZY5A 4DQVA 2CMDA 2EKDA 2JK8A 4C3IB 1NQXA 1YDMA 4FHZA 4CMKA 5HVNA 4RD1A 2W90A 2BD0A 3HMQA 4ND3A 4RNDB 3LWEA 3IQIX 1N8NA 1RLOA 3HS3A 4DAYA 2WU3A 1XNHA 2XIJA 3SXJA 2WAXA 2HA4A 3NONA 4GLVB 2P9QA 3HJCA 1Q8KA 4WESB 3RS2A 2QYHA 3ZS9A 1R74A 5JQWA 1MJEA 3H1PA 4HI0E 3W4JA 5EL0A 4YCNA 3GHYA 5K3AA 5CMDA 1DUSA 3EGXB 3E53A 3EE6A 5ECDA 3V2HA 4Z7QB 4CM8A 4MV5A 1O6GA 1Z3CA 4JI1Q 4JJ6A 5DP1A 4MW0A 2A9FA 3H91A 2FZ5A 2BM0A 3KYCA 1HUMA 1GKIA 4TOIA 3PT9A 1ADJA 5EHXA 3HOVG 4B2IA 4D25A 2WAYA 1I6WA 3RZDH 5IT9L 5M3FH 2QEXA 1WMDA 2WF6A 2F1JA 3B1FA 5AIAA 4D4MA 2OV2A 3HJBA 3IC5A 1M73E 1STAA 1BBUA 1G8SA 3KKEA 3D31A 1WTXA 5B7GA 4KEAA 2L18A 2E2IH 3L4SO 1NUQA 1H42A 2IJGX 2X8JA 3H3XA 3OFVA 5AXAA 1CEEA 2QYSA 2W7TA 3HEBA 3WSVA 4BVBA 2D3WA 4L73A 3CZ5A 5TQVA 5GJVC 1DWQA 3SHWA 2B8EA 3WLHA 4BEJA 4C5CA 4E2WA 1MEJA 1XMIA 4RMJA 1IPFA 4UDYX 4MYRA 5I9MA 2KPOA 5KJFA 1W581 1UBLS 4LA4A 2C99A 3NVKI 3EDYA 3PUVA 3ZJ4A 5IWCA 2VO1A 4XQ0A 3F5MA 3W79A 3V3KA 1A8UA 1K6IA 1YL5A 1ZXXA 2DH6A 3Q7EA 4IHKA 5C4JB 3N53A 1EXDA 5AM0A 2ZRFA 3L82B 4J4HA 1ZH8A 1UEIA 2R1VB 4A3FG 1I4GA 1P7WA 1RJTA 2WMYA 2ZJZA 2Y1KA 3GJQA 2DLDA 3R5SA 4KO1S 2BOVA 3SQMA 2Q41A 3QFSA 2ZS7A 4QLAA 2DLNA 3GP7A 3K8AA 3L18A 1AIPA 4DLLA 1D1KA 4OHKA 4ZANA 4RTJA 2DY8A 2WG0A 4JLOA 3GDFA 3OCZA 3AQQA 1B2RA 4KXYA 3RANA 5BUZA 2CXRA 3ZK7A 4WXHA 4C29A 4D99A 2HW8A 3NAGA 2O5CA 4NK5A 4MYDA 2ZSKA 5M3MG 4EFKA 3A26A 1CQFA 4R16A 2H4FA 1VGRA 1T1JA 2QV7A 3HY4A 3OFKA 3U4AA 1PTOB 1K9MC 4JMPA 2ZGVA 1GG2A 4W8HA 3TINA 5B64A 1QH8A 2HQ1A 4E08A 5KYYA 2ONJA 3RT7A 3BE6A 4EGAA 1DP4A 1DZ3A 4H4DA 1JE5A 4U7WA 2EP7A 4YHBA 3W3ZB 2NT3A 3JYPA 3KLOA 3ASVA 3N07A 1C4XA 4IQ8A 5JSFA 1DLIA 3HKDA 3Q6MA 4TMXA 1N36L 4OFBA 2HSZA 4GLJA 4HUJA 1A27A 2DBVO 4HMIA 5E8JA 1YTUA 2BBOA 2ZJPA 4YRQA 3E22A 3RT1A 4JLJA 4DR1B 1QG6A 1AQJA 4LE2A 4FXOA 3JPYA 1E5XA 4N48A 1XMOL 1S2GA 3OOCA 1FR3A 4K87A 1QP0A 2COEA 2QRMA 4JLVA 1QO0A 3I3CA 5FWYA 4L74A 1O03A 4BMVA 3HI4A 4AY5A 1S5FD 3LV8A 5HS6A 1FX0B 1TLTA 1H9RA 5BN5A 4MNTA 3UCXA 4BJ5A 1ABBA 1BHO1 3USCS 4TS1A 1SAYA 1VQJA 5DOVA 1Z2PX 4K5VA 1JEYA 2FPWA 2HDOA 3PUWA 4Q0FA 1DO2A 2X5KO 2UZAA 3QNWA 1SUSA 4HS9A 3ZBQA 1E4YA 4AUEA 2FR0A 3EAFA