1OXVA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 98
structure length 353
sequence length 353
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxvA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxvA01
1QG4A 2ANBA 1Z7TA 1G5TA 2BBTA 1Z6YA 2G1JA 4C0JA 3GPLA 2WHXA 2ZS8A 4Q7MB 4DR5Q 1S3SA 1R2QA 3NIBA 2H1LA 3KKMA 4L8JA 4DUYQ 4R4OA 1SZPA 3KKPA 4DDTA 4D25A 2QE7D 2EVWX 4DSNA 3CC2A 4G0NA 4A15A 5IF9A 2ZJ8A 3SDZA 3GJ0A 3ZVLA 2DFTA 1YJWA 4B34A 2EQBA 4WZAE 4IFDH 5M3MG 4ZDWA 4URVR 4B44A 4GZLA 2J0SA 3CCUA 4PHTA 1E2IA 2HCBA 4QFMA 1IXZA 4KODA 3J80i 4LJ6A 3SN6A 5KDOA 2I5HA 1KGDA 2EWVA 4IXNA 5FOUA 4MA4A 3IHWA 4R2HA 1K5GA 1Y63A 3JZMA 5DE3A 1ZIPA 6Q21A 4B3TQ 2GAAA 4H02A 3VR6A 1S3GA 2JEOA 3GQBA 3HKZE 2RHSB 4UNPA 3W5IA 2ZI6A 3RRZA 3DXJC 2JLQA 4QXAA 3T1TA 4B3RQ 1R0ZA 3A58B 4LY6A 1CI3M 2QBYB 3RZOH 4M4SA 4Q1EA 4FIDA 2XXAB 3DMNA 1XCMA 3DLLA 1I2DA 5EXPA 621PA 1T0JB 1KNXA 3KZ1E 3N2EA 1MT0A 3X2SA 1LF0A 3P1JA 4HYYA 4GN5A 2ZYUX 4C3HH 3K9GA 4FXPA 4TT3D 2ZUDA 4I1UA 4NXNQ 4LX0A 3GLGA 4GL2A 1HQCA 2BBSA 2IW3A 3HDTA 3NBXX 5IE8A 4Z8XA 4AIMA 3GLFE 4B3ML 4KJZA 2V7QA 4Q18A 4NYIR 4R4QA 1G3MA 1Z6GA 1JR3A 5EP4A 2JJ2A 1Q82C 4PZLA 2YU9H 4IOAA 2VF7A 1OPXA 2Q9AA 2F4VQ 2JJ8A 2VEDA 3K0FB 1Q90A 1MABA 1YHBA 3NBFA 1JBKA 4OHYA 1IBRA 4G7HC 3LAWA 1JEEA 4OK3A 2GVBA 4A3KH 2HXYA 1KK0A 5IYDG 3PIOA 3LWNA 1VQFA 5GJVC 4S35A 3SFVA 4DXAA 2YOHA 1WA5A 3KJPA 1KJZA 1MIUA 4YCWA 4ASUA 3GJ6A 2OHFA 1CP2A 2FGJA 2JDID 4DK3C 2OTJA 4OO1G 3ULLA 1OW3B 2OLKA 5J40A 2IUSA 3VAAA 5KPJA 2UU9L 5FOTA 2XNDA 4BBRH 1B8AA 1XMOQ 2K5UA 1TXYA 2XB4A 3K09C 3SFZA 4HJ9A 3H3VI 4TMXA 1CJUC 4PAOA 4PO1A 1Z8FA 1GL6A 1HPCA 2MMCA 1T4GA 2B7CA 3HOZH 1N6IA 1N6PA 1QHSA 2CLCX 1N0UA 4JVMA 4LC1A 4W7SA 4HUTA 4QGGA 3W5OA 1N33L 5KSZA 4DVGA 5BYJA 1PLJA 2OFOA 1II8B 3C5HA 1Q21A 3VR1A 4TKOB 1J5EQ 1LUZA 1OFIA 2A5GA 3CH5A 3KJHA 3KXLA 1T3SA 2A6HC 4A3LG 1KKLA 3MEFA 1OIXA 1ZVQA 3MLEA 1CSPA 3HP1A 4Q4AB 5LD2C 4LF5Q 1FOEB 3U3MA 4YWLA 2JIZD 1XNQL 2R6FA 3UMRA 3BH0A 3RS3A 3K9HA 2DFNA 4MKIA 1ZC4A 3U5ZB 3H94A 2OFWA 3VX3A 2ZRBA 1LM0A 5SZHB 1L1OC 1S2MA 5GJBA 2JA5H 2XTMA 1Y8PB 3OW7A 1O7IA 2OQKA 1Z0FA 1ZNWA 4BEBA 2ZE5A 2ZRAA 2EFEB 1NIPA 3HOYH 1JJCB 4DV5Q 2Y0SG 2PJRA 4IPGA 4WJ4A 5JRJA 2W2VA 3GCGA 4IVQA 4MZ9A 4LF6Q 1EFHA 1W46A 5G3ZA 4QQBX 1EX6A 5EE1A 2RKOA 2ZPTX 4DR2L 3LVRE 2C2HA 2O8EA 2PZEA 1TPZA 4QRHA 2X2FA 2XZOA 3K0XA 3AVTA 4C30A 2NVYH 1COWA 3T56B 1KI1A 4TYQA 1SHZA 1SGWA 5GROA 4DAYB 4DUZL 3LV8A 4JLOA 3UXMA 3OE7A 3S1NH 1VF5C 3AF2A 3KXIA 4Q9KA 5IRCD 3PITA 2J46A 4NCIA 4UXJA 4NE2A 5KUTA 4LRWA 1E1TA 2WMOB 4RD3A 4UP9A 3OIWA 2VQEQ 2GXUA 3U7FB 5E4FA 3KFVA 4MNOA 2PL3A 3PO3G 2QQEA 1YITA 3ZS9A 3EQLC 1N9WA 1R5NA 1XU4A 4P75A 3GLHA 4NMMA 1QVGA 4Q7LA 5CK5A 4UXIA 5DYGA 4DCVA 4BLPA 1XMQL 2AKYA 1EWHA 1DAKA 1T91A 2Q9BA 4YMUA 5TDHA 3X1WA 2I0QA 2CHQA 2P6NA 1CTQA 3HOUH 4FD2A 5GVSA 4DK6C 4N0EA 4OI4A 2YYZA 1G3RA 5LMUL 1GRRA 2OSBA 4I1SA 1ZUIA 1CJMA 4KYUA 4O2LA 1QZXA 2VHCA 4OHVA 2GA8A 3QEJA 4QOSA 3MD0A 3T1YQ 1QHHA 2DGYA 3KJGA 3PVSA 4U5XA 5FUVA 4CW7A 3AKEA 1PV4A 2K5NA 1YRAA 1MKHA 4JBWA 2FGKA 4GS3A 4PQFA 3GTOH 1OF1A 2OO7A 4R1JA 4C2UA 1I4LD 3AVQA 4DV2L 2IS1A 4A93G 5ELOA 2WSSD 3CW2C 1JJ7A 1NSFA 4RFSB 5AUNB 4B35A 1XPRA 1K3RA 1U2RA 2A5FA 2ZVQX 4D0LB 4AWXA 4ZO4A 3PUZA 3AM1A 4JI3Q 4BZXA 4RD0A 1IW7C 3OPOA 4KN4C 3NBYC 2NTYC 1D9ZA 4FDBA 1RJ9B 2ODEA 3LBIA 1XEFA 2B63G 3LX5A 4PAMA 3VKWA 5ELNA 2GHIA 3TW8B 2VA8A 3B1XA 2XGJA 2A9KA 1K8RA 3LQRA 1E6CA 1ZNYA 4LFAQ 4TSFD 5C4XH 2GJSA 2G9NA 1TWFH 2AUJD 1ASYA 1FMJA 1E22A 3RNUA 1Q3HA 1UF9A 4AC9A 1QBKC 1SRUA 2EFCB 4JI2Q 1YEZA 1JR3E 1ZYRC 2QTFA 5FL7A 3M1IA 4DUGA 2F52A 2X19A 3EPHA 1H9SB 2BKUA 4JBXA 5HKKD 1ZNZA 2WAYA 5LMNW 1LV7A 1MOZA 1KSFX 4ITRC 2KCMA 3I2ZA 4M9ZA 3GLIE 1T3HA 3D8BA 3KYHC 2MSDB 3KDFB 1JB1A 1S8FA 1VCMA 2IF0A 4F38A 1CR1A 4GLAC 2AX4A 3EIVA 2V4ZA 2Z6KC 1SXJC 1VIYA 1PUIA 2R6DA 4O25A 2BC9A 4X65L 1CS4C 4R2IA 5DSZA 4DLTA 1NI3A 1H8HD 4TYNA 3BBPA 2DY1A 5F3WB 5IK2D 2LKCA 2JLVA 2J1LA 1ZM3A 1E98A 3Q8XB 4MUBA 4QG7A 1YHAA 1OB2A 1N34L 1C7YA 1PZNA 2ZS7A 2R2AA 1LW7A 3U2QA 2ZYTX 2QZ4A 2K32A 1YHNA 4B6EA 3PF5A 3SR0A 3NELA 2CCZA 4JT4A 1BMFD 2XXAA 2LXJA 2QUZA 2YTYA 4OONA 2W58A 4MKFA 3KUCA 4NTZA 2ZTDA 3NH9A 1ASZA 2BJVA 2OT3B 1KL9A 2CNWA 4IOCA 4A2WA 1SKQA 4B43A 2OZEA 3U60B 4B3MQ 1YJ5A 4PC3A 5C4JH 1W2HA 3F2BA 2PT5A 2F43B 5H70A 1DO0A 1FQKA 3KLWA 3IIMA 3G48A 2GVZC 4E5UA 4AYXA 5M04A 3BDOA 3B60A 2ZRJA 4Y52H 5FFMA 1OLOA 1F3OA 2LKDA 4KYIB 3THXB 3UE1A 1B70B 2PI2A 1PH3A 3U4VA 1N0WA 2FV8A 2CWPA 2IYUA 3BERA 2NO1A 3QPWA 3WHKA 3T12A 1A2KC 1ZW6A 1GTVA 3EA0A 1VF7A 3CF2A 5FJ8H 2UZIR 5L3QA 2QQ0A 4GZYC 4IFDG 1ZBDA 4A2QA 1VCIA 5CDFA 4B2PA 2KHJA 4RZ2A 2ASBA 3S1AA 4QIWE 4KKUA 1PH9A 2UU9Q 2WWXA 3UMSA 1VMAA 4WJ3M 3H0GH 3IILA 3GTPH 3PUYA 2B8FA 2RH5A 3C5CA 4IVPA 4MH0R 1U81A 3FDIA 3GO5A 4Y0AA 3O47A 4MYUA 4OX9L 2ZTSA 1XCGB 4OJKA 1X3EA 4LJ5A 2GXAA 1G8YA 3KF8B 3B1WA 2GXSA 3G6EA 3AVVA 4JLJA 3OFND 2OM2A 1N33Q 2JJQA 4Q00A 3IHLA 1FTSA 4LV6A 3TQFA 2QNRA 3KFUA 2OCYC 3CWQA 3GLHE 2OXRA 1UEIA 3NC1C 1HR0L 4LJ8A 4UPAA 5H1YA 5TXGA 1Z2AA 3REGA 1II8A 1YNXA 3AKDA 4JIMA 1KQSA 2IBMA 1E1OA 3K0AA 1E2EA 1AQUA 1N5LA 4KLKA 1FFHA 4TLCA 5EQTA 1N36L 1KO1A 2Q2HA 2YWHA 3UG7A 2VHUA 2DPXA 1NTGA 4Q4AA 1PYSB 4GRAA 3WMFA 3W1BA 1W4AA 2V6IA 5L3SB 3Q8DA 3I5XA 4AKGA 4BFXA 3SNHA 3VHLB 2XTIA 2GF0A 1DXMA 1VQBA 2ZSBA 1E94E 1KY2A 1XMVA 1IN5A 1U9IA 4LC0A 2A69C 4PHHA 3SHFA 2PMKA 3ER0A 3EA5A 2IS4A 3RLNA 3QVVA 4EFMA 1XTSA 1ONLA 1YNJC 4A3KG 2REXB 1MO5A 2DR3A 4HIDA 2N46A 3CONA 3I4OA 3KX2A 1Y14B 4DR2Q 5FBLB 1Z9FA 4MTNA 2QY9A 1UE5A 2KHIA 1YVCA 3CPWA 2HV8A 3DHWC 3ZYCA 1GAJA 2R6CA 1YU9A 2FU5C 4QM7A 4P4SA 4BBRG 2HXSA 3CF5A 2J0UA 1UADA 2NG1A 4X8MA 1G7CA 1OXVA 2IK8A 4NB3A 1WBBA 4V0NA 4Q9LA 4JLVA 2FSFA 1TAGA 1E3PA 3HOZG 3C7KA 4M1KA 1DE0A 3QKTA 1FVIA 3RN2A 4BFYA 4DK0A 1TF7A 1D8TA 1NBMA 1NMFA 4DCTA 1O87A 3A0JA 3TUZC 3N5CA 1TU4A 3WRXC 4Z1MD 5IP7G 4D4MA 1XMQQ 3EAQA 2ZM5A 4XD7A 1XXHA 4M1MA 3CUEF 2ZJQA 1E7ZA 4NYJQ 3THWB 4DR6L 3IUYA 1YRBA 3PUWA 2EIFA 2CLDX 2GETA 2K75A 1ZUNB 4DV0L 2EJFC 3J81c 2VTKA 1QUQA 2FX3A 3F0TA 3FHCB 4Z8YA 1E3MA 5LMUQ 1DOAA 2QG6A 2XX3A 2JA5G 2VLIA 1XP8A 4QM6A 4ZKEA 4P4TA 3A8TA 2OCBA 1E2JA 4B75A 3CCJA 1EG7A 3HOYG 3KDSE 5HE9A 2XAUA 1K8AC 4I1VA 2ODWA 5C0XH 5FUWA 1QVCA 1ELOA 4BY1H 5C46F 2OTLA 2VHQA 3EZFA 3I4LA 4JYAQ 5K8IA 4GSYA 4PFSA 4YXWA 1CF4A 4EPVA 4G7ZC 1NIJA 4GOXA 1W36D 3WXMA 1I94L 5FBVB 2XB2A 1T6NA 1VCOA 1E2DA 4AD8A 1BVSA 3JAMi 4KXFB 1KSGA 3CPJB 1UKZA 2NO7A 1RL2A 1US8A 4Q1FA 3TUIC 2KBNA 1XNRL 2Z0SA 2E76C 1X3FA 1RW4A 1COWD 4OI1A 2BV3A 4OK6A 2DB3A 4UXHA 2JQOA 2WSMA 3OE7D 1XJVA 5JEEA 3C15C 4ABYA 1T3LA 2R9VA 1YVDA 3DOEA 4ARZA 4PPQA 3G5UA 1CRQA 1WE2A 4AKEA 3NHBA 1ZINA 3SEAA 5AJ3L 1P6XA 1Q1QA 2GRJA 4JI4L 1AIPA 2JATA 3I56A 2RGNC 4Q66C 1VQ8A 3CCQA 4HJAA 2PI2E 4BPBA 4G01B 1XCPA 3E2IA 3J7ZC 3RRNA 2FNAA 1WP9A 1Z08A 4DIEA 4QY7A 2R44A 3F2CA 3HOUG 1GIAA 3BK7A 3IPYA 5EP2A 3SGIA 1Q22A 3PIRA 4TTQA 2WFWA 1SULA 2BM1A 3K0CC 3J81k 4GKKL 2VSFA 5CDFE 1KIXA 3TS0A 3AGPA 4X65Q 3KF6A 2CE2X 2AD1A 3KQHA 2WIAA 5EUMA 1EXMA 1FUUA 2NZ8A 5TVKA 4OHZA 2J7PA 3ZD6A 1VPLA 3K70D 1W2BA 3GTLH 2CW0C 5B64A 4JBYA 4JOIA 1N34Q 2VHJA 1HZCA 3RHFA 2IX3A 4A6PA 5KU1A 4IQZA 1AQYA 2Z43A 4IW3B 4GOPB 1VG1A 2N78A 3VR2A 3OEEA 1E1QD 3D3QA 3PO2H 2R93H 4P3YA 2O8FA 5JEDA 2IX0A 1G8FA 3PJRA 2QT0A 2CCKA 2VQFQ 3BIFA 3J81j 1Z07A 2WPDA 2EW1A 3C8UA 4YHHL 4RD4A 1VS0A 3BRWD 4CDGA 1AN0A 1TWHH 1HTPA 1E2GA 1A63A 1LTQA 1GNPA 1LS6A 1PH5A 1ZCAA 3RLOA 1HZBA 1RVDA 1X8JA 1H9KA 4LF7Q 5C4XG 2OILA 4LYHA 4JBKA 2NO9A 2E75C 1T9HA 3WP1B 4DR4L 3GFTA 3EPJA 5LD2B 2ATWA 2GBLC 4DLVA 2GCNA 3CCVA 4UP8A 4CEIA 4RZUA 2ZSDA 1OB5A 5TY0A 3U7HB 1E4VA 4DUGD 3DMDA 5FL7D 5CITA 3IFTA 1W48A 3T1OA 3L0OA 5DN6A 3S2HH 2WAQG 1FP6A 5F9FA 1XD8A 3CXCA 1KSHA 2GJ9A 2PZGA 3U58A 1EWRA 1G4UR 1HNXL 3WWVA 4QBIA 2D7DA 2C9OA 4L4UA 4L9WA 4L5TA 3CWZA 2E2HH 1KDRA 1UM8A 4A76A 2REBA 1NJIC 3TSWA 3ZGXA 2KCCA 2OLJA 3J80c 3NHAA 4RCNA 2O8BB 4AIIA 3QBTA 4YMVA 3WBJA 3A4LA 4OX9Q 2V54A 3QXXA 3CH4B 3TS2A 4PC2A 2DWQA 5CIQA 1WCMH 1M90C 4IPCA 1VQ6A 1QRAA 4R98A 5LMNL 4AG6A 5A35A 2I5LX 1E0JA 3O8DA 4KFRA 1IYVA 4UY8C 1X86B 1M2OB 3KTAA 4OK5A 3FKIH 1NBME 2RGCA 3QF7A 4URWR 3EXAA 1OXXK 2PQAB 1EFCA 2BM0A 1VQ9A 1HR0Q 2JA7G 1AS0A 1E2WA 1MJCA 2WB1E 5IT5A 4D4KA 3OHMA 1XXHE 3S2DH 1VYVA 1P73A 4AQYL 1I5FA 4M8NE 1N36Q 5GJCA 3R8CA 1E79D 3RVBA 4URZR 1U99A 2C9CA 2ZQ5A 3PEWA 4DV1L 1JJ2A 4A3GH 1A5TA 5K8TA 4YWKA 1Z6AA 4F93B 2FSHA 3Q85A 4G5GA 5B30A 4GNXA 3GJ7A 3W3ZB 5FBQB 4QGHA 2O0HA 1EESA 1VQDA 1B9NA 4I1OA 5UKDA 1X55A 4I7ZC 4MGYR 2QROA 4Q47A 1D9XA 4HLDA 3RS5A 4B2LA 3BE4A 4L16A 4LUCA 3GLIB 1NMYA 3SHWA 2C78A 3B78A 3LA6A 5AJWA 3GFOA 4CT4B 4F4IA 1A6XA 1G7TA 3Q3JB 2AHOB 1KIMA 3VTKA 4AYBE 4L5QA 1XTIA 1RE0A 2NPFA 4AI6A 1NBWA 1N25A 3KKOA 4IDQA 4CEHA 4KAXA 1Q8KA 4LYFA 1ZKOA 2N8NA 3J81i 4HAZA 4KCGA 4XJXA 2GXQA 4UNNA 3A8KE 3RS4A 1I6HH 1XMJA 3EASA 4LK2A 5CYOA 1PA6A 3T1VA 2FPKA 3THOA 2ZIAA 2HLDD 4JLPA 4XWAA 3H15A 2XNSA 3B1ZA 1ESMA 1KAOA 3NBZC 5FLXc 1Q1EA 1J6QA 1TUIA 2CJWA 2VIIA 3ULPA 1XJ0A 1VHLA 4XH9B 4C3IH 4M1OA 4P4UA 2B7BA 5JSZA 3CP0A 4DR6Q 4GNKA 2MNAA 2PNRC 2O8CB 3EG5A 2WWFA 3IBGA 1CJTC 1U98A 3CF6R 2H16A 3DZDA 3LNCA 1FJGQ 3QE0A 4UP7A 2BDTA 3DPUA 4GOKA 4C2TA 2GZDA 3C16C 5BWMA 4DLYA 3LXXA 4MKGA 1O7LA 4YMSA 5KSOA 2HHHL 1NLYA 4GKJL 4QL3A 1DAFA 4BUJA 1KI3A 1JR6A 3KLRA 4X8LA 4R7ZA 3TAUA 2DFLA 5E7MA 1PVOA 1SXJB 5HR5A 1W5SA 2WIBA 5AUOB 2H5XA 1SKYB 1W3SA 5EE9A 1NN3A 1W36B 4A0HA 1HE1C 3OZXA 1SVWA 4I4LA 4B71A 2DWOA 2B92A 4JC0A 1EFUA 2R7FA 1I94Q 4L9SA 5JEAH 1HZ9A 2BBOA 3I8SA 4E07A 3I4NH 3TMKA 5KNDA 1Z3IX 3LXRA 2ORIA 1N32L 3O8RA 3AYHB 1E0KA 3CMEA 5DHFA 1XNRQ 1VQJA 3HKZG 2OV2A 3Q9LA 1WMSA 2IYZA 1F5NA 4NYJR 5H8WA 1K8GA 1HE8B 4KSBA 3ZVNA 2XTZA 5FOVA 1OXUA 4IDOA 2KWIA 1WFQA 3LGJA 4N0DA 2AK2A 5LBIA 1NE3A 1EYGA 4O2DA 4TVAB 4KVGA 3AVYA 1WYDA 4K8OA 1E2LA 3CPHA 1CXZA 1E2KA 3AF0A 3AGQA 4AKIA 4JI4Q 5FLMH 2D2FA 5KNCA 1U5KA 2QA4A 1G8PA 3SQXA 3DM5A 2GEVA 3CLVA 3TRZA 2NZOA 5EE3A 2PT7A 2E1RA 1DO2A 2FSGA 4KO8A 4M1TA 1N6HA 3PCOB 3SJCA 4C7OB 3AQQA 2FN4A 3PEVA 3RC3A 1SN8A 2QU8A 2VQSA 3UMFA 3K70B 5FTLA 4LF9L 3DEFA 5C0XG 3DM3A 1ZM2A 2BJWA 4BY1G 3A4NA 3A5ZB 2VP2A 4C9BA 2ALYB 4LWZA 1A0IA 4BY7H 1A7JA 1S72A 1YZUA 2JA1A 2ZREA 1T5EA 4D81A 4DT1B 3TZUA 2F1RA 4LOAA 1EWIA 4PZ6A 2A19A 4YXWD 3K09A 1XMIA 3LWUA 3OAAD 1NKSA 3SBEA 4ZIRA 3QXSA 2GEUA 3T53B 2F1HA 2EFHB 5J47A 1SQ5A 2UXDQ 4HR7B 4KBFA 4NCKA 4LUOA 3EX7C 2VL7A 5EJEA 5FI0B 2BBWA 5JS8A 3KFXA 4DR4Q 1GL7A 3P32A 1BYIA 1KO7A 4EPRA 1IBKQ 1W4BA 1S0UA 2G0NA 4LF8L 1NMGA 3FMOB 3L2OB 4GP6A 3CIOA 4HIMA 4B74A 1NY5A 2ZRNA 2ZVPX 5DI9A 3LX8A 4DR1Q 2RAPA 2W0MA 4G5RA 4QGUA 4NPHA 2J45A 2ATVA 3SJBA 2ZI3A 1YE8A 4R9UC 5LB2A 4NL4H 2A3RA 1L1OA 3H2YA 1MRNA 1AKEA 1E1RA 1EFTA 2WV9A 4GMDA 3HU1A 3SI7A 1KO8A 2ZRPA 5HPYB 1H8ED 3VQTA 5JZVA 3FKSA 3F2DA 4BASA 4IPHA 1IXRC 2HJVA 2Q6TA 3MAAC 3M4OH 1JJVA 2QM7A 3QENA 2WWIA 1DARA 4JVNA 4X62L 4OQMA 4WZ6A 5IT9c 3UKDA 4C0SA 1XD2A 1YR6A 3OEHA 4LJYA 3T61A 3ZVRA 1CRPA 4IEIA 3GTGH 1TU3A 2J7PD 1E9BA 1DAGA 1P2TA 2IC5A 3EC2A 3CCSA 2K5HA 3FPAA 1WB9A 1GFIA 5BN3A 3PO2G 1I4DD 2R93G 2ORVA 4MGIR 3MWLA 5E3HA 4C0AC 4FCWA 1ZNXA 1UE1A 3KJOA 2VSXA 1HJPA 1GVNB 3OEED 3NG1A 2V3CC 4HJ5A 3K7UC 3K1JA 4RD1A 1OHHD 3REFA 2UUCL 2JLZA 5SZJA 4CVNA 4AQYQ 2QAGB 5JJLA 4IOMA 1QHIA 4BLTA 1KJYA 1UKYA 1NVXQ 4HAXA 4JT2A 4ZDKA 1AK2A 2IX1A 1YZGA 4PHGA 1VQIA 4DV1Q 1YJNA 1Q1ZA 3BS4A 3CR7A 1DS6A 3WMEA 5M5YH 4EPYA 2H18A 1Y8NB 1N3BA 4DLWA 1WBDA 2ZAOA 1IM2A 1SVIA 1X9NA 1E2PA 3L8ZA 4HB3A 3O8BA 5E7JA 1WJJA 1R5BA 2UZ3A 1FW6A 4LWCA 3CNNA 4HDCA 5FL3A 3U6KA 1GKHA 1XMSA 4GOPC 1GUGA 2QMOA 4JI0L 2FEMA 4HATA 1Y1WG 2WM9B 3QBVA 1HV8A 4PSKA 3MRSA 4B3SL 4K0KL 5JWHA 3ZS8A 4FCVA 1D8LA 2AD5A 2BMJA 2G1KA 2Q3HA 1JE5A 2XSZA 1LYLA 2ZRIA 2JEBI 3LQQA 2IHEA 2JK8A 1KI6A 4KBGA 3M7NA 3I72A 1VQPA 1RYFA 5JRZA 3RWMB 2O0KA 2HJGA 1E2ZA 4P33A 2AHOA 4TQAA 1VIAA 2E87A 4V02A 2AL7A 3I92A 2VYFA 3KB2A 3IEVA 4MRSA 1QVAA 2RHDA 1WCMG 3CW2A 2A5JA 4GN3B 1W0JD 5FR2A 3VR4A 2DN8A 3TVTA 2O8DA 3RN5A 5IYCH 2CMKA 2NO6A 2ZJ5A 4A0RA 3FKIG 1JPJA 1GUNA 3J7A5 4A3EH 4PANA 5GADl 4UQOA 4DBLC 2FE4A 5E7NA 2CCGA 3QI2A 1GNQA 4ME3A 1XDBA 4X8HA 1F2UA 1CU1A 1QDEA 4DCNA 3UDFA 3R7WA 4Z51A 4DNTB 2UXCL 5IWAL 1FGUA 2FWRA 2GVAA 2QEQA 2V9PA 2ZRGA 3ZZUA 1VQ5A 2VP9A 1W44A 4A3GG 5KDLA 3KQUA 2AXPA 3QQ5A 3ZIAA 4BZPA 1AZTA 1RKBA 4KV9A 3TH5A 2VS1A 5IYBH 1NG1A 1XEXB 2GJ8A 2HHHQ 2Q21A 4AYTA 3AVUA 4GKJQ 1TX4B 4QBFA 2I3BA 3GTKH 1J99A 4G5QA 2P0EA 4DIDA 4DB2A 4HLQB 3BJUA 1TF2A 4F92B 3HPQA 2UXBQ 2JEAI 4MGZR 4V0KA 5CJ2A 3RYTC 4CZ2A 3FYHA 4ILEA 4TYYA 4GLVB 1K83H 1KC8C 1IN8A 2OEPA 2IWRA 2Z6KA 2ZJYA 1SXJA 1ESNA 4Q4HA 3TW4A 3QG5A 3RRMA 1JI0A 1YR7A 4PZ8A 4BFTA 2V1UA 2YTXA 4TMVA 4M0LA 3PFIA 5D3MB 2FPLA 1F6BA 1XZPA 4X8OA 4WBSA 1XTDA 1OIWA 2I1QA 4CEJB 5J4HA 1N32Q 4QJ3A 2KENA 4BXXH 1IY1A 4NU0A 1YJ9A 3S15H 3CMAA 5EP3A 4TYWA 4LJAA 1VQ4A 2Q2UA 3ND9A 3TQYA 1V43A 4O3MA 2J87A 3CR8A 1DG1G 2IHBA 4LI0A 1C9OA 3QPUA 1VQAA 1N8RC 2JLSA 2CK3D 2ZRHA 4QJ5A 5JMTA 4EX5A 4TQUS 4BA1I 1ZUHA 3AKYA 4PO9A 2VY3A 3CC7A 3U44B 4JV5L 5EE0A 1KNQA 4HB2A 4BZQA 3KQNA 5L3VA 1V1QA 1EFWA 1S1CA 3K53A 2W0SA 2IXEA 3BB1A 1UJ2A 5EP1A 5AWFC 1Q86C 4Q02A 3K7AH 4DJTA 1CBUA 4HSEA 2VL6A 1GSIA 2NIPA 1OSNA 1IBLL 1E96A 4BRUA 4D2IA 3P27A 1Z6HA 3A1WA 4EJSB 121PA 1G291 1KHIA 1EUJA 2C77A 1F2TB 3E70C 4F91B 2I1VB 3F8TA 4BBSH 1NSTA 3IIJA 4TQ9A 4LF9Q 3BWDD 4PQRA 1DVRA 3CCEA 3GLGE 1HQMC 3FKQA 2E2IH 1NL3A 2B29A 2PMZE 3AF3A 4LYAA 2CLSA 2XOKD 2ZJAA 3KB1A 3M3YH 3GEIA 4NP6A 3CC4A 1W49A 4P0TA 3VX4A 1G21E 4Z54A 3SE0A 1IN4A 2W00A 5JEAG 1BDOA 2D62A 1G41A 2KB0A 3IPXA 3U4QB 2WVJA 3P4XA 1G17A 3U50C 1E0SA 3JAMc 1RRCA 1HNZL 1KI4A 3TNFA 4L5RC 1XNJA 3W6OA 5GAGC 1W7AA 2R92H 4HB4A 2FDCA 5C18A 4Q4JB 4Q7KA 3QSYA 3EZ9A 2I4IA 4RY2A 3ECCA 1N6NA 1V5WA 2GK7A 2N1BA 2PBRA 4IJHA 2P5SA 3FHWA 1K73C 2NQ2C 4NCJA 1W36C 1H9JA 2CQOA 4DV7L 2BA1A 5FLMG 1VG0B 1FUKA 2CDNA 3P26A 5A4JA 2CBZA 3FMFA 3KXKA 5H1SE 3AP1A 5EE5B 4M22A 1P7CA 1OXSC 1J70A 2VHTA 4RD6A 5TARA 2ZUBA 4GPTA 1CLUA 1JMCA 1SVSA 4LHYA 5LPNA 1LNZA 2GF9A 3CRRA 3M4YA 3QKSB 3OYYA 1GRNA 1IN7A 4L5BA 1SLJA 2F3IA 4TTRA 3SJZA 2QBYA 1X6OA 1OYYA 4PO8A 4EFNA 3BZCA 1AE3A 2MSEB 4X62Q 4B3DA 1EIYB 1GWNA 3IIKA 3IRBA 1XB2A 3QJYA 2JA6H 4HLCA 5DI3B 3KQKA 1UBCA 3VDYA 4MRRA 4BY7G 1IHUA 5G40A 3CCMA 5AUPB 2ZM6L 4Q4LA 1PUJA 4OQNA 2REOA 1XEWY 2VP6A 4M21A 2CE7A 1IAQA 5BR8L 1RYHA 2GESA 5IDVA 1LS1A 2UUCQ 3PR1A 2PX0A 4DKXA 1L8QA 1TQ6A 2NOAA 2NVXH 3I4MH 2JAQA 1LTLA 4JJZA 3K0FA 3SYNA 5GVRA 3H1TA 2GCOB 3K70C 2KBFA 2QENA 4D4LA 4NBSA 3TREA 4M2LA 3CRMA 2WKPA 2D0OA 5B57C 2F9LA 1UEBA 4JBMA 1KAGA 4G7OC 1CKEA 1Z6TA 2A5DA 3A1VA 5L3SA 2R7DA 3NEMA 1GOTA 2ZSFA 4KFTA 4A4IA 3GJXC 1NMXA 4QC2A 4K0KQ 4PZ7A 4FI3C 2F1JA 1VQLA 2WZQA 1VQHA 3BZKA 2A1AA 1G19A 1AS2A 4OI0A 2A6ED 3HOXH 4MRNA 4HEJA 2NZJA 2KCTA 1VQKA 4E22A 4NCNA 2NVQH 4JVSB 4M9SA 2O0JA 4NONA 1I3QH 4X64L 3GTQH 5DIFA 3CRVA 4PR0A 1EGAA 4OJQA 3ADBA 1XNQQ 1HEIA 4DEXA 5K36H 4A3IH 3W8RA 1E2VA 1D2NA 3ICEA 1L0WA 3E1SA 3BXZA 5AUQA 4AKHA 4LBYA 2LCFA 4XVRA 3WDNA 2V7QD 4WZBE 4JI1L 4IKEA 3A37A 3BJIC 1II9A 1JR3D 1KJWA 2JJ2D 3TEHB 3QY0A 4D82A 1H95A 1KD1C 2UXCQ 4Q9HA 2B8GA 5IWAQ 1X54A 4Q03A 4U7DA 1ZD1A 5C0XI 1ANKA 2ODBA 2W6JA 4P71A 3VU9B 1CEEA 2QPOA 4FWIB 1XTQA 1Z0KA 3S1RH 2QTHA 4URYR 3B2EA 2OUKA 4DWJA 1KXLA 4R4CA 1S9DA 2W6IA 2CKZB 3LLUA 1VQGA 2RGNA 3TSOA 5AK0A 3NC0C 4DUZQ 4ASUD 3I3SR 4DDVA 2IYLD 1EFRA 2AXNA 1IONA 2D74A 4XTCS 2XNDD 1NLFA 5C4MA 1F60A 4IJLA 1Q0UA 1XX6A 1XZQA 3D0FA 2A30A 3EZ2A 3K0CA 4BEJA 2JLWA 1YI2A 2ZE6A 1DD2A 1I2MA 3BB4A 4GN4B 4JZKA 4TMKA 4DCSA 821PA 5GQOA 2QAGC 3FOZA 1GITA 3GJ5A 1KAWA 2E5LL 2Q0HA 3SYKA 5HZKA 2XZLA 2QA5A 5CB8A 4AYWA 1GD7A 2ZEJA 3THYB 3PUXA 2VRWA 1I50H 3MXUA 2Z0MA 3T5DA 2V4DA 1CKNB 2J0QA 4Q9JA 1WDTA 4KU4A 3RRYA 3GLFB 2XGTA 1IBML 4OQLA 2RCNA 2WJIA 4D0GA 1VQEA 5IYCG 1HQYE 1HH2P 2FA9A 2JASA 3CB4A 4MUAA 1CIPA 2IYSA 2HUPA 5JHHB 3K0SA 4B6FA 2ZR7A 1P2SA 1BBWA 4HZUB 4CF7A 4NZYA 5J4VA 4URUR 4US2R 3LLMA 3Q7QA 1FR3A 3KJIA 3ADDA 4TL9A 4WOPA 2ZR9A 1L4YA 4QJ4A 4GLXA 3B6YA 2IYRA 4BE7B 1E69A 1IBLQ 2AK3A 1G3IA 3E9HA 2OCEA 4LFCL 2GVDC 3TRFA 2GBLA 4DV2Q 3CNLA 3NEYA 4DNRB 3M9BA 5P21A 1SROA 3GDEA 3CKLA 1P9WA 4GDFA 1UE7A 1SVOA 1UBEA 2ZROA 5IYBG 1WQ1R 4RFSA 2RGAA 4G5SA 2FJUA 2HF8A 2PEZA 2R7ZH 1KDPA 5FTKA 2PJZA 2QMUA 3GTJH 1P5ZB 5FOXA 4A8JB 1PH2A 1PLKA 2XTNA 4NYMQ 1JT8A 1OTCA 1W0KA 5EZ6B 1RJ9A 2IHYA 2QM8A 4JLNA 1T8UA 4EPXA 3WNCA 1NMZA 1FYCA 1RIFA 3OIUA 5DLQC 1VG8A 2K7VA 4HZIA 2XJ4A 1SE8A 1U0LA 2ZI7A 1E9AA 4IFEA 2ORWA 4JLAA 5F9HA 3RC8A 1U0HC 3A6PC 3BFKA 4WA7A 2HIXA 3E5HA 4X66L 3B5JA 1KMHB 2CL7X 4BXXG 1J8YF 3VMFA 4CYMA 1HNZQ 4ACBA 3OOCA 1NY6A 3H84A 1H9SA 2V1XA 4LHWA 4UJ5A 4A3BH 4B73A 2A68D 1GO3E 2IA5A 4GOJA 2QE7A 2FF7A 4X6AH 1OKKA 4PSAA 1RPZA 1DPFA 1YZQA 1K8MA 1DELA 2YKGA 1UDWA 2TMKA 3TE6A 3CZPA 3VNVA 2YV5A 3W90A 4W5JA 4Q4JA 3KDFA 1SMXA 2P67A 2WB1G 1JXOA 1MO4A 4DV7Q 2BHRA 3HR7A 5IP9H 2A8VA 1R8QA 2C95A 1GZSA 2Q3FA 1X56A 3EC1A 2WJJA 2ZE8A 3M6AA 4IDNA 4M1WA 5FR1A 4B3GA 3VKGA 1K6MA 1KDOA 3CX7A 4RG1A 2IEYA 3AV0B 1CR4A 1OH7A 4C0KA 5JLJA 3CAMA 3HJNA 2OBNA 4AURA 1IN6A 3NE5B 2YVUA 4RJLA 3GP8A 3TJZA 1X3GA 1DAMA 2ATXA 3OW2A 5FI1B 5J4LA 4OQFA 2VBCA 5FPSA 3FMCA 3A1UA 4RKEA 4C0LA 2FPMA 4BBSG 5JI3E 2BWJA 2GJAA 4V0LA 3FWYA 1XD9A 4TT3A 1NY4A 1E9SA 2IUTA 2GJKA 3GJ4A 1R0WA 3KL4A 4P31A 2ZYVX 3ADCA 4M9QA 3CRLC 3QEOA 4TWZA 3EPKA 2JLUA 2RGBA 3RR5A 1Z6XA 1DBSA 4JI6L 4F4JA 3QKRB 2ZM6Q 1KO4A 3RS2A 4QKQA 4AYBG 1YHQA 1PH6A 4DCUA 1P9NA 2F43A 2RHQB 4BRWA 3LO5A 5BR8Q 3TAHA 5E95A 4NXML 2RMKA 2CCJA 2QEXA 4BLQA 5F98A 4EJSC 1IJEA 4JBJA 1B9MA 1P61B 1KI7A 2OE2A 2BEJA 3DKPA 1GUAA 4DDUA 2ZJOA 1MO3A 3THXA 1N6RA 1QHYA 2R92G 3HFZB 2WJHA 1XFAA 3U7EB 4QBGB 5LB4A 2V55B 2WP8J 1BS1A 1P2VA 4CT5A 1KMQA 2JDIA 4ESHA 3QOFA 4YDSA 3K8AA 5GADC 4LCBA 1EIFA 4DV3L 4YMTA 4PG3A 4DB4A 1XEWX 1GILA 3LY5A 3VHXA 1OV4A 5KPDA 4D6PA 2DBYA 4TN1A 3VKHA 1LB1B 2WOOA 2ZANA 1WI5A 2RGGA 1M34E 2YNMA 2ONJA 4MYHA 3M0EA 3A36A 4A3DH 4A75A 3OESA 3B82A 1YR8A 4H9GA 1W5TA 1GKYA 3N6RA 1TF5A 4LJZC 4B3TL 2W83A 1N0VC 3X1ZA 5JBQA 5GAHC 1M7GA 1RRFA 3BOSA 1O78A 4B3RL 1MJEA 4LJ9A 5H68A 2OBMA 2ZRLA 2JA6G 2D7CA 4JKYA 5FPHA 1X6VA 1Z0AA 3D7MA 3BG3A 3GLGB 2L0XA 2EVBA 2JIZA 4LBVA 1C4OA 4UNQA 3PF4A 2IF2A 2XJ9A 4A3LH 2QRZA 4B3BA 3PXGA 2CNWD 4Q7JB 1JQLB 3AP2A 3CZQA 3JVVA 5DYIA 5TMPA 2ZRFA 2EYQA 3I32A 2JJ1A 1ZC3A 2J41A 2I5MX 3I8XA 1Z0DA 1GUTA 4NPSA 2QAJA 3HYRA 4L15A 4TMZA 1MABB 4Q5IA 3RAPR 3ZZ0A 4KSCA 3TR0A 4ZDIA 5FJ8G 3HOWH 2HQLA 2PPBC 2XEXA 3T35A 4TMTA 2PCLA 5JS7A 3WNDA 2K50A 4ZI3A 1CR0A 2EJGC 4M9XA 3W8NA 5ELXA 2GDJA 4H44C 3H0GG 2OQ0A 3NDPA 1OT3A 3FTQA 2VPPA 3TIFA 3JZAA 5CM8B 1G6HA 4LJ7A 1KO5A 1NN0A 1FL0A 2OESA 2V8OA 2WMNB 5E7IA 2G0TA 1OYWA 1RRPA 3GFPA 4HIKA 3NWJA 1VQ7A 2CHVA 4LPKA 2L15A 2F3TA 2J5XA 2QGNA 2ZJ2A 3IBYA 421PA 2EFGA 3HOXG 1CUKA 2BCJQ 2FMXA 4S2EA 1DAIA 3IO3A 5C44H 1E2MA 4MDEA 3CO5A 1MKYA 3N70A 1G51A 4LGMA 2QI9C 2ZUCA 3LBNA 3LH5A 5FUXA 2ODNA 1JAHA 4FINA 2KSQA 2K14A 4UJ3A 4XWOA 1TUEA 3T34A 4DV0Q 5K36G 2QGQA 1QZGA 4L8GA 1CKNA 1E4YA 1IBMQ 3THWA 1FQJA 2D2EA 1E9RA 3C4JA 2JGNA 3CM0A 3TUJC 2O5IC 1L2FA 2P6RA 3QG1A 1JJGA 4QNRA 1KDTA 2V1CC 4LF5L 2D2CC 4W5WA 4UNRA 3STBD 2PLFA 5LDDC 1C9KA 1WOCA 2PNHA 2VNUD 2CL6X 2WOJA 3B9PA 3CQZH 4IFDJ 5C1BA 3OIYA 4RZ3A 4LZZA 5DISB 4LFCQ 4LV8B 2OCAA 1C1YA 1FP7A 2BCGY 2GILA 4DV5L 2OCPA 1SVMA 2WSSA 1KY3A 1QHGA 2QMHA 2RB4A 4POFA 2O8EB 4YY3L 2H92A 4B3FX 1XJCA 1HUQA 2FSIA 2ZETA 3CPEA 4GP7A 3PENA 4HLUC 1E2NA 3UDXA 2NZHA 4RKFA 1NNEA 1SHKA 3F3YA 4LV5B 2JE6I 1EX7A 3UWOA 1VTKA 2NGRA 4TSFA 1L4UA 3R9IA 2Q8IB 1VYTA 1IXRA 4BFUA 2WAXA 2ZI4A 3QNUA 5AJ3Q 3NBHB 3LBHA 2FFHA 2ZI5A 4X66Q 1KI2A 2VO1A 3GLHB 1NBMD 2VQEL 4LBZA 5HKKA 3B1YA 3K80C 4XVQA 4Q01A 3AEVA 3ZJYC 3LRPA 1KMHA 1HCZA 4XD7D 3CPFA 2QT1A 1IYJB 4ZCLA 4PMWA 4IO9A 2ZSAA 2X2EA 4GKKQ 4PZYA 1PH1A 4XSGA 2CXXA 2WJVA 3RS0A 1XBTA 1S3OA 2FXQA 4L5SA 1P9RA 2W2TA 3AEZA 4FCTA 3T06B 1R10A 1Z5ZA 1VDZA 4IEEA 2F55A 2QP4A 1H8HA 3F1ZA 3B9QA 1GM5A 1FNNA 2ZT9C 1QHHB 1YZKA 5G3YA 5IK2A 3AFPA 1XRJA 2J59A 1XPOA 3QUSA 1UFQA 1VQCA 4NYMR 3A7AB 1ONBA 1OH8A 1KYIA 1RRGA 4DAMA 1LABA 4OQXA 1M1YE 1S4QA 2L5TA 1RFLA 1X1SA 4KLNA 1A1VA 4GOPA 1Y8OB 3UPUA 1I6VC 3V4RA 4ZI2A 1T0HB 2ECKA 4YHHQ 1BMFA 3GJ8A 1A2BA 1S9HA 1ZAKA 2R7ZG 4II7A 3SYLA 2WWYA 1Z06A 1IQPA 3DL0A 4JLMA 2MSCB 4JJKA 3RSOA 3I73A 4JI6Q 1XTJA 3LDAA 3U61B 1V9PA 4W5HA 4ON9A 1IYUA 4UNSA 2EYUA 2ZRMA 1DADA 2JA8H 1GG2A 2EQSA 1QHNA 3AUYA 3HR8A 3MWJA 4EQ5A 4NXMQ 4POGA 5ANRB 3SZRA 2F9MA 1EK0A 3D31A 1DG3A 1N6KA 4A2PA 1Q46A 2CWAA 2QP3A 3BAFA 5B58C 4JI2L 1ZIOA 4A3BG 1ZU4A 3BC1A 3Q7PA 4PHFA 4MDFA 2ZXUA 2UUBL 3A1TA 4ZCMA 2FFAA 1HNXQ 1E2HA 3ETLA 3TK1A 3W3AA 3CCLA 2Q9CA 1HA3A 4DPGA 2VP4A 1OKKD 1RZ3A 4A8JC 1TU2B 1YNNC 4KHPL 2Q2TA 2HT1A 4DV3Q 2OWOA 3W6PA 4MRVA 5IP9G 3L43A 3NXSA 4PC1A 1HR0W 2WBLC 5HE8A 4YQFA 1RC8A 1G5PA 4C3JH 4WXRA 2O8BA 1Y1VH 1UEJA 3HGBA 3LW7A 5LMNQ 3CD6A 4DHEA 4OL0A 4JL5A 1Q12A 2QPAA 5DH9A 1TTTA 3RLFA 3OFNA 1NLZA 4WAUA 1G8GA 2ASEA 3BH6A 1ZM4A 2GCPA 4XSHA 1QVFA 5FTMA 3S17H 2C96A 2YWEA 4J0QA 3RS7A 4HDQB 3RDPA 4HB0A 2VW9A 2PQAA 2O52A 4MKHA 3NENA 2WPDD 4LHZA 3EPLA 2Z4RA 1P62B 1TL7C 1G16A 1YZ6A 1NF3A 2H17A 4LJ4A 1TEVA 2VSOA 4EDHA 1GDDA 2CEAA 4IOJA 5C2JB 2PCFB 2NO0A 4EUNA 1HT2E 1NVVQ 4U02A 5JHGB 3L2PA 2ERXA 3UK6A 2BVNA 2BH2A 1HNWL 4KI0A 1T5LA 5KNBA 1CKMA 3FMPB 4NH0A 1YZNA 3IO5A 4JI7L 5CLQA 5CYPA 1ZYUA 1M1KC 2MQHA 2Q3MA 1G9XA 3A5UA 1G8HA 2AKAB 4NCHA 4DLUA 2V6JA 5L3QB 2QSZA 5DN6D 3GLIA 3GD7A 3T1HL 2K5VA 1Z28A 2Y8EA 2WKRA 5BW8A 4NHOA 2WWWA 3AVOA 1OFHA 3I5YA 4KKTA 2X1VA 3HPRA 4DV4L 1TWCH 4Q48A 2DHRA 2O5JC 5FPYA 2ZE7A 3S1AB 5AJZA 3HYTA 3AVXA 1BKBA 4IDPA 4P74A 5J5CA 3G82C 2NVTH 4TL6A 4A3DG 1LFDB 3EZ7A 4XIGS 5JECA 1UWVA 5GAEC 1U90A 4GMXA 3G4SA 3X1YA 4RVCA 1GHKA 1GRQA 1S96A 2F7SA 2LWIA 1FX0B 2WJYA 3IQWA 3NKVA 4HDOB 5HCNA 4Z1MA 4AG5A 721PA 3A7LA 4A36A 2B6HA 4HAYA 1GKUB 1Z63A 1E9DA 1VHTA 4K46A 1KHTA 5G41A 3QPVA 4DR3L 2WJGA 4TL8A 5IP7H 3K0AB 4MITA 5KYKA 4QGFA 5L8VA 3MXNB 521PA 4BFSA 2FFQA 2O8CA 4FMCB 4WXPA 2CFMA 3MJHA 1P60A 2LSSA 1KI9A 5M3FH 2YZ2A 4HIOA 2A6EC 3U4ZA 4LW1A 1R5OA 2A2ZA 2GTPA 2OG2A 4M53A 4Q19A 5G53C 3I55A 2R8RA 2Z4SA 2JJ1D 1E2QA 3SC3A 3EBEA 3B6EA 2HYIC 1HTWA 3HOWG 4NKRA 2G83A 1E2FA 2ZS9A 3EWAA 3NH6A 1AGPA 4EFLA 4YMWA 3DO6A 4MYCA 4A82A 1ZP6A 2LMCB 4YY3Q 2HF9A 8OHMA 3K81C 4MQBA 2C35B 2OAP1 1GNRA 3B13B 1G18A 4GI7A 4JI5L 5C3EH 4WIAA 4P4SB 2J0UB 4RSGA 5AJYA 2UUAL 3MJRA 3MSXA 4IJMA 3SS8A 3ZQJA 1R7RA 4US1R 1Q44A 1Y69U 3H3VH 2C98A 2VP0A 1ZMXA 2OAQ1 4D4JA 1G5RA 3WY9A 4IHQA 3D4RA 3ZVMA 5HY6A 1KK3A 1Q81C 3RSLA 2BOVA 5C44G 4UKDA 3HOVH 2BKEA 2QP9X 4YONB 4C0HA 5KO2A 2FEOA 2X77A 3CX6A 2DNCA 1E9EA 3RZDH 4EIWA 1U94A 5F2EA 1IZ6A 2BE5D 1XXHB 4JL6A 3DZ8A 1YIJA 3DKVA 4AY2A 2K4KA 2ZU6A 4QNMA 1D5CA 3UWKA 3K9NA 3HU2A 2VZAA 3VA7A 2JA9A 1T8TA 4P73A 3ND8A 1QUQB 2HDNB 3QXJA 5CLLA 4YC7A 5SZIA 4QJFA 2YWGA 2YWFA 3ICQB 3GTMH 2CVHA 3SJAA 4FW9A 2FFBA 5C4GB 3U3JA 2E2JH 2GZAA 2A78A 4C7OA 2MO1A 2BH8A 1P75A 2A5YB 5M5XH 1IL2A 1A4RA 1I4TD 3L0SA 4H1VA 1Z22A 4M1SA 4MRPA 4MYTA 4OBEA 4F7WA 2KJQA 1OJLA 2ZJZA 4OI2A 4QBHA 4W9MC 3I62A 1CULC 1KZGB 2YOGA 3EIHA 5GJWC 3UG6A 3JC66 4DZZA 4US0R 1IY0A 4A3MH 2P6UA 3FHTA 3PV0A 1E1QA 1N5KA 2RGXA 2ES2A 4EPTA 5KSYA 4AH6A 3Q5DA 3I4NG 4JYAL 3V4FA 4ALPA 2P65A 4KHZA 5IY0A 1R4AA 3VR5A 3TVDA 4DT1A 4R71A 5BQ5A 2RGEA 1ZJ6A 3W5JA 1US8B 3C41J 3LVQE 4IVRA 1IXSB 3TQCA 5JWOA 2X8AA 4IOKA 1AKYA 2IY5B 4TLBA 2IS6A 221PA 2KBEA 1HH4A 4LUVA 1W2GA 4ACAA 1JECA 2JCSA 2Y0SE 3EN2A 4LF8Q 1A62A 1ZU5A 4PX9A 2P5TB 5EXSA 4ARZB 1AS3A 2VH5R 2AWNA 4PQYA 3WYGA 5JCZA 2PEYA 1AE2A 1NJGA 4HI0E 3AVWA 2F6RA 1LACA 3AKCA 4V03A 4DK1A 2AMCB 2ZU0C 2UUBQ 1QHXA 1BKDR 5BYKA 1CJVC 4DDWA 2ZI9A 3OTOL 2HYDA 2O5VA 4JLKA 1GUOA 2BMEA 4KHPQ 3QKUA 4CGZA 1PFSA 5J3BA 1MR3F 4PAQA 2ZSEA 1BH2A 1G1MA 4HUQB 1TKWB 3BB3A 5CIWA 3KF6B 2NN6I 1U8ZA 4POAA 1XWIA 4BQSA 1J90A 1JNYA 2ID0A 1HY3A 1UE6A 3ERSX 4YWMA 1G3QA 1R0XA 1AGRA 2E9SA 3IDQA 4YDHB 3SU8A 3AFQA 2VUMH 2PZFA 3WYAA 4J15A 4JYBA 4PXAA 1PJRA 3E9IA 1E32A 2A68C 4QL5A 1M6NA 3Q72A 4PC7A 1UAAA 1YR9A 4DV6L 1LF5A 1K5DA 1MRSA 2UKDA 3SBDA 2ZITA 1PLLA 4KLZA 2O8FB 4PPNA 4RCZA 2ZJRA 1R8SA 2CHGA 3ZLJA 2JLXA 3PIPA 2R62A 4BECA 4DLSA 2AKWB 2XZPA 1S40A 5KDDA 3QF4B 3L7ZC 2RGDA 1FZQA 2EXDA 2VQFL 2PH1A 4JCVE 2JA7H 1E79A 2YOFA 1OE0A 1Z2CA 2QAGA 1Q7YC 5AJVB 4OWTB 5JI2E 2ZJPA 2QMEA 3CX8A 2B3GA 4HAUA 2JA8G 1P3JA 1MH1A 2Z5FA 1FPMA 2JLRA 4JL8A 3A4MA 3BFXA 5BN4A 4JSYA 4LF7L 2IT1A 2AFHE 1VQOA 4CEIB 4Q1AA 2D4HA 4FMCF 4XWKA 3OIVA 2CVFA 4JI0Q 3ULJA 2IHFA 2DUDA 1HNWQ 2BMFA 4LSGA 3P20A 5EUQB 4ERNA 5A5GA 2A6HD 4ESVA 2PCJA 2HIVA 4B3SQ 4JI7Q 3ONWA 2QGZA 4OKSA 4PC6A 1BOFA 1SXJE 2ANCA 3EWSA 1VQMA 3T1HQ 5C0XJ 1SKYE 1CJKC 3UANA 3FP9A 4CRWB 4LK1C 1G64A 1BIFA 2NN6H 4A4DA 4Q1DA 4DV4Q 1E1RD 2C5LA 2D5DA 1XTRA 1D2EA 1P4SA 3BFVA 3L82B 2ZJBA 4ZV4A 1E24A 3FKSD 2DWPA 1IJFA 3O8CA 1Y1VG 3ZQ6A 1PYBA 3B85A 3M85A 2IYYA 3NEJA 1FNMA 1N5IA 3PQCA 3OEHD 5BN5A 4Q9IA 5AJXA 2G6BA 4KN7C 1ZM7A 4LFBL 3S14H 1JQJC 1OFUX 2HLDA 3H4MA 1J8MF 3KTAB 3N2IA 2KA7A 2YTVA 4JYCA 3V9PA 1M7BA 4DC9A 2RF4A 2W2XA 1VKJA 1Z83A 4A3JH 2EDGA 1NVVR 2WWGA 1FX0A 2ZRCA 3WBKA 1M74A 1L2TA 4LBWA 4RFVA 1U8YA 4DR3Q 1QG2A 2F1IA 2J9RA 1VCNA 4A3FH 2KI5A 2B8TA 2OXCA 3A74A 3BH7A 3CNOA 3FHOA 3A8IE 4PPGA 3D6TB 1N6LA 4DKAC 4A1FA 4BFVA 4BLOA 1PH8A 5AR1A 4HJ7A 4B48A 1E0AA 2JXMB 1NKTA 3ASYA 3FFAA 4A92A 4Y7NH 4GNXB 5FBRB 1M7HA 3GEEA 1N6OA 1XEXA 5KHOC 1SFOH 1GVPA 1JB7A 3TR5A 3K9LA 2G88A 3KUDA 4LYJA 1KI8A 4OYHA 4YLGA 3V00A 3W1GA 1GP2A 3X1DA 1Y3AA 4O0MA 3DVLA 1UBFA 1ZRHA 4Q21A 3IKJA 1TNDA 3AB9A 3WYFA 3CCRA 4JI8L 1JPNA 1A82A 3L0PA 1ZM9A 1OFTA 4BLSA 2IYXA 3MGCA 1X65A 4R4IA 2MMGA 1TQ4A 2XSZD 3EARA 5FOSA 2D06A 2IXGA 3OF5A 1KRSA 3LD9A 2JLYA 1WXQA 4BLRA 5D3MA 4JI5Q 3R9WA 4FMBB 5CJPA 2UUAQ 4CEJA 4CEHB 1HZAA 1SMYC 3A8JE 4A3CH 1QF9A 4E09A 4JK1C 4EQ6B 4DR7L 4BFWA 1ZD9A 3PSIA 2ZYWX 1X8LA 1Z47A 1YZLA 4GBMA 4A3EG 1AH9A 4JV5Q 4BFZA 1E99A 4V0OA 5TV2A 5FH9A 4LUZA 4OWWB 1BBUA 2HEIA 3BGWA 3U44A 2CJWB 2DFKB 3AUXA 3ZDQA 1IW7D 4G1UC 4LF4L 4KVAA 3C14C 5B2ZA 5JSZB 1T5IA 1CTMA 2QSYA 1AJEA 1NVUQ 3NTUA 3FPPA 1G6OA 5K8LA 1X1RA 4LHXA 1KK1A 2K33A 3ZD7A 4MGKR 1W4CA 3HWSA 4IRUB 1IOZA 3CRW1 4EJSA 5M3FG 2D0PA 1DAHA 1BO6A 2R65A 1FJGL 5DGXA 4KFUA 5JWRA 2ZTEA 4DRZA 3ZIAD 1O3YA 1F2TA 4LHVA 1SVLA 1OH5A 2WICA 4AK9A 4HAVA 2Z83A 2BMDA 3IQXA 2WKQA 4JSTA 2IEZA 1UKVY 4TLAA 4C0QC 1P8LA 3B1VA 1H9RA 4OGQC 2IXFA 3RANA 3U9SA 2P2LA 1R9TH 5KOYA 5CK4A 2GNOA 3MMPA 1G3UA 3W6NA 2MFIA 3R9XA 1QJOA 3NVAA 1W47A 2BDOA 2UVQA 3EZ6A 3QVUA 3MFYA 1DTSA 2EU8A 1SXJD 5FOWA 4PSVA 4EAQA 3R8FA 5BXQC 2ZRDA 3OAAA 2FG5A 2N49A 2C03A 3TGPA 5C3EG 1YQTA 3STBC 1EOVA 1U0JA 1UKEA 3U4QA 3WP0A 1S1MA 1Q20A 2C9YA 1CR2A 3TSZA 1JEDA 5A0FA 5FTNA 4I81A 4ZCIA 3TKLA 5CB6A 4ZDJA 3ASZA 2IYWA 5JFGA 1U9IC 3CF0A 1NJFA 1XF9A 4A0FA 3U3KA 1HURA 5L3RA 1XPUA 4K81B 3HOVG 3RWOA 4JVLA 2R6GA 4IXMA 2FZLA 5EXXA 4CIDA 5M3MH 1Z29A 2FZ4A 1LY1A 3E0EA 3GMTA 5FUYA 4B32A 1BYUA 1VYUA 2H7VA 4N1AA 1IY2A 5M5WH 4OO1I 1D6JA 3MUFA 4V0MA 4A9AA 2B8WA 4B76A 5IHPA 1NN5A 1K9MC 3OTOQ 3T15A 4IPDA 5KTYA 1SR3A 2P3SA 3IEUA 1JXMA 4IFBA 3DM9B 1H8EA 2YJTD 3QKSA 2DCUA 2GWHA 3PEYA 2A7QA 1OH6A 2IL1A 1A8VA 4JLBA 4U00A 2NPIA 3M4QA 1PH7A 2YC2C 4GZMA 4HUQA 4P72A 4DLRA 1EQRA 4WVFA 1H9MA 2HT6A 1KKMA 5DO9A 1JAIA 4FMDB 4PZZA 5DI3A 2IYQA 3KOJA 2GEDA 4TTPA 3ZH9B 4A3MG 4H13C 3H0KA 1N2CE 4DV6Q 1ZCBA 3U7GA 1HT1E 3H86A 2PLRA 3L8YA 3X1XA 1CKOA 1GUSA 4JKIA 4PTLA 4QHSA 1OIVA 2ZTCA 1DCZA 3S24A 5JJIA 2AFIE 2OFXA 4IDHA 1QZHA 5FPTA 3GEHA 4TMWA 3T51B 4B2IA 1DEKA 1OHHA 4ZIRB 3VNUA 2IS2A 3PEUA 2RHMA 4N3NA 1FTNA 1JALA 2IYVA 4DR5L 1Q57A 2H5EA 3UATA 4XVUA 5DLQE 1TWGH 3GJ3A 3QF4A 3UDGA 1G7RA 3K8YA 4E03A 5FTJA 4DUYL 2BEKA 3MWYW 1P72A 2GCOA 2UXDL 3QXHA 2J0VA 4PPFA 5IYDH 4GT1A 1AZSC 4NYIQ 2C99A 2QN6A 3L0IB 3P4YA 3KKNA 4YCVA 1H65A 4QGAA 2AWOA 3W9YA 4FWTA 1WCV1 1IBKL 1LVGA 4OO1H 2ONKA 4GFDA 5HCIA 3AQ4A 4D0NA 4P32A 4BA2I 2ZR0A 3DDCA 1U8AA 2QL6A 4OHXA 4B3CA 5HZHA 4RMFA 1QVRA 4DR1L 1L1OB 3F5FA 1Y1WH 4HJ8A 4WW0A 3WHLA 3PUVA 4YCUA 1D2MA 4F4CA 1OXTA 3FB4A 1GHJA 1N5JA 3WMGA 1TEXA 1B7YB 3JVUA 1Q1BA 1GL9B 3LNNA 1EQQA 2YC4C 2A69D 4BGDA 4X64Q 1NRJB 4O2RA 5JEAJ 5J4KA 4I99A 1X3SA 5J4YA 1XD2B 2VUMG 3R20A 1X8KA 1W0JA 1C0AA 1MO6A 1DAEA 2MO0A 4NXNL 1L7VC 3UE0A 1UBGA 1VECA 2FOLA 4LFBQ 3CRQA 4RD2A 4TLEA 4DSTA 2WTUA 1YZTA 1E9FA 4HLUA 1PH4A 4JI1Q 4JS0A 1P16A 4G3XA 3RABA 1PHJA 2HCJB 1G20E 1GKIA 2VF8A 4DSOA 3I4MG 1G7SA 1II0A 3S1QH 1UPTA 2QF7A 2F4VL 2EJMA 2E74C 3U6BA 1TMKA 3UDIA 2N3SA 1UDXA 1XJQA 5EAYA 2B21A 2KE5A 3VU9A 2GKSA 5DHAA 2XITA 4OXPA 4XTRA 1TQ2A 1K0RA 4JOIC 1NN1A 3T1QA 4TLDA 5KSPA 3HKSA 3ZJYA 1VG9B 4BWYA 4NDZA 1P2UA 4D80A 3B7GA 2YINC 4C4PA 2GAOA 2C04A 4RCYA 3T5GA 1AM4D 3KQLA 3BD9A 3SQWA 2DYKA 1CFMA 3HU3A 1B23P 2QRNA 1XMOL 1J7KA 4DSUA 3FVQA 4JI8Q 3U3OA 1ETUA 2N42A 2IYTA 5D3QA 2GK6A 1Q3TA 4G5OA 2F1MA 2E5LQ 3AVPA 3FMIA 1KI6B 2H8KA 3KKQA 2NN6G 3A1SA 1FMLA 3TLXA 3Q5EA 3MCAA 1G6PA 3RNLA 3PCRB 1RIPA 2PX3A 3PO3H 1KRTA 2K52A 1K8OA 1D7QA 3BORA 3THYA 1TADA 4C2MH 4KMUC 1R6BX 3FE2A 4Y0VA 4JLDA 4TZ6A 4A6XA 4A3IG 2DNEA 1J5EL 4DR7Q 1NVWQ 1GJXA 4O0AA 1HYQA 1MV5A 3AB3A 4EQ6A 2CK3A 2O8DB 3GLFA 4OHWA 5HTKA 2WAQE 1YKSA 2ZRKA 4B3XA 2IWHA 3G71A 4EKDA 5FPKA 4A3JG 5JCPA 4DEYA 4LF4Q 4HZUA 1F2UB 3MWKA 4EPWA 4KITB 2GN5A 1YBYA 1DGSA 4A3FG 4QHTA 3R7WB 3EIEA 2E8GA 4V0ME 3UIEA 3BU2A 2G3YA 3K0EA 4D26A 4Q1BA 1B0UA 1WF3A 1E9CA 4LF6L 2W6JD 3B8HA 3FGNA 2PMDA 2J3EA 1Z0JA 2F3RA 3LFUA 4A93H 4C3ZA 4RZXA 3VFDA 5HGQA 2W6ID 3LW8A 3ADKA 4LPSA 3EIQA 1CSQA 2BA0A 2QTVB 3I61A 3S16H 4H0LC 4PV1C 4A8JA 2EWWA 3MG9A 3FFBA 1EFRD 4A0GA 4HAWA 2XOKA 1VQNA 4DNIA 5TB5A 2ZAMA 5K8UA 3M4PA 2B63H 2UXBL 2VP5A 4Q4HB 5EXTA 3VR3A 3DOFA 4FMDF 4C0BA 2AUKA 2J7KA 4ZPXA 3W34A 4LNQA 2ERYA 3KJEA 1J2JA 3SOPA 3I7FA 2R6AA 3QIAA 3IGFA 4A3CG 1KTVA 4APVA 1WRBA 2CL0X 3CBQA 4GNXC 1W1WA 3I1FA 1KZ7B 3G0HA 3PGZA 1KOFA 2WWHA 4ZKDA 1SVKA 1KK2A 4B33A 3AH8A 1R0YA 1F48A 4LDJA 1NP6A 4DLZA 2AR7A 2D3WA 2H57A 2Q2IA 1G4AE 4OWXB 2Z6VA 3AP3A 1EWQA 3WRYC 1V8QA 3S1MH 2BIFA 1TQDA 4IFDI 1NG9A 2NMVA 3AF4A 4B47A 4M1YA 4Q1CA 1ZD8A 4H1UA 3T1YL 3EW9A 2YHSA 3U3RA 1FL9A 4IOLA 4KFSA 3AF1A 2C8VA 2AN9A 2FH5B 4DLXA 5EZ5A 4R4TA 4XOIA 3PG5A 4TYPA 5JJKA 3QXCA 4JMPA 5CM9C 1PMRA 2LXKA 5DNYB 4JG2A 5SZKB 1M8PA 1TWAH 2QORA 4TL7A 4JI3L 4FN5A 4KKSA 5FBWB 4TZ0A 2G77B 2BE5C 3TBKA 2IUUA 1ODFA 2SHKA 3WNBA 1W0KD 2EFDB 4URXR 2GZHA 3ZZTA 3CRKC 2OBLA 3QKRA 1XTKA 4QHYA 1AA9A 1W4RA 4LFAL 1Z0IA 3NDBB 1KSJA 2QPTA
chains in the Genus database with same CATH superfamily
3MELA 1SKAA 1PTOD 3KKMA 1AGYA 1GTZA 2J0SA 5CHYA 3DCIA 1YFLA 4IXNA 3WSWA 2I7XA 4R2HA 6Q21A 4X00A 1S3GA 2RHSB 3DXJC 4OYYA 3RZOH 3S17B 3E9ZA 2WU4A 4FKMA 2FW0A 1HYHA 1YL5A 3K9GA 1LU9A 4WKNA 1R8XA 4KJZA 4KMOA 5EP4A 1VGQA 4IOAA 3NIGB 4N0PA 1NR4A 5EOVA 1EH5A 1ST2A 5H3CA 4EY5A 4WFN3 1Y1RA 2HXYA 5B1IA 4ZICA 4DK3C 5A3QA 2JGEA 2TS1A 3RVPA 3J7YW 5SYAA 2RHOA 5CVJA 2NU6B 4G0YA 1TUGA 1RHJA 3SK5A 2CXQA 1DJMA 2OO3A 1ONNA 5IN4A 3FM9A 3EEYA 4GAEA 3VX3A 1QS0A 1EA7A 3WA7A 3T6KA 1MN6A 1ZSYA 4CE6A 3AEKA 5CV5A 4QQBX 5FXMA 3WK4A 3AWIA 2X1LA 4RYLA 1JZTA 4MR9A 1SGWA 4DAYB 4ZAZA 3S1NH 1DSSG 3HUDA 3PRHA 2AKYA 3EK2A 1DAKA 2AG5A 4YMUA 2XWJB 3H87A 2YYZA 1TB4A 2ZBRA 3IELA 4O2LA 5A5DA 4X90A 3AKEA 2ZUEA 3LGXA 4FNMA 4GLJA 4AZSA 1Q0ZA 1NJ5A 5ELOA 2R4QA 3NJ4A 4FUQA 3B3JA 1RCFA 1TTPB 1Q2UA 2V7WA 2L55A 3QVTA 3BZDB 2WLTA 1CNEA 3LA8A 3WBBA 5FL7A 3EPHA 2H3EA 1U4RA 1BC5A 3T4PA 1KEVA 3FMVA 4WSOA 3F2UA 2EQ5A 4OH7A 1LLDA 3QUQA 4HWTA 1XDUA 3WOFA 4XUEA 3IOMA 3LWZA 2WFLA 1JORA 1PUIA 4LWPA 3S7ZA 2JLVA 4CCYA 2EIXA 1OB2A 3DMHA 5AIBA 2ZYTX 1ZW1A 3HY3A 3NELA 4DC0A 2IOQA 1UZUA 1J4AA 3UGJA 2EZTA 3IIMA 3T0IA 5IUNC 4CMBA 4AYXA 4BV3A 1DBRA 4FFBA 1SHLA 5JNWA 2RQXA 1N0WA 2YCLA 2C7PA 3EA0A 4MV3A 1JEOA 3AR4A 4GZYC 1AUOA 5CDFA 4B2PA 2ASBA 1PH9A 1KLUD 2WWXA 3R0QA 3GTPH 1TZJA 2ZTSA 1LZKA 4QG3A 4O8CA 2WYVA 3PGA1 2JJQA 3DUFA 2IHJA 5TXGA 2O4CA 3LRTA 3AKDA 1YNXA 1KQSA 4EW3A 2IHKA 1EIHA 4Y7NB 2IS4A 1GOZA 1V3TA 3KC2A 5HVNA 4E5NA 1IEVA 3RKUA 1TLTA 2BR4A 1CP3A 4X8MA 4JLVA 4OB8A 1DE0A 3QKTA 2YJNA 1L7DA 3PGJA 3KZOA 2A1UA 1E8DA 3GCWA 4JEUA 1IZ9A 1M2FA 1SMKA 1YRBA 2QG6A 4QM6A 3CCJA 1EG7A 1SE2A 1UR5A 4RTPA 2P4UA 3JQAA 4K6CA 1WTOA 4PR3A 1OAKA 2BTQA 5C3UA 2DERA 3J81A 1T6NA 2KBNA 4EGJA 1C3EA 4UDNA 4C29A 1OFUA 1TZ2A 1JWLA 4XQ0A 2PSJA 1GYQA 4AKEA 1U4OA 1MTOA 2YXNA 4G01B 3RRNA 3OMWA 1SIWA 2OWEA 3MCUA 3NWSA 2FQWA 3N76A 1KIXA 4W4TA 2UXCB 3P9PA 4MUMA 3FNRA 3LZDA 4MW5A 1CQFA 4RD4A 4J07A 4X6XA 4WLFA 1ITZA 1LTQA 3OEYA 1Z7WA 3GFTA 2GBLC 4DLVA 3GRYA 1DRUA 2ACVA 2HK6A 1CB7A 3OO0A 3ENKA 1PR4A 1KQFA 3PDWA 3LT0A 1ZEJA 3TS2A 2F3VA 2RJ3A 2CDBA 4IPCA 5KOHA 5LMNL 3JQRA 4UY8C 1IYVA 1YI1A 1NE7A 2RGCA 1EWCA 2PIAA 4AF8A 2GARA 1XXHE 4M46A 3S1QB 1PQPA 4HX2A 1E79D 3ZTYA 4UOQA 2Q4BA 1EQUA 5B30A 4GNXA 2OQ2A 1OO9B 2PFKA 4I7ZC 3FSEA 3GDWA 3UKOA 1O9GA 4PYQA 1G7TA 3U48A 2C4KA 4HNHA 5TIIA 3IAS1 4R8IA 3AUSA 4LYFA 2AG8A 5DP2A 4UNNA 1QRUA 4KACA 4I66A 3Q3CA 1TUIA 4W6QA 2IV3A 2B7BA 3IAM1 2OLEA 3DZDA 2H16A 5BR8B 2BY4A 3TP7A 2AFHB 3FIUA 5AW8A 1N5MA 1T0IA 4CLOB 4NG5A 1W5SA 1J8IA 1HE1C 2B63B 4DF3A 1L8XA 2B92A 3CB2A 4JC0A 2O48X 5E9JA 1KS9A 1KYTA 4OFXA 3AFMA 1KP2A 1QX3A 4LDQA 4ZI7B 1XAJA 5DNAA 3NEPX 2ID9A 2JBAB 2B1RA 1EYGA 2ICAA 4HFRA 4K8OA 1E2KA 1L5RA 2K5DA 4TKLA 4NAUA 4PNZA 3TNDA 1RC1A 1OREA 1PX2A 3MIZA 1RDPD 4LF9L 3CKMA 1SC1A 4X7PA 5B7QA 5D3IB 3SZLA 1N7HA 1ZZEA 1SCNE 4LXGA 3BQMB 5LL6X 4CFSA 1NRIA 2WY2D 3VNRA 3JWPA 4LTNA 2H2WA 4GMGA 2RD2A 3JS5A 4GH5A 3E0QA 1GY8A 5F7OA 2V7TA 1XDWA 4RE5A 4G5RA 1YE8A 5JJZA 3ZJ4A 3U1VA 4X7RA 5HPYB 2ZRPA 3FKSA 3QLUA 3TCKA 2RGYA 2QG4A 1C30A 1P1FA 4PCVA 1P2TA 3ZHBA 2R93G 4LMAA 2B2TC 3K7UC 2OCDA 4MWGA 4RHRA 4QPNA 2UUCL 1H4VB 5JJLA 3IP3A 3JQ7A 5E4WC 3EGIA 3LDGA 5LHY1 3GGGA 2FPIB 2ZAOA 5E7JA 1E2PA 3CC8A 2MHCA 3CNNA 4YJKA 4MW0A 3QVKA 2OD9A 4BBRB 4B3SL 4K0KL 3SHQA 1ORRA 2BMJA 4JP8A 2JEBI 3FDFA 1KI6A 2WD8A 3R5KA 1Q5PA 5CB0A 4PLWA 1KOLA 1S3FA 3I92A 2GT1A 4MRSA 1O57A 4MJ7A 4I55F 5J5VA 1FFYA 4K87A 4U6QA 5J58A 2CCGA 1RAGA 1SBTA 3UDFA 1ZUD1 4OF4A 4YXFA 1ND6A 1M5RA 2QIOA 2AXPA 3WB1A 3ODPA 4N5IX 5ALTA 3TH5A 4N9QA 1NR1A 2P0EA 2PBZA 2QTVA 1AHHA 1ZVMA 1DYQA 1ESNA 5CLJA 4TMVA 2FPRA 1XTDA 1QYRA 2I6UA 4BVGA 3UMGA 3W1EA 3QSGA 5HNKA 2G1AA 2NSJA 3CC7A 4V39A 4NOJA 5AVKA 1S1CA 2CL5A 4LDRA 1N57A 3QJGA 2Q49A 3O8OA 1GT91 1YB4A 4F91B 4GZ3A 3BWDD 4TV8B 4IIJF 3PWSA 2VTBB 2R79A 1MLDA 1W49A 1UC8A 3VU8A 2AZMA 4KNWA 4DE5A 2ZCUA 5C4XB 4QWMA 3E3AA 2FP4B 3TNFA 1R64A 4DJAA 3TG8A 3BWBA 3K1YA 4FZJA 1V5WA 1I2CA 2CBZA 1TO1E 5EE5B 3L5KA 3JAMA 2NYUA 1RE1A 3UAGA 1M8GA 1SFRA 4IIHA 2F3IA 3D3WB 3G5AA 3H4VA 4ZT5A 4U68A 2P3LA 3VSDA 3C2QA 4HLCA 4FNOA 3N8NA 1C8BA 3NWPA 1PT5A 1VXRA 1V1JA 4OU4A 1VA4A 3DLCA 1BXGA 2X5NA 3F49S 2Q4TA 1DIOB 4N47A 1N2XA 2D6FA 2D0OA 3NO4A 3GQVA 2A5DA 1IH8A 1GOTA 3EB9A 5COYA 3GEGA 4GNRA 2XUDA 3QW4B 2HADA 5DF1A 1ZD5A 1QTQA 4E22A 4M9SA 4UMVA 4JBGA 4PIPA 4NONA 2PLAA 1L0WA 4TVBA 2F90A 2A88A 1ORHA 2XI4A 1FYFA 2VKTA 1YIAA 4K8RB 5L9AA 4RPGA 3NKLA 2UUOA 1CEEA 4P71A 4AN4A 2GSWA 3CISA 3LUDA 2D00A 821PA 4GN4B 1GITA 3ACCA 3KQSA 3LCRA 4DAPA 4YRLA 2JGDA 3EXHC 3GLFB 5IYCG 3KKLA 1NP7A 2WYWA 2G9RA 3K4QA 4GRDA 4R31A 1G3IA 3UMCA 3UWOA 2OWDA 2MINB 2LD4A 1Z8NA 3N8KA 1J23A 5FLYA 1QTIA 4E2ZA 1A2OA 3DPIA 4CM5A 1JZSA 2QM8A 1THMA 1T2DA 3OIUA 4TTVA 2K7VA 3ZHCA 1E9AA 2ORWA 1S4MA 1C7JA 3BFKA 2PKWA 1RQ7A 2DUWA 4BLUA 1XQ1A 3W90A 3KLOA 2WB1G 3KR0A 5CU7A 1H3FA 3NAGA 3LVBA 1T0UA 3M6AA 4IDNA 4M1WA 3Q3GE 2BF7A 1K6MA 1XQWA 2IEYA 2VJBA 1LNQA 1H0SA 3H0EA 2O7QA 3OUUA 1ZCZA 1AHIA 3OP4A 4LTMA 1WKCA 1R0WA 2ISCA 4ENWA 3OPYB 2PMBA 1VE9A 4BRWA 1J1UA 3ZU3A 3Q0TA 3DKPA 4DDUA 4FHEA 3QOJA 3DBLA 3LPNA 3R2JA 1XFAA 2V55B 2GR9A 1TYBE 1HMPA 1ZN7A 1PR6A 4HT3B 2E2HB 3VHXA 1EGVB 5EJ2A 2ONJA 1YZHA 3GQBB 4IINA 2AOUA 3MWEA 3C46A 4KR2A 4C4TA 2Q6IA 3K30A 1NZDA 2OBMA 1A27A 2FPPA 1S6YA 2WKDA 2L0XA 5EMHA 4B4WA 3L4KA 1A8HA 3VO8A 4AZ3A 2CJFA 2VYNA 2V5VA 3TLEA 1LLCA 2ZTLA 1QLJA 2X5KO 1Y8ZA 1RHMA 2VPPA 3HB1A 4MP6A 1J00A 4MHEA 2L15A 1LA2A 2FMXA 2BN4A 1K28A 3N28A 4XWOA 4IZIA 4C3IB 3MB5A 3T34A 4CM3A 5KTPA 2D2EA 2XCOA 2P8SA 1SNCA 4KK4A 1GPMA 5CV8A 4LZZA 1ZMBA 3I4CA 2XGSA 3FKJA 5DYTA 5CBPA 2PZBA 1FSPA 4G1FA 4O59O 4YALA 3FDXA 3ZCSA 5JJCA 4LIPD 1DFIA 1EX7A 3R9IA 5IARA 3DPSA 1QKKA 4MVJH 4X66Q 3CKYA 1BE8A 4IO9A 1CIVA 2QAIA 2ZTMA 1VDZA 1RTTA 3QHPA 2F55A 2NYRA 3E4DA 1XPOA 1QR6A 2EYHA 1RRGA 2QW0X 1X1SA 2JARA 1I6VC 5KYWA 2ECKA 4FFLA 1BMFA 2XLCA 2EIHA 3WGTA 1LI5A 4MICA 1L7MA 1K0FA 3Q8WA 5EHQA 1EFPA 4QDZA 1DADA 2QV0A 3V3TA 1X1TA 4NY1A 1PT9A 2CY0A 1XAGA 3NXSA 4N5LA 5HE8A 1PNRA 2P9GA 3S81A 2JL1A 2GBIA 3OZTA 1V3VA 1KABA 1M2OA 4R2KA 4Y2XA 5K3DA 2JANA 5F12A 2CXRA 2H17A 3ZD9A 4EDHA 2QN1A 2EGHA 1HNWL 4ZT6A 5CYPA 4NH0A 4UBKA 4B31A 1JPUA 3GLRA 2Y68A 1RVV1 1JLRA 5L51A 3S1AB 1TWCH 2UYQA 1MNAA 2H2IA 3PGKA 1ABEA 2AMLA 4J0FA 1TJNA 4UW9A 3ND7A 1ISIA 5EIFA 1A50B 1D2CA 4EMBA 5AVTA 1Y1PA 3K0AB 3NLLA 1GKKA 4BCDA 1FRQA 1X70A 4CM1A 1JG3A 1JLLA 3JQQA 4EL0A 2OG2A 1WNTA 3A0UA 3L6EA 4X3TA 3OIPA 3UCEA 2C35B 1WXFA 2A33A 4CKEB 1XE3A 1YONA 3OCWA 3FWNA 4IUBS 3KJNA 1SUBA 2WM2A 3OZFA 2WQ6A 3EBLA 2BKEA 1AQJA 1E5QA 3R3JA 4KO1S 4BEWA 3U4DA 5SY4A 4P73A 1I6WA 3TP6A 5ILGA 4YGYA 3NK9A 2ZJZA 4BVFA 3K5LA 3UO8B 5FO9B 1TO2E 5C8YF 1NQAO 4RA9B 3V4FA 4ALPA 1SVNA 5HA5A 1L7XA 4RA6A 2A7XA 3H11B 4KQJA 1W87A 3N2ZB 2RHTA 4GIBA 4V03A 1AXGA 4PEVA 2ZU0C 1X1AA 2VQ6A 2ZI9A 4HYQA 1ZXLA 2BCEA 3QKUA 3U37A 1N9GB 2ID0A 4CQMA 1JTEA 1D5XC 1J39A 3WYAA 2IODA 1U9ZA 3A54A 4HX5A 4UVGA 2ZITA 4KLZA 3IIIA 1V9LA 2Y1OA 3F7TA 3D6MA 1KR5A 1GU0A 2G67A 2VJOA 2DUDA 5DM73 5EUQB 5SY9A 4RVUA 2W6QA 4BQNA 3ONWA 4FYIA 3EWSA 4HADA 2EY2A 3N05A 2FWBA 1E1RD 1RBZA 2QJRA 2G4LA 1DX9A 1GFZA 1OYOA 3B85A 1GXSB 4B81A 3H4MA 4YUWA 3IJ5A 2PR2A 2EDGA 1SAYA 2ZRCA 2G40A 2B8TA 3P9RA 1JC7A 3D6TB 4UDOA 3S1RB 3ASYA 3FFAA 4BMXA 3A31A 5IMSA 1TYCA 5FBRB 2G9DA 1KI8A 3VNBA 1ZRHA 4Q3AA 1TNDA 3AB9A 4MX8A 4RPJA 3L0PA 3EARA 2I2BA 3H13A 4JI5Q 3IB6A 4WVLA 4HTHA 4NQRA 3IAXA 3H9UA 5DWDA 3PNMA 3TSYA 3C97A 3B38A 5FH9A 4EA6A 2JP1A 2DFKB 1IW7D 2QSYA 2P9CA 4IRUB 4X97A 2FMMA 1TVMA 1CVLA 1PR5A 3GEDA 3P94A 5IAJA 2WKQA 5CVDA 1MAUA 4TLAA 2HD3A 4ZV7A 2P2LA 2F8LA 2X0RA 1KRWA 2UVQA 4AWBA 1WUKS 3K6OA 3OHSX 2XVXA 1RJGA 1U0JA 4DA0A 2F0NA 5CB6A 4AECA 1NAIA 2VT2A 1JKXA 4MIEA 5FUYA 3JQ9A 1ZN8A 1XXLA 3THRA 2I2WA 1F2ZA 2R1TB 1W5FA 2YJTD 2DCUA 1B14A 1OH6A 5CMLA 4JLBA 4YACA 1PH7A 3CT6A 2OK7A 2RGUA 4YRTA 1GQ2A 5DI3A 3BCHA 4DKJA 3OY2A 1SUCA 4G0QA 4PTLA 4KN5A 1JDVA 1QZHA 5KC9A 1Z2PX 2IYVA 3KR1A 4X1IA 1TM1E 1X13A 3OBBA 3M6IA 5IYDH 3COWA 3KKNA 4IYJA 3CF4A 2AWOA 2QOEA 4OHXA 2QL6A 2VPYA 5TQ0B 2PXCA 4BO7A 2O3TA 5B37A 4F6CA 3KEOA 5CV9A 1B3AA 2PMZB 1N2BA 3R20A 1VECA 3SC4A 3UE0A 4FF4A 2DEUA 3L6RA 3OZDA 1STYA 4ME5A 4DQ0A 5LU9A 3L6UA 2E74C 3WGKA 1KYQA 3BL8A 5DHAA 2VSYA 1AK1A 1P2UA 5CDHA 4KJXA 2GK6A 2E5LQ 1H5UA 1N8NA 3PRJA 4Y8VA 4WT7A 1GADO 4X65B 1FMLA 5GV8A 4UQLA 1D7QA 1CA5A 1HKUA 1OROA 5JBIA 2VUHB 3S2YA 1MV5A 2ZBGA 2RE8A 4TYMA 2WAQE 5HDQA 4JQOA 2WIKA 4YO7A 3PC6A 2GQ0A 5DJ5A 1ILWA 2TSYB 1NLMA 4BB5A 1SU4A 4R2LA 4HAWA 4LRXA 3IUPA 1A5BB 2Q4RA 2R68A 3L1JA 4LNQA 1KOFA 1XV5A 5FADA 2RDGA 4EGVA 1R0YA 3ELDA 2I33A 4XVHA 4WZBB 1HR0B 4HAIA 2WYOA 1LT3D 3K2BA 1N9KA 2A74C 1JXAA 1ZD8A 4AFNA 1UBJS 3C1FA 4YCNA 2LP4Y 4KQEA 5JUWA 1PDVA 1UK7A 2ADOA 3TBKA 1OLXB 1W4RA 2R66A 1NPYA 3ENQA 3PLRA 3KWFA 1LLQA 2WHXA 1RRKA 1JF8A 2H1LA 3KVYA 3HP3A 1NVKA 1VXOA 4NP5A 4KB5A 2YZMA 4WOKA 1E2IA 3KBXA 5AKXA 2JFQA 1FJGB 1Y1VB 2O07A 3V8BA 1QMGA 3T4AC 1T0JB 1CUZA 5FNZA 3HDTA 4LGVA 2ZUWA 4AIMA 1ZN2A 4B3ML 1V1PA 2YU9H 3EDCA 5AW5A 1TZKA 2F4VQ 2VEDA 2E4AA 3EGVA 3SM9A 3VI4B 2WWTA 1XLTA 3LWNA 4HNSA 4ZAYA 3TIVA 2IUSA 2UU9L 1XMOQ 4R9SA 5T4HA 5C1OA 2MMCA 4WCVA 1QPBA 2BTOA 4AU1A 2J3IA 4EK9A 5LYJB 3OF2A 4HFMA 2DAPA 1X7GA 1IKMA 4YB8A 1T8YA 1CDZA 1I3OA 2XXJA 4YCDA 2OQKA 3PHBE 1E6WA 1DUVG 3OIDA 4DV5Q 2VHZA 2GH1A 3L49A 2G72A 1U7PA 5DNEA 5KSWB 1NX9A 2NYVA 4Q9KA 4C01A 3QYJA 4ENRA 1C9YA 2QX6A 2K2WA 4GM1A 2XVMA 3GLHA 4P75A 4NMMA 1T9KA 4FLMA 1NNUA 3EQZA 3GOHA 1FX1A 2VHCA 2GA8A 3MUNA 3V1KA 3GTOH 4DV2L 2IS1A 4RFSB 2PMWB 4MW1A 1RXIA 4C06A 2WA1A 1VKHA 3AM1A 3TQQA 4RD0A 1L3BA 3I6QA 5DV9A 3DDHA 1NUAA 2UZ0A 2X19A 3M1YA 3KOZA 2PW5A 3JTEA 2VUIB 5TC4A 3U26A 3B6ZA 4YT5A 2IV2X 3G5LA 4FYYA 1RYNA 3BBPA 1C7IA 3LFTA 1W9HA 2ZKIA 2V0GA 2NN3C 2C5EA 3EYWA 4GG1A 4S3SA 3V4PB 3O7WA 3U4AA 1V16B 3U60B 1QIEA 3EC7A 2BFFB 2ZUUA 4YWHA 1KJQA 2VP3A 1P33A 5EJWA 1NNXA 1XWFA 2ZWIA 4ZT4A 3SGLA 2P2GA 4PBRA 2FUEA 3CF2A 2UZIR 3EBPA 1ODIA 1U81A 1XCGB 4HFNA 3Q2KA 3G6EA 1FTSA 1WTQA 3BHMA 5DX1A 3NC1C 2IDJA 4A3FB 1E2EA 1N5LA 3FFWA 4B7ZA 3K1TA 3AG6A 3SQOA 1CDEA 1E8NA 1DXMA 1V95A 1KY2A 1K3FA 2A69C<