1OXVA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 98
structure length 353
sequence length 353
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxvA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxvA01
2W2VA 1Z3IX 2WIBA 4C0LA 1XEXB 4GBMA 4CEHB 4DR7L 2DFKB 4GLVB 4RD1A 1Q1ZA 1QHXA 1Q0UA 2NG1A 2CHGA 4AG5A 2VHCA 4JLDA 1CJTC 4LYHA 1VQOA 2GAAA 2P0EA 2UZIR 3SZRA 5CDFE 2FSIA 2ZM6Q 3VR2A 2OFOA 3DZDA 1BKBA 2UZ3A 2Z6VA 4HLQB 1AE2A 1ZM3A 4DR3L 1GIAA 1E98A 1P73A 2AKWB 4YXWA 2OUKA 4I1UA 3CRKC 1OFIA 4DEXA 1FMLA 1ZJ6A 1X54A 1DO0A 3NE5B 3D8BA 3QKSA 3OAAA 4HEJA 1K6MA 1CU1A 4K8OA 1E99A 4PZYA 4DV6L 3AM1A 4PQYA 1HT1E 3IFTA 2GVBA 1X3SA 4KAXA 1KSJA 3WMEA 2VP9A 4TL7A 1MRNA 4DV5Q 3AVYA 2QP3A 4JVSB 4N0EA 3ICQB 2P65A 3HU1A 2DR3A 3G48A 5AJZA 2PPBC 3A5ZB 1P9RA 2A6HC 3ULLA 1DELA 5TXGA 2ZI9A 3B85A 2PI2A 1G19A 1KRTA 1S3GA 2KB0A 2XSZD 4B73A 721PA 5C0XG 4HJ9A 1N6IA 4JK1C 1QRAA 1OYYA 3KUDA 2AFHE 2OCEA 3HYRA 1Z08A 2GJKA 1R10A 5HPYB 3QBVA 1GO3E 5F9HA 2H57A 3IHLA 2E75C 1HV8A 5BXQC 3UDIA 1J8YF 2GAOA 2HLDD 4GN4B 2ZI4A 2C2HA 3DOEA 2YC2C 3H84A 4NU0A 4NL4H 1B23P 3J81i 1CTMA 2E5LL 1G8FA 2QMHA 3VA7A 4PFSA 4Q1FA 2IYLD 2GRJA 3BXZA 2OM2A 2XSZA 2ZE6A 3C7KA 4TL6A 2K7VA 2Q8IB 3TUIC 3E1SA 3CCUA 1IAQA 4IJHA 4B3DA 4W7SA 4C30A 4HATA 5DYGA 2OCPA 1E2MA 4AKGA 1MR3F 5DO9A 1NNEA 1WMSA 1IN5A 4H44C 3WRYC 1DOAA 3KF8B 3RN5A 5B30A 3DMDA 3V4FA 1QDEA 2Q2TA 2QI9C 3T5DA 1MKHA 4H02A 1E2DA 3U7EB 1WDTA 3PIPA 3AUYA 1TEVA 4PC3A 5HGQA 4WA7A 1GKYA 1GUTA 3P20A 1G8YA 2WJGA 4GDFA 1N6LA 3RC3A 4M9SA 2E74C 4GOPB 1E2LA 3VR5A 2NN6G 3U58A 2F1HA 4KXFB 5C44H 4IRUB 3LGJA 1YR8A 2HT6A 4NYMR 1G5RA 5HE8A 2V4DA 3PEWA 3ZS8A 1X8LA 4BBRG 2W0MA 4RFSA 3ZLJA 2XZLA 4Z8YA 3RHFA 1E9AA 2WHXA 2VYFA 2GJ8A 4OQLA 1U90A 1TTTA 3F5FA 1XMOQ 1AS0A 3GJ5A 4L9SA 1AIPA 1WA5A 1VMAA 2O0JA 3GJ8A 1YVCA 2CK3A 4TWZA 4E5UA 4F93B 3GFTA 1MABA 1VQ6A 2C35B 2ODBA 1W0JD 5JEDA 1RRCA 4OQFA 4IPHA 1TU4A 4G1UC 1UFQA 3TIFA 4RKEA 4B3GA 3VU9B 2VSFA 1EX6A 2P2LA 3PSIA 2GK6A 1Q7YC 2Z6KC 4A3DH 2WKRA 4MYUA 4R4CA 4E09A 4YQFA 1SHKA 2QSYA 4JZKA 3U6KA 2O8CB 1AGPA 1P8LA 4B43A 3M6AA 1WXQA 3MXNB 1E1TA 3EIEA 2VEDA 4LHYA 2QM8A 4M22A 4DCSA 3PEUA 2IA5A 1G5TA 4IDNA 4QY7A 4MTNA 2WJJA 2GXAA 1E9RA 4JVMA 4EDHA 2JGNA 4WXRA 4LFAQ 1JR6A 3KLWA 3CWZA 3VHXA 1UE5A 2VHQA 4LZZA 4C0JA 5L3VA 4HJ5A 2WWIA 4PPNA 4IHQA 1G20E 1FX0B 3OFNA 4N3NA 3T35A 3BFKA 4L4UA 1M7GA 1CJUC 1R9TH 3PVSA 4FI3C 4MA4A 1E2KA 1HNXQ 4DV0Q 3CRW1 2GZAA 4YCWA 1XNQL 1IM2A 5FJ8H 1NY6A 2EWVA 2H18A 3BBPA 3QXXA 5CITA 1GL7A 2BE5C 4D4KA 1WOCA 1WYDA 3AKEA 4CZ2A 4UNSA 2ZRBA 3FKSD 1GL9B 2R65A 2H5EA 4AURA 1KTVA 4HYYA 3U4VA 3F3YA 4QJ5A 3W8RA 1BS1A 1Q8KA 2PZEA 4PAQA 1OLOA 2WPDA 3T15A 421PA 5AJXA 4MKFA 2AUJD 3DPUA 4MRNA 1R5BA 2D74A 4LJ5A 2R7DA 1G3MA 4A93G 2OCYC 4DR5L 1ZCAA 4DUYL 3WMGA 4OHWA 4CIDA 3KYHC 2O8FB 3G82C 1W1WA 4IFBA 1KKMA 3W6NA 4A0HA 4BLPA 1NVVR 1S9DA 3SJCA 1QF9A 2ORVA 2AK3A 2XJ9A 3D4RA 1VQBA 1XMVA 1SVWA 1A1VA 4Z51A 1G7CA 2P3SA 2QE7D 3K7UC 1SN8A 2BMFA 2WJHA 3MJHA 2ID0A 5IE8A 3QKSB 4I1OA 4QOSA 4I7ZC 1GJXA 2EYQA 5HTKA 5IYCH 2KSQA 2ZYTX 1EOVA 1L4YA 1DTSA 2A2ZA 5BYKA 4TMZA 5JECA 4OHZA 3KFVA 4Z1MD 3ZYCA 3BB4A 3PUZA 1Z6AA 3C4JA 2JXMB 1BH2A 3PUXA 1M2OB 4YMTA 1K0RA 2WJYA 1E9BA 4LF9Q 1JEDA 3CM0A 1FUKA 1VCMA 1CFMA 5SZHB 3UDFA 4GNKA 2EQSA 2K50A 3RS0A 4URUR 5K8LA 2QORA 4KSBA 5FOWA 1X56A 1VQCA 2A69C 5AUOB 5F3WB 2O8BA 3IPYA 6Q21A 2W0SA 4V0LA 4DJTA 3CH4B 4GSYA 2NZ8A 5EE3A 2CCGA 4PC2A 1N32Q 4DWJA 2GETA 1TPZA 5BR8Q 2O0HA 5EE1A 2C99A 4L8JA 1Y8PB 4PPFA 2V7QA 4TL8A 3SBEA 3SNHA 1G18A 3OTOL 1HNWQ 1TF2A 3Q9LA 5JBQA 1HZBA 1N0VC 3K8YA 3LX8A 3C41J 2RHDA 4FMCF 4IVQA 1DBSA 4A3DG 3LWNA 3UG7A 5FI1B 1N9WA 2BC9A 1PHJA 2LXJA 4M21A 4JBJA 2QU8A 2CMKA 1IL2A 1CR2A 1Q82C 2MSDB 2XTZA 1DE0A 1YJ5A 3OZXA 5CB6A 5L3QA 4HDOB 1QHSA 2GTPA 1QG2A 5A5GA 2ZU0C 4RCZA 2OLJA 4B3ML 5M04A 4JV5Q 2OXCA 4QG7A 2V6JA 2KWIA 3A8IE 5C4XG 3X1XA 2D2CC 2JJ8A 4KSCA 4XSHA 3FE2A 1W48A 1TQ6A 2VHUA 1OB2A 5FH9A 1GG2A 2NO6A 3AEZA 2AD1A 5FPTA 5ELXA 4RZ2A 4EAQA 4LNQA 4A3LH 1PH2A 4JLVA 3PUVA 4B3TL 2QAGA 2WIAA 2BJVA 3BB3A 4NHOA 2RH5A 3AF1A 4GOPA 4YMWA 5EE5B 4DR7Q 5HCIA 1E0AA 4NYIR 3MWLA 5B58C 1B7YB 5FOSA 3A8JE 2YZ2A 5DSZA 3PENA 3GMTA 2DHRA 1KGDA 1W4CA 1C4OA 2OCBA 4JCVE 4DR3Q 2I5MX 3CD6A 2FFBA 3SDZA 4PC6A 3S2HH 4A3MG 1T4GA 1IN7A 3TSWA 4RSGA 3BH6A 1K9MC 2A3RA 4R2HA 1O87A 5EXPA 5C4MA 1U0JA 2IYVA 3BU2A 5E95A 4GNXA 1DARA 2GBLA 1B9NA 1PH9A 2QPOA 3NH9A 2AWOA 4LHXA 2IYQA 4NONA 2GNOA 4E03A 2K5UA 2Q9BA 1W0JA 1JPNA 4QRHA 1Z8FA 3BDOA 4KKTA 4R4IA 1D2EA 1DAIA 2QAGB 3CO5A 1CRQA 2REXB 3NG1A 4FD2A 4JI6Q 2VS1A 1T8UA 3CMEA 4DC9A 3M4YA 1XX6A 1P9NA 2V7QD 2A6EC 4P33A 2J0UA 1NJFA 1YZUA 2WB1G 2JATA 1N6NA 1KNXA 3GJ6A 4XH9B 5JCZA 2E2HH 5DI3A 4A3JG 1M74A 2KI5A 2A5JA 3M4QA 2UXCL 5FPKA 1ZNZA 1P62B 1Z6GA 4B6EA 2R7FA 1UBEA 2F6RA 4YWMA 3MLEA 3U9SA 2ZTDA 2CDNA 3GP8A 4L5QA 2JLYA 1A2KC 3SN6A 1RZ3A 2J0UB 1UKVY 5FL7D 2VRWA 1XMSA 1OV4A 2QTHA 4O0MA 4R98A 4A8JC 1RIPA 3H86A 4QJ4A 2D62A 1ZU5A 3I72A 3TQCA 1LY1A 1Q57A 3CXCA 4BECA 2XXAB 3ZVLA 4X65L 1G21E 2YWFA 1PUJA 4NBSA 3AVVA 5EUQB 4QM7A 1KAWA 2ZUBA 1JAHA 1RRFA 3FKQA 5EAYA 4DLUA 2IYYA 3DKVA 1NVUQ 1FQKA 4MITA 3IBGA 1II0A 2FF7A 2PT7A 3A5UA 3ETLA 4JL5A 3HDTA 3UXMA 4EQ5A 1JXMA 2O0KA 2IYWA 4G7OC 4IJLA 1Z0IA 2CLSA 5J4VA 1A2BA 3PJRA 4XTCS 4LUCA 5AUQA 4EPYA 2BOVA 4QQBX 1KI4A 1KMHA 1R0YA 1FQJA 1RRPA 2RMKA 4DXAA 1OH7A 3EPKA 1N33L 1NVVQ 3CX7A 1Q1BA 4HIDA 3U3MA 1IXZA 1S9HA 4D4LA 2H7VA 1A0IA 1G9XA 3CB4A 4GOJA 3RS4A 3HOUH 2CHQA 2VHJA 3K09A 121PA 4JJZA 5DI9A 1XMQL 1IOZA 5EZ6B 4EIWA 4YMUA 3RC8A 1P7CA 2IYSA 3CCEA 4MUBA 2VTKA 4EJSC 2IYRA 2R92G 4RZ3A 2ZE5A 2VLIA 4X66L 1I94L 2G77B 2WICA 4Q01A 4BLQA 2ZAMA 1FP6A 3BB1A 1Q20A 1MOZA 1R0WA 4L5BA 3LW8A 5CYOA 1DADA 4RCNA 2QMEA 1U8AA 2VUMH 2LKCA 2O5IC 3ECCA 3FDIA 2HDNB 2N8NA 4A6PA 4D0GA 2GK7A 5JI2E 1NRJB 2RKOA 1SVOA 1S3SA 4TSFD 1Z07A 2WAQG 2QAJA 4RZXA 5KNBA 1QHNA 2JJ1D 3RRMA 2PMZE 1W44A 1XMJA 3DOFA 4Q4LA 4ABYA 3PV0A 1SMYC 5C3EH 3AQQA 3K80C 1SFOH 4TZ0A 3OW7A 2YV5A 2Q2IA 4IFDG 2O8EA 1HT2E 5TVKA 3VX3A 4TYPA 1Y3AA 1GKIA 4B3XA 4NB3A 1DAMA 1IBLL 2NGRA 3AKYA 2QTVB 1HH2P 1EXMA 1RRGA 4WW0A 1LTQA 1PLKA 1E1OA 3HOZG 2ZR9A 3KQHA 1J2JA 1ZC4A 4JI8L 1GAJA 1W2HA 2H92A 2R2AA 3K9HA 2F9LA 3KF6B 3K1JA 1NJGA 2RGXA 4P71A 4PMWA 1R0XA 1F2TA 4JVNA 4PHFA 4BLSA 4C0BA 3TS2A 5LD2B 1SKYB 2E76C 3AVQA 3NKVA 4RD2A 4C3HH 2EFEB 2A5YB 4PTLA 2PJZA 3G71A 4IO9A 1VIYA 1VQAA 1NKSA 2N78A 3CPWA 2HT1A 2JEOA 3K9GA 2UUBQ 3GLHA 4PQFA 4Q7KA 4YCUA 2ZROA 2AD5A 4WAUA 2VZAA 1HNXL 4R7ZA 5LMUQ 2RGNC 3IKJA 2IW3A 3TR5A 3LWUA 2ZRKA 4Q4HA 1A62A 4W5HA 3HOWG 5C0XH 2BDOA 1VYUA 3EZ7A 1XD8A 5EXXA 3WYAA 4A0GA 1II9A 1XD2B 5BN4A 3FWYA 5KHOC 4JBYA 2DWOA 1UM8A 3X2SA 4PANA 5KPJA 3AP3A 5GJBA 1JJ7A 3I32A 1HR0W 1GM5A 1E9SA 4V0ME 3EX7C 5CK5A 1WF3A 1XU4A 2REBA 2VL7A 4B3TQ 2Y0SE 1BYIA 3CH5A 2G1KA 1AS3A 2QAGC 2MQHA 1GKUB 1XXHA 4A3GG 1YE8A 2IWHA 4HIKA 2JLWA 4HR7B 4L5TA 3OIYA 4KYUA 2D3WA 2R6DA 4UJ5A 4F91B 1PYBA 4TLCA 1O3YA 2YOHA 3KL4A 4BFSA 5KTYA 1UBCA 4D4MA 4C0HA 2VP2A 2FX3A 3Q72A 3TRFA 2J0VA 1JECA 1CBUA 4IJMA 1XEWY 3F2BA 5EZ5A 3OW2A 2Z6KA 4LFBQ 2HV8A 3NC1C 1NSFA 4GKKQ 2MO1A 3I73A 2QN6A 3IIKA 4LSGA 4Q19A 3W6OA 2CNWA 3AGPA 1JMCA 3LXRA 4TMKA 2RGCA 3FFBA 3M0EA 2YYZA 2AMCB 2BH2A 1OKKD 4LUVA 4I81A 4IOKA 2E87A 2IUTA 3GO5A 4KLNA 1NL3A 4TQAA 2H5XA 4MDEA 5A35A 1W2GA 3NHBA 4CEIA 1V1QA 4HAWA 1S1CA 2OG2A 3LQRA 3D7MA 1F6BA 3K0CC 4TN1A 3QSYA 2F52A 2JA8G 1BBWA 4AH6A 4KU4A 3WYGA 1E2GA 3OE7A 5CJ2A 3I4OA 2F1IA 1MO3A 3KFXA 3H0KA 3QPWA 5DI3B 3AKDA 4NP6A 4JKYA 3NHAA 2ZM6L 2ZYVX 4IVPA 4B32A 2NZJA 3OOCA 1G7TA 2YU9H 3ICEA 2FN4A 5IWAL 2G0NA 4QHYA 5HR5A 3M3YH 2XTNA 5M3FH 2NOAA 2R62A 4PC7A 1CR1A 1J8MF 2KBEA 2ZS8A 1YVDA 4TMVA 4EPRA 3SJZA 1KDTA 2ZRFA 2QMUA 1Z6YA 2PCFB 3K0XA 1UBFA 2O52A 1R5NA 5E7MA 1XD2A 2OAQ1 3W5JA 3BZCA 2GXSA 5CIWA 3CRRA 1COWA 1L4UA 2QA5A 1K5DA 3OESA 3CPFA 4DV1Q 4KODA 4RG1A 2VSXA 3RZDH 2WJVA 1I6HH 1H8EA 4EFNA 5L8VA 3VR6A 5BN3A 1FL0A 1QVRA 1ODFA 1R5OA 3BRWD 821PA 1B0UA 1XWIA 4LOAA 4DUGA 4DAMA 4LC1A 1N5IA 3WHLA 3GLGE 4UPAA 2I4IA 1E2FA 2IYZA 3S16H 5JMTA 3ASYA 2B8FA 1DG3A 4X64Q 2VPPA 5C4GB 2IYUA 4BLOA 5KDDA 4CT5A 4B3SL 1OFTA 3S1AB 4DLZA 3RNUA 3U44B 4HB2A 1K3RA 1KO1A 3CCQA 2BMEA 1ANKA 3AV0B 2RB4A 1QUQA 2OBMA 3CNLA 3T61A 2FPKA 2MFIA 1X6VA 2CNWD 2QGZA 4NYJQ 4UNNA 4YWLA 2VL6A 3B7GA 1LFDB 4MKHA 4FWTA 1KO4A 2A1AA 3FMCA 3NBHB 1FJGQ 4NYMQ 1XZQA 1NVXQ 4JSTA 5EP4A 2MSEB 2ZSFA 4LHWA 2C95A 4Q9HA 3VU9A 2KCMA 1E1RA 3GFOA 3NXSA 5CIQA 3AVWA 1GSIA 2BHRA 1H9KA 2A30A 3EG5A 4Q4HB 1A8VA 2MSCB 2VO1A 4GMXA 2VNUD 5JLJA 2B3GA 1ZD8A 2F9MA 1Y1WH 3HR7A 1H9MA 2C78A 3KXLA 4XD7D 4XWKA 3I5YA 1J7KA 2WSSA 2UUAQ 1KK3A 3TE6A 3Q5DA 5E7IA 3H3VI 1VQPA 2Z0SA 1KSHA 3U50C 3V9PA 2GHIA 1T5LA 1DAHA 1P3JA 4YDSA 1G5PA 1R4AA 1W49A 2Y0SG 1PH8A 4HZUA 1J90A 4JLBA 1G51A 4ZKEA 4DDVA 1US8B 5JRJA 1AGRA 4MYTA 2KBFA 4DSOA 4QL5A 3BIFA 3I55A 3B9PA 2YWGA 4RFSB 5E3HA 4TQUS 1XCGB 3W1GA 1J5EL 1CIPA 1SZPA 1VQ9A 4BBSG 3KJHA 3N5CA 3BD9A 3IDQA 3GQBA 3I5XA 1KKLA 1OHHD 1N34Q 3P32A 5GROA 1YI2A 2ZR7A 1HNZQ 4S35A 4XVRA 1N6OA 1LF0A 4EFLA 4M1TA 3HFZB 5BQ5A 1RJ9A 5IY0A 1VG8A 1XD9A 4GLAC 1H9SA 4QGUA 3S14H 2J46A 2OAP1 4MRSA 3PFIA 3U2QA 1CJMA 1G3IA 4XIGS 2Q3FA 2WJIA 3RNLA 4US1R 4Q1DA 4LI0A 1ZM2A 4LF6Q 1DG1G 3TNFA 4L5SA 3ND9A 4OKSA 4LF8Q 2P6UA 1SVSA 1JQJC 4BA2I 4HZUB 3Q7QA 4I99A 2D2EA 2JA6G 2HEIA 2ZEJA 3H0GG 4TLBA 1XTRA 3HKZE 2BMDA 3O8RA 4ZCMA 3O8CA 3A7LA 2F1JA 1YZGA 2A7QA 4TQ9A 5DHFA 5FFMA 2OWOA 3P1JA 1D2NA 2D0OA 4UP9A 5LMNW 1GILA 2W00A 3EIHA 3L0PA 3G6EA 3QKRB 4MRRA 5L3SB 4KLKA 1GNRA 2C9OA 2CJWA 4B76A 2ZTSA 2XNDA 5IP9H 1CJKC 4Q4AB 4C2MH 4JI0Q 2N1BA 3EW9A 1XPRA 4LFAL 3U3KA 3WP1B 3KLRA 2OHFA 3KKQA 1EFRD 1NIPA 1HE8B 1YZLA 2RAPA 1P4SA 5C4JH 4YCVA 2GWHA 4QJ3A 4B44A 2ZR0A 4QBHA 1JALA 1YRBA 4H1VA 4NXMQ 1G6PA 1MABB 4BE7B 1KHTA 4LK1C 4DUZQ 3A4MA 4OO1H 3QEJA 1DAGA 4HAXA 2ZJ8A 4PPQA 2GVAA 3C15C 1L0WA 3CC4A 2HXYA 4XVQA 3WHKA 1RC8A 2O8BB 3A0JA 4QIWE 2DGYA 3AQ4A 4O0AA 3VKHA 3EBEA 1EQRA 1Q86C 3LVRE 2VF7A 3A1VA 3PF5A 3TS0A 2JDIA 1XJ0A 3BE4A 4LV5B 4NCKA 4B3RQ 1T3SA 3N2IA 3NWJA 2NVXH 1NE3A 3I4NH 4K81B 4DCNA 1T3HA 2D4HA 2N42A 1YZ6A 2YC4C 5BW8A 1U8YA 3CQZH 1ZYUA 4DIDA 5A0FA 1EFWA 2QROA 4DV3L 4ERNA 3F1ZA 2FPMA 1XJVA 1Q81C 2YNMA 4RD4A 1AKEA 1G7SA 3NBXX 2W6ID 4AI6A 3WBKA 1YHBA 5CM8B 4GKJQ 1IBLQ 1W5SA 4V0OA 2L5TA 3I3SR 3QPUA 2IK8A 3RSOA 3I4NG 2IC5A 5KYKA 2K4KA 1T8TA 1UWVA 4CEHA 3UDXA 2FEMA 4P4TA 5UKDA 1TAGA 4B3MQ 1DS6A 4NCHA 1VQMA 2VA8A 2NVQH 4BY1H 2J41A 4QGHA 4BASA 5TDHA 3MWJA 3AVUA 1AZTA 1GHKA 2PCLA 1XNRL 5FOTA 2JE6I 1NMGA 1FMJA 3SR0A 4QJFA 2HHHL 5IYDG 2R6FA 2X77A 3PQCA 5FL7A 3J7A5 3EC1A 1E4YA 3D0FA 2K5NA 2RGEA 4K46A 3OEHA 1QHHB 2AUKA 3CR8A 4B71A 4TZ6A 3BERA 3S15H 2IF0A 4L16A 2ZT9C 2IUUA 4V0KA 3RS2A 4GP7A 1I2DA 1WE2A 4HDCA 4JLOA 4F38A 4PXAA 3HOYH 4B3SQ 2KHIA 1E4VA 5EP2A 3SJAA 2K14A 1E2IA 1AKYA 3JC66 3GTKH 3ERSX 1RJ9B 1T91A 4FIDA 2ZJYA 3LVQE 1A82A 1BIFA 1K8OA 5JS8A 3TBKA 2OO7A 2N49A 1KY2A 2UUCQ 1ZVQA 3KOJA 1HTWA 1U8ZA 1KJYA 2F3RA 1XNJA 2A78A 3OTOQ 1HNWL 2FSHA 2ZRCA 4TMTA 5LDDC 5BN5A 4DIEA 3DL0A 3QI2A 5D3MA 2EYUA 2WKQA 4J15A 2W6JD 3W9YA 3QF7A 3GLGB 4BFUA 1NLYA 3CNNA 2ZQ5A 4HAVA 4Q1EA 4X8OA 3EZ9A 5CJPA 1BMFD 3UPUA 3SU8A 2ZI7A 3AFPA 3CCRA 2I1VB 2Z83A 5DISB 1IN8A 2GESA 4BEBA 2ZU6A 1Z0JA 1KHIA 1A7JA 1E32A 4ZV4A 4NDZA 4D0LB 3FPPA 1E2ZA 4YHHL 2MMGA 1IXRC 3NELA 2DFLA 1EWQA 4LJ9A 4S2EA 2YOFA 3SOPA 4DV7Q 1KI6B 1TF5A 2UXBQ 2FFHA 2QNRA 1Y14B 4OONA 1XPUA 4IPCA 4JIMA 1S72A 4NCJA 1TQDA 3NENA 1ZINA 1U0HC 4DUGD 3A6PC 1TX4B 4ALPA 3IIJA 3J81c 2AHOA 4KN4C 1CSQA 3I8XA 3TMKA 4PSAA 1NJIC 4EFMA 4DCTA 2G3YA 3GPLA 1HNZL 1YNJC 1W0KA 1XF9A 2ZSEA 4DV2Q 4Q21A 4BGDA 3HOXG 4EQ6A 3THYA 2CW0C 3DXJC 1ZD9A 1AE3A 1VQ7A 2HQLA 1D7QA 4XD7A 4ACBA 4RVCA 2EU8A 5FI0B 4C0AC 3CPJB 3A8KE 1QHYA 4GZLA 3EPLA 8OHMA 1MJEA 3EIVA 3P26A 1S4QA 3PITA 4PX9A 5G40A 2QBYB 1AJEA 2RGNA 4CEJB 2D0PA 2UU9Q 4XJXA 4HSEA 4GLXA 4RCYA 2X2EA 1M8PA 5JEEA 4A75A 3BAFA 2EJMA 1N5JA 4R71A 1MO4A 4H13C 3THOA 4H9GA 1UKZA 3R9WA 3LBIA 3NBFA 1IXRA 4NPSA 2JA5G 3A4NA 1S3OA 4IKEA 3PIOA 1E7ZA 4GNXC 2GBLC 4JI3L 4Q9IA 1HCZA 4Q7LA 3U44A 1OHHA 2AXPA 2E9SA 4GP6A 2JA1A 1C1YA 4KHZA 4AK9A 1GD7A 1KDOA 2PX0A 1CKOA 4LFCL 3I61A 4QM6A 2QUZA 1OF1A 2LCFA 1NG9A 2WSMA 3FHTA 5CB8A 1D9XA 3TUZC 4LY6A 3CW2C 2HUPA 4A3FH 4GT1A 1Z63A 1XTJA 1XTDA 4RY2A 5BR8L 1E2PA 1AZSC 1Q3TA 3C5HA 3RS5A 4AKEA 2WAQE 1IJEA 4E22A 1KK2A 4EPVA 2YTVA 1HUQA 3IPXA 4EPWA 5DN6D 1FR3A 1SGWA 4P75A 1PLLA 4GOPC 2X1VA 4LBZA 4IQZA 3TVTA 1KL9A 5GJCA 1SLJA 1IYVA 2ZPTX 4M1YA 4CDGA 3RANA 3LY5A 3VR3A 1LACA 4II7A 4PAMA 5KOYA 1E3PA 1L2FA 1EIYB 1LF5A 1IBRA 1ZIOA 2B8TA 2C96A 4YONB 5FOUA 4MYCA 3Q5EA 4F4IA 4M9XA 4RFVA 2BVNA 1CEEA 1Z6HA 4QGFA 2WSSD 4BY1G 1UDXA 1VYTA 3KDFA 1BBUA 2ALYB 5FLMH 3L8YA 4QKQA 3KTAA 4KBGA 1EFRA 4APVA 4N1AA 2B6HA 3T1HL 1I4DD 2BBWA 1VECA 2QQEA 2E8GA 3GCGA 3MUFA 3V00A 4DDUA 3MCAA 4A36A 4AYTA 2D7DA 4YLGA 2FG5A 1XMOL 2J59A 4V0NA 5C2JB 2OBLA 2G0TA 4A82A 5HKKA 4DV6Q 4M1MA 1AN0A 1WJJA 4CT4B 2ZRAA 1OB5A 2A5GA 3STBC 4C0QC 4Q48A 1C9OA 4TMXA 3QG1A 1Q12A 3B6EA 3UG6A 1OIXA 1SQ5A 3EASA 1J99A 3J81k 3ADDA 1XRJA 1Z83A 3W1BA 2PL3A 3A58B 3BJIC 1VQEA 3Q7PA 1JE5A 4B48A 1ZCBA 5EUMA 1U9IC 2CCZA 3B1XA 1CP2A 1KDPA 5FOXA 4AYBG 2AK2A 4F4JA 2O8EB 1SULA 1WQ1R 1G291 4A3MH 1PH3A 1FL9A 4PV1C 3A37A 3C16C 5G3YA 3DM5A 3NBZC 3C14C 1EESA 5KSZA 3EN2A 4IPDA 1KI3A 1JJGA 2W58A 3KKNA 1G4AE 3MMPA 3AYHB 2W6IA 2TMKA 4A8JA 1J70A 1IW7D 1DXMA 4G5SA 3D6TB 4GMDA 1B8AA 4URVR 3NH6A 2QEXA 2GXUA 4A3CG 2ONKA 2A19A 1IY0A 1GTVA 2NVYH 1TQ4A 4JJKA 4OI0A 1SVKA 1UE7A 1TU3A 3TQFA 3NDPA 3TQYA 2A6ED 2DFTA 3A36A 4ZIRA 4DR4L 1Z7TA 3I4MG 2WB1E 4OO1G 3MWKA 3NIBA 5G41A 1XPOA 3H4MA 1VYVA 4F4CA 2ANCA 4P31A 5HKKD 3V4RA 2IS6A 3S1QH 1G6OA 4JI0L 3T1TA 2H17A 1G3UA 1JT8A 3K0FB 2I1QA 3GTJH 3LBHA 3R20A 3ZGXA 2NO0A 3MFYA 4BPBA 2PH1A 4BFYA 3CBQA 4KHPL 1U99A 2WPDD 1JB7A 2WWWA 3THXB 1PA6A 2Q21A 1ZRHA 2ZVQX 4ZI2A 4DRZA 2EDGA 1MO5A 2WWXA 3SQXA 2F3IA 3F2DA 5EXSA 5EE9A 4DUZL 2PEYA 4B2IA 3C8UA 1P6XA 2BE5D 1YQTA 2QZ4A 5CLQA 4D81A 3U4QA 4NE2A 1ZUHA 2BKUA 2F7SA 2IHFA 3K09C 4KCGA 4KFUA 4Q66C 2VQEL 1QHHA 1T0JB 3I92A 2CL0X 1VPLA 4B35A 2F4VQ 3HR8A 2K5VA 5FUWA 1NVWQ 4GL2A 2WWGA 3NEJA 2VP0A 3MRSA 1GVPA 4A3KG 1IBKL 5IP7G 3T1YL 621PA 2XB2A 2CFMA 2VP5A 4ZO4A 3TJZA 3CLVA 4FN5A 3B78A 4PC1A 4UP8A 4DNRB 1YZQA 2Z5FA 4DR2L 1KJZA 2DCUA 1TXYA 2AHOB 2Q2HA 5DLQC 3I1FA 1EGAA 4DV3Q 4W9MC 1GHJA 3U5ZB 4HB4A 2LXKA 3B1YA 4AWXA 3SYKA 3FGNA 1X3GA 3UMRA 1ELOA 4LRWA 4DKXA 3OIVA 2V54A 2GA8A 3GJ3A 3I2ZA 1A6XA 1VQNA 5GADC 1Z22A 2WKPA 2WVJA 1IBMQ 4O2LA 4TMWA 2A69D 3NEMA 1H8HD 5DGXA 3GTMH 5JWHA 4LF9L 1ZM9A 1BO6A 2F43B 3IILA 4XVUA 3KQLA 4X66Q 2JLQA 2DYKA 1Q44A 1C9KA 2C03A 1HQCA 1VQLA 1TUIA 3AF3A 3H15A 5AR1A 5JFGA 4G5QA 1GNPA 2IEZA 4X64L 1HYQA 2PZFA 4GPTA 4BFVA 2QP4A 3BFVA 1N0WA 3QXSA 1KIMA 4DNIA 1HE1C 3HU3A 4RD0A 4B3FX 4BXXH 5K36G 3A1TA 2BMJA 3G4SA 3PG5A 1TQ2A 3QPVA 1N6HA 4PZ7A 4JBMA 3GEHA 2R7ZG 1MO6A 4HLUA 5FUVA 2R93H 2O8CA 4XOIA 1HPCA 3HOVG 4DB2A 2JA7G 2CQOA 4FCWA 4IVRA 4BZPA 4AQYL 1SXJE 1L2TA 4W5WA 2V8OA 2I3BA 5B2ZA 4QHSA 3REFA 2QGNA 4G0NA 3TW4A 4IDOA 4PZ6A 1P5ZB 3WXMA 2AWNA 1OFHA 5EXTA 4PHHA 1XCPA 3I4LA 2CHVA 3RRZA 3M85A 2QT1A 4Q00A 4OI4A 3VFDA 1QVFA 1YIJA 5FPYA 3R8CA 3J81j 3AP1A 4WBSA 1DPFA 3HKSA 2QQ0A 3KJGA 5KNDA 2ZI5A 1N36L 2D2FA 3CCJA 2YTYA 2NPFA 4G7HC 4NYIQ 2GJ9A 2FWRA 3E2IA 3QF4B 5AJWA 1V43A 5H68A 4DNTB 4EX5A 3OEED 4HLUC 4IDHA 2V3CC 2CL6X 4A2WA 4DV1L 2RGGA 3OYYA 4RD3A 3VR1A 3ADCA 3IHWA 5D3QA 4W5JA 4BLTA 3K81C 4C3IH 2K52A 1D2MA 2ES2A 2Q3HA 4M1OA 4CGZA 4KLZA 3CPEA 2ZRHA 1I3QH 2CK3D 2VH5R 4TSFA 1E22A 1J5EQ 3B8HA 5TMPA 3L2PA 2VQSA 3KXKA 2NQ2C 1OH6A 2LMCB 4ZDKA 2EFDB 4PQRA 4HJ8A 1E0KA 5IK2A 2BBSA 4JYAQ 1G4UR 1YKSA 2XNSA 3WDNA 4FDBA 3KJOA 3RABA 3PO3G 2V6IA 2YVUA 4OX9L 1XJCA 2JDID 3K0FA 1D8TA 4MZ9A 4U5XA 4D82A 4JYBA 1PJRA 4X6AH 3RDPA 1EFHA 4MGIR 2PNRC 4J0QA 2ECKA 3DM3A 3CF5A 1E1QA 1WFQA 2X8AA 3LW7A 1XP8A 4JI7Q 4IOAA 3FP9A 1C7YA 1Z9FA 3ZZ0A 3UK6A 3EA5A 3WNBA 3FKSA 4Q18A 4L15A 4BFWA 4G5OA 3T56B 4Y52H 1YBYA 2QT0A 5IYBG 3FHWA 5JS7A 1VQDA 5JCPA 3CF0A 5BWMA 4OK5A 4DV4L 4JI5Q 3U6BA 3MWYW 2HYDA 1KJWA 2B7CA 4JOIC 2QPTA 4WVFA 1M1KC 4CYMA 1B9MA 3KKOA 4B47A 4IFDI 3LH5A 4MH0R 2KA7A 4BLRA 4JC0A 3BK7A 4C9BA 3GJ4A 3K8AA 1DVRA 1KAGA 2J45A 1XEWX 3LQQA 4LBVA 4TYQA 3VQTA 5KSYA 2WWYA 3PCOB 3SJBA 4DSUA 4DKAC 1N32L 2ZI3A 4POAA 1OTCA 1TEXA 2EVWX 2RGDA 1V5WA 2FFAA 1KRSA 2BKEA 2HJGA 4KKSA 5GQOA 1CKMA 1QZHA 1GRNA 3F0TA 4ZI3A 4MDFA 4K0KL 1R6BX 3CC2A 4NXML 2ORWA 4GFDA 3SC3A 4Q4AA 1DAEA 1CKNB 2J7PA 1FUUA 3IGFA 1IYUA 1ZW6A 3LO5A 3RLNA 4WJ3M 3AF4A 2ZRIA 3EC2A 3TVDA 2B8GA 1JI0A 4KVGA 1N25A 4Z8XA 1X65A 3TRZA 4KFSA 2VIIA 4GZYC 1IY1A 4IFDJ 2GZDA 4JYCA 1KQSA 4HUQA 1HR0Q 3QXCA 1VQGA 4A3KH 3C5CA 4ZDIA 1LS1A 2IS1A 2PQAB 1FYCA 1W36D 4UQOA 2ZJPA 1COWD 2SHKA 1W0KD 1F2TB 2BCGY 4Y7NH 1CR0A 2ZANA 1BVSA 4CW7A 2IHYA 1O7LA 2BIFA 4PZZA 5AUPB 2B21A 1OJLA 2N46A 3GDEA 4LW1A 1E79D 1AQUA 3KX2A 4QGAA 5LBIA 4HDQB 1GZSA 1NN1A 4C0KA 2OV2A 5H8WA 4LF4Q 3IO3A 4WZBE 1R8SA 4GN3B 3ZIAA 4ESVA 4DBLC 2Q9AA 4YDHB 1TUEA 4O25A 2PZGA 1CJVC 1YNNC 1M90C 2WZQA 3HWSA 3JZMA 1UBGA 2CLCX 5HE9A 2JLUA 4O2DA 4L5RC 2GEVA 2K5HA 2ZREA 5AWFC 3IEUA 4PO8A 4R1JA 2ZS7A 3EWSA 1ZP6A 2OFWA 3QF4A 4BFTA 1S8FA 1YR6A 5J3BA 4U02A 4BY7H 2XTIA 1KIXA 4UNPA 1BMFA 1NY5A 5JJLA 2C9YA 3SQWA 4A2PA 4QFMA 4DT1B 3TEHB 5E7JA 5KU1A 3HOZH 3PGZA 5C3EG 3GLFB 1RFLA 1RW4A 4B2LA 1OIWA 1UKYA 2EWWA 4MNOA 3E0EA 2XJ4A 2B7BA 3K70C 4DDTA 2OFXA 1VF5C 1K8RA 4PG3A 4NYJR 2R9VA 2Z4SA 1YEZA 1K83H 2ZSBA 4AYXA 2NZHA 2CJWB 4QNMA 1Z06A 1OW3B 3M1IA 4Q02A 4F7WA 1Y8OB 2YWHA 2B29A 5FBQB 3CRMA 4URWR 3F2CA 2ZXUA 3LXXA 2UUCL 3S1MH 5IK2D 5FLMG 3UWOA 5JRZA 2K33A 1X1RA 3BZKA 2UVQA 1XZPA 3LBNA 5DH9A 1H8ED 2UXDQ 2FSFA 2ZJ5A 4DK0A 4JI4Q 2HF8A 4JT4A 2I5HA 1SMXA 1SVMA 2IYTA 4HZIA 1VQ8A 4DR4Q 1E94E 1U2RA 1KI8A 4Q4JA 2F1MA 1Z29A 4A3GH 3L82B 3BFXA 5IDVA 4LJZC 3W34A 3UANA 3LNCA 1XXHB 5HZKA 1QJOA 1N8RC 1Z0FA 2XEXA 3NC0C 4BFXA 2WV9A 4HLDA 3JAMc 1F3OA 3AB9A 4DSTA 3EPJA 1XNRQ 2C5LA 1IZ6A 1XEXA 2DY1A 2IXGA 2J5XA 3DVLA 5LD2C 2O8DA 4POFA 2QENA 2IXEA 3GLFE 3GEEA 1DEKA 3H1TA 5ANRB 5FTKA 4DVGA 4GZMA 4AC9A 4X62L 5CDFA 1QZGA 3WNCA 5GVSA 4A15A 3L8ZA 5FJ8G 4JS0A 3M9BA 2VQEQ 4IPGA 1E2NA 3QVVA 2AL7A 1NG1A 2ZJBA 3TR0A 1K8MA 3MG9A 1S40A 1LABA 4JL8A 1FVIA 5SZJA 3U3OA 4A9AA 1ZM7A 3TSZA 4FMCB 3T1YQ 1IBKQ 4P4UA 2JLZA 2OQ0A 4G5GA 5CK4A 2HCBA 2ZYUX 4GKKL 3KF6A 1E9CA 4B2PA 1OKKA 1TMKA 5DHAA 1GUNA 3A1SA 1P61B 4NXNL 2JASA 1L7VC 4P32A 3QIAA 5KPDA 3A7AB 1GVNB 5KO2A 4HIOA 4PZLA 1UADA 4IFEA 4L8GA 4BXXG 2Q2UA 2WOOA 2HXSA 3TK1A 1SKYE 1U9IA 1MH1A 2ATVA 3CR7A 2ZSAA 3FMFA 2YWEA 3A4LA 3AP2A 3KJIA 5EQTA 4BQSA 4JMPA 5F9FA 1VCOA 1M6NA 1ZMXA 2XOKA 1HY3A 1K73C 2BEKA 3TH5A 1HQMC 4JI3Q 1OYWA 2ZE8A 2CE7A 2QGQA 3RVBA 4A92A 2ONJA 4YHHQ 3EXAA 2ZRNA 3EWAA 1ASZA 2DPXA 4NH0A 1GKHA 5FPSA 3A8TA 4G5RA 3T53B 2UXBL 1ZAKA 3T12A 2FE4A 3E5HA 3EIQA 1K5GA 4YWKA 3T1QA 3HKZG 2ZJAA 4CF7A 1KI9A 1NBMD 2CCKA 3AVTA 4LUZA 2AR7A 2G83A 5IRCD 1QVGA 2J3EA 2O8DB 1W2BA 1UDWA 5M5YH 1Z6XA 1I50H 5KDLA 1CUKA 5FLXc 2F55A 2ZJZA 3ZJYA 4UKDA 4BRUA 2GXQA 1ESNA 1GRQA 1QVAA 1XFAA 3STBD 1XXHE 2G88A 3BJUA 4DV2L 2NO9A 5L3SA 2IHEA 3LV8A 4JT2A 5IT9c 1ZUIA 4X8LA 3CRQA 2REOA 2BA0A 4US0R 2D7CA 3QXJA 4PO1A 2R6GA 4X8MA 3S2DH 4BWYA 4I1SA 3SHWA 4ASUD 3NDBB 4Z54A 1NN3A 4KBFA 2IX3A 4D6PA 2VY3A 5M5WH 2I0QA 4JKIA 2BWJA 2WMOB 1NMYA 2F1RA 2ZETA 2JLXA 2FSGA 2Z43A 3PF4A 4DR6L 2R8RA 3CF2A 1OH5A 4MGZR 4QC2A 1EFUA 2YINC 3QG5A 1SVIA 4NTZA 3WMFA 1Y1VG 1NMZA 1M7HA 221PA 2Q6TA 2GCOB 2CKZB 1FJGL 3QENA 4OJKA 5JHGB 2JJ1A 2NO7A 4B33A 2KENA 2ZJQA 3U4ZA 4R4TA 3HJNA 5J4YA 3S24A 3T5GA 5H1YA 1G1MA 1JJVA 3ZJYC 2CBZA 1RE0A 2PCJA 4EJSB 3A1WA 3MAAC 1P60A 4OK3A 1XTIA 2VBCA 3VHLB 1XTQA 2KCTA 4NZYA 5KSPA 4DLYA 1Q90A 3RLOA 2K32A 2GEDA 2UU9L 3TAHA 4FINA 2FPLA 2QRZA 4L9WA 2AN9A 5C18A 2QA4A 3CP0A 1X3EA 3K0EA 1E6CA 4C7OB 1R8QA 5AUNB 4TLEA 1E2EA 3B6YA 4NMMA 3NEYA 5P21A 1UPTA 2XTMA 3IRBA 4DB4A 5M3MH 4LJAA 4BZQA 3B9QA 1NMFA 4BRWA 1SROA 1YHAA 1F5NA 4Q1CA 4B3BA 4DK3C 1EK0A 1Z0DA 5C1BA 2IXFA 3UDGA 4JLPA 1AQYA 1N6RA 1E69A 2O5VA 2ORIA 2CVFA 1KSGA 2EJGC 4LYAA 2RGAA 1KC8C 1W5TA 2MO0A 1VCNA 1PH6A 3DZ8A 3CZQA 4LF6L 4WXPA 3WNDA 3IBYA 1MJCA 4DEYA 4IEIA 5FPHA 1V8QA 1I4TD 1E2WA 1L8QA 2WAXA 2AKAB 3SYNA 1FOEB 1VQIA 1FTSA 2LSSA 3GJXC 1G8GA 1G8HA 1KO5A 1EFCA 3L43A 3QOFA 1E0JA 1HH4A 2OTLA 3AEVA 5JZVA 3X1ZA 3GTPH 3PO2G 1T6NA 3FHCB 3U7FB 4C2TA 1HR0L 1EQQA 1C0AA 3GEIA 3TKLA 4BFZA 5F98A 5IF9A 1OPXA 2FJUA 2PLFA 1RIFA 3SI7A 1G3QA 4FMDB 1LB1B 1JAIA 1CULC 2B8WA 1LYLA 1RL2A 4UY8C 1N6PA 5SZKB 3FHOA 1TNDA 3MGCA 4WZ6A 3A1UA 2H1LA 5AJVB 5KUTA 1MKYA 1Y8NB 3T1HQ 3H94A 4UNRA 4P72A 4AD8A 1VQ5A 2OESA 4A4IA 4Q9LA 4PSVA 4JOIA 2GF0A 4LPKA 1HZ9A 4XWOA 1RYFA 1P2TA 4MGKR 2EIFA 2X2FA 1TWAH 4LJYA 2P5TB 1VTKA 4U00A 3K70B 1P2UA 3I62A 3KQKA 1Q46A 3RZOH 1L1OB 4YY3Q 1E1RD 5M3MG 3BWDD 4LF7L 4LYFA 3G0HA 2CLDX 3GLIB 1S2MA 3ND8A 4DLTA 1KY3A 4IOLA 1UKEA 1G41A 3ZDQA 1JR3A 3U4QB 3R9XA 1ONBA 3GTOH 4M9QA 4IXMA 1E3MA 2HIXA 2ZSDA 1D8LA 2ZTCA 3U3JA 2IT1A 4Q03A 4ON9A 3W8NA 2O5JC 1U5KA 1LW7A 2JJ2A 2CE2X 2ZJ2A 4MKGA 2QTFA 5FUXA 3OPOA 2BM0A 1AA9A 1RYHA 2B63H 2EQBA 2Q9CA 1VF7A 1T3LA 2GF9A 4TYNA 1VQ4A 2JJQA 3BG3A 4NCIA 2F4VL 2GCNA 3EARA 4ZDWA 3SEAA 1UAAA 2DFNA 2XZOA 4TT3A 1Q1EA 1DAKA 3K53A 2OBNA 1NI3A 2IBMA 5HY6A 3IIMA 1EWIA 1XJQA 3WY9A 5GVRA 3KQUA 1HURA 3EAQA 2ZUDA 1HQYE 3ADKA 3EPHA 1V9PA 1X3FA 3L2OB 4XSGA 4M9ZA 2A9KA 5KSOA 1FTNA 2Z0MA 5C44G 1QHGA 3RR5A 4DPGA 1MRSA 1DO2A 1E9EA 1MV5A 1NBME 3CONA 3KKMA 1ZC3A 3U7HB 1B70B 2YOGA 4OBEA 4JI4L 3EQLC 3CAMA 3ER0A 2HHHQ 3W5OA 2JIZD 2XB4A 3KKPA 3OEHD 4R2IA 3Q3JB 4Y0VA 3VNVA 1IBML 2J7KA 3GTLH 2GEUA 3MSXA 3CZPA 2QMOA 2NO1A 3LAWA 3RWOA 2NN6H 2IEYA 4A93H 2DNEA 4M4SA 3FMIA 4OK6A 5FL3A 1AH9A 3HYTA 3MJRA 3ZD7A 4M2LA 4WZAE 1KI6A 3THWA 3M4PA 4PR0A 2D06A 2XAUA 3HPRA 3OF5A 3RN2A 1R7RA 3B13B 2DUDA 4A3EH 4C4PA 1YHQA 4AKIA 3PIRA 4Q9JA 1GL6A 1LNZA 5AK0A 3AUXA 2YHSA 4ARZB 3OFND 1Y1WG 5JI3E 2FGKA 2ZITA 1LV7A 2HCJB 3KQNA 4M1SA 1WRBA 2AX4A 2CL7X 3B5JA 5JJIA 3FPAA 1UEIA 2GCOA 2IX0A 4DR5Q 1EG7A 2WMNB 1MIUA 3QJYA 4AQYQ 1G7RA 1JB1A 4NPHA 2BV3A 3L0IB 4R4OA 4ZCLA 1Z2AA 4B6FA 1E79A 2I5LX 2IUSA 4LUOA 4DHEA 2F43A 3N6RA 2CVHA 1OE0A 2J87A 1F2UB 3CUEF 1SXJD 2C9CA 2A6HD 1CRPA 2OZEA 1QBKC 1PFSA 3KTAB 4MRVA 4ESHA 3VNUA 2Q3MA 2KBNA 1PH4A 4BEJA 1H65A 1XEFA 1I5FA 4NXNQ 2OLKA 521PA 4JLKA 4TVAB 2VQFL 4R4QA 4FCTA 1H9JA 1FPMA 2C98A 5AJ3Q 5LMNL 3H3VH 2FFQA 4GOKA 4V03A 3IQWA 4WOPA 3LLUA 3JVVA 3QKUA 4YC7A 3REGA 3UKDA 1W36B 4B3RL 2OE2A 4LJ4A 1T9HA 3KXIA 3QKTA 4HAUA 1P9WA 2UKDA 5M3FG 1GFIA 1CF4A 1KMQA 1SHZA 1WB9A 4DLXA 4QBIA 3Q8DA 1SR3A 1VG9B 5H1SE 2WWHA 3I56A 3T06B 2ERXA 4DDWA 3W6PA 1KK0A 1VDZA 2FGJA 3SYLA 3RS3A 4C3ZA 4DSNA 4RZUA 4ASUA 2NPIA 2JLRA 1Z5ZA 4JLJA 4JVLA 1UE1A 3RSLA 1I2MA 2ZE7A 3GJ7A 3GJ0A 1GP2A 4ACAA 1TADA 3RLFA 2PBRA 2J9RA 3H0GH 4KYIB 2XGJA 2JK8A 1TWHH 2FV8A 2DN8A 3WRXC 5DNYB 4JI1Q 3AFQA 5ELNA 3NTUA 5BYJA 4KVAA 2JA5H 4DR2Q 3J80c 2RCNA 1U0LA 2VSOA 1G17A 2FDCA 5K8IA 3AGQA 4HUTA 1ZIPA 3O8DA 4A1FA 1CLUA 2QBYA 4LF5L 4MQBA 5GJWC 2FZLA 1JR3D 2WWFA 4DV5L 4JI2Q 2ERYA 3DMNA 3EA0A 3SE0A 3SFVA 4KKUA 2ZI6A 4JLNA 2W6JA 4DLWA 2PI2E 4EJSA 4KITB 4QBGB 1T0HB 1Q22A 2N3SA 4LF4L 4MRPA 2D5DA 5IHPA 1HA3A 1FX0A 1X86B 5DE3A 2CEAA 2DNCA 4BBSH 1E9FA 1TWFH 2VP6A 3ZQJA 3KDSE 4ZDJA 5FBVB 5FBRB 5JSZA 3S17H 3JAMi 1IN6A 3CWQA 3ULJA 3W5IA 1OT3A 2J0QA 2ZM5A 1CKNA 3CCVA 2A5FA 1OSNA 4HAZA 1RPZA 1W7AA 1GITA 1GUOA 3SBDA 3ZZTA 4TLDA 5GJVC 5D3MB 1ZUNB 3FOZA 3M4OH 4LGMA 5FTJA 3MEFA 3UIEA 3UWKA 4A2QA 4Q47A 2NTYC 1UE6A 4P74A 5IP9G 3AB3A 4I1VA 1KZGB 4OQNA 4EKDA 3CKLA 1XB2A 1E24A 1P72A 1IQPA 1JEEA 5JJKA 3CCLA 5H70A 3SHFA 4GN5A 2QRNA 2IWRA 4DLVA 2GJAA 4OWWB 1H95A 3D31A 2DBYA 4LX0A 5TB5A 1X6OA 2MNAA 3DLLA 2FA9A 1R0ZA 1NLFA 3NBYC 2BA1A 4DT1A 5IP7H 2EFGA 4R9UC 2IS4A 2GCPA 4M1KA 1N36Q 5CYPA 3K9LA 4AIMA 4ZIRB 4LC0A 1E0SA 2ASEA 3Q8XB 1KDRA 3N2EA 4EUNA 2NVTH 1CSPA 3HOWH 4V02A 1BDOA 2FEOA 1O7IA 4A3CH 2OEPA 2ZIAA 4OHVA 3X1DA 2BM1A 3CMAA 2EFHB 1I4LD 3RWMB 1ZNXA 4A3EG 4A3BH 4IDQA 1WI5A 3S1RH 2B92A 2PT5A 4D4JA 3A74A 4URXR 5CLLA 5IT5A 4JSYA 5DLQE 3KJPA 3WWVA 5C4XH 1W36C 1HZAA 4YMSA 4JBWA 3U7GA 1F48A 5DYIA 2X19A 2A68D 1NIJA 4CEJA 2AXNA 4DR1Q 4TTRA 4B74A 3K7AH 1VIAA 5KNCA 4HB0A 1YR9A 3AVOA 4OYHA 3E9IA 1S1MA 3W3ZB 5JWOA 3L0SA 4JLAA 5TV2A 3F8TA 3VR4A 3X1YA 2R93G 4LWCA 2UUBL 2W2XA 4IOJA 2VUMG 4HJ7A 4QBFA 1M1YE 4XTRA 3R9IA 3U60B 1KSFX 4PZ8A 1IHUA 4P4SA 2FNAA 2HLDA 5C0XI 4AYWA 1U94A 4BA1I 5GAGC 4DCVA 1US8A 2A5DA 2E1RA 2NIPA 1T5IA 3QVUA 5EP3A 4BBRH 4KFRA 4DUYQ 5G3ZA 3WYFA 3ZZUA 1W47A 3IQXA 3E9HA 2O8FA 2E2JH 2OILA 3IEVA 5LPNA 1WCV1 4LV8B 2H16A 2WOJA 3RRNA 2W2TA 1AS2A 1F60A 4CVNA 2JJ2D 5K8TA 1Y63A 1A63A 2V1XA 4P4SB 2DB3A 4ARZA 1NBWA 1KI7A 3GFPA 2ASBA 3JZAA 3P4XA 4TKOB 1RKBA 2FU5C 2XX3A 2B63G 1N33Q 2LWIA 4LFCQ 1IW7C 2YJTD 2EFCB 3G5UA 4M8NE 3OEEA 4GOXA 3J7ZC 4MKIA 3ZQ6A 1YR7A 3FKIH 1XMQQ 1YZNA 2JQOA 1OIVA 3PEVA 1SRUA 4HLCA 1N6KA 4DZZA 3ZVMA 4Q7MB 2QL6A 3NVAA 3SFZA 1F2UA 1G3RA 4D26A 1PUIA 2PX3A 2ZVPX 1O78A 2IS2A 3OAAD 3WP0A 2A8VA 2E5LQ 1S0UA 1XNQQ 3MD0A 2VP4A 4IXNA 5IYCG 1KNQA 5FTMA 3UMFA 4EPXA 3BGWA 3O8BA 4UNQA 1W4AA 3AH8A 1QHIA 5AJ3L 5LMNQ 1U98A 1X8JA 1NKTA 2QY9A 3ZD6A 4JL6A 4QHTA 2DWQA 1YHNA 1Z6TA 4OWTB 2NN6I 4DK6C 2FH5B 3QEOA 4JLMA 5FTLA 4LV6A 5A4JA 3LDAA 2EJFC 2JEBI 2K75A 2XXAA 1IYJB 1K8AC 5JEAH 1VQFA 1CR4A 4FMBB 2JCSA 4Z1MA 4A0RA 3OE7D 1PYSB 1NSTA 2FOLA 1TU2B 3GLIE 5DIFA 4WIAA 4WJ4A 1W46A 2UXDL 3PO2H 4A4DA 4UP7A 1SXJB 2QE7A 2RHSB 3FMPB 5IWAQ 4AKHA 1KAOA 2ODEA 2PNHA 2GZHA 2V9PA 1SE8A 1JNYA 1I6VC 2L15A 3FMOB 2R7ZH 2AFIE 1IXSB 1NN5A 5CM9C 3MXUA 3N70A 2PEZA 4LYJA 4P3YA 4AG6A 1M7BA 5GAHC 4G3XA 2ZRJA 4A3JH 3EZ2A 3VKGA 1GUAA 2P6RA 2JA6H 4EQ6B 3THYB 4LF5Q 1EIFA 1EYGA 4IDPA 4OJQA 2FMXA 4Q7JB 3J80i 4TT3D 4DR6Q 4OQXA 3DO6A 3TLXA 4CEIB 2Y8EA 3DKPA 3JVUA 4H0LC 2BH8A 4RMFA 1E2JA 3TSOA 3B60A 1T5EA 1NN0A 2BJWA 1G64A 1X1SA 5B57C 1D5CA 2KJQA 2P6NA 3GTQH 3AVXA 4D80A 4O3MA 4MUAA 5DN6A 5FBWB 1YNXA 2JA8H 1CTQA 2G1JA 2EVBA 3X1WA 2IX1A 1L1OC 5E4FA 2NZOA 4KMUC 1IY2A 1JBKA 2H8KA 1VHTA 4A0FA 1GWNA 4AY2A 3FKIG 2JLVA 5K36H 3EZFA 4LHZA 4N0DA 1W3SA 1WCMG 3QY0A 1Q3HA 1G16A 1PZNA 1P16A 2AKYA 1ZKOA 5C0XJ 4X8HA 3U3RA 3B1VA 4LBWA 3PXGA 2BDTA 3B1WA 1X9NA 3RYTC 1X8KA 4LDJA 2P67A 3BH0A 4JBXA 2R44A 5SZIA 1UEBA 2OQKA 1KMHB 3R8FA 1DAFA 4KHPQ 1QUQB 2KE5A 2JLSA 3QQ5A 2EXDA 3TUJC 5HZHA 3K0AB 3QXHA 4Q5IA 1ZU4A 3ONWA 5EP1A 3CNOA 4A3IG 4LK2A 2C8VA 4G7ZC 2RHQB 5LB2A 1P2VA 1OXVA 4JBKA 2C04A 2ODWA 2ANBA 4KO8A 1JR3E 1SXJA 1LS6A 3OHMA 5EE0A 5J4LA 2ATXA 1RVDA 2R92H 3K0CA 2R6AA 1X55A 3HGBA 5JEAJ 1NLZA 2C77A 2QEQA 2QP9X 2J7PD 3PCRB 3E70C 4FW9A 4OL0A 3CX8A 5KDOA 1YITA 3AF0A 4GRAA 2WAYA 1NTGA 4E07A 3EZ6A 1EWRA 1EUJA 1PLJA 1TF7A 4TL9A 3ZVNA 2HYIC 5TARA 4CRWB 4IW3B 4OI1A 4DCUA 1YU9A 2BEJA 3UE0A 3I4MH 3KUCA 4TTQA 4U7DA 4X62Q 4PO9A 1GUSA 1UF9A 3AVPA 4OHYA 2KCCA 3BC1A 3VX4A 1D9ZA 2JAQA 2VF8A 4JI7L 3FVQA 2HIVA 5G53C 3UMSA 1II8B 2BCJQ 3BORA 4C0SA 1N34L 3GLGA 2GVDC 3K0AA 2FXQA 4MGYR 4A3LG 1VQKA 4DLSA 1UEJA 4DR1L 1SVLA 1KXLA 5GADl 1ETUA 1OXTA 2WM9B 2Q0HA 4PPGA 4JI1L 1KYIA 2WFWA 4C7OA 3H2YA 1ZM4A 5M5XH 2V1UA 1YJNA 2IYXA 4GS3A 1NBMA 4Q1BA 2PMDA 2J1LA 1XCMA 4LBYA 1IN4A 1JXOA 4HI0E 5L3QB 5C46F 2GDJA 2CWAA 1GUGA 2KHJA 2XOKD 1JQLB 4Q1AA 4EPTA 4RJLA 1HEIA 3GLFA 1Q21A 1XTKA 4TTPA 3TREA 5LB4A 3LNNA 1A4RA 1EFTA 1JPJA 3T1OA 3K0SA 4D25A 2WBLC 1TKWB 1VCIA 3GLHB 3M7NA 3KB2A 1E1QD 3KB1A 1LUZA 2J0SA 4A8JB 2MMCA 2PJRA 4AIIA 2UXCQ 3LA6A 3UE1A 4ZCIA 4KFTA 2IY5B 3CX6A 3QBTA 4M53A 4OXPA 3AF2A 5FOVA 5J47A 4US2R 1SKQA 3TGPA 2Z4RA 1L1OA 4PHTA 3CRVA 1OXSC 5J4KA 2ZRLA 3CRLC 1KZ7B 4JG2A 3PR1A 4ZPXA 4B3CA 3AKCA 1WCMH 2OTJA 1N5LA 2QPAA 4BZXA 4DLRA 1CI3M 4IFDH 1KO7A 2BBOA 2QF7A 2IHBA 1KOFA 4KJZA 3LLMA 3KFUA 2DWPA 3RAPR 3RRYA 4KN7C 1Z0AA 3THXA 1GOTA 5JHHB 1ASYA 4PHGA 4JI6L 3HOUG 2L0XA 2ZS9A 3OIUA 1G6HA 4JV5L 3LFUA 1Y69U 1VG1A 2ZJRA 3TW8B 3GTGH 1ZD1A 1KI2A 2XZPA 1II8A 5FR1A 4JI8Q 2G9NA 5HCNA 4JYAL 4TYWA 4BY7G 3BH7A 1H9RA 3ADBA 3LD9A 4OX9Q 1W4BA 3B1ZA 4OQMA 1UJ2A 2G6BA 3IO5A 3VMFA 4PAOA 3ULPA 4I4LA 3SGIA 1GRRA 1XDBA 2JIZA 4POGA 2XITA 1CS4C 4RD6A 5EJEA 1M34E 4YY3L 2QG6A 3BS4A 3VTKA 5LMUL 1AM4D 3LRPA 4C2UA 2GILA 3HOYG 1D6JA 2CXXA 3PO3H 1N0UA 2WP8J 1PH1A 1BOFA 2GN5A 1N3BA 3GLHE 3R7WA 4LHVA 3VDYA 2PQAA 4A3FG 2V4ZA 4JI5L 4DV4Q 2HJVA 4B34A 4OO1I 1K8GA 1Y1VH 3QE0A 5JEAG 3KZ1E 1BKDR 1QZXA 4QL3A 3ZIAD 4B75A 2V1CC 4LF8L 1DD2A 1IONA 1H8HA 1KI1A 2PMKA 2ZUCA 3CPHA 4OI2A 3B82A 3O47A 4GI7A 3UATA 1MT0A 4Q9KA 4GNXB 1FZQA 1J6QA 5GAEC 3HOXH 3CC7A 3W3AA 3HU2A 2ZJOA 1P2SA 4URZR 1ZYRC 1E96A 1OXXK 4IOMA 3QKRA 1PV4A 2A68C 3BOSA 2ZRDA 4LJ8A 4K0KQ 1BYUA 5J5CA 1VKJA 4LFBL 3FYHA 3P4YA 4HJAA 2GVZC 5L3RA 4F92B 4LPSA 4H1UA 3GLIA 4DV0L 1TWGH 4A6XA 4O2RA 1I94Q 3L0OA 4QGGA 3OIWA 4M0LA 2RGBA 5F2EA 2RF4A 2XNDD 1CKEA 3WBJA 4UXHA 1WBBA 3R7WB 4DAYB 1P75A 1HTPA 1KD1C 3S1NH 1OXUA 3L7ZC 1KO8A 2ZRMA 3FTQA 3FB4A 3PUYA 2EW1A 2QM7A 4OWXB 2XGTA 1N5KA 4QNRA 1FW6A 4ZKDA 2ZYWX 4YXWD 1PMRA 2OXRA 1NF3A 3DHWC 5JWRA 1H9SB 1PH5A 1AK2A 2VW9A 2RHMA 4BUJA 5FBLB 2JA7H 1VHLA 3K9NA 3CW2A 1E9DA 3B2EA 4X65Q 1OH8A 4KI0A 3VKWA 2P5SA 4TYYA 4HIMA 1DCZA 1Q1QA 1FP7A 3P27A 4UXIA 2ATWA 1E2HA 2GKSA 4IOCA 1SXJC 1GDDA 3T51B 3RS7A 3PEYA 4HAYA 4HB3A 3W90A 2E2IH 4DV7L 4YMVA 4FXPA 4IEEA 5B64A 1QG4A 1YRAA 4A3IH 1E2VA 4FCVA 3QUSA 3ASZA 4ILEA 3SS8A 4C3JH 1QVCA 1YZKA 3IUYA 2LKDA 1YJWA 3DM9B 2GJSA 1U81A 3CF6R 1XMIA 2ZRPA 3GD7A 2BBTA 4FWIB 5AJYA 1LM0A 5FTNA 4LWZA 4XWAA 1EWHA 2R6CA 3T34A 3TAUA 4MYHA 3ZVRA 1YJ9A 1ZNWA 1FNMA 1G8PA 3PUWA 1ESMA 4OGQC 1NP6A 2QSZA 4A3BG 1TWCH 4GKJL 1A5TA 1GNQA 2HF9A 1TL7C 3QNUA 2W83A 4Q4JB 1YZTA 2WTUA 2JA9A 5E7NA 1LTLA 1ONLA 2CCJA 3KJEA 2OT3B 4V0MA 2OCAA 3I7FA 4LF7Q 4URYR 1PH7A 3LX5A 4A76A 1OFUX 2IL1A 1CXZA 2ZRGA 3HPQA 2VQFQ 4ME3A 4Y0AA 4PSKA 4M1WA 3FFAA 3VAAA 2ODNA 5K8UA 1VG0B 4QXAA 4RKFA 1FFHA 2IF2A 1WBDA 1ZNYA 1W4RA 4FMDF 4AYBE 1DGSA 3KDFB 4P0TA 5FUYA 3ZH9B 5JSZB 4LJ6A 3I8SA 2YKGA 2V55B 2OSBA 4ITRC 1Z0KA 2JEAI 2CWPA 1N2CE 2FZ4A 1R2QA 1XBTA 3CCMA 4NKRA 4D2IA 3CCSA 1VQJA 1WP9A 4UXJA 1NY4A 2YTXA 3K70D 2NMVA 4G01B 1PVOA 1NMXA 3ZS9A 4OHXA 5IYDH 2PLRA 1FGUA 1HZCA 1JJCB 5IYBH 1LVGA 1IJFA 2ZTEA 1KK1A 3TZUA 1XTSA 5ELOA 1S96A 2VHTA 3DEFA 4DK1A 3Q85A 3CIOA 1VS0A 4P73A 1EX7A 4LJ7A 5FR2A 2UUAL 3HOVH 1E2QA 4KV9A 5J40A 2F3TA 3S1AA 4D0NA 1HJPA 1Z47A 2ZAOA 3U61B 1Z2CA 3D3QA 3HP1A 5TY0A 3T1VA 1Z28A 4NCNA 4UJ3A 5J4HA 1ZBDA 4JI2L 4LCBA 3THWB 1JJ2A 1FNNA 3DDCA 4HUQB 4TLAA 1VQHA
chains in the Genus database with same CATH superfamily
2C7PA 1Z3IX 2WIBA 2XRMA 1GD1O 4K6FA 4GLVB 4UCQA 1ZK2A 1PHPA 1LBQA 4BMXA 1Q1ZA 1VLZA 1Q0UA 4ND8B 2H63A 4PFJA 3S2IA 4BE4A 5JAZA 3D3RA 3WB9A 1KJQA 2B30A 5K3FA 4Z9AA 1IIRA 4LYHA 1CY7A 2GAAA 2UZIR 1ZXBA 3MTAA 2FSIA 2ZM6Q 3DZDA 4OMFG 4Q3BA 1BKBA 2Z6VA 3HUTA 4HLQB 1X7YB 3E05A 2V98A 3ZWAA 1GIAA 1JIQA 1Y1QA 4YXWA 3ZGNA 3DLIA 4QKQA 3PC8A 3CRKC 3HOYB 2V8BA 4DEXA 2ZJ4A 3I39X 5JYCA 1JOOA 3NORA 3D8BA 3NE5B 5K3FB 5BWLA 4JK3A 1CU1A 4YAJA 1M33A 1U6IA 3RU3A 4F5WA 3HP3A 1KSJA 2I7VA 1G1AA 1GCAA 2VP9A 4TL7A 4WHMA 3P52A 3VGJA 4YK7A 4MP8A 3WHPA 4UVEA 4EY5A 2M6RA 4I19A 3HVKA 1QG6A 3IKMB 4KQGA 4C3HG 3EEIA 3KG2A 4B6OA 3P7JA 2C2KA 2DR3A 1EPUA 3ZZ1A 3NHKA 1MZVA 1PEYA 3A5ZB 3GTLB 3D6MA 3HNRA 4IFIA 2KHSA 1JEYA 2Q2WA 4EA6A 4X1IA 2WG2A 2VBGA 1PNTA 4QFCA 1PRTD 3B85A 5G4KA 2BSQA 4XCQA 7ABPA 2I4MA 5DM73 2KB0A 1A8IA 2XB8A 5C0XG 2AG6A 3QNMA 5BV8A 3LO8A 2G5TA 2SICE 5D14A 1PYOA 3IOEA 4J7AA 3RSGA 5H5JA 5C5EA 4L51A 1FMFA 2VXCA 2VJCA 1EZZA 1GO3E 2Y1DA 3AR4A 4OY3A 3SY8A 1ZGCA 5HPYB 5I3ZA 1MCZA 5F9HA 2OO5C 2Z30A 1W93A 3WIBA 3WYNA 2H5LA 4J07A 4NU0A 3WMWA 3DOEA 2YC2C 4EDFA 4YX9A 2KQUA 3HEJA 2JB9A 3IMKA 3CVWA 3CVXA 1CTMA 3S2HB 1CY1A 4TWBA 4EX7A 2XQJA 1Z13A 3VA7A 3ZJ5A 2FEWB 3D5EA 3MTSA 2NNLD 2K7VA 1T35A 2Q8IB 4X9XA 4TOIA 3TUIC 1Q7CA 2W5UA 3L06A 2I6TA 4B3DA 3C45A 2P9BA 3CUWA 5C4IA 5DYGA 2OCPA 2MWMA 3RW9A 5LCXA 1GQ2A 1LTID 1WMSA 2EEZA 4QA9A 4CLOB 1AN9A 4G0ZA 3WRYC 1PWYE 2I1WA 2Q29A 3IPRA 3DMDA 2ZZNA 4L4ZA 2PIDA 2QI9C 5FUBA 4H02A 4UEWA 1RCTE 1KYTA 5BQFA 1PV2A 1PK7A 2PU7A 1TEVA 5HGQA 3MFGA 4QT0A 1IB0A 2ADOA 3OJWA 1GUTA 1G8YA 1JQAA 3RQSA 4UUMA 1RKNA 3RC3A 2B3TA 3K20A 4M9SA 1LPMA 4OVKA 3T54A 4NPAA 4FR2A 3TFQA 1E2LA 3T3OA 4FP9A 4LXHA 3WICA 2IH4A 2F1HA 4OHMA 2ONZA 2YN4A 1I2ZA 3TP7A 3L3OC 2HT6A 4NYMR 4YHBA 3L1KA 4OB8A 5SICE 3ZS8A 5J2UF 2CMDA 4BBRG 1NRIA 3ZLJA 1J9ZA 3EQ7A 3K9WA 4Z8YA 3PCTA 3I52A 2VYFA 3FWZA 4OQLA 4YCSA 4ES6A 1NJ2A 4E3ZA 4P4LA 5K51A 3PNMA 5JZSA 4ZQBA 1OQAA 3AOGA 3S8MA 1VMAA 3KPUA 1NV8A 2OQIA 2LR0A 1VQ6A 1DKRA 1W0JD 2GN4A 1ADGA 3FAKA 4L72A 3PDIB 4IPHA 4G1UC 5DRTA 4RKEA 5KAMA 4EG1A 4B3GA 2VSFA 2WKRA 1LTRD 2GK6A 1Z8HA 3G2HA 4FDMA 4MMYB 4MVWA 2BOSA 4HS4A 4E09A 2NB0A 3MD9A 4JZKA 1JF8A 3GVCA 2P5ZX 3M6AA 3SR3A 3EVZA 3MXNB 2HU8A 3F7OA 1B50A 1PDWA 3K05A 2LFNA 3EBLA 1F9RA 3PP8A 4PVDA 4AXBA 4QY7A 1YXMA 2WJJA 3C3YA 1LT5D 3I34X 2HTFA 4JD5A 4QELA 4C7VA 1Y6FA 4ZICA 5B1EA 1ML3A 3ZXYA 4UUPA 4Q7EA 3TQTA 4LFAQ 1QQBA 3NETA 2VHQA 3JAWB 3WYCA 2RJNA 2DPHA 2N9UA 3CLUC 4C0JA 2WWIA 3FEWX 5IKXA 1FX0B 4O8CA 4RJKA 5BURA 2ZUVA 3B12A 2C4TA 2BMWA 3BFKA 4WFN3 1U3TA 3GA5A 1C8BA 3IUNA 4L4UA 4KD3A 1R9TH 2X0RA 2H1CA 3PVSA 3AEQB 3Q3GE 4FI3C 2P9QA 4UM9D 2FCRA 1Z8NA 1NY6A 3WGGA 1NVGA 3RIHA 4BEVA 1Y42X 1TYCA 3NHYA 2P8JA 4EGCB 1WYDA 1QOZA 2BELA 3AR9A 2EHDA 1PK9A 2WWVD 2ZRBA 4BXOA 1ORDA 2C92A 3CFYA 4AURA 1UC9A 3O91A 1L0XB 2ZXEA 2EKPA 4HYYA 3Q10A 3W8RA 1SYFA 1V7QA 3FPFA 4FDTA 3T7SA 4CLRB 1EIZA 3QNWA 1BA2A 1SBNE 2CNDA 1XLTC 4E5MA 1NT4A 4MWZA 1EEID 1R5BA 1X1CA 2D74A 3HEAA 5A5DA 2JKYA 4CIDA 2F0GA 4MVYA 1MJFA 2OGWA 5HX7A 4OAQA 1T1JA 2VZEA 4CNQA 1J20A 1ZCAA 3QBDA 4LRUA 1WTRA 1ACLA 2O06A 2VUMB 1B74A 2QG9A 1J0CA 3ORSA 4U63A 1YE5A 1KKMA 2XWQA 2GNAA 4LZNA 3VC2A 3WGJA 1NVVR 3DE5X 3NK9A 4UHVA 4IFTA 3SJCA 3GFBA 3T52A 2O2YA 2XJ9A 4C7BA 3D4RA 4EY7A 5JXGA 5DBOA 4W82A 4C1NA 1L1FA 3MJHA 2ID0A 5IE8A 3J81E 3BK1A 4IX9A 3E2MA 2PWBA 4XYQA 2EYQA 2IHUA 1UJ5A 3GNLA 4FNGA 2ZYTX 4XWYA 5DGTA 1DTSA 5HTKA 3VKUA 3GZJA 4TMZA 5BO5A 3V1LA 5JECA 4U7TB 3KFVA 4Z1MD 3VUEA 3Q8MA 2BN4A 3O2JA 3R7AA 3JQ7A 3S2DB 1LSUA 4EJ0A 1TPYA 1BH2A 2IU4A 1JHDA 2HO4A 4RLHA 2O2DA 3C5EA 3MINA 3I9V6 1E9BA 1UJ4A 3GUHA 4RZQA 5DXJA 2C1XA 3T7IA 3UDFA 3KP1A 4GNKA 16PKA 1JKJB 1XRLA 2F62A 1STBA 4URUR 4ZPJA 2CXHA 2QORA 5NULA 1X56A 3UV3A 5K8LA 5JJZA 3N8GA 3BWCA 6Q21A 3C1FA 3CTPA 4J2TA 1H2YA 4MW0A 1L4GA 1U0GA 2W0SA 3G88A 1SNQA 3CH4B 2NZ8A 5IP5A 1L8XA 5EE3A 3TTYA 1N32Q 1AHHA 2CF5A 1NJ8A 2GETA 4QGBA 2EBFX 3KEOA 1BJTA 4EB0A 5IJWA 2FJ2A 2Z2IA 4HUJA 5JG7A 3IUQA 5CFOA 3M8KA 2PN1A 2Z2ZA 1B8NA 1CZGA 1M6HA 1WVGA 1YL6A 4PPFA 4CXMA 3SBEA 3SNHA 1TF2A 3OTOL 1HNWQ 1UJNA 1Q1GA 2RONA 3D1LA 2L9HA 1U3UA 1QKJA 1N0VC 5KYWA 4MJLA 1AKUA 3C41J 1F1JA 5NUCA 2RHDA 3JQ7B 3JYNA 4ZGBA 3D6JA 3LWNA 2IH5A 3HJFA 2LXJA 2QU8A 3ZHXA 3TD9A 3MERA 1CR2A 1Q82C 1TIBA 2XTZA 1DE0A 1E5TA 2JZNA 3D4PA 3OZXA 3P9RA 5EYPA 3KEFA 4B09A 2C7RA 2G1PA 3MTEA 5T41A 5A5GA 3OFSA 4RCZA 1RWKA 4P5DA 5M04A 1TJPB 1KBOA 1WPRA 2IEIA 3HN6A 1FXSA 4LHSA 4AJ2A 4KSCA 3VDQA 4J9VA 1L7NA 3C3JA 1U4RA 2PL5A 3PWTA 2VHUA 4MAFA 4O08A 5FH9A 2ASVA 2AD1A 5ELXA 4RZ2A 4C76A 3WKDA 2HA0A 4IIBA 1PH2A 4JLVA 3SM9A 4Q82A 2QV7A 1QLWA 3JAKB 3U4MA 5JAOA 3ZWCA 2FN3A 3PEEA 5EE5B 4CV2A 1P29A 4D92A 2QXTA 5IS2A 4G5XA 4CM1A 2JGLA 2OAEA 1DO8A 1RAGA 3DE7X 1H9CA 4WKGA 2C7VA 4MS1A 3FKJA 1X39A 1IHOA 3DMFA 4KRGA 2IQ5A 1VP9A 2RVLA 2LPMA 3A8JE 1KJ8A 1UOQA 3ZYYX 2YZ2A 4H7DA 3PENA 5EIHA 3GMTA 2DHRA 1EE9A 1IXKA 1C4OA 1UXGA 1NOJA 5D84A 3FTCA 5I5GA 2OK7A 2Z9HA 3OZIA 3CD6A 5K0BA 4NDNE 3S2HH 3BHIA 1QGZA 5CT8A 2FTKE 4RSGA 1LKZA 4R2HA 2A3RA 2EP8A 3C1OA 4GR4A 4X95A 3RIEA 3MT0A 3PGKA 2X5NA 1OXBB 2EGGA 2IYVA 1O6FA 3BU2A 3NV9A 4B80A 3KHUA 1BCSB 1PYGA 5BR1A 1NM5C 2GBLA 1PBNA 1RWXA 3OBIA 3U39A 2MSNA 3H8SA 3L6CA 2IYQA 2RB5A 4NONA 3IBCA 2GNOA 5F3DA 2K5UA 2OF1A 1W0JA 2QLNA 4QRHA 3TPZA 3CO5A 4A8TA 1DAIA 1QDLB 5DBHX 5SY6A 1OU4A 1ZH4A 2I4TA 1PG5A 4KR3A 4RH6A 2VS1A 4YT8A 4ZZ1A 3BAZA 3CMEA 4E2XA 3M4YA 3M6MD 1D4AA 2CB9A 2A6EC 4P33A 4OSPA 7YASA 5K2MA 4TWIA 1N6NA 3HSYA 3K5WA 5G2OA 5JCZA 3JQDA 1RXVA 1Y0BA 5DI3A 5HUQA 3KQPA 1P33A 3E3MA 1M74A 2KI5A 3RK0A 2DH5A 2D5BA 3MTBA 5LNK6 1UBEA 2PL9A 1B26A 3WK7A 3IE1A 1J00A 3IMFA 2ZTDA 2CDNA 3HFRA 4L5QA 1E1DA 2JLYA 1F4PA 1A2KC 2P9GA 2CB0A 1RZ3A 4G9GA 4BJHB 5FL7D 4JXXA 3SM3A 3H86A 1RKVA 1ZU5A 4JVOA 3JZFA 4QULA 1CZOA 1LY1A 3TQCA 5H3CA 4P58A 4CBVA 2GA9A 3AFMA 3VH2A 4IUTA 3KVRA 1CQJB 3ZVLA 4I1IA 4QM7A 2G9HD 4R1QA 2ZUBA 4D99A 2K04A 1QIJA 1RRFA 5TMBA 2IUYA 2IYYA 1VE7A 1K98A 1NVUQ 2CUNA 3C98A 1SC3A 3GVHA 4JL5A 4YUVA 3A5UA 1U65A 1S5ED 2PX2A 3F6BX 4DG8A 5HUHA 4B8WA 4DADA 2IYWA 3T5CA 1YS7A 4IJLA 4RWSC 1XQXA 1GA1A 3IEIA 1GCUA 3OU7A 3BTVA 3G1UA 4RA9A 4EPYA 2YZNA 1KMHA 1FQJA 1TO2E 4DXAA 1TCCA 3V2TA 1EKXA 2CL5A 2B8NA 2RI0A 2XA1A 3V3TA 4A27A 1NVVQ 2I0FA 2X58A 4NAVA 4HH3C 4HIDA 1K92A 1M66A 1Y98A 3WI7A 5HYVA 2DQZA 3G7SA 3D0OA 5KIAA 4YFVA 3C3PA 2R5NA 3CB4A 2H2IA 3FUVA 3HOUH 5HBGA 4G84A 3B6IA 2F03A 3IQEA 4JJZA 1L7PA 3PWZA 5ALWA 5EZ6B 3W8EA 2Q5EA 4D9EA 2F9FA 1BE1A 3LYLA 3B9RA 4Z9YA 4ND2A 1SN7A 3G13A 3MRTA 4F9EA 1GPKA 4BBPA 1QZUA 1RAIA 2HADA 2G77B 2JCXA 3MZ5A 2PBZA 3GO4A 4RCVA 1GQYA 3EGVA 3K1ZA 1I94B 2VN8A 3IHTA 1J8QA 2AOWA 4RJ2A 4TMTA 1T9GR 1W2WB 3I9V1 3QLTA 4RCNA 1GDHA 1I4WA 1U8AA 2CUKA 3AB8A 2IPXA 1YIDA 3G2MA 3OOHA 3ECCA 1KEEA 2WJ6A 3TTTA 3NJRA 4UUAA 4G8CA 1ZI9A 4A6PA 5JH7F 5JI2E 3F73A 1C8CA 3OURA 4JEHA 3UUGA 2QAJA 2WAQG 3RRMA 1QHNA 4BZPA 1OYVA 2JJ1D 1W44A 3DOFA 4ABYA 2I2FA 1BCPD 1WTHA 1E7WA 3MQ4A 3K80C 1Q7BA 1SUBA 3HLYA 1VA5A 2BT4A 2P2SA 3DVRX 4LE1A 5AHKA 5LIRA 3IEMA 3VX3A 2QG4A 2ZAGA 4F4DA 5CW2A 4B3XA 1PT7A 2FR8A 1DAMA 4I8IA 5JCXA 1HDOA 4G0YA 4MNTA 4WW0A 4KQHA 2ZR9A 3M6IA 4FGKA 2GLTA 2G9QA 3A6LA 4JI8L 1W2HA 4L8LA 4R31A 1WAMA 2Q4OA 3KF6B 3NXKA 4KPGA 1BWQA 2VT7A 1R0XA 4QTZA 3A0RB 5AHXA 4ARBA 4C0BA 4YUAA 5FJJA 1WUIS 1FP4B 1ECJA 1QTIA 1SKYB 1YA8A 4YUYA 3QJGA 3AVQA 4RD2A 2EFEB 4LVNA 2CFIA 3ZE2B 1STOA 1V2HE 5HEKA 3WK9A 1VIYA 5BNIA 3K9GA 1NKSA 4MV8A 2N78A 2HA5A 5CX1B 2R1UA 2VNHA 4KKXB 1EM8B 4MWBA 1BJRE 4DM4A 1BS2A 2AD5A 4YP7A 4AKTA 4LG1A 2BM9A 4R7ZA 5LMUQ 3ZV7A 1R4NA 1D1SA 3LWUA 4W5HA 1CSEE 3ZU2A 3HOWG 5JFOA 4WVLA 1RI4A 4A0GA 3EZ7A 4A2CA 4DIUA 1E3WA 2C82A 1XD2B 5BN4A 1BTOA 1C3JA 5DW3A 4JBYA 5P8WA 1V39A 4R51A 4V0ME 3W2EA 2XHEA 1PR1A 1WF3A 2REBA 2VL7A 3RU2A 4YMLA 3HVHA 3GZNB 5LA6B 3E8SA 4DPLA 1U6KA 3DZIA 5L4LA 2G1KA 4TKUB 1NE7A 3HUFA 1YE8A 3DWPA 4HIKA 3DFMA 3HRIA 2XQIA 2ZWPA 5AIBA 1LSOA 1O89A 2R6DA 5H4GA 4RXMA 4ID9A 1PYBA 3IDZA 4RABA 3KL4A 4YP1A 5AYVA 4D4MA 1H2AS 3G0BA 1F38A 4NHEA 3Q72A 1FIUA 4QDJA 1UUPA 1JECA 2EQ5A 4MPRA 1VHJA 4JP8A 1XRPA 1H2BA 2VDLB 2R87A 3WNVA 1XEWY 3F2BA 2XUPA 4KN5A 3NEPX 1V7ZA 5EZ5A 4LFBQ 3OX3A 3EODA 1LBSA 6AT1A 2YV4A 4Q19A 1UM9B 2CNWA 5ESWA 5DKFA 1JMCA 5M5YB 3KYCB 3Q8WA 4X60A 3M0EA 3MXPA 2YYZA 2BH2A 2ABWA 1OKKD 3EVGA 3PDWA 3X2FA 3UMMA 2J0EA 3SS7X 5IGFA 4KLNA 1NNLA 2F0SA 4MDEA 4TRJA 1W2GA 1UMKA 1ULBA 4MV6A 2OG2A 5F5XA 4OQEA 5HZMA 5TEVA 3AEYA 1K0UA 3BM5A 1RQGA 4JDUA 4P22A 4FYYA 3EPRA 3FG9A 3HXTA 2HU2A 5JVDB 2W11A 4JI3B 3JALA 1I24A 3CINA 4N7RA 3WYGA 3KYJB 1VMKA 2AUMA 3OLVA 2F1IA 1MO3A 4JB0A 1IKLA 2EP7A 4M7WA 2FPRA 1ZLXA 1F0KA 1BEUB 1QFJA 4JKYA 1Z75A 2CLFB 2QUAA 5AO9A 5KAPA 4B32A 1N1GA 5DCYA 1CW2B 1HZZA 2WHPB 4QRDA 4QHYA 2G0NA 2YU9H 4RCOA 1ABEA 2FN4A 3EGDA 1PR5A 4H60A 4K6MA 2C97A 3T95A 2QTTA 3TI9A 2KBEA 2XBLA 4YPVA 5LMCA 1YVDA 4EPRA 4LS3A 1LI7A 5JARA 1M8FA 1KDTA 2PQ2A 2QMUA 2ZRFA 3KBBA 2PZUA 1I3NA 2PCFB 1Z6YA 3I2JA 4OXNA 4TS4A 1RWOA 1TIPA 5CGZA 1XD2A 1C4KA 1KQOA 4R9SA 4EMUA 1KJNA 1P39A 4CZ2A 4O5OA 5AM2A 3A25A 1ONPA 4A3EB 3DO5A 3WSWA 5KEEA 4GOND 4Z53A 2KCNA 4DIFA 2WJVA 2X8LA 5I9TA 2K87A 5KJFA 1TYBE 4EFNA 5DWVA 1OX4A 1TMYA 4R2MA 1DHRA 4RTRA 3DT6A 1ODFA 1S2IA 3PVCA 3GFSA 3GLGE 3M2PA 3LQYA 1C4XA 2IYZA 4RJTA 3C3EA 2YY6A 1SVUA 1K3BC 1DG3A 3ASYA 4GPAA 4CKWA 5KDDA 1NR7A 1MB2A 3ON5A 4CMAA 2A74C 2XQVA 3GJRA 1PGJA 4INPA 4ETNA 1CF9A 1OFTA 1M34A 1BVHA 3CJTA 1X2EA 2B1IA 2CMHA 3P0IA 4HB2A 1IM8A 4XUEA 3CCQA 1IEVA 2BMEA 3AV0B 2RB4A 1QUQA 3S6JA 3T61A 1ACMA 3EBPA 4NYJQ 2EL7A 4DV4B 1B15A 1KH3A 4YWLA 4LZJA 2B39A 1LFDB 2P9JA 4K1XA 1KO4A 4LMRA 1VMDA 3AR6A 2A1AA 4OLHA 3FMCA 4JSTA 4L6CA 4Q9HA 4YRQA 5CTAA 2KCMA 2C0QA 2I87A 3GFOA 1UINA 5CIQA 1GSIA 4YWHA 2O5EA 1RACA 4CHGA 2JAWA 2F0OA 4ZD6A 1GQFA 4GMXA 1C1HA 2P75A 2VO1A 2VNUD 4UBNA 1S7GA 1SBTA 4RDHA 3VR4D 1R4ZA 1ESCA 3HR7A 2F0TA 1UJMA 1SOVA 2CXQA 2AOXA 3KXLA 4XWKA 1XTCD 4HDMA 4S0ZA 1Z15A 5EHXA 1J7KA 4UAVA 1JSRA 3STWA 3WTCA 2F0WA 3WZ2A 1AA6A 3ND5A 4J6HA 4FDAA 3BVZA 3HN7A 1DOMA 1GAWA 1KSHA 2YN0A 3M3YB 5JZOA 1MDBA 3V80A 5JOQA 1E1NA 2GHIA 1T5LA 1DAHA 1P3JA 5IGBA 1FS6A