1OXVA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 98
structure length 353
sequence length 353
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxvA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxvA01
1SKQA 3EZ6A 3EAQA 4Q02A 2OLJA 4WIAA 1F48A 1X8LA 1Z0JA 5JECA 1KQSA 1E79D 1QHSA 4AQYL 1AA9A 1ESNA 4N3NA 2VSOA 4BEBA 1B8AA 3I4MG 4WJ3M 2IF2A 4A0FA 3WBKA 1SKYE 2E76C 2EFGA 2A5JA 1EIFA 1A82A 1M7GA 1X3SA 1XEXA 1N33L 2C77A 1IXRC 2J0UB 3BE4A 3F5FA 4NYJQ 3TUIC 3F1ZA 1U81A 4R71A 5JI3E 1QVFA 4GKJL 1FJGL 1WYDA 1AZTA 1AQYA 1Z06A 1ZM4A 2ASEA 3DM5A 2HIVA 3OFND 4CEJB 4DUZQ 3RNUA 2IYLD 2ZUDA 4HYYA 3SZRA 4B2IA 4EPWA 5J4LA 1FFHA 5E7MA 4TLBA 1XMSA 3K53A 4DKXA 4PANA 4R7ZA 3BG3A 3W1BA 3A5UA 2A78A 1C9KA 2WKQA 4DUZL 4NYMQ 5ANRB 3T61A 2NO0A 4C3ZA 3PV0A 4QL5A 2Z0MA 2D7CA 3JVUA 3NDPA 1N34Q 5HE8A 4LUCA 2VO1A 3K0FA 3T53B 5L3SB 1AZSC 4Q1AA 3W1GA 4MQBA 3U3JA 2QA4A 3CZQA 4MKFA 4GLVB 4DCTA 3SBEA 2O8EB 1H9RA 2AKAB 2GA8A 2JE6I 1LF5A 2PEZA 2MQHA 3MWKA 4ZDKA 3CMAA 2OE2A 1HQMC 1MR3F 2ZRKA 3PQCA 1NY5A 1JXMA 4JLKA 3M6AA 1KSHA 5FUWA 2CWPA 2H17A 3W8NA 4YWMA 1P7CA 1TTTA 4A3BH 1FX0B 3I92A 3U7HB 1E2VA 2MMGA 2O8EA 3SR0A 1CUKA 1V8QA 1XD9A 5FJ8H 3MAAC 4LZZA 4JBYA 4W5JA 3I55A 4A15A 3WMGA 3ERSX 1G8YA 4BLPA 1YEZA 1QVCA 1A7JA 2R6FA 5GADC 4G7ZC 1RRFA 5B30A 3PCOB 4DLXA 2K14A 3HOZH 1DD2A 3B78A 4XJXA 1FNNA 4DPGA 1A2KC 2G88A 1AGRA 3S1RH 1W47A 2OBLA 4LOAA 4F38A 1Z29A 4Z1MA 1OH6A 1G291 2HCBA 5DHFA 1X3FA 5HPYB 5E7JA 3K8YA 1G19A 4L9WA 4LYAA 1OYYA 3X2SA 5GAHC 2QAGA 3OIVA 3L43A 4GP6A 5FBQB 4A76A 2FN4A 4EPXA 1CI3M 3I4NH 2WHXA 2PCLA 2X77A 3G6EA 1NSTA 4LY6A 5CK5A 3GFTA 5EUMA 2AUKA 2IX3A 2HHHQ 4Y52H 2G1JA 4LJZC 1VIAA 4BZPA 1S2MA 3VR2A 4DV3L 1VQ5A 2VYFA 4TLDA 4KBFA 1Z6GA 4JBWA 1R0WA 1R0YA 2VIIA 2UUCQ 3A37A 3C14C 4M0LA 1HYQA 5A5GA 1UJ2A 1ZUHA 1E2KA 4MRSA 2UUBL 3CWZA 4NZYA 5J5CA 2K5HA 2KCTA 2H1LA 4AYBG 4JBKA 4HLQB 2UUCL 2A5GA 2AHOA 3LWNA 5M3MH 1HZAA 1WJJA 2YTVA 1OFHA 2ODEA 1CTMA 3RNLA 4BBRG 1A5TA 4ZKDA 4HJ5A 3U58A 1TMKA 3J81i 1U94A 1Z7TA 1ZUNB 4OL0A 3JAMc 1P61B 5FOSA 3ADBA 5LMNQ 2VY3A 2W58A 1H65A 4R9UC 4M1MA 3VR1A 3G0HA 4JV5Q 2PZGA 2VQSA 3WRXC 2X2FA 1GFIA 4ZI3A 1Z0IA 5LMNL 4LF4Q 4FMCF 5LMUL 1VYUA 1E94E 4A3EG 2EFCB 2ES2A 4CVNA 4IW3B 4ARZA 2Z4RA 4KKSA 1GUSA 1N3BA 1JJ7A 2K4KA 4LF9Q 1N6HA 1YZNA 4HR7B 1ZJ6A 2NIPA 2YOGA 4KSBA 4I1OA 4Q1CA 3TIFA 1J70A 3FTQA 3FP9A 3TJZA 4GLXA 4HAZA 2Q2TA 2UXDL 2P2LA 2VP4A 1PH8A 3PUXA 1FMLA 2RAPA 3HPQA 4G5OA 4NH0A 4RD4A 1MABB 1SVOA 4LFCQ 4HSEA 1HZBA 3GLGA 2MO1A 3NE5B 4QNMA 2QTVB 1B7YB 3MXUA 3QBTA 2G0NA 1NN0A 1OFIA 3DXJC 3K0XA 2JATA 2JA7G 4TL8A 4A3DG 1KSFX 4S2EA 1L2TA 5JSZA 4QBHA 5BN4A 2ZRFA 4XWAA 3GLHE 3FHOA 3Q9LA 4HB3A 2GETA 3M4QA 4TYNA 2XZPA 3I4MH 3SU8A 2FZLA 2GJKA 2WJGA 1D2NA 4RJLA 2PMKA 4YWKA 1NVVQ 1U99A 3IHLA 2RHMA 1VQNA 1XXHA 4XTRA 5J4YA 3GJ3A 1VQ9A 1Q8KA 1IQPA 3PIOA 1IZ6A 1E2LA 3RS0A 4DDTA 1P9RA 1CKNA 1VCIA 5C4JH 1II9A 2IUTA 3KTAB 1GNPA 4B44A 4Z54A 3PCRB 2VP2A 2KCCA 2HIXA 1KI7A 1JR6A 2E8GA 1N32Q 3EIQA 4U5XA 1YNNC 4A3IG 4Q9IA 3LVRE 2EJMA 1U2RA 4LWCA 1K83H 3BC1A 5KO2A 2PX0A 1Q7YC 1NLFA 4B3GA 2JEBI 1F2TA 2C2HA 2KBNA 4POGA 2RGNA 3W34A 4DLSA 5HCNA 1KMHA 2GCPA 4Q5IA 2ZU0C 4E5UA 3THYA 4QOSA 3A5ZB 4DV0L 1ODFA 1EWRA 4DV2L 1SVKA 3FPPA 1L1OB 2ZRBA 2R7FA 4Q4AA 3CRQA 4K8OA 4TQ9A 2EFDB 1S96A 3GFPA 1AK2A 1NP6A 5BQ5A 2YWHA 3F0TA 2OBNA 4H44C 3CCQA 4DR2Q 5JWHA 4C3IH 1G5TA 1W0JA 4GOPA 2K5VA 4HUQA 4RY2A 4I99A 4TTQA 3NBHB 2WB1G 5CB8A 1W36D 3CRKC 1AKYA 4OX9Q 1G4UR 1FQKA 4YMVA 2V9PA 4QBIA 3SFVA 3CC2A 2XJ4A 4FN5A 4JKIA 4OHWA 3GQBA 1Q57A 4B3SL 3DDCA 3KXLA 1EFCA 4RD0A 3GLGE 4OX9L 1FPMA 3IO5A 3LQQA 3WMFA 5AUPB 2QAGC 2PEYA 1PYBA 3PF4A 1IBLQ 1ZNXA 2JA6H 2QM7A 5LBIA 3EX7C 1LNZA 1VCNA 4DR5Q 1G41A 4ABYA 1DARA 3WWVA 1CF4A 4KJZA 2VA8A 3BIFA 1A2BA 1VQEA 4DV1L 4IFDJ 3IBGA 4P0TA 4LK2A 2IHYA 2DHRA 1QVAA 1KKLA 3PEUA 4DDVA 2UXCL 1E2GA 1XXHE 3MXNB 3AVXA 3V4RA 3T1QA 3V4FA 1Y8OB 1VYTA 4LC1A 2O5VA 2FDCA 1XMVA 4XOIA 1P3JA 2AKWB 2B8FA 4TLAA 5F98A 3T1YQ 2QQ0A 3E9HA 3ONWA 1PH4A 1YITA 2VF7A 2RMKA 1L4UA 4KFSA 3CCVA 1GL7A 2V8OA 1U9IA 4JI3L 1GP2A 2IS6A 1D2MA 1G8FA 2PMDA 1O7IA 4IPCA 4PZ8A 1TKWB 3T1YL 2YJTD 4MKHA 5DI3B 1XEWX 4A6XA 2B92A 2HF8A 1W0JD 3HU1A 3TAHA 3P4XA 4C0HA 1KNQA 4G5SA 4I81A 4R2HA 2GVBA 2FH5B 1GSIA 2H92A 4DBLC 3CW2A 4D2IA 2J1LA 3NH6A 4X8OA 3T1OA 4P4SA 3NVAA 1TWAH 2H57A 2RHSB 2VLIA 2UKDA 5M3FG 3A1TA 4AKEA 4L16A 1Y63A 2GVAA 2PH1A 4I4LA 5GAGC 2Y8EA 1PH6A 1IN7A 4BFWA 3AGPA 3AQ4A 1JJ2A 2R7ZH 3GJXC 4US0R 4FMCB 2CVHA 2AWOA 4HIKA 5FL7A 4C0QC 4OQXA 3HOVH 1XTKA 1DADA 2GNOA 1LW7A 5FL3A 4Q03A 1NMGA 4A3EH 1MOZA 3BZCA 3B2EA 3TH5A 4EQ6B 2RGDA 2YTXA 2J0UA 2K75A 1YJNA 1X3EA 1G3MA 4DHEA 4Q1EA 4S35A 4A9AA 1E2FA 3C7KA 3A58B 3PSIA 4CEJA 3A8TA 4FCVA 2FSIA 2OFXA 4EJSB 5EUQB 4OHVA 1ZNZA 5JJIA 2QL6A 4RD2A 3J81c 2JA5H 1TEVA 3LO5A 4RD3A 1OHHA 4C4PA 5TXGA 1VCMA 1VQAA 3B6EA 4D4MA 2HT1A 3TNFA 1R10A 3QOFA 3ASYA 3EPKA 3ZZ0A 3DO6A 4ZDIA 2LXKA 4GMDA 2QTFA 4BXXH 1AH9A 1UM8A 5L3SA 5EXSA 2ZRIA 3EIVA 4MKIA 4EDHA 1GO3E 2WM9B 5KHOC 4RCZA 3B7GA 1UAAA 4RG1A 2MSEB 3PEYA 2V7QD 2A3RA 1QF9A 1Z5ZA 2KSQA 2D4HA 4X64Q 1JNYA 1VHTA 4LDJA 3D6TB 5FBVB 4QGUA 2WJJA 3NHBA 3OAAA 1P16A 2BVNA 3ZZUA 1NJIC 1M74A 2D0OA 1YE8A 2FSFA 1G8HA 2Q9BA 4L4UA 1FX0A 1VQ7A 1HH2P 1FP7A 3WRYC 2GBLA 2LKDA 4JYBA 5FL7D 5BXQC 1ZIPA 2DYKA 4NBSA 1YHNA 4B3TL 5A35A 3U7GA 4AKIA 2ZI5A 1FUKA 1KMQA 3QKSB 2ZS7A 3AKYA 4EFMA 1DAGA 2OCBA 4RZXA 2F1MA 4JL8A 1YR7A 5FPYA 3RABA 1Z47A 3QXSA 4XSHA 1E99A 1HNWL 3H0GH 5SZJA 4MYUA 1E9DA 2BDTA 4TKOB 2NZHA 1QJOA 3HOYG 4GOPC 1Z0FA 4L5BA 2RF4A 1NN3A 1G6HA 4HATA 4P4TA 1MT0A 3L8ZA 1CR2A 1LTLA 4B3BA 3EG5A 4P33A 3RN5A 4JI7L 3EN2A 1XJQA 4IDHA 3AV0B 3CRRA 3LVQE 1SMYC 2CLCX 4JLOA 2ZT9C 3GO5A 3BU2A 4DR7L 1IY2A 3VR5A 3TGPA 1BIFA 1YR9A 2O0JA 3K0AB 2W6JD 1XMJA 3O8CA 3TLXA 2GEDA 4GNKA 3KJHA 4B2PA 1XMOQ 3DZ8A 5EJEA 3OIUA 4TMZA 2XGJA 2F1HA 2X1VA 1GL6A 2J5XA 3K70B 1PUIA 3OAAD 5FOTA 4KBGA 4M8NE 5AJVB 4BLQA 3K80C 3KOJA 2ZVPX 1CTQA 4JLDA 1S9DA 2I4IA 2VQFL 1V1QA 3OIYA 3NBXX 5TVKA 4YQFA 1CJTC 5C0XJ 1AS2A 1G8GA 4U7DA 1E1OA 4FWIB 1KTVA 3UDXA 2N49A 4PAMA 3H2YA 3P32A 3P4YA 3M4OH 2CFMA 4G5QA 5DYGA 3HFZB 1AGPA 3GTKH 2F55A 3A6PC 3RRNA 1U9IC 5IYDH 3M1IA 1GKHA 3KZ1E 3LX8A 4HAWA 4OQNA 2R44A 1XTQA 5KOYA 2ALYB 1R9TH 3HYTA 1KK0A 2O8CB 4YY3Q 3C16C 2E74C 4BFZA 3A8KE 3CW2C 1W44A 1GHJA 2HJVA 3AF3A 2EIFA 3PIRA 1T0JB 5FTLA 3VDYA 5DSZA 2PLFA 5KYKA 3IIKA 1KYIA 2QMHA 2N8NA 3K8AA 5H1SE 1YRBA 1BYUA 3CX8A 1BBWA 4LHZA 5C46F 4DJTA 2VPPA 3QPVA 1MABA 3J7ZC 1ZNWA 1KAOA 2D62A 1RYHA 3QSYA 2VNUD 2I3BA 4HJ8A 2JA1A 5IP7G 2V1XA 2JJ8A 3EC2A 4GFDA 5M3FH 2FPKA 3WBJA 5F9HA 4B74A 4DUGA 1YZQA 2AWNA 5AJ3Q 3M0EA 2WOOA 2E5LQ 1X6OA 3FHWA 3FKIH 1J2JA 3I73A 4GNXA 2QP3A 3FKQA 4TL6A 4URWR 4DCNA 3FHTA 1HR0Q 3T1TA 4CEIB 3AB9A 5AJ3L 5HKKA 1E1RA 2EVWX 2JLXA 1VG8A 2ZUCA 2O0HA 1COWA 3CR7A 3EA0A 3QF7A 1RE0A 1G18A 3IUYA 4GBMA 1NLYA 3TKLA 1RPZA 1YVDA 3OW7A 1A0IA 4W5WA 1E2ZA 3ZQ6A 1GITA 4PPGA 3VAAA 3R8FA 1NKSA 4R4OA 2FV8A 3KTAA 4B34A 1OFUX 1U98A 1XNQL 1ZKOA 2HT6A 4GS3A 4POFA 1RC8A 4JCVE 2OO7A 3VU9B 1T9HA 3GJ5A 4X8LA 3RS3A 3FMPB 1XJ0A 2LCFA 3CM0A 1GRRA 3KXIA 4PC3A 3RRZA 2IHEA 1XMQQ 4E03A 1K0RA 5E3HA 3VR4A 2BMJA 3FMOB 2FEMA 3OEHA 1KI8A 4GZLA 2V1UA 4YWLA 1XD2B 1XTJA 4X8HA 4BGDA 4EPYA 1AE2A 4KKUA 1KJZA 1D7QA 1NVXQ 4J15A 2DCUA 3C5HA 4AIMA 1VECA 1E2PA 2C5LA 1L1OA 4Q48A 2WKRA 5DHAA 1IJFA 2FA9A 3N6RA 1DAEA 4KYIB 5EXPA 1J90A 1OFTA 5AJYA 1OH8A 4YCVA 2HF9A 3EPHA 3I62A 5DLQE 4DUGD 1CJVC 3PO3G 4DSNA 5IYBG 5FPSA 1FTSA 4CEHA 2P5SA 1W4BA 4BPBA 2ZYVX 2IC5A 3K81C 4IXNA 5L3QB 4LF6Q 1E1RD 4DDUA 5HKKD 5JBQA 1DE0A 1SVWA 1VYVA 3UWOA 2GCOA 4A3FH 1SVSA 4HLUA 1SGWA 1NTGA 1CJKC 1IXZA 4P75A 1W2BA 4OHXA 2IUUA 4DKAC 4LF6L 4DNIA 2GAAA 2CJWA 5FFMA 4UJ5A 3DOFA 1HJPA 4DLYA 2JLWA 4K46A 5AUOB 2XTIA 1OKKA 4X8MA 1XPRA 4QRHA 2LXJA 4UNSA 3UWKA 3B5JA 1PHJA 2NOAA 2YINC 3DKPA 5CJPA 3RC8A 4HIMA 1ZNYA 4QGHA 1JALA 1EWIA 2KE5A 4OHZA 2J0QA 4JVMA 1D8TA 4PHHA 4QGAA 4WZBE 3WY9A 2ZS8A 1Q20A 2JGNA 2V6JA 1OH7A 2IF0A 4H1VA 1M7HA 1UPTA 1JE5A 1TWCH 1E2DA 3GTPH 2B8WA 1E2EA 4BFVA 1BBUA 3GLFE 4B2LA 2NN6I 2J59A 3CPFA 4IOJA 3EWSA 5F3WB 121PA 3THWB 2QA5A 3KQHA 2DWOA 4OWXB 1Z8FA 5CITA 3U6KA 3CCUA 2OFWA 3KJGA 4JI1Q 2A6EC 1PH2A 4QKQA 3A7LA 621PA 4JOIA 2ZRMA 5BW8A 2EFHB 2L0XA 1N0WA 2YWEA 2NPFA 3SC3A 2BKEA 5BYKA 2G1KA 2YWGA 4M53A 3K9GA 5KDLA 2BJWA 1NG9A 4A6PA 4JI1L 3R9WA 2P6NA 4C2MH 4EUNA 5C18A 3CB4A 3U4QB 4B32A 1NIJA 2YOHA 2VP6A 1VQ6A 2WJVA 4K0KQ 4G1UC 1XZPA 2FFBA 3B9QA 2EDGA 2DUDA 4O25A 1X6VA 5IE8A 3OESA 1GUOA 2XNDA 3S24A 1BYIA 2BBTA 2ZEJA 3QPUA 3B85A 4TT3A 4IHQA 5JEDA 4DK6C 2V55B 1XTDA 2BV3A 3I72A 1JR3E 2GXSA 3JZAA 2ONKA 1BMFA 4JI6Q 3A1WA 1L2FA 1MO6A 2A6HD 3NG1A 3Q7QA 4M9XA 1VQDA 1CFMA 4LF7L 1NY6A 4TL9A 4US2R 5HGQA 4EQ6A 3I1FA 2HCJB 4B33A 3SN6A 1VQ8A 1C0AA 1ZM2A 2GVDC 4O0AA 5FJ8G 5GJWC 4B47A 4E07A 5JI2E 1LACA 1DTSA 2CCKA 1QHIA 2ZYTX 4PHTA 4EJSA 2WP8J 3A8JE 2YTYA 1RRPA 3ICQB 4GKKL 3SYLA 1CULC 4DNTB 3GJ4A 3GJ6A 3OIWA 1KO4A 3PUVA 4QL3A 2ZJ2A 2PLRA 3TBKA 2WWGA 4QBGB 4N1AA 1N25A 2NZJA 1UF9A 1ELOA 2QORA 1FTNA 1I4TD 2IEYA 1E2WA 3GEEA 4GN3B 4PHGA 4KVGA 2HXYA 4NXNL 4QJ5A 1E2NA 1FZQA 3H1TA 4GT1A 1E2HA 4X66L 2A5FA 1Q0UA 2ZAOA 2V4DA 4EPTA 1NSFA 2XNSA 1JEDA 1EFTA 1E9BA 3BJIC 3RSLA 1Z0KA 2PQAB 3ULPA 1GUNA 4EFNA 5JEAJ 2VUMG 3KKMA 3T1VA 3CRVA 2ZXUA 1IJEA 3REGA 2D2CC 2R6AA 4PZ6A 4RFSB 3N70A 4TLCA 5GADl 2V6IA 2A30A 1CR0A 1I2DA 3QG5A 1E79A 1BMFD 5M3MG 1AIPA 1V5WA 1KI6B 3QKSA 4PSAA 4RSGA 5AK0A 2GXQA 2R7DA 5HTKA 5BN5A 1H8HA 2PT5A 2VF8A 4DCUA 1GHKA 1UE6A 3R9IA 2GRJA 1U0LA 4B35A 4OI4A 2QF7A 4IQZA 4PQRA 1L1OC 1UBGA 2V54A 3ADCA 2A68C 8OHMA 1PZNA 3HR8A 4PZYA 3OFNA 4JLBA 1Q46A 3M85A 2MSDB 4LRWA 4IFDH 3N2IA 2GN5A 5G53C 3QEOA 4HZIA 2O8BB 5KUTA 3S2HH 5FTNA 2QGQA 3KFXA 2CHGA 3CC7A 2FOLA 2PJRA 4JIMA 4Q19A 4JJKA 1I2MA 2MSCB 821PA 3K9NA 1P9WA 4HLUC 2QMEA 2VQEL 1QRAA 3IFTA 4JI0Q 1W5TA 3NEYA 4OQLA 2ZTCA 4YONB 3W8RA 1KO5A 1NMFA 4D81A 3T56B 1DAHA 1JBKA 3VNVA 1KRTA 3K0AA 3MMPA 1GKIA 1UE1A 4JI0L 1W4RA 4M4SA 1S1CA 1Z28A 1AN0A 4EX5A 2A6HC 4HJ9A 4DV7L 3BH0A 2GEUA 3CIOA 3EASA 1QVRA 1E1TA 1YHBA 1RJ9B 4X65L 3B8HA 1Q1QA 4G7HC 2ZI4A 4Y0VA 2OQ0A 2IYVA 3FMFA 3VKHA 2FEOA 1J99A 2ZI6A 4QG7A 2B8GA 3NH9A 3RDPA 2GAOA 4XWKA 4BLRA 1N5LA 3QKRB 1ASZA 4BFSA 2KA7A 4TMWA 1GZSA 3U44A 3DM9B 2HUPA 4JMPA 4BBSH 1TQ2A 1Q22A 1E22A 4DLTA 3KDFB 1H8HD 1SHZA 4JLAA 1VQ4A 2B21A 2WAQE 5LB2A 3RRYA 1PV4A 3H94A 2XZLA 1R0XA 5KNCA 2C99A 1KRSA 1I6VC 4H9GA 1NRJB 4JOIC 2QMUA 1UWVA 3EW9A 4FXPA 3OF5A 2RKOA 1Q1BA 1DVRA 4RFVA 4TTRA 3U3RA 3QBVA 4DLVA 3H15A 1NY4A 3AF1A 1YJ5A 1KOFA 2O8CA 3KUDA 2GDJA 4LHYA 1Q3HA 3NBFA 5FUXA 1HTPA 2HYDA 2PNHA 4DR3Q 3WYAA 2OLKA 1VQLA 2CE2X 2W0MA 4TLEA 3CPEA 3U3KA 1Q12A 2GF0A 2AKYA 1XZQA 2QBYB 1DGSA 2J7PA 4DR3L 2HEIA 1DCZA 4FCWA 3NKVA 3GTGH 2OESA 1OLOA 4DSTA 2ANBA 2RHDA 4OO1G 5B2ZA 3LNNA 1N34L 1Q82C 1SN8A 3MJRA 4LYHA 1XNJA 2CK3A 3K70D 3ETLA 5GVRA 3Q85A 5FPTA 3ZJYA 4C0AC 5FR2A 4JC0A 3PIPA 4PSVA 2ZJYA 2NGRA 4YLGA 1CXZA 3DPUA 1GG2A 1S1MA 3WNCA 1TL7C 2X2EA 4EJSC 4CF7A 1II8A 2PPBC 3PUYA 2KCMA 1FNMA 3RN2A 1MO5A 2EU8A 4AK9A 5IHPA 3TQCA 1H8ED 1P60A 1SXJB 3EC1A 4V02A 1YNXA 2QEQA 3QKTA 2A2ZA 2W0SA 2EFEB 3EZ9A 4JLJA 1DELA 4V0KA 4AWXA 1PH5A 3I7FA 3OW2A 2D74A 3PVSA 1HNXQ 2JA6G 1KDPA 2E87A 1HUQA 4G5RA 4IOLA 1Z07A 4EPRA 1Q44A 3ZDQA 4BQSA 4DLWA 4P3YA 3AVTA 1W5SA 3VU9A 3OYYA 1YZTA 1HNXL 3NWJA 2E2JH 1G6PA 1ZBDA 4TVAB 4A3KH 3SFZA 2FGKA 2AXNA 1VQIA 1IM2A 1NG1A 2KI5A 4DV4Q 1XFAA 4KLNA 1J6QA 4G7OC 4LF5Q 2J7PD 2YC2C 3ZVLA 4DV6Q 2ZJZA 3T34A 2ATXA 1XD2A 2G77B 3HKZG 1XX6A 1CU1A 1L7VC 2HLDD 1AQUA 4NCHA 4BASA 2ZRGA 3J81k 2YYZA 2VP5A 4V0MA 1KI9A 1TQ4A 1YU9A 5K8LA 4BY1H 1ASYA 1E9RA 5B64A 2VUMH 2HHHL 3AVUA 2CK3D 2OEPA 2PX3A 4OHYA 1QHHA 2WWIA 3HGBA 4LUOA 2J3EA 4KODA 3VHLB 1N6KA 3UMRA 1HURA 4LJ5A 4TL7A 4U02A 4H02A 3TW4A 2CCGA 3A4MA 2Y0SG 1T5IA 3HOUG 3LW7A 4MYCA 4TN1A 4R4CA 3MGCA 3CCJA 2QAJA 3OZXA 5EP4A 4IDOA 5JMTA 3IO3A 1ZM9A 1CKOA 3BWDD 3SI7A 1Q86C 3EBEA 3Q3JB 5AJXA 1SRUA 3TQYA 2JJ1A 2Q2HA 1E2IA 2IUSA 4A2PA 5LD2C 1CRPA 5C0XH 3SJCA 1X65A 2CMKA 3G4SA 1RZ3A 2GHIA 2OCEA 5E95A 1NBMA 3U7FB 2OWOA 3J80c 2AXPA 2R7ZG 4C0BA 4Y7NH 2WAQG 3IQWA 1QDEA 1EIYB 3HOVG 3MWLA 2W2TA 3BRWD 3QF4A 3JZMA 2DN8A 5GQOA 1GM5A 4DR6Q 4JV5L 1FOEB 1E96A 1HY3A 1X1SA 1ZRHA 2BWJA 2FFQA 2BA0A 4IOCA 4A3LG 3T1HQ 1KKMA 3LAWA 1M90C 4HDOB 1LB1B 4LF4L 4DXAA 2ZAMA 3TK1A 1M7BA 3THWA 2BA1A 3KKQA 1NIPA 2GVZC 2YC4C 1AJEA 4LF9L 3LWUA 2JA5G 4KHPQ 3RR5A 2Q0HA 4HJ7A 4Q9LA 4FMBB 5CLLA 3UIEA 1Z63A 2ZIAA 1ZU4A 1M8PA 2ZSBA 3B1WA 3NIBA 4IPGA 4M9QA 4QJFA 5JHHB 2VBCA 2ZTSA 5KSYA 1S72A 2O0KA 2ZJ8A 5EE0A 1V9PA 4LFCL 3K7UC 4BXXG 4D26A 1CR1A 1HH4A 2OXRA 2F52A 2QN6A 2C35B 4KMUC 4V0ME 4EAQA 3GLIA 4PV1C 4JBJA 4GOXA 2EYUA 3UPUA 3W6OA 4YHHQ 3FGNA 4A4IA 3AEZA 3S16H 1D8LA 2CE7A 4F92B 4XVUA 5KDOA 3EA5A 3PO2H 2PL3A 1EWQA 2JJ1D 2F43B 4JT2A 3KLRA 3VFDA 2ASBA 1R8QA 3L8YA 4PZ7A 1JB1A 1NBMD 4IDPA 4IRUB 1E3MA 4PX9A 1KZGB 4DIDA 3TAUA 3HJNA 2BBSA 2R92H 4PZLA 4ESHA 2ZSAA 3D0FA 1M1KC 1FQJA 1PLJA 1EFWA 1LY1A 4DV5Q 3AF4A 1BOFA 3MCAA 4OO1H 1IN8A 1N32L 1EXMA 1NJGA 3GFOA 3GTLH 1NBME 3H0GG 1XJCA 2D06A 3PENA 1II0A 1W2HA 5DYIA 3RANA 3TE6A 3D4RA 1H9SB 1HE1C 2PZEA 4DEYA 3MWYW 3ULJA 4B6EA 4Q9JA 4ZI2A 5HE9A 3TUZC 1J7KA 1A4RA 4PR0A 3TVDA 4TZ6A 4URXR 2GWHA 1CBUA 2R93H 2QPOA 4FWTA 4QQBX 1KZ7B 4LJYA 4Q18A 4LFBQ 1IN5A 3RYTC 4F4IA 3U4QA 3S1AA 2QTHA 1Z6AA 1SMXA 5DNYB 2VHTA 1XB2A 3U4VA 5FTKA 3WMEA 4A93H 4DR2L 2ATWA 1P2TA 2R9VA 2PQAA 4LJ7A 4LFBL 1UKZA 2ZE8A 3BBPA 3SJAA 3WDNA 2EW1A 2L5TA 4ERNA 3LBIA 4ME3A 4WAUA 4CT4B 1FP6A 5F9FA 1VCOA 5JHGB 4JI2Q 3RS4A 2Z83A 1NI3A 2ZI3A 4WXPA 3X1ZA 4WXRA 1KI6A 4A8JA 4B3MQ 1PLKA 4RZ3A 2UUAQ 1IBLL 3LH5A 3FYHA 5DN6D 1HTWA 1JB7A 4MA4A 4Q66C 3GLIE 4DR5L 1TAGA 2JDIA 2G6BA 2XX3A 4QM6A 1YZGA 1KSGA 1T6NA 1G7SA 2DNCA 3UG6A 2AK3A 1EYGA 4ACBA 1DO2A 1H9JA 1VG0B 2IW3A 1S3GA 5J3BA 5IYDG 2KBEA 4JL5A 3RWMB 1QHXA 1K5GA 4DCSA 1W48A 2ZUBA 3AP3A 5FOVA 4GMXA 5JCZA 3C5CA 3KKOA 4A0GA 2O8BA 1XNRQ 3KF6B 4NB3A 2QE7A 3D31A 3BORA 4V0LA 3S1QH 2Q8IB 5JS8A 4W7SA 3HU3A 4CYMA 3DHWC 4R2IA 3ZVMA 3PUWA 4DK0A 4EQ5A 2IBMA 4LYJA 4ZDJA 3NHAA 3MRSA 2J41A 4LHWA 3H0KA 4OI2A 2WWYA 2LSSA 1ETUA 2C03A 2GZAA 3QI2A 4JKYA 2JEOA 2E1RA 3S15H 3QXCA 1WI5A 1S9HA 3HOUH 5C1BA 2V7QA 1YZUA 1E32A 1F3OA 2VSFA 2GJAA 4IJLA 1G3UA 2B7CA 1K5DA 3L0IB 1E69A 4L5QA 1RJ9A 2OHFA 4Q4JB 4WOPA 2QRNA 3SDZA 3AFPA 1Z2CA 2DWPA 2IHBA 2P5TB 3BH7A 4LFAQ 4X62Q 5J4VA 1X3GA 2WMNB 2ZRJA 4DUYQ 3QKRA 3AF2A 2H16A 3IHWA 4UNNA 1E1QA 3FKIG 2OTLA 4M1WA 1WCV1 2RGAA 2BOVA 1I3QH 3N2EA 3KDFA 2HXSA 3UE0A 4IFBA 4A2WA 4HAYA 1MJEA 5KNBA 5AWFC 1UFQA 2A5YB 1E24A 3R20A 2CNWA 2JDID 5L8VA 3RS2A 4RZ2A 2BCGY 4A3LH 1TF2A 1HQCA 4B76A 2JLVA 2Q2IA 1ZCBA 1SFOH 2ZSDA 4PC1A 1GUAA 1F6BA 2JASA 4OQMA 5CYOA 4D80A 3TS0A 5JWOA 2GK6A 1IYVA 4NXMQ 1W36C 4P73A 4JI8Q 1IN6A 2QE7D 3JC66 4PC7A 2F9MA 4HIDA 3RZDH 1LF0A 3AVPA 2QBYA 5IP9H 5M5WH 4L9SA 4NXML 1JI0A 1UBFA 2OCAA 2ZSEA 4LJAA 2QROA 1Q1ZA 2IXEA 2KBFA 4PXAA 2R65A 1OXXK 2A7QA 5DO9A 2EQSA 4NU0A 5L3RA 1E9EA 4TQUS 3R9XA 3CCEA 2W6JA 3I5XA 4NCJA 5EXXA 1HQYE 3CH5A 4YXWA 1WOCA 1CRQA 3EXAA 2E9SA 1HT1E 1KO8A 2ZRDA 4NTZA 3X1DA 1PLLA 1FUUA 2GILA 2Q2UA 4X64L 2VH5R 2YWFA 2FE4A 2A69D 4AG6A 1K9MC 1W49A 1OV4A 1E1QD 3IIMA 4ZO4A 2ECKA 2FSHA 1X54A 3FHCB 2N78A 5A4JA 1SXJA 1AKEA 2CNWD 3QPWA 2A1AA 1TEXA 4A3FG 3CPHA 4Q1BA 4GOJA 3ADKA 1VQGA 2CL6X 5L3VA 1VF5C 3GD7A 5M5YH 1IYJB 2IK8A 4JYAQ 3BDOA 1US8B 4LWZA 1KY3A 3RWOA 3EQLC 5H70A 3UG7A 4DLZA 4UXHA 4MGZR 5ELXA 2XZOA 1SKYB 3KQNA 1ZAKA 3LFUA 3W9YA 3VR6A 4LF8Q 4NYJR 1VQFA 2PBRA 3FMCA 5EAYA 3L2PA 1EQQA 2XJ9A 1N0UA 1X1RA 3DMNA 1ZYRC 5B57C 4LW1A 3IEUA 3UATA 5K8IA 5TDHA 4LF8L 4BFTA 2OQKA 1YIJA 4HB2A 3RLFA 5KSPA 1RRCA 4MITA 1IHUA 1MKYA 2BE5D 2JLQA 3AKCA 4NYMR 4Q7JB 4Q4HB 4A8JC 4LX0A 2WFWA 2QP9X 1OB2A 4R4QA 1I94Q 2F4VQ 1AS0A 1GNQA 4YXWD 4XIGS 1R4AA 221PA 1R0ZA 2IYYA 1PH3A 1S0UA 2Q9AA 2ERYA 5AJWA 1XMOL 1I94L 5HY6A 2C9OA 3ZVNA 3MSXA 2ANCA 4LSGA 5EP3A 1G6OA 1EX7A 4B3RQ 3C41J 2QSYA 2NO9A 4KHZA 3CF6R 3CF0A 5FLXc 2C9CA 1V43A 4JT4A 5FOUA 1SXJD 3MWJA 1P8LA 4QIWE 2DWQA 5EP1A 2UVQA 4PQFA 2BMEA 5G3ZA 1W3SA 2W00A 2C95A 4FCTA 3A36A 3RRMA 5C3EH 2VEDA 1A6XA 4M1OA 3TVTA 1U8AA 1K8AC 4QJ3A 4JLMA 2AUJD 5CIQA 3I61A 4NCKA 4D4KA 4NCNA 4KSCA 2IYSA 5FLMH 3KYHC 1U90A 1TUEA 3SEAA 3B1ZA 4LC0A 4DLRA 3BERA 3S1MH 1WE2A 3LXRA 4JZKA 5A0FA 4QY7A 2I5MX 4YY3L 5FBLB 2OSBA 3T06B 1TF7A 2K7VA 1ZCAA 1VG9B 3DLLA 1G3IA 1O7LA 3RZOH 1G9XA 3EZFA 2A69C 1Y8NB 2B8TA 4FD2A 4G01B 2OCPA 1JJVA 1Y14B 2XXAB 1SROA 1MRNA 1ZIOA 3H84A 2BJVA 5F2EA 3HYRA 2Z6KA 3CAMA 1IY0A 1PUJA 2QY9A 1XDBA 5KNDA 1LYLA 2JJQA 4C3JH 4BZXA 3U7EB 3FVQA 2GJ8A 1T3LA 1TWFH 3DKVA 3RS7A 5C4MA 1SQ5A 4B75A 3V9PA 5CM8B 4PFSA 4QFMA 4CDGA 4DZZA 4YMUA 1SVIA 2E5LL 1HA3A 2FZ4A 3FB4A 1J5EQ 1YZLA 3ZS8A 4CT5A 1DAFA 1HR0L 5IY0A 1JECA 2CLSA 2V1CC 3GTMH 2NG1A 2F43A 3H4MA 3GJ0A 4HEJA 4A0HA 4TYPA 4XVQA 2ZU6A 3KJIA 5GVSA 4W9MC 5IT9c 2F6RA 2BBWA 4Z8XA 1OPXA 1O78A 1A1VA 1Y1VH 4PZZA 4XWOA 2DNEA 2FF7A 3A8IE 1YR8A 2BE5C 1QG4A 2DR3A 3E2IA 3O8BA 1E4YA 2R62A 3AVWA 1T5LA 3QE0A 2I1VB 3OOCA 3PG5A 1P75A 1JJCB 2G83A 3IPXA 4LJ9A 2Q21A 3CNOA 1D2EA 1KDTA 3HP1A 4PPQA 5GJBA 2CWAA 3BFKA 5TY0A 1KJWA 1H9SA 2KHJA 4IFDG 5BR8Q 3NEJA 1XMQL 4A0RA 1FL9A 1KHIA 1ZC4A 2GZDA 2IYWA 2XSZA 2GF9A 4O2RA 5EXTA 3W3ZB 4KN4C 3IBYA 1QBKC 1SXJC 5BR8L 3REFA 2LWIA 2MNAA 4JS0A 5UKDA 3EIEA 2AR7A 2ZJBA 1UKVY 3TZUA 2C04A 1YI2A 2FGJA 4PC2A 4JL6A 4LBYA 2WWFA 2VP0A 5CDFA 2QAGB 2J87A 1RL2A 1GWNA 3ZH9B 4O3MA 1A62A 4LUVA 1EG7A 3KQLA 4UKDA 3QQ5A 5LDDC 1VQMA 3MLEA 2NO6A 5J4KA 3I5YA 2OXCA 3GLHB 4J0QA 4F7WA 3T35A 4MRRA 5EE3A 3QXXA 2RGBA 4BZQA 1EUJA 2K32A 1U0JA 1NVWQ 2JA8G 2XTNA 4TTPA 4XVRA 1N36Q 4B43A 1DS6A 1FYCA 3TW8B 3MEFA 1VMAA 1OIWA 2F1JA 4O2LA 1Y8PB 1NVVR 3MUFA 3CLVA 5JZVA 4BBSG 1KNXA 4KAXA 4PHFA 3EIHA 1TWGH 2IHFA 1VG1A 1ZD8A 4K81B 4QNRA 1N6NA 2VRWA 1TQ6A 3K0CA 1FW6A 1JPNA 2VHQA 3DOEA 1GVPA 1ZW6A 2OBMA 1KO1A 3ZD6A 4LV5B 2ZRNA 3C15C 4IVQA 4DB2A 2VZAA 4DAYB 3L2OB 1G5RA 4WW0A 1OXSC 2BM1A 2XSZD 4KFTA 3I4LA 1R8SA 2DFLA 1KXLA 1GUGA 1Y1WG 5DI3A 5TV2A 1G4AE 3SNHA 2WWXA 2EXDA 1G16A 4PG3A 1GAJA 4I1SA 5CM9C 1WCMH 3OTOQ 1K8GA 4BFYA 1N5JA 2IS4A 5IWAQ 5AUNB 1X9NA 3TSOA 4YMTA 2JLZA 3HOWH 1Y3AA 2ZANA 1FL0A 4Q4JA 4DDWA 4RD6A 1IYUA 1VQCA 2ZQ5A 1ZMXA 1Z2AA 2EJGC 1EFRA 2W2XA 4CRWB 1P2SA 2ZVQX 1E0AA 2WVJA 3G5UA 4HLDA 4TZ0A 1XTSA 2JEAI 1HZCA 3CONA 3TQFA 2NO1A 4HIOA 1D9ZA 3GP8A 1FR3A 4K0KL 3GLGB 3ADDA 2L15A 4A1FA 1C9OA 3CNNA 4DWJA 5CDFE 1DAMA 3KB1A 4P31A 2C96A 2PZFA 1VDZA 1UBCA 2VL6A 3RSOA 1VKJA 3WHKA 4QHSA 4JI6L 2CBZA 5JSZB 1IN4A 4M9SA 4MRPA 4JI5Q 3ASZA 4PQYA 3UXMA 2Z6KC 1DBSA 2W2VA 4M1SA 4OK3A 4P4UA 4KLZA 2G0TA 2VW9A 4AKHA 4AYWA 1SE8A 4JI5L 2LKCA 3B1XA 1B0UA 3J81j 1MIUA 3FFBA 1NKTA 3ZYCA 4ZIRB 4JI4Q 5JEEA 3MD0A 1D9XA 2Z6VA 3H3VI 1L8QA 1OW3B 2ZYWX 2IX1A 4A3KG 4Q9KA 1EFHA 1DAIA 2V4ZA 4A3GH 4OWTB 1Z08A 4WBSA 4HAXA 5FUVA 2WTUA 4F4CA 1GIAA 4FMDF 4IVPA 1K73C 1VQKA 1P62B 4Z51A 2WAXA 3ND9A 2I5LX 1SZPA 2R6GA 1CKMA 1UEIA 1N8RC 3CMEA 3J80i 4IDQA 4BY1G 3QUSA 2F7SA 3IPYA 3J7A5 1ZU5A 4LJ8A 3I2ZA 1HNZQ 3U3MA 1G5PA 1EFRD 1OT3A 4XH9B 1A63A 1F2TB 5JJKA 4DT1B 1OXUA 1KMHB 2RHQB 1R5OA 2YV5A 2YOFA 3LA6A 1XCGB 1HNZL 1MRSA 4N0EA 5K36H 3F2DA 1ONBA 2C8VA 5KPJA 3BJUA 5JWRA 1SLJA 1N6OA 2AK2A 2ZTDA 1MV5A 3M4YA 3BK7A 2IY5B 1US8A 5JCPA 2X8AA 4X6AH 3KFUA 1TQDA 1IBRA 4UPAA 3LGJA 3CO5A 4JVLA 4IOMA 4QBFA 4BLTA 5JFGA 5H8WA 3EPLA 1NMYA 3QKUA 1Y69U 5C0XG 2E75C 5G3YA 3ER0A 4QC2A 4DC9A 3DM3A 1C1YA 3QNUA 3NENA 4R4IA 2GZHA 5C4XH 5CLQA 4FI3C 4HDCA 3S17H 1G17A 1KAGA 2REXB 3BOSA 2WJHA 1YJ9A 3CKLA 4KN7C 2B7BA 2B29A 3T5GA 4DLUA 4LUZA 4QXAA 5FI1B 1K3RA 3TREA 1QZGA 1IBKQ 3K09A 4ZDWA 5P21A 4OI0A 4Q4HA 3CX6A 1YRAA 2ZE7A 3SS8A 2WAYA 2CDNA 2Q9CA 2XEXA 3ULLA 4BA1I 1CSQA 2CHQA 5CIWA 1OXVA 3VR3A 421PA 1G21E 2NO7A 3CZPA 1E0KA 2CCZA 1P4SA 2GCNA 1UEBA 2JA8H 5JS7A 1DG3A 3ECCA 5GJVC 2JQOA 1MH1A 3ZQJA 1TU2B 3B13B 3NBYC 3RC3A 2FU5C 3K0CC 1TNDA 1Z0DA 4QJ4A 4I7ZC 2PCFB 3MG9A 5D3QA 5HZHA 1E9FA 3AYHB 3L82B 4YCWA 4IFEA 4URYR 1EFUA 4V03A 1H8EA 4ZKEA 4APVA 4OXPA 3WYGA 4DRZA 1NNEA 2ORIA 3MJHA 4KI0A 1IBMQ 4AYBE 1CJMA 1CP2A 3FMIA 3STBD 3KJEA 5BWMA 3UANA 3U60B 4IPDA 3WNDA 3R8CA 5JRJA 3PO2G 1G51A 4MRVA 1J8MF 2MMCA 5K8TA 1IBML 3ICEA 2XTMA 1PJRA 3KKPA 5EP2A 2ZRCA 3THXB 4IVRA 2WJYA 2PMZE 3VKWA 1R7RA 2DB3A 2G9NA 1UDXA 1Y1WH 5H68A 2NVQH 2CCJA 4WJ4A 3DEFA 5E4FA 4RCNA 3CQZH 1E98A 2C78A 1S3OA 2R92G 2QU8A 4BA2I 3VNUA 5LMNW 1N33Q 3KFVA 1FGUA 2ZREA 3SYKA 2F3RA 4A36A 2HLDA 3CCMA 5E7NA 4GKJQ 1FJGQ 1T3HA 3TEHB 2WWHA 3L0PA 2XXAA 2F3IA 2RGGA 1IY1A 3A1SA 3TRFA 1GKYA 1YJWA 2KWIA 1G7RA 2GJSA 1DXMA 1S4QA 4B3FX 4IKEA 4BY7G 5C44G 3PFIA 3TR5A 4MDFA 1AS3A 1G7CA 2GXUA 4TSFD 5CJ2A 1TUIA 3FKSD 2D2FA 4QGGA 2F9LA 2OTJA 4EIWA 3B9PA 1GRQA 1ZINA 3HKSA 2R93G 4LPSA 1LV7A 1DO0A 3RVBA 2V3CC 3GJ7A 4LBWA 2K5UA 4CEIA 4M1TA 3TS2A 2ID0A 2FFHA 3AKDA 3BH6A 3FOZA 1OB5A 4RZUA 1EQRA 2FPMA 4A2QA 1T91A 2O52A 4BRWA 4A93G 2K50A 5C4GB 2J7KA 2KJQA 2IX0A 4YMSA 4DVGA 3S2DH 3I4OA 4OWWB 1CR4A 1GVNB 4FIDA 4QGFA 3V00A 1XEWY 3T15A 2YNMA 5AR1A 2IYQA 2IYXA 2BHRA 4A3CG 2RB4A 2JAQA 4MDEA 1T5EA 3OPOA 4UJ3A 2C9YA 4ALPA 4A82A 2D3WA 1NMZA 1SULA 3DL0A 1M6NA 3W6NA 1LTQA 4UY8C 1HE8B 3VKGA 3QVVA 4NPHA 1UE5A 2K33A 1I50H 4B3DA 4AY2A 4NMMA 2HQLA 1CIPA 3LX5A 4FMDB 5EE1A 4A4DA 1N6PA 1HV8A 2D7DA 1ZM7A 3AEVA 1JXOA 4GLAC 5FPKA 2ZJOA 4DV4L 1XD8A 1XRJA 4KKTA 3W3AA 4UP7A 3HOXH 1N6RA 2CL7X 2Q3HA 4LF5L 3FWYA 4IOKA 4B73A 3G71A 4C3HH 4DV6L 4E22A 4YDHB 2HYIC 4F91B 3EZ7A 2BMDA 1WF3A 2QT1A 2NVTH 3BAFA 3G82C 1Z83A 4CIDA 3B60A 3CX7A 1H9MA 3STBC 1KI4A 1ZD9A 2XOKA 3M4PA 2ZPTX 3AH8A 3QJYA 1KJYA 2WSSA 2ZRLA 2VS1A 4KVAA 4M2LA 4UNQA 4NL4H 4DV3Q 3N5CA 2ODNA 4RMFA 1F2UB 2ZRAA 1ZYUA 2ZITA 3GLHA 3PEVA 3GCGA 4OI1A 3U3OA 1PVOA 4ON9A 1IOZA 2EWVA 3RLOA 1X8JA 1YVCA 3AB3A 1EWHA 2ZETA 3UMSA 2UUBQ 2QP4A 4ACAA 2WB1E 5IYCG 3BB4A 4KFRA 1YZ6A 3KJPA 3VMFA 4KITB 1GUTA 3F2BA 2ZR7A 2QZ4A 2B63H 4P74A 3SJZA 4ESVA 1P6XA 2XTZA 1WBBA 4C2TA 3CRLC 4DAMA 2PJZA 5J4HA 4LHXA 1NVUQ 3K09C 4IFDI 1KI1A 4PPNA 1DG1G 2NVYH 3QY0A 1JMCA 1HT2E 1EK0A 1OF1A 3LW8A 3G48A 4RD1A 5KTYA 4HLCA 4NPSA 1M2OB 6Q21A 4AI6A 4JK1C 3M7NA 2C98A 2NMVA 3BGWA 3D8BA 3HR7A 3SQXA 4LPKA 1BKDR 2ZM6Q 4DR6L 1RFLA 4PAOA 1MKHA 4W5HA 5E7IA 3E0EA 2WWWA 3T1HL 1Q21A 2CL0X 1S40A 4KYUA 3I8XA 1JEEA 4AD8A 1KDOA 4MUBA 4LI0A 4A3MH 2ZM6L 2P67A 4DR1Q 4BFUA 5LMUQ 2ZRHA 4TYYA 2ZR0A 1KHTA 3VX3A 1WA5A 5IP9G 2Z0SA 3AF0A 4DSOA 4KHPL 1G7TA 4Z1MD 2DFNA 2R6DA 2XOKD 1KIXA 2EWWA 4DR1L 2P6UA 2IS1A 2WSSD 4GI7A 4BRUA 1LABA 2UXDQ 4D25A 4NYIR 5IDVA 2AD5A 1Z6HA 2A9KA 3DMDA 1ZD1A 3CWQA 4NKRA 4D4JA 4JVSB 1D5CA 1OXTA 2ZRPA 4JG2A 1P2VA 1VPLA 2JJ2A 1JJGA 4HI0E 2WMOB 1Z9FA 2OAQ1 1E0JA 4V0NA 1N6IA 4YHHL 1XBTA 4G5GA 1P2UA 2OZEA 3QENA 4NONA 3F2CA 2F1IA 3UDGA 2A8VA 4C9BA 2NPIA 3QG1A 1U5KA 1KK1A 5DN6A 2N46A 1PH9A 3MFYA 4YDSA 1OIVA 5JEAG 1NJFA 2FG5A 2OM2A 3IDQA 1E2MA 2J46A 1GKUB 5DI9A 4JJZA 3CXCA 5H1YA 5IRCD 1KIMA 3CC4A 4C30A 4GNXB 3M9BA 2YU9H 2RH5A 2X19A 1N6LA 1IW7D 5GAEC 1N0VC 3NXSA 3BFXA 1IL2A 3ND8A 2ERXA 5TB5A 4JLVA 4H1UA 2BEJA 4ASUA 1RRGA 4ZIRA 5DE3A 5KSZA 4BY7H 4MNOA 5C44H 3S14H 4DV5L 1P5ZB 4Z8YA 3GLFB 4LJ6A 1H9KA 2YVUA 3EZ2A 1EX6A 3BZKA 3P20A 1XTRA 1E2QA 3U2QA 5BN3A 3PF5A 1P72A 5TARA 4MUAA 4NHOA 2ZI7A 2VHCA 1MJCA 1HEIA 2JLYA 1ZP6A 4D0NA 3AVVA 4DK3C 3GEHA 5FOXA 4MYTA 3TSZA 1Q1EA 3CCSA 1GRNA 2FMXA 2IEZA 4OYHA 4DV0Q 2QT0A 4DV2Q 2ZYUX 1E0SA 2R6CA 1EOVA 3QEJA 4LV8B 3LRPA 2JJ2D 4Q21A 4RFSA 4DT1A 4IJMA 5KU1A 3PJRA 3ZD7A 3KUCA 2MO0A 5HZKA 4A3CH 1VQJA 2JIZA 5AUQA 1XPUA 4HAUA 4UXIA 3K9HA 3UKDA 2F3TA 4H0LC 2RGCA 1XCPA 1GL9B 1LFDB 2IYTA 1KD1C 5M5XH 1U8ZA 4JI2L 1F5NA 1R5BA 1XWIA 4M1YA 1SVMA 2ZROA 3D7MA 4B3SQ 2NN6G 4UNRA 2O8FB 4WZ6A 1CEEA 2QPTA 4B3ML 2XB2A 2H5XA 2UUAL 1YR6A 3A74A 5FBWB 5FOWA 3Q8XB 2J45A 2IA5A 1RYFA 4MTNA 2RGXA 4LJ4A 1OSNA 4LYFA 2FSGA 1SHKA 5C3EG 2DY1A 2GCOB 2VP9A 3ZS9A 4H13C 4D6PA 4EFLA 5D3MB 3UDIA 4PTLA 4Q7KA 4URZR 1AM4D 1E9AA 1KO7A 4ASUD 2CJWB 4DV1Q 3IQXA 1IAQA 2J0SA 1CKEA 4LV6A 5FLMG 2WJIA 4CGZA 2CVFA 2GXAA 4O2DA 1ZVQA 1XNRL 2UXCQ 1XU4A 2SHKA 3A4LA 4MKGA 3KQUA 2WOJA 3T12A 3LLMA 4JBMA 2UZ3A 1ONLA 1NN5A 5IK2A 4D0LB 3O8RA 3B82A 1N2CE 3IKJA 2K5NA 1P73A 1TADA 2A5DA 2VHUA 3LLUA 1FVIA 4HB0A 5CYPA 4L15A 1WB9A 1O87A 2G3YA 4R98A 2NVXH 3CD6A 2WSMA 2ORVA 4JI3Q 5IYCH 3X1XA 4BWYA 4G3XA 4HZUB 3UK6A 4R1JA 1Q90A 4R4TA 2JIZD 3L0OA 1UBEA 3SOPA 3AGQA 2N42A 1G20E 3I8SA 5HCIA 4GZMA 1IW7C 4HAVA 5C0XI 4I1VA 4LFAL 4X62L 4LHVA 3KKNA 1FMJA 4DUYL 4F93B 2NTYC 3NELA 4CZ2A 4C7OB 3Q7PA 3CNLA 4C0LA 2E2HH 4BBRH 2PCJA 5GROA 1CLUA 3KDSE 3P27A 3ZGXA 4D0GA 2IL1A 3UE1A 3BB1A 2ONJA 3U5ZB 1DPFA 4LNQA 4TWZA 3THXA 2UXBQ 1F60A 4ZCIA 4FW9A 1Y1VG 4MGIR 1KSJA 2UZIR 3AKEA 1OE0A 4AYXA 2B6HA 2P65A 1QG2A 1BS1A 4F4JA 2CW0C 1VQPA 1B9MA 2UXBL 4Q7MB 5IF9A 4PPFA 2ZJAA 1K8RA 2REBA 1W46A 4JI8L 3KLWA 1E2JA 2ZR9A 4DIEA 5FTMA 1ZC3A 3PXGA 5FH9A 4OKSA 2OT3B 4GL2A 5IK2D 3PITA 5ELOA 3SJBA 1GTVA 1E4VA 4WVFA 4TMKA 2QPAA 2VTKA 2WIAA 3QVUA 4OJQA 5JLJA 4C2UA 4LBZA 2ZJQA 2PNRC 1WQ1R 3AM1A 2OCYC 1X56A 1PH7A 1DAKA 3E1SA 4LBVA 2CLDX 2B3GA 2BC9A 1YKSA 3CPJB 2YKGA 3F8TA 1VHLA 4O0MA 1ANKA 3VX4A 3K7AH 1S8FA 3UDFA 4IOAA 2CKZB 3Q5EA 3WNBA 1TU3A 1T8TA 5FI0B 1X86B 2QENA 3TSWA 2BH2A 4URUR 2JA7H 1GILA 4A3DH 2FX3A 4GP7A 5JEAH 3R7WB 4HJAA 2NZOA 1BVSA 1D6JA 1E9SA 4TQAA 4A92A 1M1YE 1W4AA 1DEKA 1QVGA 4BUJA 3PUZA 2F1RA 1N5IA 4OGQC 2N3SA 2FWRA 1HR0W 4AH6A 1UDWA 1OTCA 1JT8A 4KO8A 3HWSA 1GNRA 1Z3IX 1PYSB 3LBHA 4YC7A 3OE7A 5SZHB 4G0NA 1MO3A 2JLUA 1KK2A 3K1JA 1WBDA 4HUTA 4OO1I 3JVVA 4JYAL 3W5OA 4B3TQ 1E9CA 3AP2A 3D3QA 2JLSA 4PO1A 2JXMB 3T5DA 2E2IH 1XMIA 2WKPA 1BDOA 1QHYA 2WV9A 2RGNC 2AL7A 2DBYA 2QMOA 1P9NA 2RGEA 3CF2A 5DISB 1HNWQ 1UE7A 4A3IH 3DZDA 2NZ8A 1UKYA 4C0KA 4ZV4A 2BMFA 4A3JG 1LVGA 3P26A 3ZJYC 1VF7A 4GRAA 2FFAA 3ZZTA 4AC9A 3K0EA 3CRMA 3GEIA 2O8DB 4JI7Q 3A1UA 5SZIA 1C7YA 3LD9A 1WMSA 1NE3A 3AQQA 1OHHD 3GTJH 1Z6TA 4UQOA 2F4VL 4DR7Q 1W4CA 1K8MA 1RIFA 4HDQB 4KCGA 4XD7A 1XTIA 3GDEA 1WCMG 3KB2A 3SHWA 1K6MA 1VS0A 1LS6A 2BM0A 5B58C 3GPLA 5EE5B 1F2UA 3ZIAA 2P6RA 4MH0R 3SBDA 4II7A 1MO4A 2NN6H 2I5HA 4Q00A 4BE7B 2Q3MA 5LD2B 3HOWG 3THOA 4B3RL 2FJUA 3IEVA 1QUQB 3KX2A 3O47A 4Y0AA 2GTPA 2EYQA 3P1JA 5HR5A 3OE7D 4I1UA 4TMVA 4QHYA 2CHVA 3RS5A 4C0JA 2VQFQ 5L3QA 4B71A 3X1YA 4JVNA 3E5HA 1SXJE 3SYNA 5J40A 2O5JC 2ODBA 3WXMA 1G3RA 4IPHA 3EPJA 3UMFA 1E6CA 3W90A 1KL9A 3RAPR 3U44B 3PGZA 2R8RA 4KXFB 3AVYA 1GOTA 1TU4A 4IXMA 4DNRB 2P0EA 4OK6A 4RVCA 4M1KA 3AUYA 3K70C 3EWAA 4A75A 4IEIA 3CCRA 1XEXB 1U0HC 3AFQA 2PI2A 4P71A 1XCMA 4P32A 3U61B 3THYB 3LV8A 3E70C 1NL3A 4A3GG 5IT5A 2NQ2C 2DPXA 1TF5A 4PMWA 1WRBA 3Q72A 4B6FA 3U50C 2GJ9A 1O3YA 4XD7D 1W2GA 4Q7LA 1CJUC 1R5NA 2BEKA 3ZIAD 4KFUA 2IWHA 5KPDA 3A0JA 4JYCA 1W7AA 4GDFA 3U4ZA 2R2AA 2ODWA 2YHSA 2QEXA 2GEVA 3K0FB 4AIIA 4BEJA 3GTOH 5JRZA 4AG5A 3B6YA 1OJLA 1RW4A 3H3VH 1J5EL 4DR4Q 2KB0A 2BKUA 1X55A 1ZM3A 2N1BA 4PAQA 4E09A 3W5IA 1NN1A 3ZVRA 1BO6A 4AURA 2IXFA 5K36G 2HJGA 4DR4L 2J0VA 2JCSA 3HU2A 1JQJC 4KLKA 1ESMA 3BS4A 3AUXA 3H86A 5DH9A 1GDDA 3LBNA 3NTUA 5TMPA 1KAWA 1N9WA 1JAIA 4JLPA 3BFVA 1VQBA 1PH1A 4ITRC 2A6ED 1II8B 2AD1A 3I3SR 3F3YA 4GPTA 5J47A 3KJOA 3U9SA 3GMTA 2VL7A 1BH2A 3FPAA 2GKSA 3NC0C 1CS4C 2UU9Q 4UP9A 1Z0AA 3C4JA 3HDTA 1W0KA 1XNQQ 3S1NH 2FXQA 2WZQA 4CW7A 2ZM5A 5EZ6B 5K8UA 3FE2A 2DGYA 1DOAA 1YBYA 3L0SA 5FUYA 4BFXA 3GLFA 2LMCB 3SGIA 4L5RC 2UU9L 1G1MA 3AP1A 2EJFC 1UKEA 2XAUA 5C4XG 4NE2A 1YZKA 1NBWA 2D2EA 1I4LD 2W83A 5EZ5A 1QHGA 4WZAE 2ZE6A 3NDBB 2H8KA 3A4NA 1CSPA 5AJZA 2BIFA 3CUEF 5SZKB 2QG6A 4ZCMA 2IWRA 3VHXA 2Q3FA 1KDRA 1EGAA 2IYUA 3LNCA 4RKFA 3CH4B 1L4YA 1WXQA 2W6IA 2PI2E 3TRZA 2GESA 2O5IC 4IJHA 2GBLC 2OV2A 1NLZA 1JPJA 1Z6YA 4L8JA 3I32A 1YQTA 5GJCA 4LCBA 1IXSB 2QGZA 4Q1FA 5FBRB 4GZYC 4NYIQ 1GD7A 5FR1A 2QRZA 1YHAA 5KDDA 2O8FA 1XF9A 3LXXA 1QHHB 2BH8A 1L0WA 1N36L 1JR3A 2DFKB 2Q6TA 4UP8A 2QQEA 3KXKA 2H5EA 1EESA 1TXYA 1S3SA 2ZJPA 3K9LA 1TPZA 2AHOB 4DB4A 3I56A 3IRBA 1XPOA 1T0HB 1COWD 3RLNA 1Z6XA 2CEAA 4LGMA 5D3MA 4A3JH 3KF6A 4ZPXA 2CQOA 1PA6A 1G3QA 3SHFA 1W0KD 4B48A 1QZXA 2I1QA 2TMKA 2ZS9A 3CF5A 4PSKA 4NDZA 2XGTA 3HOYH 4EKDA 1PMRA 1WP9A 1TWHH 5FPHA 1G64A 5EQTA 4ILEA 5KSOA 3OEEA 1K8OA 4OONA 3GTQH 1VIYA 2QM8A 1YNJC 4U00A 3NC1C 3TUJC 2PT7A 4AYTA 1SVLA 3QF4B 1KGDA 1RKBA 3M3YH 1OYWA 4TYQA 3A7AB 4TMTA 4ARZB 4TYWA 3OTOL 1HCZA 2P3SA 3OEHD 4P72A 1IONA 4CEHB 2W6ID 5IWAL 4HZUA 4L5TA 1XP8A 4L5SA 2ORWA 2J9RA 3W6PA 2ZI9A 3DVLA 4BLSA 3IGFA 1IXRA 1B23P 4MYHA 2A68D 521PA 3QXJA 5DGXA 3PR1A 2ZE5A 4C7OA 3VA7A 4PC6A 1JR3D 3IILA 2EVBA 2XITA 2VHJA 4GN4B 2BBOA 1W36B 2BCJQ 4UNPA 1R6BX 2AX4A 4MZ9A 1N5KA 4RKEA 1E3PA 4RCYA 2WPDA 5CB6A 3TMKA 2AN9A 3HPRA 4OBEA 1T3SA 4IEEA 4B3XA 1R2QA 2IYRA 4DEXA 3GLIB 4NCIA 2QGNA 1M34E 1I5FA 2XB4A 3A1VA 3AVOA 1E7ZA 4JSYA 5DLQC 2D5DA 4LF7Q 2HV8A 1XXHB 4URVR 2OILA 3Q5DA 4GSYA 2OAP1 1Z22A 2FPLA 4PO9A 1OKKD 4B3CA 5M04A 4GOKA 4A3BG 3FFAA 1CKNB 2ZJ5A 4JI4L 3WP0A 1A8VA 3KQKA 4V0OA 4FDBA 4IO9A 2QI9C 2WICA 1Q3TA 3CRW1 3VQTA 4DK1A 2QSZA 3NBZC 3OEED 4GKKQ 1OIXA 1AE3A 1LUZA 5ELNA 3SQWA 3HOXG 1VQOA 2ZSFA 5G40A 4YCUA 1BKBA 1XJVA 1VQHA 1QZHA 3HOZG 2YZ2A 1KY2A 3KL4A 5JJLA 2REOA 4GNXC 4Q4LA 5EE9A 4OJKA 4Q1DA 3KF8B 3VTKA 5IP7H 3FDIA 1I6HH 2KHIA 4M22A 4NXNQ 2ZTEA 1I4DD 3WHLA 3X1WA 1SR3A 2ATVA 4D4LA 4GN5A 4X66Q 2DFTA 2QUZA 2WIBA 2WBLC 3B1VA 3OHMA 2AFHE 4Q4AB 1RIPA 4ZCLA 3R7WA 2KENA 2IT1A 2JK8A 1G8PA 4XSGA 2A19A 721PA 3IIJA 2EQBA 3I4NG 2OUKA 1VTKA 2OFOA 4MGKR 4LK1C 1KI3A 5DIFA 4POAA 1T8UA 5BYJA 3JAMi 3L7ZC 4GOPB 2MFIA 2VSXA 3CR8A 4HUQB 3NEMA 3S1AB 3TR0A 4WA7A 4DCVA 4IDNA 5FTJA 3O8DA 2JA9A 3WYFA 3CCLA 1T4GA 2WPDD 4N0DA 2IS2A 2B63G 2K52A 5G41A 4EPVA 1QHNA 3AVQA 2I0QA 2XNDD 3EARA 4JBXA 1KK3A 4KU4A 4MGYR 1YHQA 1WFQA 4TT3D 2H7VA 2AFIE 3BXZA 3ZLJA 1Q81C 1TX4B 2CXXA 1LM0A 4A8JB 4DSUA 4L8GA 4M21A 3W5JA 3QIAA 4JLNA 4C0SA 5C2JB 1OH5A 4QHTA 2HDNB 1RVDA 5LB4A 3K0SA 1PFSA 4NP6A 4BLOA 4KV9A 1KC8C 4JSTA 1B9NA 1W1WA 1GJXA 3RHFA 1NMXA 2H18A 2IYZA 4US1R 2D0PA 2IXGA 3C8UA 4TMXA 1IBKL 1XEFA 4Q47A 2Z4SA 2O8DA 4TSFA 3LDAA 4A3MG 2ZJRA 3FKSA 4HB4A 3CP0A 1JAHA 4Q01A 4UXJA 3PEWA 3U6BA 3HKZE 2VQEQ 4OK5A 1UEJA 1J8YF 3CBQA 1WDTA 1NF3A 4QM7A 2BDOA 4Q9HA 3PO3H 1X8KA 5IYBH 2AMCB 2JLRA 4XTCS 2FNAA 2OG2A 3WP1B 4PO8A 3CPWA 4D82A 3B1YA 1H95A 2RCNA 4BECA 3E9IA 4DV7Q 2GK7A 1QUQA 3QXHA 4M9ZA 3BB3A 4FINA 5CK4A 5LPNA 3T51B 1B70B 4X65Q 3LY5A 4MRNA 1UADA 3BD9A 4YMWA 1C4OA 1U8YA 1JQLB 2Y0SE 3LQRA 1HPCA 3SE0A 1KI2A 1LS1A 2Z5FA 4OQFA 3Q8DA 2Z43A 3GJ8A 4P4SB 4AKGA 4AQYQ 2QNRA 1HZ9A 1ZUIA
chains in the Genus database with same CATH superfamily
4Q02A 3PKIA 3O8QA 5JQGA 5JYCA 4AZVA 3K96A 4BEBA 2DQSA 5B3LA 4BFLA 3EJWA 4B4DA 3EPRA 4HN7A 2ASEA 4TWJA 3A1DA 4QGSA 2UXCB 5E8RA 1XMSA 2P4UA 3PFKA 2Z0MA 1N34Q 4PNPA 2R7LA 1PI3A 1AE1A 5L3SB 4X3KA 3CZQA 4HWOA 1HQMC 1V2HE 1FFSA 1JXMA 4G81A 2NZ2A 1V8QA 1DONA 5E6SA 3OQBA 1T2UA 1W47A 3E27A 2QZJA 3H5VA 5TIIA 2V97A 2WHXA 3OLQA 2JHPA 1AN8A 5KMGB 3HBJA 2UUCQ 2OUIA 2K5HA 1UBLS 1D6SA 3I2FA 3V4VB 1SKUA 5A3SA 2XA2A 2YMLA 5D3KA 4ZKDA 2Q07A 3S2IA 1T9GR 4DDHA 4OUDB 4KH0A 5FOSA 4FZRA 1I50B 5HZMA 2ZSIA 1KXJA 2ES2A 2Z4RA 2ZIZA 3D9QX 4I1OA 2Q2TA 1PH8A 1LLQA 4IQ4A 3KBXA 1Z33A 1MQ8B 3OQMA 3MXUA 1OFIA 2JATA 2HC9A 3JQ8B 5D84A 3RBXA 3WQBA 4C1NA 3K8QA 3RVDA 1ULHA 3FB1A 4E3WA 1VCIA 2IUTA 5D01A 3KKZA 4KJNA 5HX7A 2B2XA 3BMQA 1SOVA 4LWCA 1BHO1 1GVHA 4BBAA 1OUMA 2WUEA 2JEBI 3W34A 2Y66A 1W4ZA 4QOSA 4DV0L 1CS0A 2BMWA 1XFDA 1W0JA 3EOZA 4BV2A 4WLVA 1P29A 4KP7A 1IZZA 5DHRA 3DV0A 3FWZA 4Q7EA 4JA0A 3K2BA 1QVAA 2WFZA 1V71A 4FFWA 3V4RA 2FDCA 4QPDA 3ZHUA 2SKCA 3VNBA 4TLAA 4K87A 3FFXA 2AH5A 4X91A 1O7IA 2YY5A 1XEWX 2B20A 2HLNA 6LDHA 9ATCA 4LOHA 2F0KA 3UO8B 4PY2A 4TVKA 4FW8A 3D2AA 1TM3E 4LAFA 4C0QC 3QGMA 1YB1A 2ID8A 3UGJA 1T4CA 2KHSA 1CEXA 1Z5GA 1E2FA 1MNAA 3LHDA 2CJPA 2QL6A 3CR3C 1HKHA 2Q4EA 2FLKA 1M72A 1SBZA 4ZDIA 5J59A 4RA6B 5KOIA 3EIVA 1ZVMA 3K0BA 3M5CA 3I4CA 4R1QA 4LDJA 1AFPA 3EGEA 1M74A 3TSYA 1FX0A 2BP7B 5GGXA 2JGKA 3WRYC 4NBSA 3BDIA 1EWKA 5HDQA 3CX3A 4PCUA 3QXSA 2P5ZX 5IAEA 1HNWL 4DAEA 3RUPA 2NZHA 4HATA 1MT0A 1W76A 1LNSA 3KQSA 3RKUA 2H2FA 4GMFA 4YALA 3X1KA 1HFGA 3LL4A 1PG0A 3H1PA 5AJVB 5CDUA 3D4PA 1G8GA 1JZQA 4ALMA 2QLMA 1PU2A 3UN1A 2E74C 2R8XA 2X3YA 3AF3A 4LVCA 5KYKA 2N8NA 4BGIA 3H1GA 3W9UA 3LRXA 2VNUD 4F5WA 7MDHA 2I67A 1EAMA 3HXKA 2MJLA 4URWR 2QQFA 2EVWX 4Z0HO 3S55A 3TFQA 3BGDA 4L0MA 1CEYA 3TKLA 1V8DA 3GFVA 1C81A 1ETHA 3EF1A 3L7KA 3O8OA 4B34A 1XNQL 4H0NA 4MQLA 4JCVE 1XF1A 2XOEA 4HS4A 3VYTB 1L7XA 4RGQA 3JD0A 5FX2A 4AIMA 2Q29A 4KX3A 2C92A 2OK7A 3KM0A 5CBKA 2PO5A 4DUGD 1CJVC 2GBIA 4OGLA 1RZUA 1NNSA 2HA5A 1DRUA 1OT5A 5ALKA 1SC4A 4UAVA 1Y1VB 4PNHA 2VDWB 3B3GA 4HH3C 1HJPA 1WXEA 3WOHA 4X8MA 1T8WA 2NOAA 5JCOC 2KE5A 4JVMA 5JVH3 1JHXA 1JE5A 4N6OA 2WFAA 4MZDA 2J59A 1XGKA 1KA9H 4DHWA 1J5XA 3KQHA 2DWOA 2WJAA 2OORA 2G9HD 3A7LA 4CHTB 5J43A 3SC3A 2O4UX 1DJQA 3R9WA 1DX9A 2QKYA 2WPNA 3PFHA 2EJWA 4O25A 2BBTA 2IEBA 4NE2A 4M9XA 4ND8A 1VQDA 4US2R 3TTUA 1W30A 1KERA 1ADGA 1I33A 4EJSA 2P4SA 1B1AA 5FOBB 1IAVA 1UZUA 2PLRA 1JIKA 2XRFA 3ITKA 2OWEA 2A86A 3VJLA 5IBPA 5IJ0A 1UDAA 4G0PA 1MN6A 1PW7A 5D14A 4CL8A 4MI1A 2HQSA 3KETA 2I4RA 5DTIA 1VSTA 3KWJA 4ARIA 1JEAA 2O54A 2GN5A 4ZMRA 4Q19A 1PQ4A 1SCQA 3A54A 2C7RA 1KRTA 3QH4A 4G89A 3AEUB 3MMPA 4REMA 1VBKA 2YRFA 1FYXA 2QXYA 2GEUA 4H3KB 4IIHA 1QVRA 4Y0VA 4BAGA 3VKHA 1I30A 2G72A 5GM2A 3DZJA 3V2HA 1EQ2A 1MVLA 2C99A 5ES4B 4XQ0A 2ZSHA 4DV1B 3QBVA 3RTAA 3H15A 1NY4A 1ZSYA 1PEAA 3B6IA 4RQTA 1NZJA 1L7AA 3NKVA 4L3VA 3AY3A 1JIJA 1Q82C 3ILHA 4GRIA 1STBA 1V5FA 5K03A 4NECA 3WVNA 4OU4A 3WNCA 4ZT5A 5B4UA 4A03A 2H7XA 2X1MA 4TWIA 1H8ED 2EIHA 2QEQA 3QKTA 2COKA 2OVFA 1T8RA 4Q6WA 1TYCA 1T1SA 2I2WA 2RBKA 3L7CA 5I7HA 4CMIA 4TRMA 2PTHA 1TECE 1REQA 1QILA 2YC2C 4DV6Q 2ZJZA 3FJ1A 4GM1A 3AVUA 4OHYA 1GT6A 2GPYA 1DNPA 2J3EA 3ZDXB 2CCGA 3HOUG 4HGPA 4RTSA 5EIHA 2WU3A 3BDVA 1GEEA 2OV8A 4A2PA 1DIGA 2Q7DA 4OBXA 3U7FB 4ZT4A 2AXPA 2FK7A 3HUUA 4DR6Q 4JV5L 1FOEB 5CK4A 4C3HB 2PYIA 1V7CA 5EZYF 3G5MA 3K0HA 2NTJA 2GVZC 1A9TA 1M8PA 5ADVA 4LCJA 2VBCA 2O0KA 4MB2A 3DHVA 1P1BA 2B2UC 3F4KA 2ADOA 3OFVA 2WD7B 4A26A 3U7JA 3PO2H 3QVMA 4RDXA 4N3GA 2W48A 1NBMD 3AM4A 2A4KA 4U673 1I4HA 1IN8A 1E7QA 4AJNA 2CKMA 3PENA 1T6YA 4W5NA 5B1IA 3CZ9A 3TUZC 1RCVD 4DA4A 4LFBQ 1IN5A 3S1AA 1N5DA 2PX4A 4A93H 3OTQA 4AM8A 4OL9A 1QLHA 2EATA 4H08A 2IL8A 1FUEA 5HKBA 2E5LB 2NUAA 3FDJA 1U7XA 2WHPB 5EG5A 4A8JA 4RZ3A 4D3FA 4CT0A 5IGDA 1TAGA 4J0CA 1Z8HA 3IRVA 3SSOA 1KY4A 3BRSA 3NK9A 1DO2A 1K2VN 5JARA 5IYDG 1S8OA 3OC0A 1W48A 2ZUBA 1TT5B 5KKAA 1GHTA 1QR6A 3DQQA 4YUYA 4BVBA 3I52A 1ZX1A 4X3TA 4JKYA 3KD2A 1DOZA 2ROQA 4Y2RA 2XZLA 1CDZA 3SDZA 1SO8A 2IKQA 2G08A 5EIWA 3QKRA 1E1QA 1H4VB 2IOHA 2Y1KA 1UFQA 4CU2A 3PHJA 1VI6A 1WU8A 5DV9A 1ULUA 3IHKA 4BNKA 5M5WH 4NENA 1FFEA 4D9CA 2PD3A 4BCBA 2BI8A 4RK4A 1BZYA 3ETGA 1CX9B 3B3QA 3EXEB 1M9NA 3UXHA 2PMZB 3ADKA 1PT8A 5M5YH 1R5JA 3EMVA 2C5GA 3TXAA 2XCTB 4A3EB 4LOKA 3WLMA 1WCWA 3Q10A 1R3UA 2II6A 3UATA 1DFIA 1PNQA 1MKYA 4P0QB 4GPEA 2WFWA 1OB2A 2QHXA 4PQXA 1EA7A 1I94L 5FPQA 3CINA 1XZNA 2XA9A 4ENRA 1P8LA 4QIWE 4Q3LA 1UOQA 1LLDA 4FCTA 3A36A 5LZ8A 1YRQA 1SU8A 3SEAA 5K6AC 4ZZ1A 1YA4A 1HDZA 2K7VA 2REQB 3DLLA 3LDUA 4CIDA 2OCPA 3GRUA 1FQOA 3L6RA 1KVTA 1TWFH 4KBYA 1JVBA 2NU6A 4Q3CA 1TT7A 4PFSA 1WMAA 1PN3A 4WJLA 4OATA 1FVHA 5JSUA 5C8YB 2PKWA 3E2IA 3K6RA 2R62A 5CFNA 5KYXA 3DEJA 2ECFA 5JDCC 2KLBA 3DKIA 5BR8Q 1FL9A 1KHIA 2EZ8A 4OBBA 4BNJA 5CVCA 5UKDA 5HRUA 3NBHA 1ULTA 4MDHA 1X1BA 1JWLA 1FU4A 5BNZA 4AMGA 2GJ4A 3T35A 3CVVA 2B2CA 1QXSA 4CU5A 1N36Q 2DBRA 3MEFA 2F1JA 5JXWA 1EVYA 4G86A 1MZPA 4FS8A 1TQ6A 1R4MA 4LV5B 4BV3A 4DAYB 1G5RA 1E1DA 2DFLA 2BTOA 1GUGA 5ALGA 4IGEA 2WWXA 5DK6A 3ZJTA 5C31A 3EBOA 2HHHB 2O2EA 3DWQA 2IGTA 3HOWH 2JI8A 4HCJA 1C0KA 2B5VA 4IG4A 2EC5A 5H59A 3MERA 1MEJA 1IDN1 3SZUA 4JJFA 5HEKA 1C5KA 1IN4A 2W2VA 1FF9A 2E4ZA 1PSZA 2O7RA 1AU9A 1I1HA 2A14A 3J81j 1U28C 3WWZA 1FDTA 2ZYWX 3KP1A 4TV9A 4FMDF 1W19A 4PXSA 3SEZA 3ND9A 2XWJB 3UT6A 3A9VA 5JXIA 1AKRA 4MI9A 4U2GA 1OXUA 1ULBA 5BR7A 4J8QA 1JG1A 4DQLA 5NLLA 4E7OA 1MV5A 3WK5A 4OREX 4XQGA 3LGJA 1JMYA 2RDFA 3TSCA 3OUUA 3Q8LA 2X6QA 3ZCXA 2IU6A 3K59A 1GAEO 3BOSA 1YJ9A 1U9YA 2JD0A 3BL8A 4WBNA 1ZICA 1YRAA 2CHQA 3L04A 3E9MA 1TNDA 3QEAZ 3KJEA 1Y9EA 4KMOA 4K9SA 1UQTA 1EKXA 2PMZE 2ADMA 1N5OX 3WMXA 1I3LA 4OAQA 2PWBA 1EY7A 1DWOA 3TEHB 4HNHA 3I5UA 3A1SA 3W0LB 3E9QA 2KWIA 5KEIA 3TR5A 1BE1A 2FZGA 2ZATA 4JBNA 3RVBA 1GGNA 4P2GA 1EQRA 3DQPA 5C4GB 4K5VA 4WEOA 5T6MA 3LL7A 4QMGA 2CXHA 2C5CA 3QW2A 1QMGA 4UJ3A 4DJ5X 5CT4A 3W6NA 4NPHA 4AY2A 1O08A 2VBFA 3ZCPA 1CUDA 2Q3HA 1T9ZA 4RA9A 4AUEA 1KI4A 2QLBA 3PP8A 2JFNA 3FDTA 3N5CA 3NTQA 1PVOA 4ACAA 3PJDA 2WB1E 3F2BA 4MO9A 5HJ7A 4DAMA 3C3WA 2JGMA 4L5AA 1S5PA 3P9KA 4URHA 1T35A 3W5BA 3N8GA 5E7IA 5C52B 4A3MH 4EKGA 4ITUA 4Z1MD 3EVDA 2E6UX 3LT5A 4QEZA 2UXDQ 7YASA 1L5LA 4UOEA 3MT9A 2VUMB 3LDFA 1O97D 1DJRD 1DBQA 1JJGA 1G9TA 5A9SB 4HBZA 3UDGA 3IC5A 1U5KA 4GNRA 3WRVA 2J46A 2E21A 3GK3A 3PNMA 1T3TA 4Y6OA 1IW7D 3NXSA 3GRKA 3HRHA 1NR1A 1QE3A 3L6BA 4MUAA 3R5XA 2YXPX 3HEJA 5K0BA 5ESRA 4CM4A 4DT1A 4RFSA 1HFJA 2FF5A 4UBKA 2IYTA 4IV0A 2BSQA 1SVMA 4R16A 1E0BA 3LCUA 2QPTA 1YR6A 5FBWB 3Q8XB 2JAUA 4LJ4A 5KYGA 3SVLA 2H5JA 4PTLA 4RV9A 3LUJA 4LV6A 1RAGA 1U2SA 1DC4A 3F7NA 1PYOA 2UZ3A 1QH9A 1S01A 5JMOA 4I8IA 3ONAB 1J8DA 3FCCA 4TPKA 1KRHA 3K73O 2C8KA 2PS3A 1CY1A 5A3VA 3PXBA 4BJ6A 4QYWA 1A7UA 2PCJA 4GPBA 3BB1A 4LNQA 1YL7A 1H9BA 1BS1A 4PX5A 5IF9A 3EVGA 4N5MA 4FKBA 1U1FA 5EIOA 5FTMA 2BFEA 4FOPA 4RDHA 4D9EA 3LZ6A 4RH6A 1H6AA 4NFYA 3IP5A 3UFBA 4IICA 5EIBD 1PJLA 2BW0A 5KYUA 4A92A 1F06A 1QVGA 2PW5A 4K0KB 1C9DB 5I4DA 4P3KA 2P7IA 2WWVD 3F97A 3AP2A 4F87A 3D3QA 2JLSA 2K2QB 2FRDC 2HZ7A 5TEWA 1SFOB 5JD4A 4BWGA 1UKYA 2DBVO 2BMFA 3V7UA 2NXEA 2CUNA 3V7YA 5KC8A 1AKVA 2O8DB 1DKNA 1NE3A 2F4VL 1RIFA 1EK2A 1K6MA 3T0GA 1I2ZA 5DOVA 4HFMA 4CIYA 3PEEA 3KX2A 4AG3A 1Y1PA 2EYQA 3QUCA 4OF4A 1JE0A 4II3A 1A1SA 1G5IA 4NAVA 3EPJA 5JC8A 4B82A 2JIDA 1ZQ9A 3D3RA 4WD3A 4R9VA 3FDZA 2G07A 4IV5A 2IRWA 1LV9A 5K4GA 4AO8A 4RGMA 1NFRA 2ZT7A 4E30A 4DNXA 3ITEA 3JQ7B 5DM60 3A31A 4ZHSA 4MUFA 3Q72A 4D57A 1R5NA 1IUNA 2C2XA 1WSAA 5FHRA 2Q45A 3B5EA 3KEMA 4GDFA 1IHDA 4J8PA 2YHSA 4YRTA 1YJCA 2RHLA 3OTHA 1JT9A 2AVDA 3LX0A 1PTOC 4BB6A 3HU2A 4G26A 3LBNA 1VZ2A 4H3HB 2DECA 3C4JA 2FXQA 5AI5A 2Q99A 4MS4B 4FF2A 3AP1A 1TKCA 3UMVA 3MFQA 4M8AA 4U7TB 2CVRA 4X20A 2PI2E 3NYWA 4LCBA 1IXSB 1DQNA 1GD7A 1ULSA 3GUHA 1GSAA 3RLNA 2G71A 4A3JH 1VMEA 3CN9A 1Z7BA 5J39A 1C9YA 1T8PA 4MP3A 1DJNA 1K86A 3TEFA 1OYWA 4NNPA 4YPVA 4L5SA 1SUCA 2B34A 3GYGA 4LOLA 4X1IA 4J3NA 3VSDA 3PR1A 2IDKA 2PXHA 2J31A 5I4CA 1T24A 4PC6A 1T1RA 1YZFA 5J2UF 1F0YA 2UUBB 2ZT6A 1XZHA 3JARA 1A0OA 2EG5A 1DT5A 5M04A 2Q6IA 1P4GA 5U1PA 4GOKA 4V0OA 1CUIA 2RGYA 3B1FA 1LUZA 4DDMA 5G40A 4LRXA 2ZBUA 5FUXA 1ST2A 3ABZA 1JI3A 4JR1A 2OQVA 4GOPB 1Y6GA 1N2SA 5CFMA 3WYFA 2XYGA 1UPCA 1JA1A 4X60A 3B6JA 3SVZA 1NC3A 3MD9A 2XWBF 3WI7A 2R5NA 3KR1A 2FCRA 4NP6A 1WLSA 5DMHA 2D0PA 2IXGA 5FT9A 2WNIA 2ZJRA 1Q14A 3KOXA 3PEWA 2VAXA 2FN8A 5IYBH 1Y3HA 4OCZA 2BGTA 5BT9A 1FTWA 1LS1A 3ZN2A 4MUIA 4TKMA 1PDVA 1XLWA 5TQ2B 3A2NA 4F5ZA 5E6UA 4P98A 2VSOA 2A1UB 1SKYE 4YWJA 5JI3E 4KDRA 3LSTA 3OFND 4HYYA 3W5UA 1KH1A 2QD2A 1NOKA 3JQ9A 3P52A 4LMQD 4LUCA 2VPYA 3P9SA 2GA8A 3OD5A 3W2IA 2ZRKA 4NH4A 3QM1A 4LVNA 2G9VA 1KC3A 1TQ8A 4JLKA 2D0OB 1OX6A 4FYHA 4XUGB 4AS1A 4GX2A 1U3FA 4IHJB 2NVQB 1RTOA 1AGRA 4LOAA 2R00C 1Q7EA 1P3DA 1EDOA 2NYZD 4LY6A 4WADA 4DV3L 2MTBA 3H7AA 3A37A 1KC1A 4JBKA 3QVTA 5EIFA 2A5GA 3LWNA 4G2NA 3AFOA 2ODEA 1TMKA 4MUEA 1IFXA 3MLAA 1P61B 1W87A 3GVHA 2VY3A 3DTTA 3C46A 5L40A 3PPIA 1DX4A 3F9CA 2XXBA 4KSBA 1IMOA 1YZNA 4QG3A 5TE9A 4G5OA 2HJWA 3U9OA 3IUEA 4P53A 4KG7A 2D5LA 1UH5A 3G89A 4LQDA 2JA7G 3MPUA 2WABA 3ET5A 4RJ2A 2OAGA 3QITA 3JATA 1CQXA 2AZXA 2C29D 1QIKA 1U9RA 2OOKA 4KW7A 4TXNA 1K83H 5I45A 4DLSA 4Q5IA 5DM0A 3LXMA 5A5DA 2DJ5A 4J0KA 1NP6A 3BCRA 1Z0SA 1LSOA 4QUGA 3OA2A 3AVWA 4FN5A 3L49A 5TT0A 3OU6A 3VYSB 2GHTA 1M8AA 3NWSA 4OA8A 3PEUA 3OWHA 2O3TA 3P71T 4AJIA 4YAOA 4BNUA 3ONWA 2VF7A 2RMKA 4C4YA 4IPCA 5AXBA 4XLLA 4OG2A 4KQEA 4QUFA 3TAHA 4OM8A 4DVJA 4EI9A 2JJYA 3B20A 2R85A 4MYDA 3U39A 1EEFD 1B16A 3HGMA 2J07A 1DADA 2GNOA 2YW2A 3NSWA 1NMGA 4XEUA 4S35A 1U7TA 3IERA 3SR4A 4Q3OA 1L4LA 2I80A 4FPXA 3H3XA 1OHHA 5CCXA 4UAJA 3UAZA 4XQ9A 1SK9A 2ACEA 2HHCA 2QTFA 1TRKA 4I5GA 2PZMA 4RCZA 3B7GA 3CG4A 2CJYA 3TS1A 1BVYF 4FO2A 3OIDA 3EEBA 2NYUA 3WXBA 1X94A 1HH2P 1BW9B 4AKIA 1QANA 3E23A 1YR7A 1JHYA 1Z47A 5IT9A 2QX4A 1B0PA 2CYCA 3FOBA 3ICPA 1KEUA 3GIDA 3KRTA 2RF4A 1TOAA 3UB3A 3DBVO 1WD0A 3AUTA 3VISA 2JA7B 2WD9A 1BVUA 3WB0A 4QXPA 4U7DA 2VKTA 4G56A 3H2YA 1QK4A 3M1IA 4UCFA 5KOYA 4WK4B 2H9YA 3T5CA 1KK0A 4W8OA 2FE1A 1GHJA 4N5NA 1PGNA 3B53X 3DF7A 3ERQA 1U1EA 3PIIA