1OXXK

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
352
structure length
352
Chain Sequence
b'MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Formation of the productive ATP-Mg2+-bound dimer of GlcV, an ABC-ATPase from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 105
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00005 ABC_tran ABC transporter
K PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxxK03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxxK02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxxK01
4DB2A 1XWIA 3NH9A 3TMKA 1SXJE 1FMLA 2G0TA 2QM7A 2Z83A 3GEEA 5HCNA 2IYXA 4A3DG 3CCVA 1UE1A 4Q7LA 5CJ2A 4AD8A 2IC5A 3K53A 1JR3A 1HT1E 2D4HA 1CJKC 5JLJA 4JG2A 1AS2A 1E22A 1IBML 3U4QA 2PNHA 2IXEA 2Y0SG 5FJ8H 3GTOH 221PA 4M9QA 3IHWA 1QHXA 1K83H 3ZVLA 5EP1A 3U3KA 1IYJB 4NPSA 1G9XA 2QAJA 3EPKA 3CB4A 1B0UA 4GP7A 4UNPA 4DDVA 4IJMA 1KTVA 2CHGA 5EZ6B 1N36Q 2E2JH 1UBGA 2YTXA 1ONLA 4KKUA 3I4NH 1Q1ZA 1ZD1A 2HEIA 2O0JA 2XAUA 2A7QA 3OFND 2ZE7A 4KSBA 5TY0A 1UAAA 3RN5A 2BVNA 4NBSA 2QNRA 4RFVA 1NJGA 1WCMH 1U0LA 2NO0A 3BBPA 4JLMA 2NPFA 4A6PA 4BLPA 2QM8A 2YU9H 2VHTA 1VCOA 3BERA 4E22A 5FR2A 3GLGA 4LPSA 3FKIH 3WWVA 2R92G 2W6JA 2WVJA 1HTWA 2IUUA 1YJNA 1KC8C 1EFRD 1V5WA 3KTAA 3KF8B 2BE5D 2CKZB 4DUYQ 3J7A5 4WA7A 2UZ3A 3K0SA 4JVLA 1JJ2A 1N0WA 2A3RA 4GT1A 4PQRA 1E9AA 1GZSA 1P2VA 1YZKA 2VP0A 3I4LA 5IE8A 5C4MA 2QP3A 2J5XA 1P62B 3B82A 2GXAA 2Q6TA 1O7IA 2OESA 5D3QA 1KNQA 1KAWA 1FUKA 1RKBA 1Z06A 2YWFA 3B6EA 4KITB 1GNQA 1QHIA 1KSGA 3GLIE 4JLAA 2F9MA 3CPJB 3LVQE 4GOJA 4L5SA 5HPYB 2R6FA 1RYHA 4Q9KA 3DM5A 2GEVA 3I1FA 3AF4A 3T1VA 5DHAA 1CSPA 4LUOA 1F60A 4OHZA 1GVPA 1RYFA 1NF3A 2RGEA 1N9WA 2ZRBA 1I5FA 2Z0MA 4TMKA 2FPLA 5CB6A 4MRRA 4OHVA 5KNCA 2RGGA 1EFWA 3K0FA 4BFSA 1N8RC 2LCFA 2AWOA 1Z5ZA 5KOYA 1Z0KA 2FFAA 2H57A 2Q2IA 1VQAA 1FW6A 3OTOL 1HY3A 4Z8XA 2ZUBA 5JSZB 4W7SA 1G3RA 1SVIA 2J1LA 3BH0A 5DN6A 5K8LA 5K8TA 4GN4B 3H2YA 3K09A 1Z6XA 2QT1A 4X66L 3CM0A 3T51B 2CE2X 3FMFA 1HZ9A 1M90C 3RHFA 4EFNA 2L15A 1LB1B 4AURA 1R6BX 1KO1A 1WQ1R 5JWRA 3QG1A 2PQAA 4JI2Q 4Q19A 1IONA 2Z6VA 4ZI2A 2K4KA 3L43A 2OBMA 1OFTA 5IK2D 2ZJBA 2PCLA 4OO1I 3T1YL 4QJ5A 2PBRA 2W6ID 4ITRC 1R9TH 1IBKL 4RCYA 1OH8A 4RFSA 3AVWA 4A0FA 3A0JA 4IW3B 5FI1B 2QSZA 5IP7H 2NVTH 2WPDA 1SXJB 5KU1A 1UEJA 3UXMA 2ZRIA 1R8SA 5FBWB 2ZRJA 3SFVA 1S3OA 3KDFA 3LA6A 2GF0A 5B2ZA 2GVDC 2GTPA 1GUNA 1O78A 3K7AH 1GKIA 4YHHQ 5JI3E 4TTQA 5C44G 1AQYA 1T5IA 5TDHA 1HNZQ 2QMEA 2V1UA 5HE8A 2G3YA 3DO6A 4YDSA 3I73A 3I92A 2QF7A 1IJEA 1KL9A 1GTVA 1CJVC 1IBKQ 3K8YA 1Q8KA 2R93G 1Z6YA 2AXNA 2NN6I 3TK1A 5F98A 2ZQ5A 2DWQA 4W5JA 2E75C 3BRWD 1XD2B 4LJ7A 3X1XA 4BY7H 3LLMA 3SFZA 2A6HD 3AKCA 4G5GA 2OXRA 3OEED 2Q3HA 4DSNA 1EWHA 1YHBA 5E3HA 1LTLA 1MO4A 3HU3A 3DZDA 3JAMc 2J9RA 3W5JA 3UMFA 1E0SA 2ZE6A 4TLEA 5IYCH 2XTMA 1YQTA 3T34A 2AD5A 5JCZA 3WBKA 2WJVA 3B7GA 2GAOA 5M3FH 3Q9LA 3JAMi 1N6IA 1X86B 1Y14B 1J70A 1LF0A 3VA7A 3FTQA 5FTMA 4KXFB 3HGBA 3AUXA 5DLQE 1IJFA 2HF8A 3RRZA 5AUQA 1VQOA 4B3DA 2P6RA 1A4RA 1XNRL 3FKQA 1ZM7A 1QUQB 2KENA 1KNXA 2WOJA 4IOKA 1RE0A 3NBFA 4LRWA 4POFA 3U60B 4X64Q 4JBWA 5CYOA 1KZ7B 1ZNWA 3AB9A 3FB4A 4P4TA 1HH2P 2OEPA 4PZLA 4JBJA 4B3XA 4BE7B 3ULLA 4DLUA 4PO8A 3NDBB 5AUPB 5KHOC 4M1TA 2EYQA 3E9IA 1VQMA 3V4RA 3UANA 3T56B 4B3TL 1Z22A 3TS2A 2MMCA 4OJQA 2ZYUX 5DH9A 2FSGA 3J81j 2PJRA 1WE2A 1VMAA 4F4IA 2G6BA 4ZDJA 1US8A 1CS4C 2Z6KC 4P4SB 5A4JA 3LD9A 1L0WA 4QL5A 1XMOL 2F4VQ 2DFLA 2FFBA 3OPOA 2XTZA 2ZU0C 1CJTC 4MYCA 1NIJA 4YC7A 1BKBA 3HFZB 2K32A 4TMWA 4LUCA 3ICEA 3GD7A 2A6EC 3OOCA 1S96A 2E87A 2JAQA 2PL3A 2P6UA 4U5XA 5ANRB 2EJMA 4JVSB 3TQCA 3ZLJA 2FJUA 3RRYA 1Q1QA 5IY0A 3CRLC 1EWRA 2C95A 2O8FA 4GLVB 4Q47A 4KHPL 1HE1C 4UNNA 2K52A 3K0CC 3WNCA 4JI5L 5CLQA 4A0RA 4CVNA 2BA1A 1E69A 3C4JA 4AYBE 1GNRA 1ZINA 3A5ZB 3GTMH 4MKFA 3GLIA 5FI0B 2BH8A 1Z28A 5DLQC 3B78A 3RS7A 1W46A 2B8TA 4KVGA 3OYYA 4UP8A 3B85A 4YONB 1G16A 4GOPC 3B13B 1XMOQ 1AA9A 4TLBA 2LXJA 1JJVA 1QDEA 1JI0A 1NJIC 2ZAMA 3N2IA 5FPSA 1A8VA 3QKSA 1SVWA 4FDBA 2QPTA 4NKRA 1E9RA 1CKMA 1JALA 3IQXA 1CR4A 4RKFA 5F3WB 4N0EA 1G3MA 5JCPA 4JV5L 1P7CA 5LD2B 4OI1A 4OI0A 1ANKA 1XB2A 2YOFA 2VF7A 1IAQA 5CIQA 1CULC 4KHPQ 4Q4AA 3W34A 2P6NA 1DPFA 3TR5A 4JI5Q 3Q8XB 3UPUA 1U98A 4CEIB 2HCJB 1NVXQ 4MQBA 4JI3L 1Y8PB 1IN5A 4OYHA 2B8FA 1VQEA 1JECA 2DPXA 3HU2A 3OIYA 4JI8Q 3AFQA 3MD0A 4WJ3M 2ZJ5A 2OSBA 1A1VA 1GRRA 1LY1A 3K7UC 3DEFA 5E7NA 2ZT9C 2F1MA 2XEXA 3D3QA 3H0GH 2Q2UA 2ZTDA 1D9XA 1EFCA 5BN5A 3X1WA 3U44A 3RANA 2VHJA 4OK6A 2PCFB 4PZ8A 4HJ5A 1XEFA 3CC7A 4JI6Q 3JVUA 2GJ9A 3QG5A 3ZD7A 3HOYH 2YVUA 4F7WA 2WP8J 1S3GA 1L4UA 4BQSA 3KQLA 1XJQA 3S1MH 5UKDA 1PMRA 1CBUA 4ASUA 4IOAA 1W2GA 3DMDA 4A9AA 4TYQA 3TLXA 2XNDD 5B57C 1NN3A 2P5TB 3W5IA 2FNAA 2ZUCA 4Q1FA 5JEAG 4JI3Q 4HDCA 1X54A 4B47A 4OGQC 5FLMG 2OILA 5AUOB 2NVXH 4F4CA 4HJ9A 1MT0A 3ZDQA 5IP9H 4LV6A 2WWGA 4ZO4A 1F48A 1I4LD 5G53C 1X6OA 521PA 1TWFH 1JEEA 1YJ5A 2C5LA 2O8CB 4QIWE 1Z3IX 1XNQQ 1FQKA 1II8A 1YR6A 3GJXC 2GA8A 1X1RA 2GEUA 1TU2B 4EPYA 2GXUA 2OHFA 4KN4C 4TVAB 1MABB 2P65A 4DV3L 1TADA 2OFWA 5EE1A 2J0SA 4JVMA 4PAOA 1ZU4A 2VP4A 3CZPA 3W3ZB 5L3SB 4DR5Q 4EPWA 1E0AA 1SROA 4OHXA 4XVRA 3W90A 3AP3A 1SMYC 2IS4A 1HR0Q 1T0JB 4MRVA 5GJWC 3EZFA 1E94E 4TSFD 2EFCB 5CYPA 3CF6R 4Q4JB 5JEAJ 2CJWB 1LFDB 1T8UA 3GLFE 1XPRA 2V3CC 1OJLA 5FH9A 2DYKA 2BIFA 2AR7A 3QI2A 3BDOA 5KNBA 1XX6A 3Q5DA 4BUJA 2CCKA 2VW9A 2AD1A 621PA 4HAYA 3HDTA 4TL8A 5TXGA 5HR5A 1LYLA 5KSOA 4JL5A 2XSZA 3QPUA 4MYTA 1PH6A 2UXBQ 2ZI3A 4DV3Q 4LFAL 1VYUA 4GOPA 1BMFD 2H16A 4HJ7A 1ZIOA 4R4IA 1XZPA 3BH7A 3TUJC 4NXMQ 1DAKA 1E2PA 2HV8A 1NLYA 2ODBA 1E24A 1BBWA 5C0XG 3PO2G 1NVUQ 1VG0B 2H92A 6Q21A 2PPBC 1E4VA 3BS4A 1Y3AA 2ZSEA 1GKHA 1VG1A 1Z6GA 2KE5A 2QQ0A 3P32A 4PAMA 3FMCA 4DUGD 4YCVA 1W0JA 1VQHA 1VYVA 2WB1G 1E2FA 2NZHA 3X1ZA 1OT3A 3EIVA 5ELXA 4PXAA 4V0KA 3HKSA 3N5CA 3THYB 4A3CH 1VDZA 2CLSA 1NVWQ 2FG5A 1P4SA 5LMNQ 2R7ZH 2MO1A 4RCZA 5LB4A 3SU8A 5M04A 2ZJPA 1KMHB 1KXLA 3L7ZC 4DR3L 1G5PA 1WMSA 4NDZA 4MYUA 2O8BA 4JYAQ 3U4VA 2WWFA 1UWVA 4A3FG 1Q86C 1AE3A 4UNSA 3VR3A 3D4RA 2X2FA 4JJZA 3FPAA 2D2EA 3J81k 2GCPA 4Q1BA 5J4LA 4LHWA 5C0XJ 2F52A 2JJ2D 4MGIR 2BCJQ 1VQDA 3AEVA 2K5NA 1J99A 1Z08A 3K9LA 4A82A 1YZLA 2H7VA 1SQ5A 3PQCA 2UXCQ 1KKMA 4CYMA 1XMQQ 4DNTB 4RG1A 4DV4Q 4Q01A 3EPJA 1LACA 1H9SA 3TIFA 3EA0A 2K5HA 2IYTA 2AHOB 1U99A 4MKGA 4XVQA 5LBIA 2GVAA 4OK5A 4RZ3A 4HATA 4DR3Q 5EXTA 4YMVA 2OBLA 3THWB 3AVXA 2NMVA 2DWOA 4ZCMA 1ZBDA 1G8FA 4AIIA 1DE0A 2A68C 4DR6Q 3BFXA 2BMEA 2BBOA 3KLWA 4BBSG 1IY2A 5D3MB 3SBDA 1NMYA 1MKYA 4NONA 1X56A 4HB4A 1NBME 1LV7A 5GADl 3E0EA 4JZKA 1EG7A 4FCTA 1TX4B 3HKZE 4WZ6A 4NMMA 1K8RA 4TQAA 2VQEL 1OHHA 4LY6A 1BOFA 1NRJB 5H68A 1HQMC 2D5DA 5LMUL 3WXMA 4POAA 2QE7D 4PMWA 1YBYA 3HOUG 2KBFA 4KYUA 3F5FA 5AWFC 1UKYA 1ZU5A 2G0NA 3ZJYA 4UNQA 4NXNL 2UUCL 4YMTA 3K0XA 2Q8IB 1KK0A 3AEZA 3PSIA 3W8NA 1TF7A 5GVSA 4TL7A 3H94A 4HJ8A 1G7RA 1SVSA 3SI7A 5FLXc 4NCKA 3DLLA 3HOXG 2ZJQA 1GL6A 1DTSA 2N46A 4L16A 4PC2A 3MRSA 3MWJA 3GPLA 5KPDA 2ANCA 1UADA 3ETLA 4HR7B 2K75A 1XDBA 3NEYA 5EJEA 3U6BA 2DB3A 2GAAA 4FN5A 5H1YA 3U7FB 2QQEA 4WOPA 1ZNXA 3HYTA 2NTYC 2A69D 4YXWA 1Z8FA 2EJGC 4PHFA 4QNRA 4D4JA 1CP2A 4HZUB 2ES2A 2IHEA 3TGPA 1K8MA 3WP1B 2OO7A 1E1OA 1Q21A 3OEHA 4LZZA 4C0AC 3PIPA 1Q82C 4NXNQ 2XB2A 4GFDA 1E9SA 3O47A 3THXA 2GJSA 2XXAB 1KKLA 1GSIA 2ZM6Q 3TRZA 1ZP6A 4ACAA 2R6AA 2OWOA 1I6HH 2QEQA 2OZEA 4F91B 3OESA 4TTPA 1K8GA 1YNNC 4HAZA 1IYUA 1VF5C 1K9MC 4R71A 4AK9A 3NBYC 4A3GG 4LSGA 4R9UC 5SZHB 3TUZC 3K81C 1N6OA 4D81A 1CF4A 1CKNB 3T53B 1U81A 2ZITA 1IHUA 1P2UA 2FGJA 4MITA 2LMCB 5EP3A 1O87A 1GUAA 3BD9A 3QKRB 2YWGA 3VX3A 3A5UA 4NU0A 1BO6A 4BZQA 3GTQH 4A93G 1M1YE 2FX3A 4DUZQ 3AKEA 3TSWA 3AP2A 4Q21A 1YZNA 2ZM5A 4IRUB 3SNHA 4EFLA 2DR3A 4Q1AA 4LV8B 5FUYA 2Q0HA 1NTGA 4OK3A 4A8JB 4EPXA 1LUZA 4HAVA 3AV0B 4F92B 3K9HA 3A8KE 1QHHB 3RC8A 2QP4A 2EU8A 4DR1L 3HYRA 3OFNA 2ANBA 4LJ8A 3TBKA 1Z63A 2OFXA 2FN4A 1LS6A 4G7OC 2G83A 2OUKA 2C35B 4JI7Q 4A3IH 4V0ME 1YIJA 1IN4A 1IY1A 2AMCB 4A3BH 1YZUA 4WZAE 3I62A 4X6AH 1R5OA 1NMGA 3PV0A 1RZ3A 1MJEA 1QHYA 2ZRAA 2GK6A 2PZFA 2Y8EA 3EIQA 1K6MA 2A78A 3U7HB 3A6PC 3CPEA 1Z7TA 1EX7A 1NN1A 3EA5A 1JBKA 4GNXB 2CK3A 4TYYA 4PO9A 2V6IA 3HOZH 3UKDA 1WP9A 4HLDA 5FL7A 1N2CE 1KRSA 2XZLA 2BV3A 1CR1A 1OYWA 5FJ8G 2AX4A 2BBSA 2W83A 3J80c 4LBYA 1WBBA 1YITA 2XZOA 3GO5A 4A3MH 1QVGA 2ZYWX 4O2DA 3BJUA 1JB1A 3K0EA 4BLQA 5K8UA 4L5QA 3A8TA 4WBSA 3OW2A 4OQXA 4UP7A 2BEJA 3J80i 1F5NA 2YYZA 3LX5A 3I4NG 2RB4A 4C3ZA 3HP1A 3AVPA 2VQFL 2CW0C 3GCGA 1VQ5A 1HJPA 1WCMG 2ID0A 1PUJA 1VIAA 2IYRA 3MCAA 4JJKA 2BJVA 3BFVA 4RVCA 1GUTA 3QXCA 1BYIA 2N3SA 1GHJA 3PGZA 1IXRC 3NEJA 2CQOA 1NKTA 3DL0A 3KKQA 3BU2A 5FOSA 1DO0A 1A0IA 1XTRA 3FKIG 1VQGA 1N33Q 3SYKA 4EJSC 3VR1A 3DKVA 2O0KA 3TSZA 4M4SA 3QBVA 4HI0E 3REFA 3D8BA 2BHRA 3MGCA 3BG3A 4HAWA 2J87A 3F2BA 3GTKH 5AJWA 5FTLA 4C2MH 1S72A 3UK6A 4QHTA 1Q3TA 3RVBA 1E79A 3CNOA 2FZ4A 4EQ6B 4O0AA 1SULA 1E1TA 2ERYA 3GJ7A 2HYDA 1FL0A 4HAXA 5IK2A 5FBVB 3K70C 3GMTA 4Y0VA 3PF4A 4JI0L 4LF4L 1QVCA 1IXZA 1ODFA 2GESA 2ZSDA 3VNUA 4LFCL 1L1OB 2GF9A 3FFBA 5FOTA 3G48A 2ATVA 3KDSE 3VQTA 2UUAL 5AK0A 4JVNA 4C3IH 721PA 2ORWA 1RJ9A 2C9CA 1UJ2A 2FMXA 4AYTA 3NVAA 4DJTA 3IIKA 1GD7A 1RIPA 4AG6A 4BPBA 1N6RA 1WA5A 4JT2A 4A15A 3GLHE 4DDUA 2D0OA 2WMNB 4UJ5A 4OO1H 3ADBA 1E1RA 1QVRA 2DUDA 2VS1A 5GJBA 3LWNA 3E70C 4DR2L 1EUJA 2DFKB 3QPWA 4B3SL 4JK1C 5DIFA 4A0GA 3FWYA 3VR6A 1S2MA 3GQBA 1XMJA 3FFAA 5IDVA 3U2QA 2NVQH 1U5KA 2ALYB 2G1JA 4DV7L 2UUBL 3CX8A 3CBQA 2UUAQ 3HOVH 4Q7JB 2ZI4A 1HE8B 1J90A 4EUNA 1GM5A 1P75A 4DV1Q 2JK8A 4DR4Q 1ZM2A 4V0LA 4KN7C 3CCLA 2IY5B 3T1OA 4FMCB 4HUQA 1XXHA 3MUFA 4Q02A 3G4SA 1KHTA 3CRKC 1KHIA 2V9PA 1PJRA 5EE0A 3SJAA 3WYAA 5C46F 3I5XA 4B74A 3OEEA 4UP9A 3FP9A 5IP7G 3CH4B 2JLSA 3T1QA 1TEVA 4IVRA 3OZXA 4A6XA 2OG2A 2QRZA 2VTKA 3K70B 1N0UA 4MRPA 4BGDA 1TF5A 5J5CA 3EAQA 4A0HA 2DNEA 3QENA 4HB3A 3U4QB 3GEIA 1HV8A 2NN6H 4L15A 4G5OA 3WNDA 1FJGL 4K46A 4BECA 3UATA 2QENA 1QG4A 3UG7A 3OAAD 2I4IA 4G5SA 2Q21A 3DZ8A 4HLUA 2GJ8A 3LH5A 1I6VC 1KJZA 4DV2Q 1XD8A 2WIAA 4RD2A 4LW1A 4EKDA 5L8VA 1N5JA 4J15A 3MWLA 4TL9A 2UKDA 2JLUA 4ABYA 1BKDR 1K0RA 1IN6A 1W36C 2HXSA 1D8TA 1QHNA 1IQPA 1S1CA 3RABA 1CIPA 4JS0A 3GLGB 4OQLA 1IXRA 1SE8A 1NMXA 1OFHA 1T4GA 2TMKA 3TAUA 1N5KA 4D4LA 5FOUA 2D3WA 2EW1A 4BEJA 3AGQA 5HY6A 3SR0A 4EJSA 4GKKL 3KTAB 1YHNA 2GZHA 3CWZA 3U7EB 1N36L 4JI4Q 3REGA 2REXB 2J0VA 1N5LA 3FVQA 4V0MA 5FTNA 2ZTEA 4B73A 1KDTA 2XB4A 2UXDQ 3EZ6A 4RMFA 1YR9A 1SFOH 4DLRA 1OYYA 2QSYA 4CEHA 2ZJOA 2QMHA 5IYCG 3CF2A 3C7KA 1GAJA 1E7ZA 3CNNA 1NSTA 3IBYA 3B1ZA 3K9GA 5M3FG 1H9JA 3R8CA 4RZUA 1U8YA 5G3YA 1I3QH 4QGHA 3PUYA 4DUYL 3PITA 4TT3A 3TSOA 4X65Q 4Z1MA 5HE9A 4B75A 2RHQB 4BBRH 2GN5A 5F2EA 4G7ZC 2CCGA 3AKDA 4QBFA 5FTKA 3P20A 3EN2A 4QJ4A 5A0FA 4A1FA 1TMKA 4K8OA 1OFIA 4IDPA 4GKKQ 1ZCAA 2XTNA 2FDCA 4L8GA 3RN2A 2RGXA 4B3CA 4HSEA 1XNJA 3H3VH 1NNEA 4KI0A 4Y0AA 1BVSA 1DBSA 3K0FB 2VZAA 1S9DA 4G5QA 2V7QD 1Z0FA 1JQJC 2CBZA 4B34A 5A35A 3KF6A 1C7YA 2A5GA 4IPHA 3OHMA 1Z6AA 2NIPA 3T1TA 1OV4A 1R2QA 3CPWA 2AKYA 1TXYA 2PNRC 4LHYA 4Z51A 3A8IE 4CEJA 1EWQA 1VQIA 1P2SA 5EXPA 2V55B 3U9SA 5KDLA 2RCNA 2PQAB 2I3BA 2YZ2A 1J8YF 1OH7A 1JR6A 4KBFA 5IYDH 3A37A 2V8OA 3BE4A 3M9BA 3Q72A 4O2RA 4OHWA 4W5WA 2WKQA 5IF9A 2FE4A 2WKPA 1W48A 1IW7C 1G64A 4Q1DA 1GJXA 4DR7L 4RFSB 1UBFA 2E1RA 4Z8YA 1PLLA 2J7KA 1W47A 4Q4LA 1X3SA 2P5SA 2DGYA 2C03A 4PTLA 4LC1A 3A58B 1X3EA 4DLYA 4JI2L 1Q0UA 1T5EA 3KDFB 3X1DA 3RS3A 1D7QA 1KD1C 4DVGA 4P71A 1U94A 1PYBA 1ZD9A 2KHIA 4QOSA 4LPKA 3EQLC 1ZC4A 5CK5A 1VHLA 3AGPA 1SHZA 5GVRA 3NENA 2A30A 2B92A 2IEYA 4PANA 5JZVA 4JI1L 4A92A 1XRJA 4NP6A 5G3ZA 1DG1G 2XNDA 4PO1A 2EIFA 4DWJA 2A5DA 3GLHA 4B76A 2QTVB 1V8QA 1JJGA 4BY1H 1II0A 2IUTA 2ZE8A 4QBHA 4QQBX 2CE7A 3L0IB 4DK6C 1DAIA 4DR7Q 3RSLA 1SKYE 2R6DA 2N49A 2JA7H 1Z0JA 2Q3FA 2WSMA 1OF1A 3ZIAA 4YHHL 2KJQA 1YHQA 4LJYA 3NWJA 2ZRKA 1KGDA 1HNZL 3KFXA 3PJRA 3DXJC 1S8FA 4WAUA 1G20E 3P4XA 4NCJA 4E09A 1E9EA 1N6HA 3W6PA 3U3RA 1E2QA 3MLEA 1COWD 1NG1A 4MDFA 4JIMA 1SR3A 1NN5A 3SEAA 3UE1A 4FMCF 4L8JA 5IWAQ 4M53A 2E76C 3H0GG 3BAFA 4GLXA 3KX2A 4L5TA 1H9MA 2OAP1 4JI1Q 3WMFA 2Q9CA 4B3RQ 1OXTA 2F9LA 3AF1A 1I2DA 3EG5A 4KO8A 3LGJA 4U00A 5J4HA 2QI9C 4RKEA 3HOYG 4PZ6A 3L2PA 2PZGA 1BYUA 1CR0A 3NC0C 2OXCA 5J3BA 5EP4A 3AVOA 2WJGA 1NBMD 4TSFA 2GNOA 3CRMA 2UVQA 2UU9Q 1YZGA 4G0NA 1Z0DA 1KK3A 4PG3A 4MNOA 1PUIA 1CTQA 2C98A 2WAQE 1Q7YC 2FPKA 3DDCA 3CUEF 4Y7NH 4ESHA 2O8DA 2DFNA 2QPOA 2QU8A 2JA5H 1PZNA 1G6PA 1EK0A 1KZGB 2JASA 4GNKA 4YMSA 3WYGA 3ZVNA 5IP9G 1U2RA 1YU9A 2WOOA 3AQ4A 3M0EA 4TZ0A 4US2R 1SLJA 1VQPA 5JJLA 4HIOA 2F43A 1F6BA 5GJCA 3UE0A 1NIPA 2RHDA 3ZZUA 3SGIA 1US8B 2VLIA 2LKDA 5SZIA 1A6XA 1U8ZA 1M34E 1MKHA 1NJFA 1FQJA 2VA8A 1FUUA 4LBVA 4X64L 3ZQJA 2ASEA 2LWIA 3LWUA 5HZKA 1G291 5BN3A 1P9RA 2QROA 4A36A 1BBUA 3S24A 3D31A 3HR7A 4DB4A 3I72A 1S3SA 4AKGA 1OTCA 2AFIE 1KDPA 3BZCA 2FEMA 3GFTA 4FMBB 5E7JA 1N6LA 4ZCLA 4B33A 5K8IA 4PPQA 1IN8A 2IS6A 1EQRA 3LNNA 4BLSA 4A4IA 3AM1A 2O8FB 4DDWA 2B29A 1A5TA 2JA1A 2OCEA 3UDXA 2V4ZA 3SN6A 1JB7A 2VH5R 2HCBA 1S40A 4YWLA 1XJVA 1Q1BA 2F4VL 1T5LA 2BKEA 3PVSA 4QJFA 5G40A 2ZE5A 1FP6A 4CRWB 2VO1A 3C5CA 3DKPA 3GLIB 3CCRA 4II7A 3B2EA 1GDDA 3DOFA 5DO9A 1WBDA 3STBC 2JDID 1JEDA 2K7VA 2GZAA 1PHJA 1VQCA 4B3ML 1KK1A 2JLRA 2QG6A 4I1VA 4C7OA 4FIDA 1W2HA 1OXSC 1F2UA 2C9OA 2OV2A 4HB0A 3VFDA 2ONKA 2JJ2A 5IRCD 2YNMA 3QKSB 1DELA 1VIYA 3T06B 3DOEA 4D25A 2BMFA 3VDYA 3GTGH 1E4YA 1XFAA 2ZI9A 5FFMA 1NY4A 1U0HC 1GVNB 1QVAA 2V1XA 2ZIAA 3SZRA 3M6AA 1NY6A 2CLDX 5DE3A 5F9FA 1T91A 1XP8A 2XTIA 1D5CA 1IBRA 2ODEA 3FHCB 4Q4AB 5BYKA 2J7PA 1Z2AA 5ELNA 3MSXA 5FOXA 1DOAA 1I4TD 4RD6A 1GUSA 4GBMA 3C8UA 3S15H 1WRBA 3AVVA 4P73A 1XTQA 5J40A 4A3CG 3FYHA 4C30A 3H3VI 1GRQA 1KOFA 1E2LA 2R7ZG 3TVDA 1EFUA 4E07A 3CRW1 3FHOA 4B3MQ 4RZ2A 3FPPA 2I5MX 1EFHA 4O0MA 4PHGA 4V0OA 4PC1A 1EIFA 4L5RC 1E99A 3FKSD 4FCVA 1R0XA 1FNMA 5CM9C 3U44B 4KKSA 2VYFA 1PLJA 3S1QH 1Q57A 5FOVA 4MRNA 2ZRDA 2L5TA 2VL6A 2VUMH 2GBLC 4B71A 4DT1A 4XVUA 2GRJA 1XD2A 4R4OA 2ZRFA 2ZVQX 2C2HA 1N34L 3R9WA 4JI8L 1CXZA 1KY2A 5BXQC 2A19A 2FGKA 2IYQA 2ZS7A 3AF3A 3O8RA 1G8GA 1PH4A 4DNIA 1GP2A 2BKUA 4FXPA 4QNMA 1HR0W 3JVVA 1JR3D 1P60A 3H15A 1Z0AA 2QORA 3PENA 4KJZA 4QGFA 4C0KA 2A1AA 1N6PA 4M1KA 1HA3A 1KO8A 1U9IC 3TEHB 1WOCA 4A3JH 1I94Q 4JI6L 3TQYA 3B9PA 3FGNA 5DI3A 4ZKEA 4AYWA 2ASBA 1KI2A 3BB4A 1Z0IA 4PPNA 1CFMA 3CRRA 3CMAA 2F3RA 1II8B 4OJKA 1Q22A 2YC2C 2QN6A 1MRNA 3FMPB 4KV9A 1P5ZB 3MJRA 1ETUA 4M1MA 1G1MA 1LNZA 3F3YA 1OXXK 4DLSA 4TZ6A 1N34Q 5EAYA 1FP7A 4CT4B 4RZXA 1EWIA 1SMXA 4LF5Q 2BJWA 1KY3A 3KKNA 4Q7MB 4ARZA 3AQQA 3GP8A 3G6EA 3L0SA 4QHSA 3PEYA 2W6JD 5CJPA 3KQNA 2Q3MA 2R6CA 2JLVA 2BWJA 4TLCA 3GTLH 1XNQL 2EFHB 3EASA 1G8PA 4Q48A 2OT3B 4NE2A 2VSXA 1SHKA 1H9RA 4K0KQ 4RSGA 4GOXA 3AYHB 2WAYA 1NVVR 1AK2A 2RMKA 1Z9FA 2KCMA 3C16C 1XMSA 3ONWA 5GAHC 1T8TA 3G0HA 4ON9A 1AGPA 4PQYA 2HJGA 1G4UR 3PR1A 4RY2A 4DR5L 1F2TA 3CX7A 3T12A 2IX0A 5LMNW 1CR2A 1XJCA 1HR0L 4IFBA 3CX6A 4XWAA 1VQ9A 5C4JH 4GOPB 1GG2A 4AC9A 2K14A 3GDEA 4IPDA 2A5FA 1ZM4A 2QL6A 4RD3A 4D4KA 2O8EA 3A7AB 4EQ5A 3MFYA 3CD6A 3T61A 2Q2HA 1JMCA 5JHHB 4Y52H 2OE2A 4BFVA 1E9CA 1KI1A 1G3UA 1Y8OB 4JL6A 3RRMA 1HZAA 3B1XA 2VHQA 2IHFA 2CNWA 4CF7A 3MXNB 3A4NA 4M1SA 4C0HA 1NLFA 2ORVA 4YY3Q 2E5LL 1HYQA 4N1AA 3I7FA 3I56A 2UXBL 2YJTD 5LDDC 2W58A 3ULPA 1FOEB 3SE0A 4BLTA 5JFGA 1QG2A 4OWXB 4NXML 2HIVA 4IXNA 2EFGA 1UEBA 1RRPA 1VYTA 5JEEA 1YZ6A 4LFBQ 4G01B 5DN6D 4D26A 2OLKA 1RIFA 1GUOA 2HDNB 4RD1A 3SHWA 2O8BB 4TLDA 3ZJYC 1YJWA 2YWEA 2ZRPA 4BLRA 2JLZA 4I7ZC 4PSAA 4F93B 1MO6A 2I5HA 2JEAI 1GKYA 4JLDA 4HUTA 1Y1WH 2CVHA 4R7ZA 4OXPA 1OKKD 2UZIR 4DKXA 4NPHA 1GOTA 2GBLA 4A4DA 1UE6A 4FI3C 2HHHQ 4UXHA 2GETA 5E7IA 4DK1A 4BWYA 1J6QA 4MTNA 1HNXL 5J4KA 3KJPA 2QT0A 5LMNL 2YINC 2IYLD 4IDHA 4M1YA 5KYKA 2E5LQ 2R9VA 4TMXA 1NSFA 1V43A 4NCNA 4X8HA 4QGUA 3IEVA 1HTPA 2WPDD 1NL3A 1Q90A 4JLJA 3KQHA 1FTNA 1W49A 2GEDA 4JMPA 3FOZA 4JYAL 1H9SB 1ZM9A 4YCUA 2ZI5A 3CPFA 1MIUA 1K8AC 4LJAA 3R7WA 2R44A 2REOA 1U9IA 2OTLA 3F8TA 1SGWA 2B8GA 4DCSA 2IYWA 1AS3A 4E5UA 2QBYB 2WWHA 4GDFA 2VPPA 3I8XA 4Q4HA 3F0TA 4NYJR 1RC8A 2ZYVX 4IOJA 4DSUA 4AYXA 1ZW6A 4A3IG 4UY8C 4A3BG 2AK3A 4QXAA 4TMTA 4B6EA 2JJ8A 2DWPA 2UXCL 5C18A 1E1QA 2LSSA 4DV4L 1X55A 1XMQL 2J0QA 1EESA 4PC3A 1G5RA 2PT7A 3CZQA 1W2BA 1HNXQ 4Q66C 3I61A 4HB2A 4QRHA 3U3JA 3W6NA 4ZPXA 3AVTA 1I50H 1XTJA 1SVLA 3EWAA 4OKSA 2R2AA 5JJKA 4P33A 4IQZA 4DR6L 1IOZA 1YR7A 3Q7QA 3HOZG 3WMEA 4DLWA 1UKZA 1KI6A 2BM0A 4MH0R 5FUXA 1RPZA 1C9OA 1TUEA 4IFDH 5M3MH 4OWTB 1UBCA 3QUSA 1EYGA 4NZYA 3NG1A 5FPHA 3TZUA 2PLRA 1NMFA 2R62A 1NG9A 2FFQA 4AH6A 1VTKA 4A3MG 2H1LA 2YC4C 4MA4A 1Z83A 2HJVA 1HUQA 3KB1A 4KLKA 4QJ3A 4NTZA 1GO3E 1IBLQ 2ZTCA 2Z4RA 3MEFA 1JJ7A 2ZTSA 5C2JB 3U58A 1SXJD 5H1SE 2Q9AA 1BS1A 1CJUC 5C3EH 4BXXG 2WTUA 1XEXA 2JLXA 3S16H 2XOKA 4I81A 3IQWA 4FD2A 2CJWA 1YKSA 4WJ4A 1M74A 3X1YA 1OFUX 2IHBA 1AKYA 1R0WA 3LBNA 4QFMA 2KI5A 5EZ5A 4KHZA 4FW9A 4ZKDA 3THXB 2VHUA 3ZYCA 2ZS9A 4IEIA 2BDOA 1B23P 5EE5B 4DKAC 3CC4A 4A3EH 1M7GA 2CCZA 2JE6I 2RGBA 2ZEJA 3QF4A 2BE5C 3UIEA 4JKYA 4Q18A 5IYBH 5AJVB 1J5EL 1EOVA 2JJQA 2PJZA 3M1IA 3A7LA 3ZGXA 2GJAA 2I5LX 4H1VA 3F2DA 1QZGA 2ZRCA 4IFEA 3BWDD 3AF2A 4NYMR 4UQOA 1CSQA 3HPQA 2JA8H 2NG1A 3EW9A 3R9IA 4D80A 5JS7A 2JQOA 5IT5A 4M1WA 4C4PA 2ZM6L 3ERSX 4AIMA 1NBWA 5JHGB 3U50C 1ASYA 3T35A 2FOLA 2DCUA 1B7YB 3GFPA 3GLFB 4WZBE 2D62A 4R4QA 1AZTA 3IO3A 2NOAA 5JRJA 2KBEA 3PIRA 2QGQA 2XITA 3ASZA 3QXJA 2WMOB 4NYIR 1VECA 4D0LB 1WYDA 1Q1EA 4OO1G 4C0BA 1RRGA 4CT5A 3CQZH 1J5EQ 2GXQA 3M3YH 2ZJAA 1MRSA 3IGFA 3QEOA 3VTKA 3QVVA 4DUZL 2BCGY 3LX8A 4KBGA 5DYIA 4DCVA 4V02A 4DLZA 4RCNA 4BFXA 2OAQ1 1W7AA 4M1OA 1PH7A 2F1IA 2EWWA 4OQFA 4LWCA 1N0VC 4G1UC 5JWHA 2JJ1A 4QM7A 1OPXA 1PLKA 1KSFX 3U61B 1T0HB 1P72A 3HOVG 1XXHE 2J46A 2ZS8A 2OM2A 3ADKA 1S9HA 3BORA 1C0AA 3SJCA 3QXHA 2VRWA 5HKKD 2FSIA 2RHSB 1NP6A 2ZR7A 1E2EA 4UJ3A 1XCMA 4DPGA 1ZUHA 3B1WA 1P16A 1P8LA 4XD7A 1G7TA 4KYIB 3PG5A 3U3MA 1XZQA 5EE3A 3VR2A 5GJVC 4JI7L 1F3OA 1JXMA 2WKRA 3HWSA 3QQ5A 3AVQA 3CO5A 4IPCA 1PH9A 2GZDA 3K0AA 4I1SA 1XTSA 3A1VA 2EFEB 1X6VA 2GKSA 2NN6G 3ECCA 4GN3B 1WJJA 1X9NA 2B6HA 3T5GA 5JECA 4HIDA 3O8CA 2HLDD 1D8LA 3WP0A 2GCOA 4XH9B 3O8DA 3EC1A 1E0JA 1EXMA 4Q03A 1VQJA 4DCUA 2JCSA 3BIFA 2OTJA 3ZQ6A 2BDTA 3W1BA 2ZJ8A 1RW4A 5EXXA 3S1RH 3CP0A 4ASUD 2IYSA 2L0XA 4O2LA 4BZXA 4R2IA 2V7QA 4OQMA 5LPNA 2QEXA 4L5BA 3CRVA 4LUZA 4URUR 3C14C 1PH3A 1IL2A 3E2IA 3L82B 1WXQA 3LLUA 4BRUA 1E2WA 1EFRA 4DRZA 4JBYA 1NI3A 2A6HC 4FMDB 1OH5A 3A1TA 3R8FA 2OBNA 5HTKA 4CZ2A 1UM8A 4DIDA 3A74A 5C4XH 1N33L 1KI3A 3PCOB 3SYNA 1R10A 2WFWA 2JA6H 2K50A 4AI6A 2IEZA 3GTPH 4LYHA 1WB9A 1Q12A 1KSHA 4BBRG 1XTKA 2O5JC 1KJYA 4W5HA 4YMWA 2EQSA 4LUVA 1KAOA 2N8NA 1P9WA 2Y0SE 2A6ED 2OCYC 4UKDA 4JLNA 3LDAA 1RJ9B 1TF2A 4IJHA 5TARA 4BA2I 3DHWC 4HLUC 2J0UA 2VEDA 4TN1A 4QL3A 1XPOA 1GILA 3HJNA 1VCMA 2QAGC 3ULJA 1AIPA 1A2BA 1UKVY 3C15C 4BFWA 2H5XA 4BXXH 2REBA 1YZQA 2ZRMA 4LBZA 2ECKA 2ODWA 3ZH9B 3RLFA 4AKEA 3VNVA 3T1HL 2XNSA 2DN8A 5CB8A 3NIBA 4HEJA 4IFDI 4QG7A 5FR1A 5CIWA 1J8MF 3CCJA 3H86A 4PC7A 1P2TA 4KU4A 4XIGS 4PPFA 3TW8B 2XGTA 5ELOA 4QGAA 3KYHC 4P74A 4D6PA 3Q5EA 4G3XA 2IF0A 4ZCIA 1L4YA 4KLZA 4GPTA 1P61B 4LJ9A 3THOA 4AKIA 4DAYB 2DFTA 5IYDG 4XSGA 4AG5A 3SDZA 1NN0A 1YE8A 2YTVA 3CIOA 3H4MA 4N0DA 4MUBA 4UXIA 4HUQB 1XXHB 4DC9A 3KJGA 1E0KA 4QHYA 5DSZA 3S1AA 2KWIA 4JYBA 2E8GA 1W0JD 5DI9A 3A36A 1CKOA 2V6JA 4M22A 4OBEA 4CW7A 2W6IA 4LF7Q 3T1HQ 2G77B 2RGNC 4TLAA 3VR4A 4LK2A 1FX0A 2ERXA 5BR8Q 4NCIA 2R65A 5GADC 4JSTA 3IKJA 2N1BA 4OX9Q 4TWZA 4DV1L 4DR4L 4M8NE 1GHKA 1TWAH 2R7DA 1TU3A 5KDOA 3EBEA 2NQ2C 3LY5A 4LC0A 3KLRA 1DAMA 5EE9A 2QMOA 1E96A 3OIVA 2PT5A 1DADA 1HZBA 2F6RA 5FBLB 2YKGA 3OF5A 2AFHE 2AKAB 3NBXX 4DBLC 3QVUA 4BY1G 3OE7D 4Q1CA 4I99A 1VS0A 1QBKC 1KDOA 3CH5A 1HNWL 1E3PA 1MJCA 1VQKA 3EX7C 2JA7G 3CCMA 3NE5B 3RR5A 2QUZA 4URYR 4DCNA 4TL6A 4EJSB 2IYYA 1VKJA 2OQKA 2IYZA 3LNCA 4JBXA 4DV2L 1TQ4A 3CCQA 4DXAA 1PH8A 4LV5B 1E2NA 4P72A 2XJ9A 4TYWA 5L3QA 4RD4A 3ND9A 3I32A 1B9MA 4P31A 3MAAC 3CRQA 3ZVRA 1E2ZA 2F3TA 4A3KH 4B3BA 5A5GA 2D2FA 2IX3A 4CEHB 2D7DA 1E6CA 3UMRA 3WBJA 1C9KA 3RS0A 2B63H 1TQ6A 4J0QA 2EJFC 2V54A 5J4YA 2YTYA 1GIAA 2IHYA 2IWRA 3BXZA 2VY3A 4JI4L 1DAHA 1WCV1 4V0NA 5L3VA 1HNWQ 1E2GA 3I4MH 1R8QA 5J4VA 4LJ5A 1ZM3A 3S17H 2D2CC 2UXDL 3CCEA 2FEOA 1KIMA 3G5UA 1M7BA 1NVVQ 4FWIB 5M5XH 4LCBA 5AUNB 4DV5Q 4U7DA 3ADCA 1XD9A 1XMVA 4KSCA 3V00A 1KO4A 1MOZA 5DHFA 3N2EA 4BFUA 1OB2A 2Q2TA 1WDTA 4GP6A 1S4QA 1FL9A 2QAGA 2IS2A 5BQ5A 4P75A 3A8JE 2JA5G 2CFMA 2VSFA 2QZ4A 5AJ3L 1SZPA 4LHVA 4DNRB 5CLLA 2JDIA 2C78A 3P1JA 4X65L 5BN4A 1PH2A 3KXIA 4C0LA 3KF6B 3E5HA 3L0PA 1KO7A 4B35A 5FL3A 2ZRGA 3CR8A 2BEKA 3BGWA 2AKWB 4JLKA 1TQDA 5FUWA 1E9BA 4F4JA 4CEJB 3W1GA 1S0UA 3IEUA 2XGJA 4EX5A 2G1KA 1DAFA 3VR5A 1LVGA 3KXKA 4MRSA 1ZIPA 3KJHA 2D0PA 1M8PA 4MKHA 1TQ2A 1OIWA 3TR0A 4B44A 4ZDIA 1H65A 1AZSC 4FWTA 5DNYB 2FH5B 4M9XA 2F1RA 1WFQA 3CKLA 1W0KD 5KUTA 3OW7A 1YVCA 4AWXA 1YEZA 3F1ZA 2IA5A 5AJ3Q 2H17A 4P32A 4M21A 5EUMA 3CCUA 4LK1C 1PA6A 3RWMB 4D2IA 2RGNA 1SVOA 4V03A 4UPAA 1DEKA 3GJ6A 5TV2A 4XOIA 1GFIA 5KTYA 1PFSA 2JEBI 3RLOA 1UDWA 4KODA 3EZ7A 3AVUA 3RRNA 3RLNA 3PEVA 5CK4A 4DK0A 4H9GA 2ORIA 4PC6A 5DGXA 1A7JA 4OWWB 2GXSA 1AJEA 1W4BA 5TMPA 5C0XI 1X8KA 1ZKOA 4C9BA 1DS6A 2N42A 3GLHB 1CLUA 3PUVA 4JLPA 1W36B 1P6XA 1HCZA 2WZQA 4IJLA 1DCZA 2DHRA 4X8LA 3RNLA 3DM9B 1AGRA 4IVQA 2H5EA 2I1VB 4Q1EA 3M85A 2K5UA 4WVFA 4R1JA 4Z54A 3F2CA 3H1TA 2K33A 3PXGA 3SJBA 4NYJQ 4YLGA 3I8SA 3B9QA 1TUIA 5CDFE 1FZQA 4XJXA 3I55A 4F38A 2WJYA 5KDDA 1XTIA 3WY9A 4KMUC 4DK3C 1ZNYA 4B3FX 5JRZA 5JEDA 2EVBA 3P4YA 2BMJA 4WW0A 3KKPA 3LQRA 2A68D 4PV1C 4ZIRA 2GDJA 4LYJA 2ZSFA 3S2DH 3VU9A 4FINA 3PIOA 1AE2A 1DXMA 1W4RA 3IHLA 3LFUA 2VUMG 3WRXC 2QA4A 1FR3A 4JOIA 1CU1A 1X3FA 1VQBA 3LXRA 4MGKR 4E03A 4LYAA 1HT2E 1IBMQ 3IIJA 3HPRA 1I4DD 1OIVA 3WHKA 3EWSA 3NHBA 4MUAA 2GK7A 5IWAL 2CK3D 2IL1A 1XCPA 1UPTA 3NDPA 1LW7A 4HZUA 2O8DB 5FL7D 3A4MA 1RRCA 4B3RL 3AUYA 4PX9A 5JS8A 5K36H 2BH2A 4JLOA 1TAGA 4A3JG 1T9HA 4GZMA 1SXJC 1H8HD 1II9A 3PF5A 1G51A 4H02A 3IPXA 2WSSD 2F43B 1JAIA 2UU9L 3PO3H 2PEZA 5FPTA 3K1JA 3DVLA 2YHSA 3FE2A 1VG9B 3B1YA 4LF8L 1EGAA 3MWKA 1M6NA 1E9DA 1ZYUA 3NBZC 1CEEA 3KKMA 4C0SA 5BW8A 1Q81C 1TNDA 2XX3A 3CPHA 4ILEA 1HPCA 3TW4A 3VKGA 4DV6L 2GWHA 4DIEA 3DMNA 2W00A 1A63A 1RVDA 1C1YA 5M5YH 1CJMA 2ZPTX 3BZKA 1UKEA 4BZPA 4GN5A 1K8OA 2A9KA 3B5JA 4CDGA 2OFOA 4IKEA 4MYHA 1L2FA 4TQ9A 2XJ4A 1P73A 2MO0A 1E2MA 1WF3A 4NYMQ 2HT1A 1RL2A 1YVDA 2BC9A 1IN7A 1E79D 4TKOB 2C99A 1SN8A 2CL0X 2WAXA 2JA9A 1FPMA 1H8ED 1LTQA 2SHKA 2C9YA 3AH8A 1PH5A 1YRAA 5FBRB 1OKKA 4XTRA 4YMUA 3SQWA 1JQLB 2QGNA 4LF8Q 2VP9A 5JI2E 4C7OB 1Z07A 1K73C 1F2UB 2JEOA 4DV0L 2PZEA 3BJIC 1Y1VH 3D7MA 3IRBA 1QF9A 3IILA 3RWOA 2ZUDA 4NYIQ 3TREA 4DV6Q 1BMFA 4GSYA 2A69C 4EAQA 2CLCX 2JATA 4NB3A 2P3SA 2OLJA 4YWMA 1J7KA 4HLCA 4IXMA 3OTOQ 1JNYA 2AN9A 5C4GB 3TRFA 4MZ9A 3NH6A 3U5ZB 1OXUA 2MNAA 2F1HA 4WXRA 1KMQA 4GL2A 3UDFA 4X66Q 3LBIA 3FDIA 2PCJA 1E1RD 2EQBA 1S1MA 4US1R 3KUCA 4DUGA 1JJCB 4LI0A 4B43A 1OXVA 1VHTA 4GKJL 3VMFA 1TEXA 3IBGA 1YRBA 3LBHA 3VHLB 2NO9A 4GLAC 3T1YQ 1KI8A 1Q44A 1ZUNB 3NHAA 4KLNA 2IXFA 1DGSA 4DV0Q 2LKCA 3EC2A 4PHTA 5JSZA 1I2MA 3ASYA 3CAMA 1PVOA 2EFDB 4LGMA 3PUXA 4UXJA 1Y1WG 3V9PA 2R6GA 4BEBA 1ZC3A 3HOWH 2GILA 1H95A 2ATXA 3AP1A 3BK7A 4JLBA 4DT1B 3W3AA 2P2LA 3QBTA 4GOKA 1P3JA 2V4DA 2HF9A 1G7SA 3I3SR 4X8MA 1AN0A 2BBWA 3JZAA 2HYIC 3KKOA 4DAMA 1K5GA 1V9PA 1YI2A 1NY5A 5FOWA 1Q20A 4H44C 4IDQA 4A3LH 4EPRA 3GTJH 1LM0A 2JIZD 4JBKA 2FF7A 2P67A 4JL8A 4B2IA 4DZZA 3EZ9A 4B48A 3ZD6A 4Q5IA 2B3GA 1QRAA 4GMDA 4GKJQ 2ONJA 5CITA 1GRNA 4A3DH 4ERNA 5DISB 2OCBA 1NLZA 4Q00A 1SXJA 1A62A 5DI3B 5TVKA 4EIWA 1MO5A 2OQ0A 1GNPA 1QJOA 2V1CC 5BYJA 4LYFA 3A1UA 1YNXA 1VQFA 4MGYR 1SKYB 3EZ2A 3CMEA 2A5YB 2WB1E 1UDXA 4URXR 4PFSA 4C2TA 3QKUA 2IS1A 1KI4A 2RF4A 2W2VA 4ARZB 1I94L 1TWHH 1BIFA 4BFYA 1SRUA 5CDFA 4D0GA 1OH6A 1TTTA 3RNUA 5B64A 2VP2A 4ESVA 3CLVA 3TJZA 5LD2C 3K8AA 3W5OA 5G41A 2JLYA 3RDPA 1Q46A 3IIMA 4MKIA 4IFDG 5M3MG 2R92H 4IPGA 1LS1A 2C77A 2QE7A 4OI4A 3KXLA 3ZZ0A 3CC2A 3J7ZC 3RS2A 3M4QA 2IWHA 3TQFA 4TYNA 1KRTA 4NH0A 3CF0A 1FYCA 1R5NA 4LF5L 1F2TB 1VQNA 2WJJA 1MO3A 1B8AA 1D2NA 3EPLA 1JE5A 4IOCA 5B58C 1XNRQ 2CHQA 1X1SA 4ZDKA 2D7CA 3K70D 5C3EG 2RGCA 1JPJA 2VHCA 4TT3D 1E2HA 2DBYA 2ZU6A 2O8EB 4K0KL 3TUIC 2HXYA 4Z1MD 3RS4A 2HIXA 4GZYC 5KNDA 2MFIA 821PA 4POGA 4ACBA 2X2EA 3QY0A 4B3TQ 1FGUA 4LF6L 2O5IC 2R7FA 1MR3F 4LJ6A 2EXDA 2CVFA 3LQQA 1TL7C 4NL4H 5L3RA 4YWKA 1QUQA 2IBMA 1W5SA 2VIIA 4A3EG 3TNFA 1XEWX 2EWVA 1W4AA 4IFDJ 5IYBG 2PH1A 1CUKA 3B6YA 3DPUA 2QMUA 1ZVQA 2NVYH 3I5YA 1XU4A 4DEXA 5EQTA 3AF0A 4JC0A 1KJWA 1G21E 2ZR0A 4B2LA 1EX6A 3PFIA 4KFTA 2JA8G 2WJHA 4YY3L 5HKKA 5KPJA 3T5DA 2BMDA 5LB2A 5FPYA 4XTCS 2OCPA 3TS0A 1D9ZA 2VL7A 2X1VA 4P4SA 3WHLA 4PZ7A 4TMVA 4DHEA 2C96A 2ZANA 3U6KA 4I1OA 3UDIA 1N5IA 4LF6Q 1E2DA 4KFSA 4US0R 1TPZA 3KJIA 4DSOA 4IO9A 4LFBL 1SVKA 4S2EA 2WV9A 4B6FA 2BOVA 2NO1A 2NZJA 1AM4D 4LJ4A 3KFUA 4HLQB 4PZZA 4YCWA 3SQXA 4H1UA 2IYVA 4HJAA 2O52A 2CMKA 2HLDA 2VF8A 3R7WB 4CGZA 4A75A 4I1UA 3QSYA 3CONA 3ICQB 3GEHA 1XPUA 4HYYA 1Y69U 1KSJA 2H18A 1ZNZA 5FTJA 4Q4HB 2HHHL 4JV5Q 2RKOA 4PR0A 1E32A 4AQYL 2WBLC 4M0LA 1D2EA 2F7SA 4EPVA 3W9YA 4RJLA 1T3HA 1HEIA 2WAQG 1AS0A 2WJIA 5C44H 3LAWA 4HAUA 2JLQA 4P4UA 1V1QA 2P0EA 3CXCA 4D82A 2WWYA 5P21A 1W36D 5F9HA 3QJYA 4TYPA 2FA9A 4LOAA 1M1KC 2ZJZA 4OI2A 2G9NA 1OE0A 2CDNA 2Z0SA 3ZIAD 1FFHA 1C4OA 4LNQA 1O3YA 2NGRA 3X2SA 3VKHA 2QTFA 1GL7A 1R7RA 1NE3A 2I0QA 2ZR9A 4IEEA 4LX0A 2CHVA 3FHWA 1KI6B 2R93H 2A5JA 4Q7KA 3WDNA 4ME3A 2Q9BA 4DLXA 3EIHA 2NO6A 1IXSB 5HCIA 1N6NA 2Z6KA 4CEIA 1W3SA 2J59A 2MSDB 2O0HA 5EXSA 4AQYQ 1OB5A 1XBTA 4YDHB 3CNLA 4KCGA 4P3YA 1T3SA 4OL0A 1CKEA 2KCTA 3VAAA 3SJZA 1XEXB 3WYFA 1QVFA 2YV5A 1JPNA 4GMXA 1GWNA 1Z6TA 3P27A 1NKSA 3SHFA 4KFUA 2PMDA 3CW2C 1QHGA 1MV5A 1QHSA 3K0CA 3R9XA 4LHXA 1R5BA 2ZI6A 4A2QA 3TAHA 3K80C 1P9NA 1XEWY 2FWRA 1IBLL 2D74A 3NXSA 4LJZC 4PZYA 1JT8A 1AKEA 3NKVA 1XMIA 2R8RA 4PQFA 1ZRHA 5SZJA 4H0LC 3QF4B 1VQ8A 3KQUA 1FVIA 1VQ4A 3GJ8A 1FTSA 1YJ9A 3SS8A 5M5WH 1PV4A 1GITA 4KAXA 2IXGA 2FU5C 3P26A 5C4XG 1Y8NB 2EYUA 2QP9X 3LVRE 1N25A 3GJ4A 2JA6G 2IF2A 2O8CA 4BA1I 1G5TA 1VQ6A 2ATWA 3ER0A 2X8AA 1E98A 2E9SA 2WWIA 3S14H 1B70B 1T3LA 5FUVA 2QRNA 1MABA 2JGNA 1A82A 3MJHA 1UE7A 2PLFA 1A2KC 2VNUD 2ZJYA 2J41A 3Q7PA 3QIAA 2O5VA 5L3SA 1IW7D 1L7VC 3NTUA 1U90A 3Q3JB 1LF5A 2KHJA 1EQQA 2CL6X 3LXXA 4PAQA 1BDOA 2CL7X 3MMPA 5JWOA 4QM6A 4CIDA 4LFAQ 3CCSA 5GAEC 2MSCB 5JBQA 4IOLA 5KSYA 1OSNA 4PHHA 3U4ZA 5TB5A 2VP5A 3S2HH 1ZUIA 3CR7A 4Q4JA 4U02A 1VCIA 4TQUS 4JCVE 4AYBG 3CF5A 3IFTA 3VX4A 2AUKA 5IHPA 3M7NA 4OQNA 1G6OA 2IYUA 3OE7A 2E74C 3I2ZA 1E2JA 1Y63A 5EP2A 2IUSA 3BOSA 2LXKA 2KBNA 2C8VA 4Q9JA 4BFZA 3IPYA 4B3GA 1VPLA 1G41A 1HH4A 1Z6HA 4A76A 2GHIA 3QXXA 4JSYA 2NZOA 4OONA 1B9NA 4KKTA 1PH1A 1VCNA 1W4CA 3HR8A 2H8KA 2VSOA 2F55A 4XSHA 2CEAA 2J7PD 2QBYA 3FMOB 2AUJD 1GL9B 2GVZC 3ZS8A 4BFTA 3BB3A 2B7BA 4LWZA 2PI2E 2ZROA 2J3EA 3K0AB 2KA7A 3A1SA 3EPHA 3N6RA 5HGQA 1N6KA 2ZJ2A 4B32A 4AY2A 1UF9A 1J2JA 4URZR 4W9MC 1ZJ6A 3BH6A 4OHYA 1HQYE 3LO5A 4D4MA 3WMGA 3THYA 1ZYRC 3IUYA 2GCOB 3WRYC 5GAGC 1KO5A 3MWYW 2WWXA 4PSVA 4MDEA 1KMHA 1ZMXA 4ZI3A 2FXQA 4HZIA 3D6TB 2B7CA 3QEJA 1Z2CA 3OAAA 4DLVA 2RAPA 4URWR 5KSZA 3KUDA 2G88A 4UNRA 4G5RA 4GRAA 3CW2A 1G19A 1CRQA 2YOHA 3EXAA 2KB0A 4IVPA 5E95A 2ODNA 2WICA 2ZVPX 2NPIA 4C2UA 3KL4A 2F3IA 1TU4A 5C1BA 3PUWA 2VQSA 1FMJA 2HQLA 1W5TA 1Q3HA 2FFHA 3DM3A 5JJIA 1XF9A 1KQSA 121PA 3U7GA 2RGDA 4L9SA 2QY9A 4JT4A 4A8JC 2JXMB 5JEAH 1FNNA 3PEWA 4TTRA 5FLMH 3SOPA 1EIYB 3UMSA 4A3KG 2AHOA 2I1QA 3SYLA 4BRWA 1M7HA 2FSHA 2VQEQ 3H0KA 3L2OB 3THWA 2B63G 5LMUQ 3QNUA 3QXSA 4R98A 4TMZA 5E7MA 2ZAOA 3AKYA 3KZ1E 3RSOA 1Z47A 5IT9c 2UUCQ 3RAPR 3E1SA 3I4MG 1G6HA 5D3MA 1W0KA 2KCCA 2VP6A 3NELA 3M4YA 1G8YA 2IT1A 1OW3B 2EDGA 1XJ0A 2NO7A 3K9NA 3PUZA 1DVRA 3OIUA 4M9SA 3OIWA 5CM8B 3EARA 2ZXUA 4DEYA 1SKQA 2QA5A 1X3GA 4P0TA 2J0UB 5HZHA 3M4OH 3PEUA 4I4LA 1W1WA 2K5VA 4GNXC 4PPGA 2E2HH 3D0FA 2YWHA 3GJ5A 4M9ZA 1U0JA 2WIBA 3UWOA 8OHMA 3TE6A 1IYVA 3FHTA 2XZPA 4MGZR 2WM9B 1D6JA 3RYTC 4A2WA 3KOJA 2ZETA 2B21A 1ELOA 4C3HH 3STBD 4XWKA 2FV8A 3QPVA 4NCHA 3LRPA 3GLFA 1YR8A 2ZJRA 3ZZTA 2W0SA 4IDNA 3M4PA 2PMKA 3QF7A 1N32L 2AXPA 1Z29A 4ZDWA 2AK2A 5KO2A 4HDOB 4FCWA 3S1AB 2CNWD 1R4AA 3U3OA 4L4UA 2ZREA 1E3MA 2RHMA 3PO2H 5C0XH 1KIXA 1VQLA 1TWGH 1W44A 4GS3A 1HQCA 4JKIA 421PA 2W0MA 2FZLA 3ADDA 3BB1A 4PSKA 3H84A 1FX0B 3B60A 4IDOA 4C0QC 2XXAA 4ALPA 1AQUA 1UBEA 3RC3A 3J81c 3QOFA 2ZYTX 3G82C 4C3JH 1ONBA 1KDRA 1RRFA 1HURA 2IK8A 2PX0A 5J47A 1K5DA 3JC66 5AJYA 2RH5A 3J81i 2ZSBA 3AVYA 3SC3A 2RGAA 3I4OA 1N32Q 3BFKA 1JR3E 1CKNA 3UDGA 3BC1A 4LF7L 4HIKA 1LABA 1KAGA 2GJKA 5BR8L 4A3FH 2ZSAA 3QKRA 1L1OC 1QZHA 2C04A 3QKTA 3RZDH 4OX9L 1NMZA 2MSEB 2XSZD 4YQFA 4DR1Q 5AR1A 2GCNA 1R0YA 2ZRLA 2N78A 2D06A 2WWWA 1X65A 1G3IA 1AH9A 1TKWB 2X77A 1H8HA 4X8OA 1X8JA 1CI3M 4BASA 3C5HA 5KSPA 5SZKB 1JXOA 1XCGB 1ASZA 2WSSA 2PMZE 5E4FA 2EVWX 5DYGA 1UEIA 2CWAA 1KYIA 2ZI7A 3ND8A 4B2PA 4A8JA 5L3QB 4LDJA 2AL7A 2WHXA 2CXXA 3GLGE 4QGGA 3CWQA 1QHHA 3PCRB 1OIXA 1JAHA 1COWA 4NHOA 1U8AA 2A2ZA 2GVBA 2Z4SA 3AB3A 1YNJC 2NZ8A 4N3NA 1E1QD 1E2VA 1M2OB 1SVMA 4C0JA 3RS5A 5FPKA 3KJEA 4BBSH 2B8WA 4R4CA 1GUGA 1KK2A 2E2IH 1R0ZA 4LBWA 2PI2A 3AFPA 2J45A 4KFRA 3HKZG 3E9HA 1VQ7A 1OLOA 4Q9HA 2Z5FA 1NBMA 2QAGB 5K36G 5GQOA 1H8EA 3R20A 3HOUH 4GNXA 4HDQB 1G3QA 4O3MA 2VQFQ 4ZV4A 1L8QA 1XTDA 4LHZA 3A4LA 4LF9L 2PX3A 2W2XA 2ZRHA 3UWKA 1G7CA 3PO3G 2MMGA 3EIEA 5H8WA 4DV5L 1ZAKA 4G7HC 3LW8A 4O25A 3HOXH 1VG8A 3O8BA 5GROA 1DG3A 1G8HA 1ZD8A 3S1NH 2XOKD 1EFTA 3VHXA 1E9FA 2F1JA 4M2LA 5EUQB 3TVTA 2A8VA 4H13C 4A2PA 3T15A 2QPAA 1ESMA 4APVA 3KFVA 2Z43A 1WI5A 2ZRNA 1HZCA 1N3BA 1K3RA 2KSQA 3GJ3A 5B30A 4IHQA 2FPMA 1MH1A 3KQKA 1ZCBA 3HU1A 4JLVA 4EPTA 4QC2A 3MXUA 3WNBA 5BWMA 2HT6A 2AWNA 3NC1C 4IOMA 1CRPA 4S35A 4QKQA 4JOIC 3V4FA 4DCTA 1QZXA 1DAEA 1T6NA 4JI0Q 4LF4Q 2QGZA 4LF9Q 2MQHA 4HIMA 1KI9A 1OHHD 2JLWA 3SBEA 4LFCQ 4K81B 3QE0A 3W8RA 3W6OA 1TWCH 1YHAA 2DY1A 4GI7A 4X62L 4BLOA 1BH2A 1E2IA 4RD0A 4EQ6A 4Q9IA 1X8LA 3C41J 4A3GH 1Y1VG 1DD2A 1DO2A 2QTHA 3TH5A 3LW7A 4GZLA 3NEMA 3KJOA 2OCAA 1KI7A 3B8HA 2JIZA 3GFOA 3Q8DA 4URVR 3IO5A 1L1OA 4R2HA 4DDTA 4QBGB 4AKHA 1IM2A 4WXPA 1G17A 4DR2Q 1YZTA 1PYSB 4R4TA 4A93H 4JYCA 1VF7A 5AJZA 4B3SQ 3JZMA 5H70A 3ZVMA 2HUPA 2YOGA 3KB2A 4YXWD 5JMTA 4EFMA 5FBQB 1CTMA 4Q9LA 3A1WA 1UE5A 1O7LA 2DNCA 3IDQA 1E2KA 4DLTA 4DV7Q 2UUBQ 2PEYA 4FMDF 3OEHD 3L0OA 4X62Q 1DAGA 3G71A 2IW3A 4L9WA 1D2MA 1G18A 4JBMA 2IX1A 2FSFA 4DSTA 3NBHB 1DARA 1ESNA 3B1VA 4ZIRB 3RZOH 2BA0A 1IZ6A 2JJ1D 3K09C 1L2TA 3L8ZA 2BBTA 4QY7A 3VU9B 3HOWG 1UFQA 2X19A 3ZS9A 4EDHA 4QBIA 2CWPA 5AJXA 4XWOA 4D0NA 3Q85A 3FKSA 4BY7G 2VBCA 2W2TA 3L8YA 3VKWA 1H9KA 1G4AE 4KVAA 3UG6A 1GKUB 4XD7D 2BM1A 3LV8A 3N70A 3FMIA 1FJGQ 4A3LG 4WIAA 1IY0A 3TKLA 1RFLA 3MG9A 2CCJA 3GJ0A
chains in the Genus database with same CATH superfamily
3NH9A 1XZKA 2QM7A 1HT3A 3WG9A 4GECA 1IBML 1LRKA 5GV8A 3L93A 3NBQA 1K83H 3ISVA 5ELEA 2PFGA 3I4NH 4FF3A 2JFPA 1N9ZA 4L27A 1G5IA 1EUQA 2XMDA 2OGUA 4MAFA 4UHHA 3WWVA 2WVJA 4W82A 1YJNA 1ZPDA 4K6LA 1FJHA 3URMA 3I1JA 1SQSA 2V0CA 2I7XA 1QFYA 3AEUB 5C5IA 1CEXA 2PZUA 3HVKA 3M4JA 5DULA 1CUVA 2ZB4A 2C3MA 3ILXA 4MRRA 2XUFA 2RGGA 2AWOA 4YRMA 3KNZA 1YKFA 2A0WA 5DN6A 3ML1A 3J7AC 1F0YA 3CM0A 3K6SA 2YV3A 1TDJA 3QW2A 5E1FA 2OBMA 4ITRC 3UHAA 4RTNA 1YB7A 3AVWA 3DVSX 3STXA 3TOVA 1PR9A 1W93A 1C5KA 5A71A 3F2IA 4DG5A 4IS2A 5EGTA 2R8ZA 5AP9A 2Z57A 1Z6ZA 4OY3A 1IBKQ 1KZ1A 4R84A 2RDMA 3IDZA 3L79A 2DY0A 4ZJPA 4CLOA 2YZNA 3IQHX 4B4DA 4TLEA 3CLUD 1E1DA 5ICEA 3DC2A 3QSGA 2O50A 5F64A 4B3DA 3BDCA 1RE0A 5EIAA 3C98A 4X64Q 3AB9A 1QP7A 3AESB 4ETWA 4MQEB 3OX3A 4KXYA 4PLZA 4JBLA 2P2ZA 4Y67A 1R1DA 4P4SB 1TK9A 3BVMA 1ZKMA 4YC7A 2M2IA 4MYCA 5CX4A 3KUUA 4ZANA 3ECAA 1EKXA 3KDPA 1E7MA 4RA6A 4UNNA 4RF2A 4XWWA 1VLMA 5IZ4A 1W46A 4C21A 4DR6B 4MQMA 1GNTA 1A8VA 1N77A 4QTZA 4JV5L 3EXIB 2HWXA 3KYCB 3G17A 2P7HA 1F2DA 3Q8XB 1Y8PB 1ZSVA 5BR7A 2ZZNA 3G8CA 3GMDA 4K9LA 5A6SA 4QA9A 3ZE1B 2G5PA 5UKDA 1PMRA 1OX5A 4TYQA 2PBLA 1NN3A 3IBCA 3PTAA 3DP7A 1ZOOA 4S0ZA 1MT0A 3ZDQA 2Q28A 2C4VA 4I7AA 4WCFA 4ZALA 3RZDB 3DT6A 1CRLA 3CT4A 5AK5A 3PLRA 4EUHA 2AR7A 3SSOA 1MB2A 2AD1A 5ICFA 3HDTA 4TL8A 5TXGA 3U49A 4R4IA 2LKVA 2BEWA 1OR8A 1VYVA 4BVHA 1ZA2A 1ORIA 1LBTA 4C3IB 3WLSA 2ESRA 3D4RA 5AW9A 2PDAA 4Y2GA 1YA6A 4LHWA 4JJAA 1VQDA 4B7CA 5BV0A 2WM8A 4DV4Q 3FYUC 3TIFA 4D3YA 5JE8A 1UWLA 4ALNA 3D3RA 3BFXA 5D3MB 5HEKA 1IEVA 3PSHA 4EHDA 3RVQA 3L4JA 3WGMA 1SD5A 2VKTA 5ISRA 4NXNL 4DPKA 4F97A 3AEZA 4I1YA 1VSQA 3K73O 1J2EA 1UC9A 2XYRA 3U6BA 1HDGO 2DCMA 3IMGA 1ZNXA 1K1EA 2PSSA 5AOVA 3NAZA 4BO5A 5EGNA 4G5HA 4YYEA 1RWNA 1N7HA 4F46A 3K6KA 4D81A 3DE1X 1PTOH 3DQZA 3S2SA 2NSYA 2C7BA 5DHSA 1JPUA 3LDUA 5KYLA 3STWA 1SE4A 3EUWA 3FYUA 3HHPA 3K9HA 3HBLA 2FW0A 1TZKA 2F3PA 3OZBA 4FE3A 3CU7A 2HNAA 1RZ3A 4OYYA 1JG1A 1MJEA 3ZHXA 1K6MA 1MTOA 1S89A 3R1IA 2ASVA 3CPEA 1SUDA 3WHPA 1DC8A 4CBVA 5JSFA 1T1GA 2W83A 1A8HA 4RZIA 2PUTA 1JB1A 4C3ZA 2YYZA 3DBRB 3VHXB 3M4ZA 3DMHA 1IXRC 1WUYA 5FOSA 1EM8A 3VYRB 1JHAA 4WFIA 2YRXA 4INJA 2CFTA 2J87A 3O2JA 3K8QA 5CFNA 3A9VA 2HYDA 2IVZA 4ZQCB 2VPWA 2GESA 2GF9A 5ESDA 2C9CA 2FB9A 4FZRA 1KEKA 4DG8A 4DDUA 4HL6A 2WMNB 1DTWA 4RNCA 1EUJA 3EBOA 3F4BA 3FWYA 4JJ6A 4J6EA 5IDVA 4B3RB 3ORSA 2DBZA 1E7RA 4DR4Q 3TP8A 3WYAA 4P2BA 1Y3IA 1U8UA 1CZOA 3GRYA 3S1SA 2QRVA 1TT2A 4CIWA 2QZZA 3M6XA 4RD2A 1XD8A 4ABYA 1EJBA 4MV4A 1D8TA 1XKQA 4H15A 1KDBA 2OFPA 1IXRA 3VZQA 1T4GA 3AGQA 3EODA 4ZYYA 2LUOA 4JEIA 4HVCA 4MVJP 1M2EA 3RUCA 4EENA 1SMKA 2O1WA 2CFIA 2HD4A 2IEBA 2O05A 3BMNB 4WEQA 3HI4A 1BVSA 2WAMA 1ZSNA 3QVGA 4DN6A 5LIRA 3OTQA 2NIPA 4ZVMA 2QD3A 1WJGA 1EWQA 1PG0A 3IR6A 1H0RA 4HYTA 4W5WA 3VV2A 1M5TA 4ZO9A 3TIGA 1HHVA 1B6TA 2R47A 2R6ZA 4DLYA 1KA9H 1RTKA 1I94B 3CUVA 5DX0A 2KHIA 4LPKA 3EQLC 5JZVA 2MR6A 3GLHA 2QTVB 5K05A 4V2IA 4IR7A 3F3MA 2HPAA 4YAIA 4M53A 3B6IA 3H0GG 3D4OA 1LKZA 1U1GA 3ZD9A 2A7XA 2F9LA 1V7QA 4KB5A 5J3BA 2P4SA 3C8ZA 4PG3A 3TBHA 1D2BA 2O8DA 3SICE 3PJFA 3PX7A 4FEYA 2Q49A 4D8YA 2F43A 1ULTA 3HUTA 5SZIA 3WGKA 1M34E 4WFJA 3TRDA 4R1UA 3ZQJA 5BN3A 3TTWA 3ZZNA 1WMAA 1QWSA 3S7ZA 4AQYB 4UOEA 3DMGA 2C4TA 1SJED 1UBOS 2WDPA 4HDMA 2XYVA 5DOVA 3QHQA 1KAHA 1VJCA 3DOEA 4HDAA 3TECE 3GTGH 1X94A 2HA2A 3IAXA 5CFRA 1RM4A 3SQNA 1IBRA 4IN3A 4Q4AB 3LC1O 3FSEA 4LDRA 3L92A 4CCAA 1KOFA 3U9OA 4B3MQ 3CZAA 3U26A 2F3WA 3TCKA 4N3BA 1XD2A 3EDRA 4EDFA 1KY2A 2A19A 4KR0A 1P60A 4M1KA 1D6EC 1C7RA 3B12A 3U13A 3HO6A 1X1DA 2F3RA 3H5RA 2B61A 2PX6A 3OCWA 5A1TA 1S5CD 1OXXK 1QFMA 1BE6A 4RLFA 4HVTA 3GLSA 2WR8A 1UDBA 5K8JB 4HRVA 3DWQA 5JROA 1I8TA 1P18A 4LRUA 2VYCA 5ALGA 4ZOLB 1CR2A 3AHFA 2OVFA 3ORHA 1BXRA 2K14A 2QL6A 2P4UA 3EIXA 5D5QA 1XKXA 3FDXA 2JFBA 4QUGA 4DN4M 3MXNB 4DL9A 1R0SA 3AC0A 4FYJA 4OATA 4C1NK 2HDNB 2FRVA 2Y1FA 2JLZA 2G4VA 2I5HA 3NNNA 4G41A 4Z3OA 2IYLD 1OXMA 2A0UA 4RF4A 2R9VA 4QBTA 4CL0A 3LU1A 2QRJA 1DUSA 4DCSA 2ZXOA 3ESBA 3F0TA 4G2NA 1EUDA 4QXAA 1L5HA 4EGJA 1FRFS 2B5VA 4KJOA 1TWAB 2R2AA 1VJ0A 2BTEA 2HRQA 1K3FA 4G0WA 1RPZA 1TUEA 4IFDH 1UBCA 4OWTB 1VMPA 2PLRA 3CYFA 1EFAA 1Z83A 2GF2A 2PX5A 2EZ8A 2I2CA 1IBLQ 3G2LA 3VRHA 3UK1A 1QNFA 4NY1A 4BNIA 1VFNA 1OTHA 1U9ZA 2J9FA 3DDHA 2J9GA 3OJLA 4L76A 4DKAC 3CC4A 2JE6I 5BR8B 5IYBH 5L53A 4U4AA 5E3FA 3IL2A 2ZRCA 4V24A 4C7KA 5IT5A 3ERSX 1C3VA 4HADA 4QVKA 3GLFB 4PONA 4D0LB 1CUEA 2QN8A 5COAA 4PPYA 4PX5A 2DFPA 2ZJAA 5BXYA 3X3HA 2PUHA 2Q4DA 1PH7A 4LWCA 2NBFA 4W8GA 1OPXA 2ZS8A 2VK2A 3O75A 3R09A 4IKOA 4LF9B 4KLAA 4UJ3A 1VLQA 2CH4A 2I6TA 4R31A 2MIIA 2EFEB 2NN6G 4GN3B 4EG6A 3GVIA 2RCYA 4X3CA 2IJ0A 3ONDA 5KNBH 1SBIA 5KHLB 1KQ3A 4O2LA 2O3RA 3FH0A 4N65A 3UT5A 2W9XA 3OP1A 3UYKA 4DA8A 3L82B 3ETGA 3JQAD 1RQLA 2WSBA 4IP0A 3I0ZA 2XRSD 1PTOD 1R0CA 5A0VA 3PCOB 3D8TA 5EHGA 4QOEA 2FFJA 4QT0A 1WB9A 1SUEA 1JKMA 4W5HA 2P2NA 4TN1A 1XPOA 2XE4A 2H8GA 2JPDA 1YZQA 3NHYA 3I05A 1M1NA 2I6SA 3TG8A 4YCCA 4R01A 3AW8A 4Z49A 2BELA 1Y8QA 2Q46A 2YTVA 3V05A 1UJ6A 4Y7NB 2F3UA 3KHUA 3J80L 3MGKA 2KHSA 1VJGA 13PKA 3LCCA 1OV6A 1XJ5A 1LI4A 2HFJA 1YMUA 2HBZA 4R8SA 2PT5A 1DADA 3OF5A 3VR3D 3OZTA 1FU4A 4EUFA 1IZ9A 4MS4B 2Y1EA 5AM1A 1BVHA 3A54A 4CG0A 3I23A 4X54A 4PS0A 1TQ4A 5BVGB 1E2NA 4MNTA 2XDWA 5E6SA 3VSBA 2HM7A 1RAEA 5JANA 1BMTA 1I7NA 1HMYA 1PN3A 4D45A 3SYRA 1YVRA 4FWIB 2AQKA 3TSYA 1N2JA 1DINA 1CZLA 2Q2TA 1H4VB 3P1JA 1RMYA 4FU0A 1DX6A 3V1KA 3E5HA 4XCXA 2ZRGA 3CR8A 1M2KA 1T2CA 4EX5A 2G1KA 4ZZ2A 1C2YA 1E92A 1H65A 2QTBA 4WINA 3ITDA 3LXUX 3W04A 2EJCA 4KVFA 1DEKA 4R4JA 3PEVA 1Z8HA 1WVGA 1Y8CA 4G1VA 3HJBA 1JA1A 3L1KA 4S24A 1HFGA 4IVQA 2K5UA 4Z54A 9LDBA 4GYWA 2BYTA 4YLGA 3QPDA 2YV4A 1HA5A 3R6GA 3PIOA 3T13A 4KMRA 5IKXA 2O3TA 4E03A 2Q8PA 1HT2E 3B3JA 3WHKA 1PU2A 3PRYA 1EZ1A 1UPTA 3HXPA 3K94A 4YRNA 3GT7A 2YNMC 3VJLA 3STVA 4GKVA 5BV7A 1XMOB 3D6AA 3JZFA 5FPQA 3UW1A 3FTFA 3PO3H 1CQZA 4H7KA 4PWYA 1CUFA 3G5TA 1M6NA 4F71A 3JAKB 3E7DA 2C9BA 1I13A 2JIMA 1TCVA 3DMNA 3VR6H 4QEDA 5K0NA 2C3UA 3IUPA 1R8YA 3CH7A 3OD5A 4XQ0A 4CM3A 4DAOA 1ZGAA 1NW8A 5J59A 3D6HA 2RSLA 2PKQO 1PSWA 3D7MA 1C3XA 1UC8A 3RWOA 1O6FA 1H4SA 1ECLA 3EQ9A 2OLJA 3UT6A 1JNYA 1J8DA 3WGJA 3QMVA 4GL2A 3G59A 3UJNA 1TR5A 3WZMA 1TAHA 4X7MA 4RYDA 1JJCB 1JR4A 2XQKA 2NO9A 1EYCA 4WLFA 2G08A 1HLFA 5REQA 4LGMA 3U80A 3D7NA 4LWQA 1G6ZA 1VL2A 2FWNA 5FOWA 3A6GA 3MERA 5H59A 1HDYA 3S3TA 2OCBA 3BGOS 2PMWB 3AXSA 4EIWA 4N3CA 3TPFA 1DQNA 4KPGA 4DGSA 2C5CA 5D86A 3DE0X 4QF4A 1U9JA 3JU3A 1TZMA 5B64A 2R2GA 1JBQA 2I07B 5HA5A 1WSWA 2DBRA 5BY2A 5J5AA 4BNYA 3L0BA 2PUVA 3UJHA 4Z4QA 1ZH4A 4TT3D 5CB4A 3CUSA 4K1XA 3ZBUA 3HRKA 3DVAA 4BVKA 3VPDA 3R40A 4D4IA 3I64A 1XU7A 1L5KA 1CUKA 4GBGA 4XJTA 3EVTA 4IMIB 2AFIB 2ZR0A 3LOUA 1L7RA 2BMDA 4M9UA 2ENBA 2X1VA 1SKMA 3KKZA 4K05A 4DSOA 4IO9A 3H91A 4LJ4A 3KFUA 4H1UA 4L5IA 5EIFA 2O0MA 5ALIA 4CL8A 1GTMA 5FTJA 1TGVA 4Y2TA 3BTOA 3TLCA 2WAQG 1N5MA 3CXCA 2UUCB 3O95A 4M7PA 1KABA 4GMGA 1R7RA 5HQ3A 2CHVA 1KI6B 4DIBA 2PV0A 4DLXA 3EIHA 3FNBA 1N6NA 2MSDB 4PRKA 4X3TA 5CUQA 2IXBA 1PFBA 3EY4A 3SS7X 3PLAE 4QELA 1NF9A 2VDNB 2KCTA 1JA9A 1ORTA 1QHGA 3R9XA 4LHXA 4XZ3A 2AG5A 4J4TA 1AKEA 2R8RA 5EHNA 3SS8A 1GITA 3JSXA 3VDMA 2GN9A 5FOQA 1Y8NB 4AULA 1L4MA 1XL0A 2O8CA 3QFTA 2WWIA 4Z4HA 2ZJYA 5L3SA 4BC1A 1EQQA 4H18A 4TQUS 3IFTA 5AHKA 3ZU6A 2R97A 2IUSA 1S5PA 1KDCA 1VQ1A 4HAEA 1EBBA 1Z6HA 4A76A 5M5XB 5JQGA 4BBAA 3UXEA 3RJZA 2B7BA 4FUQA 1F1BA 2KA7A 2DJFC 4YO8A 1T6BY 3LO5A 2JF0A 2GCOB 3MWYW 2M1XA 1OA1A 2BR3A 1ZMXA 5KREA 3ILHA 4IYRA 2RAPA 4URWR 4WESB 3N0TA 1S2LA 2NNLD 2IQIA 3KETA 3I9FA 4O63O 4ER6A 1TEHA 4YCAA 2HWUA 4BJHB 2JXMB 3OE1A 2YASA 4UDNA 3C97A 4LFCB 2BHTA 5IN4A 5K09A 3ABRB 4ENQA 3AKYA 1W0KA 4M9SA 4B3SB 2K5VA 5EJ9A 1T1EA 4OH7A 2FAXA 3UC5A 1Q2UA 3WL8A 4A2WA 2B21A 2WG0A 3RAEC 2FV8A 3PF8A 4Q24A 3LRPA 1JDZA 4UEWA 2L42A 2AXPA 1OI2A 3O1LA 3EFOA 3T7KA 2OD9A 4ZHSA 5HG0A 421PA 4GS3A 4K9QA 3B60A 3M6UA 2MINB 3VZPA 2PX0A 4KK3A 4ZTZB 2JI8A 3BFKA 3GRKA 3FBWA 3QUTA 2BGJA 4ZJUA 1GQOA 3QUAA 1ASZA 1UEIA 2ZI7A 5LBTA 3A2KA 1RCTE 4BCCA 1QGUA 2Q0XA 4PZDA 3THRA 3DVRX 3ZHVA 1GUGA 1M0EA 2J45A 1EP2B 2D0IA 2WFAA 5AMXA 2QAGB 1H8EA 3S9WA 3A4LA 2PX3A 5ALFA 1GDHA 2H4JA 2W6PA 5F12A 4N5NA 4RFBA 1ZD2P 3TTTA 5AXDA 3VAYA 2F1JA 2A8VA 2Z43A 5EJIA 1U63A 1ZCBA 2GA4B 1T35A 5FNZA 2HT6A 4O6VA 2ECOA 3LI2A 1TWCH 3EDQA 4BLOA 4GMHA 5KCZA 5ICSA 3IQGX 3C41J 4A3GH 2JN4A 2CNNA 4RV5A 3E3LA 3QB3A 5LM3A 1KI7A 4XLZA 1XZHA 4FNAA 1NQTA 5M5BA 3K5NA 4R4TA 5H70A 3KB2A 1YV9A 4C4ZA 2AE2A 5JNRA 1Q11A 2A0KA 1QQ5A 1TKAA 1QE6A 5A4DA 4O4IF 2BBTA 3VU9B 2G1PA 1UFQA 4QBIA 4ZVNA 1EJ0A 3MWFA 2PQMA 1FQOA 1NE7A 4P4LA 3GEEA 1T9BA 2O3QA 3A2MA 3MINA 3Q7TA 4FT4A 4X64B 3IALA 4K28A 4NV1A 3U4QA 2PWPA 3LT4A 5EP1A 4NPSA 3L8FA 3BPSA 4KKUA 4KXNA 2NO0A 1U0LA 3WLMA 2VHXA 4YALA 3OLZA 4MAAA 5LQSA 4DUYQ 3RYHA 1GZSA 5FRDA 3EOZA 1KAWA 1RKBA 1AZQA 1LU9A 2LGJA 1QHIA 4KQ6A 2VNIA 4GOJA 3KZXA 3EVBA 2R6FA 2W6QA 3MILA 5HZGA 5B1HA 3I1FA 5DHAA 4KH1A 1UBSB 1TW2A 4FT2A 2GX6A 4OHUA 4BAZA 4FFVA 3BH0A 2WU8A 3H2YA 4QUKA 5BWLA 1Z6XA 1IHZA 3VSAA 1HDCA 1M90C 4EFNA 2L15A 4BJ6A 4N48A 2QUAA 1H0SA 3L43A 2H4XA 5EXDA 2ZJBA 3TMAA 5IK2D 2QLNA 1KAEA 2ZBEA 5KTPA 1SXJB 1UIRA 2IYFA 4XW2A 1X9GA 3SFVA 3LA6A 1O78A 5HP4A 2HUNA 5AD1A 4IM7A 4JOSA 5BVHB 3TK1A 3VR5H 1QR2A 1XD2B 4C4OA 1ZN7A 2A14A 3RVSA 1Z39A 2Z4TA 1EWHA 5KVAA 2JC3A 1S2IA 2FX2A 3RQSA 1QUQB 3TYXA 3O31A 4PZLA 4IZOA 3QPCA 2N3ZA 5DH9A 3HB9A 2J4DA 2Z6KC 1BXGA 1JAZA 2DFLA 2FFBA 1R00A 4IH4A 1LQUA 4NULA 1S96A 4UBLA 3OMWA 3VTZA 4GLVB 4DV4B 1QB8A 1E1CA 3KR2A 5HOEA 1Y5LA 4UC0A 1YGPA 1SA0B 4TLBA 5GGXA 2ZAMA 4ZCPA 4ZYTA 3GRVA 3TI9A 2OM6A 1TK3A 5A4KA 1RI5A 4JI5Q 3DAFA 4H31A 4Z2AA 2HCJB 2DPXA 2GUGA 4RIGA 3RROA 1WEKA 4OG2A 3RMHA 1D03A 3PFKA 3U44A 3RANA 1PTJA 2YCLA 3PDWA 4BQSA 3PDIA 1TWGB 2CVQA 3NWPA 1X54A 3B70A 1RQ2A 2NVXH 4O33A 3DMUA 5KYWA 5AOAA 1YJ5A 4QIWE 3K35A 4AUMA 1K06A 2GEUA 3WXBA 1TU2B 4A3FB 1JFLA 1VXOA 3O8OB 4A3MB 1CY6A 1XWFA 3THSA 3MELA 2EFCB 5ALSA 2BM9A 5M2QA 4ME5A 1MNQA 1RXIA 3WKCA 2CCKA 4WKNA 5JS6A 4CU5A 2FHTA 3FUCA 3IP7A 2VLBA 4LFAL 3BH7A 4MPJA 2NUPB 1AO0A 5G3LD 1E3IA 3AI1A 3WQHA 4CMAA 4IKPA 3Q1KA 3X1ZA 1JQBA 1SKBA 2F67A 1NVWQ 1FGBD 4ZEMA