1OXXK

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Formation of the productive ATP-Mg2+-bound dimer of GlcV, an ABC-ATPase from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 105
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00005 ABC_tran ABC transporter
K PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxxK03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxxK02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxxK01
2RCNA 1JR3D 3GD7A 4C3JH 2XSZD 3HOWG 5EZ6B 4L5BA 4DR1Q 1EFCA 3EZ2A 4DC9A 4DIEA 4HUTA 5F3WB 2C96A 3MCAA 1EQQA 3GLFA 2O8DA 4H44C 3RNLA 1Q8KA 3GFOA 3ONWA 3V00A 1MR3F 1JEDA 2LXJA 1E9DA 1X3FA 2UXDQ 3ETLA 2C9YA 3ZVLA 1HQYE 3RS2A 3PCOB 4LX0A 4PTLA 1E2DA 4TQ9A 5FUVA 4YQFA 1HQCA 5EAYA 1VG9B 2UU9L 2B21A 3T35A 2CQOA 1U90A 3Q7PA 4XTRA 4JI4L 1UE1A 1T0HB 3BB4A 1JMCA 3CRRA 5M5XH 3KQNA 1XCMA 4RSGA 1UAAA 1KY2A 1X8JA 2Q9CA 3I55A 3D7MA 1DAKA 4TMTA 1VQNA 4CEJA 4MUAA 4M1OA 2ONJA 1Z2CA 3KQUA 2MSDB 1H8HD 3QF4A 5A5GA 1NG9A 2PPBC 4CIDA 2FWRA 3ZJYA 1M1YE 4R4QA 4WJ3M 2JJQA 3OFNA 2UXBL 3FOZA 1R10A 2PCJA 4TSFA 1UKVY 3A58B 3GJ7A 2VS1A 1BOFA 5IK2A 3KXLA 1ZC4A 2A6EC 3U6BA 1U94A 3F3YA 5A4JA 1W0JD 1GHKA 1WP9A 1BVSA 3BD9A 3CKLA 5KO2A 5BW8A 1SKQA 4B48A 1G3UA 3JVVA 1HT1E 3AVOA 2VW9A 4HDQB 1WI5A 4J15A 1AZSC 2FSGA 2F1MA 3A8KE 2F1IA 3J81i 1VHLA 5J4VA 1EWHA 1SMXA 2VP4A 2FPKA 3DVLA 4CYMA 4HSEA 4YC7A 1AM4D 1E1QA 3K9GA 1N32L 1HR0L 3BZKA 1YNJC 5GROA 4DSNA 3CO5A 1D8TA 3L82B 1N9WA 3RRMA 1HV8A 1MIUA 1OE0A 2BEKA 2CCGA 4PQRA 4PQFA 4BY7H 4ZPXA 2AXNA 4DNIA 5M04A 4PC3A 1D5CA 1NTGA 2G3YA 2OHFA 3P4XA 3CF6R 4C9BA 2Z0SA 4C3IH 4DR4Q 4DPGA 5EXPA 1IONA 3EPJA 1GO3E 2GTPA 4E09A 3B1XA 2E2IH 1KMQA 2C5LA 2KWIA 3EC2A 3WMFA 1MABB 1SQ5A 5CM9C 2BE5D 3M4YA 2IYYA 1KSGA 1W44A 4KJZA 2V3CC 3VKWA 4RKFA 1HJPA 1SROA 3TGPA 5AUNB 2OTLA 2VP5A 3UMFA 2HHHQ 2LWIA 3Q72A 2Q2UA 3GLGE 1A63A 4C7OB 2KBFA 4JT2A 2CWAA 4B3RL 1E99A 1NN3A 2A2ZA 2O8EB 1MH1A 3H94A 2YTXA 2PMKA 4LF8L 521PA 3FGNA 1TU4A 1VS0A 1NIJA 5C0XH 4A82A 4LI0A 4YLGA 1K8GA 1N6HA 2QN6A 4I81A 1G19A 1OB2A 5C1BA 3J81j 3CLVA 3Q9LA 1G8FA 2ANCA 2E5LL 1QVAA 2ZITA 4PO9A 2JEOA 3OFND 4M9QA 5HCIA 3FMFA 1CI3M 4CEIB 1VQPA 2I4IA 1K5DA 4TSFD 5DH9A 3CR7A 1KMHA 1VQ5A 2BCGY 3I56A 2IK8A 2WV9A 3DM5A 1AS0A 3NC1C 2XX3A 5FOVA 3TRFA 5IK2D 3LGJA 1J5EQ 1XTKA 3SDZA 1EX6A 3F1ZA 4BLTA 3DKPA 4B75A 1FNMA 3SNHA 3AQ4A 4KN7C 4ZDKA 2F9MA 4DUYQ 4LRWA 2GXAA 4LV6A 3AF3A 2UUBL 3AP3A 4P3YA 4G01B 3SS8A 3WY9A 1Q7YC 2OZEA 2NZOA 1HA3A 221PA 2OFXA 2QT1A 4G3XA 1YVDA 4BFWA 4GZYC 3IRBA 1II8B 1S2MA 4F38A 5JI3E 4GMDA 4AQYL 2NO0A 4A3KH 3A4MA 3R7WA 3WBJA 3K70C 2QGNA 3RC3A 2AMCB 5IYCG 4GNXA 1UM8A 3CF5A 3B82A 3EASA 4YHHQ 1CKEA 2C98A 2D2EA 1TWFH 1BYUA 2VRWA 5IYBH 2X2FA 2PNRC 4IW3B 5DSZA 2IF0A 4GN5A 4TLBA 1N6LA 2C95A 3NEMA 4BBRG 2JASA 2ZQ5A 2WJYA 2OQ0A 4V03A 5FTNA 4PAOA 4BFXA 1YI2A 2WWHA 4GDFA 4FCVA 1RJ9B 2WBLC 5D3MB 2O5JC 4TTRA 4DV1Q 1TQ2A 3F5FA 4GL2A 4A3MG 1DAMA 2K75A 2YWEA 3CRVA 2GESA 3AVPA 2ORWA 2RGEA 1TMKA 4FDBA 4MYTA 2O0JA 3SBDA 1E32A 1IY2A 1SXJE 4TTPA 1TUIA 2WOJA 2ZREA 2KENA 3QKTA 2PBRA 2H5EA 2ZSFA 1K3RA 2NQ2C 2LXKA 3FHWA 4JL5A 4BFSA 621PA 1P8LA 4A3CG 2JLUA 1JPJA 5F2EA 4Q00A 3BFVA 2DR3A 1CFMA 3U4VA 3NWJA 1LY1A 3CR8A 3UANA 4DCSA 1E6CA 2FU5C 1U81A 1VQJA 3CAMA 3I4MG 1NIPA 2GZDA 1ZBDA 3QBVA 1PLJA 5EQTA 2IW3A 2ODBA 1WBDA 2DB3A 2G1JA 3LQRA 4JK1C 1JR3E 3GEHA 4CDGA 4NYMQ 2QZ4A 4YDHB 3I62A 1E3PA 3S1RH 1SXJC 4NYIQ 3O8BA 3V4RA 1MRSA 4JOIC 2PEZA 2VP2A 2WSMA 1CKMA 1GNRA 4X65Q 4PR0A 3FP9A 1U8YA 4M8NE 1VQEA 2H92A 3LVQE 4CVNA 3CCEA 2R8RA 4BWYA 4TVAB 1J2JA 1FQJA 5FOTA 3WNDA 4MGZR 4DDVA 2GEUA 4G5GA 4QC2A 4QGAA 4A3EH 2AK2A 5AJ3Q 2CCZA 5FL3A 1PZNA 2B29A 2WWWA 2QEXA 3N5CA 3U58A 4KCGA 4ZDWA 2WB1E 2VQFL 3NBZC 1IL2A 2GBLA 1Z07A 1NLYA 1AIPA 3Q5DA 4HJ9A 2J1LA 2DCUA 4AI6A 4LYJA 2QA4A 1TADA 1N5JA 2JCSA 3BS4A 4JLKA 4A3FH 1OHHA 3B2EA 3WWVA 2ZAOA 1A6XA 3FMPB 2VSXA 8OHMA 1X3EA 1GUTA 2A68C 1KJWA 2QQEA 5B2ZA 1XMQQ 1GHJA 5DHFA 2VYFA 2ZRHA 5FI1B 2NO6A 5LB2A 3HR8A 4EPWA 1XBTA 2VIIA 2RB4A 4C0AC 3K9LA 4BFUA 1Z22A 1G7TA 4Q1BA 2BEJA 1TWCH 4AYBG 1EFUA 4O2RA 1FR3A 1J90A 3AEVA 2QE7A 1TQ6A 1JXMA 2QMOA 1C9OA 1UPTA 3UDGA 4U00A 1N25A 4GFDA 3R9IA 1GL7A 2RMKA 3TVTA 3SFZA 5J40A 3R9WA 1G3MA 3H0GG 3KFXA 1NP6A 3M85A 2CL0X 4RZ2A 1Q0UA 3GLGB 1LVGA 4JI6L 1GNQA 2EFCB 3WHLA 4ESVA 3L2PA 4LJYA 1G6PA 3QXXA 2V55B 4IOAA 4AWXA 4OGQC 1X9NA 2G0NA 1F2UA 4RD1A 2V7QD 5CK4A 1YZTA 2C77A 4LNQA 4IVPA 3PG5A 4JBYA 2QPTA 4PFSA 3J81k 5AUQA 1UADA 5FFMA 4URVR 3KQLA 4A8JA 2UU9Q 5DYIA 4TYYA 1XXHA 1AQYA 2MSEB 3B9QA 1VQGA 1JJGA 2XB4A 1PHJA 1K6MA 2PT5A 4QGHA 4TMZA 5AK0A 1JJ7A 1LF5A 1A82A 4GT1A 1PUJA 2O52A 3FFAA 1X8LA 4DLUA 4YWLA 3TS0A 2J0VA 2DWOA 3ULJA 2JJ1A 1OH7A 1Z6YA 2XTZA 2MO1A 3H4MA 2Q2HA 1EGAA 3Q7QA 4UJ5A 2LKCA 5KSPA 3VU9A 5FTLA 3DO6A 1GAJA 5C3EG 4GI7A 1T6NA 5HZKA 2FZ4A 1BO6A 2OAP1 3AF4A 2UXBQ 1LNZA 4IRUB 4A4IA 3S1NH 1RE0A 1KO1A 4AKGA 5EP4A 2D06A 1OHHD 4PZ6A 3K1JA 2VP0A 3E1SA 3CNLA 4PC2A 1UBFA 2AL7A 4RMFA 1EUJA 1W36C 1VQ6A 4MDFA 3PUXA 3F2CA 2ZRFA 3CNNA 4R71A 4FMCB 2WJVA 4YMSA 4F93B 4L4UA 3W5JA 2PJRA 1XTDA 4A3LG 4PC1A 3O8RA 4A15A 2IHEA 1LTLA 3H3VH 4UPAA 1DBSA 1LFDB 3AGQA 4Q7JB 4A0GA 1G6OA 3A5ZB 3QKSB 4US1R 2EJMA 2W6IA 1SXJB 1T9HA 2WWXA 1GKIA 4JCVE 1Q1BA 5M5WH 2NOAA 2ZRGA 3L43A 2D4HA 2JJ8A 3PCRB 1QVGA 3SU8A 1N32Q 2NN6H 2VF8A 3FB4A 3EW9A 1OXSC 1HR0Q 3FE2A 4LF9L 4KU4A 3DOEA 1NVVR 3MFYA 3JAMi 4JI0L 2F4VL 2NPIA 3EAQA 3IUYA 3LY5A 3M6AA 5EP3A 5J47A 4XVQA 3KJOA 1HNWL 4A76A 1GUOA 4KHPQ 2ZAMA 4TL7A 4IDNA 2JA6H 1CULC 3W90A 5JWOA 4A3JG 3ER0A 5G3YA 2F7SA 5EXSA 3BH6A 1K83H 3PO3H 3A1WA 2ODWA 3K09A 4S2EA 1CJUC 4EX5A 3GP8A 3EXAA 2WPDA 1CXZA 1Q81C 1UBEA 1WXQA 2D7CA 4AKEA 1FUUA 2PCLA 2D0OA 2JA8G 2H7VA 4IEIA 4ACAA 4GLVB 5DI3B 4B3RQ 1CLUA 5E7IA 2JA7H 4RFSB 4BEBA 3PGZA 2AKYA 1E24A 2A3RA 2BH2A 2GRJA 4LF8Q 3EWSA 5CYPA 3QPVA 2JJ1D 3ZQ6A 5FPHA 1O78A 3D4RA 2EWVA 5FBVB 3EPHA 2RHMA 1L0WA 2JLVA 3N2EA 2YWFA 4UP7A 5TY0A 3AVTA 2E5LQ 4QIWE 3FWYA 3RANA 3E5HA 5IP9G 1KO5A 3OEHD 2GHIA 1VKJA 2ZE6A 3VNUA 2GK7A 4XTCS 4MNOA 3LBIA 4DSTA 2V4DA 4HLCA 1J99A 1TQ4A 4PAQA 3ZS9A 4GOPB 3F8TA 3VR4A 2K32A 1KO4A 3A37A 3EA5A 4MGYR 1YKSA 2UUBQ 1KO7A 2IYRA 4Q1CA 3MD0A 2NTYC 5C0XI 4I1SA 4A92A 1ZYUA 1X3GA 1GUNA 3RR5A 4DR6Q 2OG2A 4URYR 3UXMA 1GUSA 2BDTA 3WDNA 1IY1A 1QHXA 3GEIA 3SR0A 3WYFA 3IBGA 2OBMA 2PZFA 1II8A 3CX6A 4UXJA 2KSQA 121PA 3A8IE 1FFHA 2V54A 1CTMA 4PO1A 3KDFB 4DNRB 3MWYW 1VQ9A 2PLRA 3LBNA 4OI0A 1U99A 2AR7A 4PAMA 1VCOA 4Q47A 3W8NA 5C0XJ 1MJCA 4B71A 1IXRA 5IP7H 2PH1A 4DLYA 2CLCX 4TLCA 4DV2L 3P26A 4OK6A 3TAUA 3KJEA 1FW6A 3ZS8A 4XIGS 4NCIA 3DZ8A 1UF9A 3QPUA 4A9AA 4DBLC 3O47A 4ASUA 1QUQA 5BN3A 1NSFA 4J0QA 3F0TA 2Q2TA 1TX4B 4Q4AA 2DN8A 1X55A 1IW7D 2B7CA 2WPDD 4JI8Q 4PZ7A 1BKDR 2DWPA 2PNHA 3BK7A 4LJZC 3GMTA 4TQAA 3NXSA 1E2VA 2ZM6Q 1G8PA 1WMSA 2HCBA 3ZDQA 1RVDA 2QP9X 2BH8A 4OQNA 4G5SA 3W9YA 1HH4A 2FFHA 1UEJA 1KDTA 3UK6A 1DAHA 2W0SA 1OXXK 2D2FA 3GO5A 3STBC 1DG3A 2G1KA 1L8QA 5LBIA 1FP7A 1S96A 2ZTDA 3FKIG 4URWR 1VYUA 3RS0A 2C78A 1H65A 4NH0A 4OHXA 4ACBA 2QL6A 3U7GA 2G6BA 2RKOA 4BEJA 4A36A 2UUAL 2VHQA 4RJLA 2WZQA 3CCUA 2R93H 4WW0A 4CEJB 3TIFA 1K8OA 2BA1A 3OW2A 1XNRL 4GOXA 2BJWA 1EXMA 4IFBA 5SZJA 2BKEA 2A5FA 3K0AB 2JLZA 2YKGA 3QF4B 1DO0A 2WTUA 2CHQA 4H0LC 4KBFA 3RDPA 3B5JA 5JSZB 3LX5A 4JBMA 4FIDA 4X8HA 1VCNA 1XTQA 1I50H 3E70C 4I7ZC 4OK3A 1E9SA 3MWJA 2DY1A 2W00A 3PSIA 1TWHH 2D74A 3GQBA 2VQFQ 2H57A 3UWKA 2OCPA 3VKGA 4TQUS 3OW7A 1ZIOA 4QOSA 2FSFA 1YZLA 1EX7A 1QRAA 4YCUA 2FSHA 4UNQA 1P2TA 2XZPA 2ES2A 1YHQA 5FBRB 3A8TA 5FTJA 3T53B 3AVQA 3HYRA 4GPTA 4BLPA 2ZJQA 3V4FA 1XNQQ 1N5IA 2WMOB 2ZU0C 3QBTA 4QJFA 2GCOA 4Q01A 3AEZA 3HJNA 2WWGA 3SHWA 3VFDA 1L4UA 2AUJD 4YXWA 1W36B 2VP6A 4RG1A 2GAOA 1JB7A 2CLDX 4LHYA 2RGCA 4XD7D 4BGDA 2ZIAA 4LJ9A 1Z6XA 4HIDA 5A35A 3C7KA 1K73C 2R2AA 1TTTA 4KI0A 1U0LA 1Z0JA 3C5CA 1DEKA 5K36H 4JLVA 1PH3A 4G7HC 4A3DH 1YR6A 1YZQA 4DV6Q 4F4IA 4YWMA 1XPOA 4NU0A 5BQ5A 4AYTA 1S3OA 1N6OA 1Z5ZA 1HUQA 1G5TA 3SC3A 4ON9A 4WXRA 3OIWA 2QORA 2IS2A 4JI6Q 2HT1A 1KNQA 4F92B 2ZYVX 5DI9A 3LXRA 1OYWA 1U0HC 4FXPA 5E7NA 2GBLC 4P72A 2AN9A 2OXCA 5LD2C 3SI7A 3ZLJA 3QENA 2VHTA 2VZAA 4M1MA 3ADBA 2DFLA 2ZJ5A 1HEIA 5J4HA 2ZYWX 5FR2A 2YOHA 4LW1A 2ZJZA 5JRZA 4LJAA 4DAYB 4B73A 4URXR 2N3SA 2ERXA 4DLRA 2EDGA 3ADKA 3C4JA 1Z6GA 3RN2A 3H15A 1VCMA 1K8MA 1WFQA 1PH5A 4BY7G 1KHTA 1WQ1R 2FOLA 1O87A 2ODEA 5JECA 4W5JA 2LCFA 1YHBA 1L2TA 2CK3A 5AJZA 1A62A 2QM7A 4BFTA 2J46A 1LYLA 2IXEA 2VF7A 4HJAA 2A7QA 4RD3A 4B74A 5JHGB 1TKWB 1XXHE 4HDCA 2CEAA 1MV5A 4V0NA 3GTPH 3U44A 3TREA 3BIFA 1KMHB 2NO9A 1US8B 5JEAH 3AB3A 4KYIB 3SGIA 3CRKC 3BU2A 1GILA 1NG1A 3KLRA 1QJOA 2WAYA 2YWHA 3OE7D 1JAIA 3CWZA 4RD4A 4W5HA 5FUXA 5KU1A 2FN4A 3TQCA 821PA 1R8QA 2ID0A 4KITB 1XJ0A 2FV8A 4B43A 5BR8Q 4WAUA 4Q9LA 5C4GB 3TBKA 1S3GA 1QHNA 2Z6VA 4B3XA 1J7KA 2REBA 3R7WB 2DNCA 2OBLA 3MRSA 4LZZA 2IT1A 5C0XG 5GADC 4GNXB 1XTIA 2IF2A 2JLYA 2NMVA 4LF7Q 4YDSA 1G8YA 4YXWD 3T15A 1X3SA 1HPCA 4NPSA 1VQKA 3D3QA 1TWGH 1JNYA 1KL9A 2WIBA 3AP1A 4E5UA 1X54A 3OYYA 1DELA 2WHXA 1ZNXA 4POGA 1U8AA 5KDOA 4GLXA 4EQ6A 2MMCA 5EE0A 3CF2A 1I6VC 2PZGA 1KK2A 2NO7A 5FOWA 2OCEA 4L5QA 4G7ZC 2DPXA 2JAQA 3QXJA 4DV3L 4MKGA 4LF9Q 1UJ2A 3T5DA 2F4VQ 1EQRA 1VQOA 2HXSA 4TTQA 4PPQA 1CBUA 4POAA 5L3SA 3B1VA 1CEEA 5IT5A 1HNWQ 4A2WA 3L0IB 1I4LD 2ZJYA 3QEJA 3TUIC 4A3KG 1SFOH 1YR9A 3TVDA 5FOSA 3LFUA 1W2HA 3H3VI 4OL0A 2KCCA 3RWOA 5IYBG 2DWQA 1R9TH 1OT3A 2KCTA 4ZCLA 5FBWB 5FLMH 4AH6A 1N3BA 4LF5L 1KI8A 1Q3HA 1TNDA 1CR4A 3RABA 1NN1A 3BJIC 3LLUA 2NN6I 1P16A 1P5ZB 4BECA 2OV2A 2BA0A 1OW3B 2V8OA 2A30A 1OH5A 1Z6TA 3VNVA 1D8LA 2HYDA 2CK3D 5KNBA 2W2TA 1N8RC 1VQIA 5LMNW 4KSCA 1Q44A 5AJYA 3SZRA 2OE2A 3U3JA 4XWKA 2IX3A 3WMGA 1P72A 2QNRA 5DI3A 2OTJA 2JLQA 4JMPA 3UIEA 3AVUA 2D62A 3IEUA 4PHHA 2IA5A 4DK1A 5E95A 2CW0C 4TL9A 4M1KA 1YITA 2L0XA 4B34A 1AS3A 4DR3Q 4Y52H 5HKKA 2AHOA 3OESA 3VR2A 2EWWA 4QGFA 4O25A 1XTJA 1OJLA 2ZRBA 2QSYA 4AYBE 1YZGA 4M2LA 1AA9A 4LPKA 4NBSA 1ZNWA 1E98A 2QGQA 4FWTA 4JBJA 1Q86C 3UE0A 1RRPA 2HCJB 4OJKA 1ZINA 4A0RA 1AE2A 4DK3C 3KB2A 3UMSA 2YTYA 3B9PA 2BBWA 3K09C 5KSOA 2A5YB 2WAQG 2G88A 5LD2B 4Q19A 2J0QA 1H8HA 1IW7C 2BM1A 1G18A 3AKEA 3PENA 5KUTA 3GTJH 5M3FH 1C9KA 1Z3IX 2V6IA 4JVSB 4DLSA 4WXPA 4NXNQ 2I1VB 1Y8OB 2W2XA 5JS8A 3MEFA 1J6QA 4NXML 2LKDA 3R8FA 5F9HA 1DPFA 2H8KA 3RLNA 2W2VA 2OQKA 5FH9A 5G41A 5EE5B 5E7MA 3THXB 4HJ5A 3GPLA 2PCFB 4U5XA 2PX0A 2CVFA 5GAHC 1N36L 2ZROA 5H8WA 3KDFA 5EUQB 4A3EG 1P9RA 3U3MA 2QAJA 1XWIA 4DV2Q 4Q9IA 3U60B 3U61B 3RRNA 4LFAL 4US0R 2Q6TA 3EIEA 3W3AA 4MYCA 1E2NA 1GM5A 2F6RA 1I94L 1BIFA 1HE1C 4ZKEA 3VHLB 4EAQA 2VQEL 1OF1A 3EZ9A 2J0SA 1SVMA 3ULLA 2WM9B 4A3FG 2CHGA 4JI3Q 1PUIA 4B2IA 2ONKA 1H9MA 2FPMA 2GXQA 5H1YA 3FYHA 4KVAA 4AG5A 2BOVA 4BZXA 2I5LX 4AY2A 1F2UB 5HCNA 4PSAA 2A1AA 4EPTA 4A0FA 4LBVA 4B2PA 2Q3FA 2IC5A 1NBMD 3DM9B 4K8OA 5AJXA 4A8JB 3U7HB 1G9XA 1XXHB 4AURA 2ZJRA 1HZBA 5HKKD 4UQOA 2C2HA 1HCZA 4M9XA 4L16A 4DEXA 4HJ8A 1E2ZA 1N6PA 3NTUA 5FLXc 2UUAQ 3I5XA 2AD5A 4DNTB 1G5RA 1XNRQ 3DM3A 3CB4A 3VU9B 2N1BA 5G3ZA 5FJ8H 1R7RA 3GJ6A 3PF5A 4UNPA 3NDBB 3I4OA 3AKCA 3LX8A 1ZYRC 1JJ2A 1ZMXA 4X8LA 3ICQB 2D0PA 1YR8A 3K0AA 1OFHA 1T5IA 3CD6A 2C9OA 3DOFA 4JLNA 2F9LA 4AKIA 3W3ZB 4K81B 3M4PA 2AX4A 3BH7A 3NC0C 6Q21A 2ZR9A 5JSZA 2KA7A 2H17A 1YJNA 2IS6A 4IDHA 2HJGA 1RYFA 3QG5A 3I92A 4HZIA 1HR0W 5B64A 1ZUHA 4JG2A 4JI5L 1CU1A 4AK9A 1SLJA 2PL3A 4JI7L 3DDCA 2BMEA 2V1XA 1ZM3A 1KRTA 4DK6C 2ZRJA 1IYJB 2PMZE 4LBWA 2QEQA 4DT1A 2KHJA 2ZRNA 1KK1A 3IILA 4NHOA 2BM0A 2ZRIA 4B6FA 4MKIA 3NIBA 2QMUA 4DR7Q 5DGXA 3TAHA 1E2JA 1NRJB 5EXXA 1SRUA 1Z9FA 2MNAA 2QY9A 2JEAI 3BFKA 5FTMA 4HATA 4PO8A 4XSHA 1VF5C 3HFZB 1A7JA 4IFEA 3PJRA 1TPZA 4HUQA 2Q8IB 3FTQA 3LRPA 5FR1A 1E96A 3X2SA 5TV2A 5JCPA 1IHUA 1E2PA 1G3QA 1G8HA 1E9FA 2WMNB 5F9FA 3IQXA 4ILEA 1CJKC 4UXHA 5TXGA 3TRZA 1G5PA 1AKEA 1E0KA 3LQQA 2E2HH 4DLTA 2KI5A 2Z6KA 3E9IA 4E22A 1S0UA 1X65A 3KJIA 4UXIA 5GJVC 4TZ0A 1CJVC 1P2VA 4A2PA 1KNXA 1S9DA 1RRFA 2CHVA 1ZVQA 2GJKA 2GZHA 4Q9HA 5G40A 4BZQA 3AYHB 4I1VA 1DS6A 2NN6G 4HEJA 4FI3C 4DV0Q 1AK2A 2KB0A 1E7ZA 2CDNA 1SHKA 5B58C 4DR5L 1PLLA 2A5GA 3B7GA 4I1OA 1L1OA 3PEVA 4C0QC 1T0JB 1Y63A 3OTOL 3KL4A 3RLFA 2JA6G 2ODNA 3CPWA 1KQSA 1U9IA 1E2FA 1UBGA 1MRNA 1JB1A 3N2IA 3PO3G 1O7IA 1UEBA 5JJKA 4LYAA 3VR1A 3LA6A 3PR1A 4D0NA 3CUEF 3X1WA 3UKDA 4B33A 2ZM5A 1Z7TA 4Q9JA 1KYIA 1G7RA 2ZRAA 1NSTA 1YJ5A 1YJWA 1HZCA 5KDLA 1US8A 2O8BA 4H13C 5DO9A 3C15C 1QBKC 2Z0MA 4EIWA 3T1HL 4KSBA 4WZAE 1YEZA 2JA7G 3AQQA 4LJ7A 3I73A 4OWWB 4KKSA 3HDTA 4YCVA 3CC4A 1FTSA 2QGZA 4DCTA 1Z63A 1G4UR 2JXMB 1H9RA 4OHWA 1G17A 3S1AA 4Q4HA 1KTVA 4DB4A 1M2OB 2JLSA 5L3VA 3ZZUA 4KLZA 3GTMH 4XJXA 3I61A 1E79A 4L8JA 1PH8A 1ESMA 1R0XA 1ZM2A 2QTFA 1IQPA 2AD1A 5C4XH 2RGAA 4Q7LA 4G0NA 1VIAA 2J87A 3K9NA 2JGNA 1YRBA 4LSGA 3ZVRA 3GJ0A 2GK6A 4KV9A 4Z54A 2IYQA 2N49A 4NPHA 1XJVA 2ZSEA 5JEDA 5JWRA 3EN2A 4CZ2A 1QUQB 2Q3MA 4WOPA 3AUYA 4JS0A 2AK3A 3RS4A 4IFDH 3CRW1 4IJHA 4Q4AB 5JEAJ 3TJZA 2ZYTX 5JMTA 3A7AB 3AM1A 3FHTA 3SHFA 1WCV1 4RD0A 4UKDA 1KI9A 1J8MF 2XEXA 4OONA 3BOSA 2ZJ8A 2L5TA 3R20A 2YC2C 5H68A 5BN4A 1F6BA 1BDOA 1VQHA 3W6PA 2A6HD 2WKRA 5SZIA 1XEFA 2DHRA 3CH4B 3SQWA 4IPDA 4DIDA 4D4JA 1M7GA 4HYYA 3PIRA 5IP7G 3I8SA 2W83A 4MYHA 5JLJA 4GKJL 2PMDA 2ZRMA 1FZQA 4IKEA 1U8ZA 1FTNA 2NVQH 2LMCB 2WJHA 4B32A 5LDDC 3IO3A 2EJGC 2JLRA 2XNDA 2AKWB 2BMJA 4DJTA 4D2IA 4IPGA 3PEWA 2V7QA 4Q4LA 4YMWA 5EJEA 3NEJA 2RGGA 2YC4C 1EG7A 5LMUL 3A1UA 3SYKA 3NBHB 1A1VA 1HE8B 3QXHA 2H16A 2XAUA 2CFMA 3KKMA 2CKZB 1K0RA 3O8DA 3T1OA 4U7DA 5M5YH 1SE8A 5HPYB 4DR2L 3UDFA 2YU9H 2B8FA 1OFIA 3TEHB 2WP8J 3LDAA 4EJSA 4C0KA 4ZCIA 2GJSA 4RFVA 2A8VA 3QJYA 5LMNQ 1NKSA 2D3WA 4C0LA 1X56A 1K8AC 3CQZH 3RZOH 4GNKA 3QPWA 1CSPA 3BZCA 1HTWA 1GP2A 2JJ2A 2GVBA 4TMWA 1E79D 1L2FA 1YVCA 3HPRA 3CRLC 2OSBA 1Z0IA 4OI4A 4Z8YA 1G8GA 3FMOB 1OXVA 1N0WA 1R4AA 2KJQA 4OX9L 5FUYA 4LBZA 4C0BA 4X64L 2R93G 2GILA 4EPYA 1Y8NB 1UEIA 2FZLA 3P20A 1UWVA 3H86A 1W1WA 1VPLA 3NEYA 4ITRC 4KXFB 2GCOB 2HJVA 3TLXA 1YIJA 1KHIA 4ARZA 1SVLA 4LF6L 3HPQA 3S1MH 4L15A 5G53C 1Y1VH 2FFQA 4KFTA 3OPOA 5KYKA 3THXA 3IHLA 3K8YA 1CR1A 1HNZQ 3MUFA 1I6HH 4LWZA 1Z0KA 4LCBA 4QJ5A 1AS2A 3SBEA 1XMIA 5JBQA 5E7JA 5FPTA 1Q12A 2O5IC 2N78A 4OI2A 3MLEA 5DNYB 5DLQE 2ZXUA 2P6NA 3CC2A 1KC8C 4B3ML 4LV5B 2JA5H 5CIWA 4D4LA 2ZSDA 5IY0A 3KXIA 4UJ3A 1R5NA 2JATA 3WP1B 4GOPC 2CXXA 5IRCD 4HIMA 4O0AA 4A3GH 2R7DA 4UP8A 2XNDD 3WRXC 2VH5R 1E2QA 2FE4A 1EIYB 1S40A 1Y8PB 4LF4L 1KAGA 1ZAKA 5JWHA 2XXAA 3HOZH 1SHZA 3NKVA 2WJGA 3VR6A 3P27A 2J5XA 2DGYA 3A4NA 4OYHA 5IT9c 5K36G 1NN5A 4A3DG 1W4BA 2K5UA 3KUDA 4RCNA 1CJMA 3D31A 2CNWD 3L0PA 5IWAL 4JI4Q 3TK1A 1SN8A 5BYKA 1FOEB 1XEXA 1W4AA 5DLQC 4A75A 2X19A 2HQLA 3GTQH 3HOVH 1DOAA 2BWJA 4IJMA 4A2QA 3U44B 1CRPA 1LB1B 1K5GA 4DB2A 1G3RA 4JKYA 4C3ZA 2DUDA 1KK3A 3V9PA 3RRYA 1WA5A 2JJ2D 1N33L 4JLJA 2FNAA 3N70A 4XWAA 3A5UA 1H9JA 2XZOA 2K14A 4A1FA 1XFAA 1RC8A 4FMBB 4B44A 3PIOA 3CX7A 2AWOA 2K5VA 3OEHA 4FCTA 3BGWA 3PVSA 3RS7A 4R7ZA 1D9ZA 2WWIA 1H9KA 4JVNA 4JI5Q 4A6PA 2NVXH 4RZ3A 2GA8A 5DYGA 3T1YL 2JIZA 3U6KA 1BH2A 2UUCL 1JQJC 5C2JB 1ZC3A 3BH0A 2HDNB 1XMVA 3ZVNA 3F2DA 4DV4L 3CW2A 2BE5C 1YHAA 3J7ZC 3UPUA 4EQ6B 1GOTA 5JEAG 2HXYA 1PH6A 1CTQA 2YOFA 4NCHA 2R7ZH 1CR0A 1TF2A 2IS1A 4M53A 1EYGA 4LUOA 4BFZA 2QF7A 2QAGA 3L8ZA 4Y7NH 4ZI2A 2J3EA 3B1ZA 2NZJA 2Q9AA 4KYUA 5JJIA 4IOMA 4OI1A 1E9AA 3VHXA 2UZ3A 3HU1A 1KY3A 3CCSA 2FPLA 2OILA 3H1TA 2VTKA 4DKXA 1W5SA 1XMOL 4R4OA 1VQLA 1BMFA 1BYIA 1EFHA 1JJVA 3I1FA 4PSVA 3ZJYC 4QHTA 1VG8A 2FGKA 4PZLA 4MTNA 3B1YA 1MT0A 1YRAA 3WYGA 1XP8A 3W6OA 3NH9A 5TMPA 1A0IA 1E2KA 2GN5A 2I3BA 3QNUA 3EZ6A 4IPCA 1ZKOA 4UP9A 2QMEA 3OOCA 4YY3L 2WAQE 2HUPA 3T1QA 2IYLD 4P75A 1KI3A 4TKOB 2MMGA 3U3OA 1VG0B 3OZXA 2FX3A 3RWMB 4B2LA 4DR5Q 3AVXA 3LWUA 1BBWA 2ZTEA 4QBFA 2O0HA 3HGBA 1KD1C 4GZLA 4DKAC 4KBGA 5EZ5A 4AC9A 1NBWA 3OTOQ 1VG1A 4GKKL 5EE3A 3IEVA 4HAVA 3H2YA 2AHOB 3SJBA 5IYDH 3BDOA 4A6XA 4CRWB 1XMJA 4QBIA 4PG3A 3OIUA 2ZTCA 2JEBI 4OWTB 2CVHA 3NHAA 1JI0A 2OFOA 5FLMG 2ZJAA 2EJFC 4B35A 1G16A 2F1HA 2DFTA 1V5WA 2D5DA 4LJ5A 3LWNA 2NVTH 4BBSH 4IVQA 4QQBX 4QNRA 1PMRA 3HU2A 4A3BH 4LFCL 1A2KC 3JC66 1NI3A 2R44A 2R6CA 1IBML 2ZS8A 4Q21A 4TWZA 3T1HQ 2CE7A 4UNSA 4DV5L 1L4YA 5K8TA 2JIZD 3BORA 1OYYA 3ZYCA 2Z6KC 5GVRA 1G1MA 4P33A 1UDWA 3HOXH 3L0SA 3QY0A 4HB2A 4Q02A 4LC1A 1QHGA 4FMDB 1B70B 3X1DA 2OXRA 2Q21A 4AQYQ 1H8ED 4EPXA 1UFQA 5KNCA 2V6JA 1WCMH 1Q82C 2FDCA 5KOYA 1WBBA 3ZZ0A 1L1OC 4MQBA 4OJQA 4R4CA 4KKTA 2LSSA 4NDZA 4K46A 3ZIAD 2ASBA 1KSHA 3CZPA 1U9IC 2EW1A 3I8XA 4O2LA 1HH2P 1BMFD 3RN5A 3RHFA 2K4KA 4V0MA 2YNMA 1N34L 1KZ7B 2CBZA 3QI2A 3PUYA 1GSIA 1W48A 1QHSA 4QM7A 3JVUA 5L3RA 5GADl 2HYIC 3CRQA 1KJYA 3TQYA 1F60A 4GOJA 1Z6HA 1TUEA 4XD7A 1KKMA 1T3LA 5M3FG 3J80c 2OBNA 1LV7A 1OV4A 3KKPA 2AUKA 2IYZA 4I4LA 2IX1A 4PANA 5AJWA 4LHVA 1XRJA 3X1YA 4D4MA 2QBYB 2F1JA 5FPKA 3X1XA 5AUPB 2ZE7A 3ADDA 3U3RA 4NKRA 4CF7A 1EESA 1SZPA 2OWOA 4M0LA 4UY8C 4LJ4A 1XD2A 3OF5A 4IOJA 4V02A 1G291 1E2GA 3LH5A 4CT4B 4MDEA 3G5UA 1WB9A 1LACA 2BBTA 1ZU4A 2QPAA 4GKJQ 4IFDI 1EIFA 1XPRA 1XJQA 4GNXC 3SFVA 5HR5A 2XB2A 1B9NA 2QRNA 2BMDA 2ZUDA 4TN1A 2ZVPX 1QHYA 3LO5A 2WKQA 1S1CA 1NVVQ 4LUCA 3P1JA 1B23P 2ATVA 1OSNA 2F3RA 2WJIA 1DD2A 4M22A 2ZT9C 3PF4A 1Z47A 1S3SA 1PH4A 2ANBA 4P4SB 3AKYA 3BFXA 3EG5A 3QE0A 4JT4A 5GJBA 4HAXA 4O0MA 3KJHA 1PYSB 2NVYH 4JBKA 1U0JA 1AE3A 4NYJR 4BUJA 2I0QA 2CE2X 2GEDA 1ESNA 4MKFA 2HLDA 3AF1A 3BWDD 1E0SA 3G6EA 1PV4A 3ZVMA 1XD9A 2FGJA 2UXDL 5L8VA 1KI7A 3G48A 2ZANA 2IYSA 2VUMH 1F5NA 4JI2L 2Z4RA 4C30A 3OE7A 3PEYA 1LS6A 1Q1QA 5M3MH 1IBLL 1TAGA 2HV8A 4X64Q 5FBQB 3THYA 3ZH9B 1UE7A 3JAMc 2OAQ1 4DT1B 5IDVA 2GZAA 2IXFA 5FOUA 2HT6A 1DXMA 1GD7A 5FJ8G 1Y1WH 2G0TA 4Z51A 3D8BA 3PEUA 1UE5A 1DAGA 2B63H 3AVVA 3W8RA 4LF6Q 3CH5A 1ZRHA 4GP7A 4B3SL 4QGUA 1IYVA 3SE0A 1HY3A 4AG6A 1NE3A 4EPVA 1DARA 5HTKA 4HUQB 4L5SA 2P65A 1P4SA 3TSOA 3CXCA 3I5YA 1CP2A 4MKHA 1XZPA 3AFPA 3K53A 1ASYA 1FP6A 1KOFA 5FBLB 4TYWA 2JDIA 1YZ6A 2ALYB 1AJEA 4QY7A 3VR5A 5FPSA 2QRZA 5BN5A 2K52A 4B3MQ 2EFHB 3AV0B 4B47A 1NKTA 2QP4A 1TF5A 4OHVA 3IIJA 4QL5A 1GKYA 2V1UA 4KVGA 3R8CA 1Y69U 3QEOA 5IHPA 2RGNA 4TYPA 5L3SB 4QM6A 1PH1A 4JSYA 3ZD6A 3GLIB 1X1RA 4HB3A 4A4DA 4TL6A 1OKKA 1AZTA 4LF4Q 5AR1A 1EWRA 3W1BA 4PPGA 4OK5A 4TLEA 4TYNA 3HYTA 1IZ6A 3CMAA 4A3IH 4OBEA 1L1OB 1Z0DA 4JYBA 4US2R 3J7A5 4DAMA 2NO1A 3A74A 1Z28A 4QFMA 2QTHA 2ZI6A 1N0UA 4IOKA 4NP6A 4BA2I 3EWAA 5DISB 4EUNA 1Z08A 2H1LA 3NELA 3QF7A 4KFUA 1DTSA 4NE2A 4C0SA 3A36A 2A6ED 1PA6A 4PHFA 2G9NA 2HLDD 4WBSA 3M1IA 1FX0B 3PXGA 4HB0A 4R98A 1TWAH 1YBYA 1N33Q 3PO2H 2IYVA 5CJPA 2O8BB 5J4YA 2ZSBA 2I5HA 5AWFC 1DADA 1NJGA 3A1VA 2YV5A 1Q3TA 2ZR7A 2XOKA 1OH6A 3UDXA 4IOLA 4QG7A 4HZUA 2WVJA 3H0KA 4P0TA 4GMXA 2GWHA 2REXB 4BZPA 1MO5A 3KX2A 3S1AB 4Q4HB 4DK0A 4V0LA 4DSOA 3IIMA 4C0JA 1DAFA 4EFLA 2EVBA 1VTKA 4KKUA 1UKZA 3I32A 2XITA 1RYHA 2UUCQ 2CWPA 2EFGA 2J41A 3HWSA 2VBCA 1YNXA 5AJVB 2WFWA 4DV4Q 1VQ7A 1HURA 3UWOA 4URZR 4K0KL 3TQFA 1ZIPA 3VDYA 1CIPA 3MGCA 4PZZA 1NL3A 5FL7A 4A8JC 4BA1I 4FINA 4DDUA 3QSYA 3S15H 3C8UA 1W0KD 3MJRA 3P32A 2JDID 4F91B 4D0GA 3QKRA 1CKOA 1RZ3A 1WYDA 3CONA 1M1KC 4ABYA 2HEIA 3AF2A 1P2SA 4IVRA 4JI0Q 3JZMA 3CIOA 1R6BX 4DUYL 1Q57A 2B6HA 2CCKA 2PI2A 4X66L 3GLHA 3OAAA 4PC7A 2EXDA 4ZIRB 4G5OA 5GAGC 1IN8A 1Z06A 3AFQA 1KSFX 1G7CA 2FEMA 3WHKA 4O3MA 4GP6A 3TSWA 3M7NA 1KSJA 1D6JA 1R5OA 1Y14B 4AIIA 1OKKD 2ZRCA 4JSTA 4ZKDA 3KYHC 4B3DA 3GJ8A 2IL1A 1KO8A 5C4XG 4JLOA 1SVKA 3HR7A 3EZFA 5TDHA 1V8QA 2YTVA 1I4DD 2CL6X 4YY3Q 1A5TA 4URUR 2BJVA 3T34A 1ZM7A 2K50A 2GXSA 1JBKA 2XTNA 1Z2AA 3FMIA 4GN3B 2FA9A 2VO1A 1NY6A 4IFDG 3S14H 1YNNC 3U4ZA 4BXXH 4JV5L 1BS1A 1S4QA 3GCGA 3UMRA 1UE6A 2VLIA 1TL7C 1UKYA 3EBEA 2ZTSA 4GKKQ 2ZU6A 1XMSA 1NBMA 1E69A 1GJXA 1JR6A 2P3SA 1G3IA 2JLXA 4QNMA 2XOKD 3TS2A 3N6RA 1QZGA 5FI0B 421PA 5C46F 3HOUH 5KPDA 4W9MC 4DRZA 4EJSB 3K70D 4LUVA 3TNFA 2XGTA 2R92H 4HLQB 4WA7A 4LFCQ 2X8AA 4B6EA 1F48A 4DLZA 1IBMQ 1XTRA 4Q9KA 1N6IA 2B8WA 3PITA 4H1VA 3LVRE 1G51A 1KIXA 1A2BA 1I2MA 1NMYA 2IYWA 2QENA 3DZDA 3KTAB 2FXQA 4M1TA 2BHRA 2IUSA 4NYJQ 4LK1C 2GKSA 5GVSA 3GDEA 1HTPA 1NJIC 4JBXA 2VY3A 4HLUA 4V0OA 5FL7D 4AD8A 3U4QA 5J3BA 1IXZA 3REFA 3I3SR 5EXTA 4EDHA 4Q1FA 3IO5A 3EPKA 4S35A 3O8CA 1Q46A 2OCYC 3DXJC 4Q66C 3TMKA 4ARZB 1XZQA 4JKIA 2GNOA 3HP1A 4R4IA 4II7A 2A69D 2A9KA 4Q4JA 5CM8B 4L8GA 3PUVA 1Z6AA 3OAAD 3AP2A 2J59A 4IOCA 5B57C 1OB5A 1KZGB 4NTZA 3AF0A 3BXZA 3FKSD 1IYUA 3ASYA 4IDQA 4JVMA 4TT3D 5EP1A 3B6YA 3NE5B 2N8NA 5AJ3L 4Q7MB 4BRWA 1YZKA 1I2DA 2GEVA 4HI0E 3S24A 3M9BA 3LD9A 4JYAL 1F2TB 3EA0A 5CB8A 2KE5A 2J45A 4V0ME 1GRRA 2JQOA 4HAYA 3EPLA 4D26A 1NF3A 3S1QH 1IN7A 1XEWY 2KBEA 3BBPA 5HE8A 2QBYA 4JI1L 5C44H 4P4TA 4JJKA 4RCYA 1XMQL 1K9MC 1G20E 3FVQA 1Y1VG 3QOFA 2XXAB 2P6RA 3Q5EA 3KKQA 3CPFA 1PFSA 5C18A 3TUJC 3BG3A 2O8CA 2XTMA 1QVRA 4ALPA 1FJGL 2GVAA 1XEXB 1N0VC 4A93H 4GN4B 4RCZA 4FD2A 4KLKA 2JA5G 3BERA 1IXRC 1EFRA 1EK0A 4LYHA 4R2IA 3MWLA 4L9SA 3NG1A 4D6PA 4HAZA 2GF0A 2A78A 4P4SA 2BV3A 2OFWA 2JE6I 4A3GG 2GJ9A 2RHDA 1QZHA 1DGSA 5GQOA 4D81A 1AGPA 5CITA 2A68D 3HOZG 1QHHA 2ORIA 3G0HA 4D0LB 1D2NA 5KNDA 1Y3AA 2G77B 1W47A 4JYCA 2F3IA 4H02A 1W2BA 2YVUA 3L2OB 3EC1A 4Z8XA 3A6PC 3I4NH 1Q1EA 3BE4A 5SZKB 2MSCB 1XTSA 4JI2Q 1N2CE 2EYQA 3EIHA 3D6TB 4ZO4A 1B8AA 3QQ5A 1IBLQ 3KJPA 1JT8A 1OIXA 1LUZA 3HOVG 1TEXA 3IPYA 1WRBA 2BIFA 5C4MA 2E74C 1K8RA 4QL3A 1W7AA 4H9GA 2Q2IA 5D3QA 2C35B 1PJRA 4DEYA 4IPHA 3A0JA 1DAIA 2QAGB 3VMFA 1AKYA 2IEYA 3A1TA 1EFTA 4IHQA 4B3SQ 2P67A 3OEEA 1H9SA 4QHSA 1VDZA 3K81C 2MO0A 4BY1H 1YR7A 5HY6A 3A7LA 4Q48A 4LDJA 4XVUA 3CM0A 2WSSA 4QJ3A 1DG1G 3EX7C 1IN4A 2UZIR 4N0EA 4Q1EA 1RIPA 4KHZA 3PUWA 4GBMA 5LPNA 1PYBA 2ATXA 4TYQA 1N6NA 2FF7A 5CLQA 2GDJA 3WXMA 4PXAA 4WVFA 3NBFA 1E9BA 2MQHA 1E3MA 1KDPA 3DKVA 1Q21A 2Q3HA 2CJWA 2WOOA 1ETUA 2EVWX 2R7ZG 1ZCBA 3LW7A 3RZDH 1VYTA 3ECCA 1QVCA 2IBMA 2K5HA 4LY6A 2K5NA 3KF8B 1RL2A 3X1ZA 3GLIA 3LNNA 1FL0A 2E87A 1GZSA 4N0DA 1EFRD 1L7VC 1COWA 4B3GA 4MRVA 2ZYUX 2ZRKA 2ZUBA 3VX4A 4ESHA 1UKEA 1VQ4A 4BLOA 3BC1A 4F4JA 4L9WA 4NYMR 1E2WA 2ZJ2A 2PJZA 4KHPL 3PFIA 4A0HA 1GVPA 1GKUB 1ODFA 4NYIR 4EFNA 1DAEA 3PV0A 5C4JH 2EFEB 1W36D 1ZUIA 2ZEJA 3DHWC 4GRAA 4ME3A 4LGMA 5DHAA 721PA 4KFSA 3BAFA 1UBCA 1WF3A 3FFBA 5A0FA 1FX0A 1CSQA 1OIWA 4EFMA 2D2CC 1GFIA 2ECKA 4DV7L 2OUKA 1NMFA 2VPPA 1YJ9A 2YYZA 2GETA 4L5TA 2O0KA 3MAAC 5JI2E 3BJUA 4IO9A 5L3QA 3KKNA 4QBGB 1M8PA 5EE9A 1OH8A 1N5LA 2RGNC 3GFTA 3KF6A 3CC7A 1G41A 1R5BA 2UXCL 2J7KA 2RGDA 1FQKA 1O7LA 1Q1ZA 1N6RA 2B92A 3NVAA 3Q3JB 4FMCF 1E1TA 5IYDG 2P2LA 1FYCA 2RGXA 3LW8A 3W1GA 3WP0A 3HKZG 1RFLA 1SVOA 4BLSA 3OEED 5AUOB 1NN0A 2W6JA 1KDRA 2PQAA 4IJLA 4K0KQ 1RW4A 5E4FA 1FNNA 3VKHA 3CCLA 1ZD8A 1JXOA 1CKNA 3S16H 4IQZA 4BBSG 1WE2A 2WSSD 3LNCA 4GLAC 4A3BG 2W0MA 4OQMA 1IJFA 2KCMA 4Q03A 3SJZA 3VAAA 2PT7A 1IY0A 1CUKA 2QQ0A 2IYTA 4KFRA 4DV3Q 1M90C 2F43A 3K0EA 4CT5A 3S17H 5HE9A 3HOXG 3K0CA 1P75A 4F7WA 4X66Q 4JLAA 1NMGA 3THWB 4DR6L 4AIMA 4IXNA 5JEEA 1S1MA 2GF9A 4ZIRA 2EU8A 2X2EA 3U9SA 4BFVA 1WCMG 3GLHE 2PI2E 2E76C 1PH9A 3I4LA 1O3YA 1XD2B 1ZD1A 2VHCA 1E1QD 4YMVA 3U7FB 2R6GA 2Z4SA 4LF5Q 3IIKA 2H5XA 1COWD 2AXPA 4D4KA 4QRHA 3GJ3A 4DUGA 3M3YH 4Q5IA 1XF9A 2ZJBA 2QI9C 4OO1H 1YZUA 1DCZA 2REOA 2IHBA 4X6AH 3W34A 2QPOA 4JIMA 4JV5Q 3WBKA 2Y0SG 1Q90A 3GTKH 2GVZC 2Z43A 3MMPA 4JBWA 1NY4A 3F2BA 1KI6B 5CYOA 1B0UA 4JJZA 3SYNA 4QKQA 1R0ZA 4UNRA 3L7ZC 3UATA 1IM2A 2H18A 3HOYH 1Q22A 4APVA 4WZ6A 1A4RA 1HYQA 4JI8L 2GCNA 5DIFA 1GITA 2A69C 3KDSE 3NDPA 4BQSA 5IE8A 1QHIA 4B3FX 2QT0A 4OQFA 4JLPA 1NBME 2ZM6L 2CNWA 3M0EA 4CW7A 2YJTD 2RHQB 3W5IA 4MRRA 3WMEA 2R6FA 4ZV4A 4YCWA 4EQ5A 3B85A 4NL4H 1JE5A 1HZAA 4Z1MA 3G71A 4C2MH 3CPJB 2AFIE 1E0AA 4FMDF 4ZI3A 1T5LA 3E0EA 1NVWQ 2W6JD 3KTAA 3J81c 4M1YA 4M9ZA 1D9XA 2C03A 2ZI5A 3THYB 3I2ZA 1E1OA 4PPFA 4B76A 2IS4A 2W58A 1KK0A 2ZS9A 2EQBA 4YMTA 1KI1A 4M4SA 5JZVA 4I1UA 3HKSA 2WKPA 2RF4A 3DLLA 4RVCA 4V0KA 3JZAA 4BASA 3ASZA 4NXMQ 2ZUCA 1VQAA 3K7AH 1XB2A 3K8AA 4MUBA 1PH2A 1R0WA 1XPUA 3DMNA 2YINC 2BCJQ 1VECA 2GCPA 3AKDA 1N36Q 1C7YA 3S2HH 1GNPA 3NBYC 3FPPA 2P5SA 3KUCA 4LFAQ 2Z5FA 3ZGXA 4C4PA 3U5ZB 3M4OH 2VUMG 3CPHA 2WJJA 3DEFA 1ZNZA 3TR0A 3STBD 1TQDA 4JYAQ 5TB5A 1OXTA 3ULPA 3RLOA 2ASEA 3PUZA 1U5KA 5M3MG 1I94Q 1HNXL 3EIQA 2VQEQ 5FPYA 1IJEA 2Q9BA 4PX9A 5CDFA 3WRYC 3ZZTA 1OXUA 2B7BA 4LUZA 1F2TA 1XD8A 1GKHA 3NBXX 2VP9A 4IXMA 4DUGD 1QVFA 1Y1WG 4RY2A 2V1CC 2WICA 4JI1Q 1PLKA 4CEHB 1DO2A 5UKDA 2NZ8A 3SQXA 4TZ6A 2B63G 1MO3A 3LAWA 4LYFA 1TU2B 5J4KA 4G5QA 2R6AA 4LWCA 1XNQL 3HOWH 4HLUC 5EE1A 3WNBA 1C0AA 1ZNYA 4XH9B 4KODA 1KI4A 4C3HH 1M6NA 4P4UA 2DBYA 3CPEA 3FPAA 3SJAA 2NIPA 2FH5B 3EIVA 4LV8B 4JL8A 3AH8A 1V9PA 2C04A 2EIFA 3BB1A 1GRNA 5JFGA 1E2LA 1CR2A 1FJGQ 2F1RA 1ANKA 1J70A 2JLWA 2R6DA 4HAUA 1I4TD 1MO4A 3CMEA 4DV6L 1AGRA 5ELNA 2OEPA 2R9VA 3K0FA 4MITA 4PQYA 3VQTA 1KKLA 1A8VA 2VHJA 1X6OA 3PIPA 1JALA 2DFNA 2IHFA 2I1QA 5KSYA 1M7HA 4Z1MD 1B9MA 1GIAA 3MXUA 1EWIA 3LV8A 4RZXA 4F4CA 4C2TA 1LS1A 3KLWA 2RAPA 4BFYA 1SR3A 5JS7A 4M21A 2VNUD 1H95A 4HZUB 4XOIA 5FOXA 3IPXA 5KSZA 3K70B 5BXQC 4AYWA 4A3IG 5CJ2A 3J80i 1IBKL 3K0XA 2OLJA 1VHTA 3BB3A 3B13B 3GLFE 3AB9A 3C5HA 1KJZA 2VL6A 4HAWA 2QM8A 3IBYA 1FUKA 2TMKA 2YWGA 4YWKA 4MYUA 4DDTA 2OCBA 4PPNA 3CCQA 4JI7Q 1IXSB 1ZP6A 4Y0VA 3C14C 2KBNA 1ONBA 3W5OA 2BMFA 1XNJA 2EFDB 2FG5A 2BC9A 4RD6A 5JJLA 4DDWA 3KKOA 3CNOA 5B30A 3PO2G 3TH5A 2R65A 5GAEC 3WYAA 3TSZA 2KHIA 3QKRB 1H8EA 1Z0FA 3T1VA 2IUTA 3EARA 1P60A 1CJTC 2GXUA 5E3HA 1GVNB 4ERNA 4P74A 3UDIA 3RVBA 3GLHB 3Q8XB 3UE1A 4DSUA 1TU3A 1MKHA 2E1RA 2VA8A 2Z83A 5BR8L 2GAAA 2QP3A 3ZIAA 1WOCA 3QVVA 1DE0A 1W4CA 3H84A 2C99A 4NCNA 1ZD9A 4OHYA 4PMWA 2I5MX 2CLSA 4LF7L 1EOVA 4FCWA 3T5GA 1WDTA 4JLDA 3KZ1E 5ELOA 1E2IA 2PZEA 1F3OA 4FWIB 4HR7B 1N5KA 3IKJA 5H70A 4AKHA 3U7EB 1KRSA 4DUZL 2J7PA 5BYJA 2QE7D 2QROA 2B8GA 3AVWA 4DHEA 3ND8A 3QUSA 1T5EA 2IYXA 2D7DA 2ZI9A 2RHSB 1JJCB 1VQBA 1OTCA 1ZCAA 2J0UB 4IDOA 3T06B 3GLIE 4D25A 3NHBA 2ATWA 4DLVA 4FW9A 2FSIA 4RD2A 1E94E 3I7FA 5CIQA 1EFWA 3T51B 2UKDA 1VF7A 3B60A 4W7SA 2R7FA 4HB4A 4WIAA 2ZJOA 1XU4A 3QXSA 1OIVA 1P7CA 2L15A 5ANRB 4DLWA 1NMZA 1MABA 4DV7Q 2IY5B 4JLMA 5DN6A 3VTKA 3I72A 1E9RA 2ZSAA 4MH0R 1IOZA 1LTQA 1RRCA 1BBUA 4R9UC 4BXXG 1JECA 4TMXA 3K7UC 3GJXC 3CCVA 2OO7A 1VQCA 4C7OA 2CL7X 2UXCQ 3OHMA 3U4QB 1ZM9A 1YQTA 4AYXA 1KGDA 4R1JA 2JA1A 2O8EA 3GTGH 2C9CA 4E03A 2K7VA 1KAWA 3CZQA 2A6HC 3E2IA 3HOUG 1NVUQ 4DR3L 3CCRA 2DFKB 5IYCH 4Q4JB 4JVLA 4LFBL 1R0YA 1WJJA 3WNCA 1SMYC 2R92G 2QTVB 2WIAA 3S2DH 1GG2A 2ZI4A 2ZI7A 4N1AA 4PHGA 1OFUX 1RIFA 3QVUA 4P71A 1IN6A 4JZKA 1SULA 4E07A 4ZCMA 4BBRH 4CEIA 4B3BA 1QF9A 3PQCA 3SN6A 4PZ8A 1X8KA 3U50C 2IX0A 2E8GA 4X62L 4A3MH 1KI2A 2P5TB 1XCPA 3T12A 4OQLA 5K8UA 1QG2A 4LC0A 1V1QA 3CBQA 1E2MA 4JLBA 2J7PD 3THWA 2W6ID 3EQLC 4OHZA 4NXNL 1T8UA 3G4SA 4G5RA 1FMJA 4A3CH 3CX8A 3B1WA 3GTLH 4PZYA 2NGRA 3ERSX 4B3TL 2ZPTX 2O8CB 1XEWX 2OCAA 4BE7B 5JHHB 5KDDA 2ZE5A 3I4MH 5HZHA 3KQKA 3G82C 2BVNA 3RAPR 2QUZA 1RJ9A 5D3MA 4B3CA 1T3SA 2O8FB 1M7BA 1KAOA 1MKYA 4OWXB 2X77A 3QXCA 1KI6A 2IXGA 3SJCA 3NENA 1NVXQ 5LMUQ 1RKBA 1TF7A 1TXYA 3QKUA 3RS3A 4JI3L 2BBOA 1YZNA 5C44G 2CMKA 5DN6D 4GOKA 4XWOA 3DMDA 3K0CC 4QGGA 2O8DB 1GUGA 1YU9A 1R8SA 4IFDJ 3KFVA 3GLFB 4DVGA 4DR2Q 4OO1I 4DR1L 4LHWA 1QHHB 1W4RA 1LW7A 3IGFA 3K9HA 2ZJPA 2HF9A 3IQWA 3LLMA 3T56B 3P4YA 4LK2A 2P6UA 5K8LA 2N46A 2A19A 3TKLA 1T8TA 1P73A 2ZRPA 5KPJA 1G6HA 2VEDA 5P21A 3SEAA 1IBRA 4HDOB 3TR5A 4JC0A 1SGWA 2HIXA 4A93G 1UDXA 2F3TA 1R2QA 1ELOA 1AN0A 2G83A 4MA4A 1VCIA 4OX9Q 3FKQA 3RRZA 1SKYE 1W49A 4Q18A 3RYTC 1J8YF 3VR3A 3W6NA 1W2GA 1EWQA 4KAXA 1W5TA 3B78A 3U2QA 2C8VA 1VYVA 1H9SB 1S9HA 4R2HA 5J5CA 1M34E 3ADCA 2QU8A 3A4LA 1OFTA 4X8MA 1ONLA 2NG1A 4XVRA 1Z83A 2VQSA 2ORVA 3I4NG 1MOZA 3U3KA 1VQFA 1X6VA 1XJCA 4GSYA 4PHTA 4Q1DA 2FEOA 1D7QA 1W0KA 1HNXQ 3E9HA 4UNNA 4EJSC 3C16C 3ZD7A 3REGA 1NLZA 2ZE8A 2VHUA 2AWNA 4QXAA 4KN4C 2F52A 2CJWB 2ZETA 4PV1C 4G7OC 1P6XA 1SVWA 4NZYA 3MXNB 3H0GH 2WAXA 2OT3B 1W46A 5EP2A 5CDFE 4BLQA 2GJAA 4CEHA 5TVKA 2XJ4A 4PSKA 4ASUD 1KDOA 1M74A 4BY1G 4DR7L 4P32A 2FJUA 4LJ8A 4QBHA 2PEYA 1ASZA 1G4AE 1CF4A 3KJGA 2BDOA 3HKZE 1S72A 3TZUA 4RKEA 3FMCA 2WWYA 4MRPA 2V9PA 1E2EA 3M4QA 3FHOA 2A5JA 1C1YA 5IWAQ 1U2RA 4HJ7A 4IDPA 3AVYA 3QG1A 1FPMA 3GFPA 3D0FA 4TMKA 2R62A 5GJCA 5IF9A 4DR4L 2WB1G 3L8YA 5F98A 4N3NA 1BKBA 4G1UC 1CS4C 1ZM4A 2K33A 3OIYA 3GLGA 2YOGA 4DCVA 3CRMA 4OQXA 1E1RA 4NCKA 4Q7KA 2NPFA 2QMHA 1FVIA 1VMAA 4LBYA 3A8JE 5L3QB 1LABA 1CRQA 1GUAA 5C3EH 3RSOA 1IBKQ 4DV0L 3KB1A 2HHHL 3IHWA 3KF6B 2RGBA 3T61A 1VQDA 1P9NA 1Z0AA 2BBSA 2QSZA 3C41J 5HGQA 2Y8EA 4JL6A 1X1SA 4BRUA 3MG9A 3CCJA 4YONB 2E2JH 3B8HA 4M1WA 2FFAA 1NNEA 1T3HA 2FMXA 2X1VA 2DYKA 3T1YQ 4FN5A 2XZLA 2PQAB 2RH5A 2GVDC 4C2UA 1QG4A 3FHCB 3DL0A 3THOA 3UG7A 4D82A 2VSOA 2WWFA 3LBHA 1CKNB 4PC6A 3Q8DA 4IEEA 4DCUA 1GL6A 1T91A 1P3JA 3SOPA 2F55A 4A3LH 4MGKR 3RC8A 2J9RA 2Y0SE 4DXAA 1OLOA 5K8IA 5H1SE 1NY5A 2E9SA 1IAQA 1II0A 3AUXA 2F43B 4KLNA 1E9CA 4KO8A 2XJ9A 3CWQA 4U02A 5DE3A 3R9XA 2XNSA 1FGUA 1J5EL 1E22A 1RPZA 1YE8A 2YZ2A 2CCJA 1B7YB 3K0SA 2QG6A 3QIAA 3MWKA 1XMOQ 4POFA 3RNUA 3IDQA 5FUWA 3K80C 3FKSA 4P73A 4TT3A 2IWHA 4P31A 2XGJA 3VA7A 1HZ9A 2V4ZA 1TEVA 2XTIA 4A3JH 2ZI3A 4GZMA 5CB6A 5ELXA 1C4OA 1IN5A 4YHHL 3RS5A 4O2DA 5JRJA 4NONA 1GL9B 4CGZA 4DUZQ 4L5RC 4NMMA 3B6EA 1P2UA 2ERYA 3CP0A 3GTOH 1II9A 1Q20A 3TW4A 3FDIA 3QKSA 4DWJA 5JCZA 1SXJA 3CW2C 2JA8H 4JOIA 1YHNA 4DV1L 1E0JA 5CLLA 3TW8B 3ND9A 1AQUA 2JK8A 2GJ8A 1AH9A 1MO6A 1XDBA 1JAHA 3HU3A 5SZHB 2IWRA 3RSLA 2OLKA 3VX3A 1U98A 2QAGC 1P61B 1D2MA 2J0UA 4D80A 2MFIA 1E1RD 4QHYA 5LB4A 3EZ7A 2BKUA 3MSXA 5GJWC 5TARA 3BRWD 4MZ9A 4C0HA 4GS3A 5KTYA 2HIVA 3KOJA 3GJ5A 5IP9H 1VQMA 1ZJ6A 4MRSA 2IEZA 2ZS7A 4Q1AA 4NCJA 1QZXA 1OPXA 3LXXA 1D2EA 1N6KA 1FMLA 1Z29A 2AFHE 3UG6A 4OO1G 1X86B 4MRNA 1V43A 1SKYB 4TMVA 3ICEA 4DV5Q 1SVSA 1JR3A 2XSZA 1Z8FA 4R4TA 4LHZA 2IHYA 4Y0AA 1DVRA 4YMUA 1XCGB 5KHOC 4NB3A 1XX6A 2IYUA 1QDEA 5CK5A 1NLFA 4RFSA 3HOYG 1E4VA 2ZRLA 4MGIR 4DCNA 3A1SA 2N42A 1ZUNB 4WJ4A 1G21E 4LPSA 4QJ4A 1G64A 1KIMA 1JEEA 2SHKA 2PLFA 3OIVA 4LFBQ 1FL9A 4LHXA 4M9SA 1P62B 4X65L 1I3QH 2EYUA 2NZHA 4EKDA 1I5FA 1E2HA 4HIOA 2P0EA 5FTKA 4HLDA 2EQSA 4OKSA 5EUMA 2B8TA 5LMNL 4H1UA 4TLAA 4ZDJA 1N34Q 2ZVQX 4WZBE 4LJ6A 2VSFA 4RZUA 3ZQJA 4EPRA 1RRGA 4X62Q 2E75C 4GOPA 1JQLB 4LOAA 3SYLA 4I99A 4TLDA 1MJEA 1ZU5A 2Q0HA 1GTVA 3TUZC 2YHSA 2ZR0A 3AGPA 3KXKA 1S8FA 2A5DA 2FFBA 2IUUA 4KMUC 1E9EA 1NJFA 1JPNA 2DNEA 4XSGA 3MJHA 1GDDA 3NH6A 1GRQA 3KQHA 3DPUA 4DZZA 1SXJD 4X8OA 2QA5A 3KFUA 3Q85A 3L0OA 4DLXA 2JA9A 1E4YA 1T4GA 1PH7A 4ZDIA 4B3TQ 4BPBA 1LF0A 1W0JA 2ZRDA 1SVIA 3T1TA 1LM0A 3CF0A 1GWNA 5J4LA 3IFTA 1HNZL 3GJ4A 4HIKA 5BWMA 1VIYA 4W5WA 3GEEA 3K0FB 2PX3A 3FKIH 1NMXA 2VL7A 2B3GA 4OXPA 2OESA 2O8FA 3TE6A 2OM2A 1HQMC 1VQ8A 1HT2E 1G7SA 1ZW6A 2AKAB 1W3SA 2O5VA 4TL8A 1PVOA 2UVQA 4M1SA 2HF8A 3CCMA 1KXLA 1P9WA 4BLRA
chains in the Genus database with same CATH superfamily
1VE6A 2O8DA 1HMPA 3AERB 1X3FA 3PCOB 4EHAA 2B21A 1USVA 4XTRA 2JGKA 3ZCUA 4DMHA 5BQ3A 3QF4A 3HO8A 5A5GA 5TT0A 3ZHRA 2JJQA 3N28A 1Q7GA 1N33B 3PHLA 1AHHA 4QD3A 4HBZA 3F3YA 2B6NA 2AG0A 3PNMA 3TLGA 5I4DA 5DNVA 2ZOSA 3TPZA 4J15A 2F1MA 5T1IA 2HZ7A 3EB9A 3WRVA 4DV4B 1YNJC 5GROA 4G8DA 5F78A 2CYAA 4ZPXA 5M04A 3P4XA 3JPYA 2CLEB 5BVGB 3VUEA 4FNMA 3PRYA 1KSGA 1IVYA 3E4DA 3NHJA 3A9UA 4GKAA 4QIHA 3ZU5A 2KBFA 1DQSA 1NN3A 5H59A 4OJNA 3WLOA 4B6GA 5AI6A 3PWSA 4FDLA 2QN6A 2QG4A 3IMCA 4U673 5FOVA 2J30A 2WYUA 3DKPA 3GMSA 2ZT5A 5IYCG 4F7XA 1EUYA 4FR0A 2FXVA 3IJ5A 1B6RA 2W2MA 1QR6A 1DAMA 3QFCA 1V11A 2BL4A 3BHNA 3TKAA 2QN2A 2QVCA 1U2PA 2UYYA 2PBRA 621PA 1VLZA 2CH4W 2C4NA 2X5OA 5CVJA 3P7MA 4V190 3JQGA 5D3DA 1RI2A 5DCYA 4DC0A 4ZI7B 1V7ZA 3IUEA 4QX6A 4Z6KA 5KYUB 2XWJI 2R8RA 3R2JA 3WNVA 3GV6A 4NMLA 1T5XD 3HDHA 4ZO7A 3H4VA 1HTTA 2FZGA 2QXTA 1AN8A 2DKFA 1YT5A 4A3FH 3QEKA 4ZHSA 1X3EA 1U31A 2NO6A 3I9OA 1CUGA 1Z68A 3STYA 3DGFC 4JAVC 3IHTA 1P0FA 4MW6A 1RXSA 5JAMA 4BBPA 4F3RA 1U8CB 3GLGB 1FDRA 1U7TA 5CB4A 1UEAB 2ZJFA 3ZH2A 2ZB3A 4IOAA 1MFZA 4N54A 3J7AF 4GKVA 1RQXA 3J81k 5AUQA 3UY4A 1VQGA 1EHCA 2A0UA 2W71A 3V3KA 3T0IA 4B6OA 2HWWA 2DVMA 2I22A 4QVIA 3VR0A 3EW7A 2IVFA 4AKGA 2O2IA 3KQMA 1VQ6A 2BFBB 1ETHA 4HNHA 3UAWA 1X15A 2JJ8A 1MVNA 1N32Q 2BHTA 3EW9A 3JQBC 4N6OA 2V7BA 1TW3A 1R27A 1JWLA 4RKQA 1QNKA 2HREA 4Y1FA 1DONA 5B12A 1FU7A 4KX5A 2WINI 5CVTA 3NHMA 3EUAA 4AKEA 4RFSB 3PGZA 2A3RA 3D6FA 2W6MA 5JAQA 4ZANA 4YRGA 4NE7A 1QRRA 2ZE6A 2RB5A 4M98A 1VXRA 2Y9MB 1WXXA 2II6A 1SAYA 1L8LA 5B4VA 5JSKA 2E4VA 3P2OA 1RQNA 2P9YA 1HLDA 1IEQA 2COEA 2Y1FA 3A4VA 2AR7A 1WCXA 3GLQA 1C2YA 2MPMA 4J0QA 4JK3A 3CMCO 1QTNA 4D74A 1IW7D 1EBFA 2BCOA 4D6YA 4LFAB 1WMSA 2O4CA 1RVDA 1AO3A 1KOJA 1BD3A 3DVAB 1EOTA 3RS0A 1VYUA 3PDJA 2WNIA 1RF2D 2G6BA 1KYYA 3HDQA 4V0RA 3N52A 1QIIA 2YKGA 4D8YA 2P4EA 4X8HA 2JGFA 3E70C 1SCNE 1NVDA 2FWMX 1Y34E 1ILPA 2I6FA 2HCFA 2GM3A 3AVQA 1AQLA 4UVEA 1L4UA 2RGCA 1XTBA 5JNVA 2PFSA 4JLVA 5MF6A 1M3SA 3GUCA 1Z5ZA 3ZDCA 4XYBA 3PL1A 3RJMA 1UK9A 5DI9A 1OYWA 2D13A 4M1MA 2DFLA 3DDZX 1RCUA 4URXR 5E6SA 4PM4A 4BY7G 2QN7A 2XCLA 4BFTA 1L2TA 1A62A 5E3JA 1GQOA 2CEAA 2W2KB 3OFJA 4BVFA 4HEA6 2XB9A 2YWHA 1GILA 3KLRA 2AR0A 4RD4A 3RTAA 3TQCA 1GV0A 5C4GB 2VVTA 1XTIA 2HLHA 4R1OA 4JITA 1BU8A 4ZC8A 1IJBA 2VQDA 2OC9A 3U3KA 1KK2A 2J3KA 2YMLA 3IERA 4PNHA 3ONEA 1I4LD 2PL9A 3JVEA 3V1KA 4OL0A 4TV9B 1R9TH 3RVJA 5KKAA 4E31A 5IF3A 2BA0A 1OH5A 4G5YA 5CVCA 3R09A 4JMPA 3VISA 3IEUA 3Q10A 1YITA 1RACA 3Q12A 3GBVA 5KTKA 2CLMB 1RTOA 4FWTA 3WJ2A 5K0LA 1ECFA 3UE0A 3ZN2A 1ZINA 1BG6A 3M9WA 4RGQA 3MHTA 4RE5A 2FHPA 1LJUA 4K1LA 4BBZA 3QPAA 5FH9A 1FNCA 4JWTA 2PCFB 4BFCA 2P9QA 3C5EA 4R6WA 2O7QA 1F5SA 5C5IA 1BIFA 1HE1C 2FRDC 1JEAA 4XFJA 1TUBB 1YFKA 4UFNA 2JEYA 1VGVA 1N5MA 4S1WA 4WH0A 3BA6A 1PTOH 1XXHB 1EJ6A 4M9XA 3WMXA 5C8ZA 3MVVA 1W76A 2UUAQ 1YHZA 1A2QA 2CDAA 3R3UA 4IS2A 3CZMA 4ZAWA 2NXWA 1ZYRC 1KAAA 3W3ZB 4K81B 5BWCA 3OX1A 1ODLA 1I7LA 4LE0A 2M9VA 3FMGA 3ZOZA 1S89A 1U02A 1TK2A 2ZRJA 3AL3A 2L19A 5BW6B 2KHJA 2L69A 3MWEA 1Z9FA 4HATA 3WIOA 5BMVF 1MTZA 2EFYA 1CJKC 4DMKA 1TC1A 1ZVQA 1MIOB 3AYHB 4L3OA 3KQYA 5KCMA 4CNBA 3HKDA 4ND2A 1U9IA 2CV0A 3OX3A 4KY5A 2ZM5A 2ZRAA 4GX1A 4H31A 4QRIA 5BV2P 1AOXA 5D1NA 3ZHZA 5A0TA 1GLNA 4KLZA 2JFUA 5ALJA 1VIAA 3HFGA 1VPEA 4EFKA 1Y4SA 2J67A 3W9UA 4DF7A 3PD7A 2AK3A 3SSOA 5JEAJ 1SYBA 4UKDA 1QS0A 1VLJA 5A05A 3V48A 3NNDA 2BFOA 2ZRMA 5LDDC 1N8SA 2JLRA 2AKWB 3U4IA 2BCEA 3NYRA 4Q4LA 4YMWA 2O4UX 2G80A 5ED4A 2G4LA 1EZ4A 1BMQA 3VVMA 4DMUB 4U7DA 1XVTA 1K6IA 1PG2A 3CQZH 4GNKA 2VYCA 4OI4A 4YRDA 4DAOA 1A1SA 2AUTA 3NEYA 3ZY3A 3LGXA 3GF4A 5IEJA 4L3WA 3PFFA 1MPTA 2WLTA 1AS2A 3O1JC 2XMZA 3TG2A 3L8HA 1T15A 4EA8A 3A9VA 2GD0A 4D4LA 3UC9A 5IY0A 2I34A 2RE8A 1W85A 1E1CA 3WDLA 3BHJA 1LVHA 3ID6C 2XBMA 1DRJA 5T4BA 1SN8A 2HRQA 1CNMA 3DQZA 4HMIA 1G66A 5DCLA 3N70A 2FPIA 3K1YA 4LEIA 2J6CA 2EYPA 2K5VA 4E5MA 2EGUA 1V8OA 3P1HA 4A6PA 2DUNA 3Q6SA 4UU0A 1YHAA 1RS0A 4LUOA 4Y7NH 5COQA 2X3FA 3NHRA 1P5RA 4TVOA 1ZITA 1SNDA 2TS1A 4DEVA 4JHLA 2FGKA 1SHUX 5HF8A 3B1YA 3WOFA 1U63A 3EZ6A 3T1QA 1Q0ZA 4N65A 4DN6A 3CEAA 3U3OA 2J9FA 3AVXA 2EKPA 4QBFA 3G59A 4GZLA 2EGGA 1UK7A 4DKAC 3KPYA 3U7QB 4LDZA 4ZA2A 5EE3A 3GEBA 2ZTCA 3V1UA 3VZSA 3NTLA 4LJ5A 4BBSH 3KZNA 5ER6A 1SG0A 2C5EA 4RSHA 4L4YA 3JPWA 4K28A 4M9RA 4JX8A 4I0WB 4DA0A 2LSSA 3BWYA 1ORHA 3HS0C 2L4NA 5L3RA 3UA4A 4LZAA 3HB4X 1E2BA 1NMEA 1OV4A 4X45A 4D4MA 5D51S 4OD0A 2ZG6A 4QTTB 5CVEA 3WHPA 4HNVA 1N2EA 2QVBA 1QANA 2X76A 1MJHA 3QE9Y 1B23P 2ATVA 4M22A 4P4SB 3QE0A 2WIGA 3I09A 4NYJR 2NZYA 2I0QA 2XYVA 1XD9A 3PT5A 1M1XB 4QBKA 3OE7A 3PEYA 2HV8A 4EO9A 3ROKA 5FJ8G 1DXOA 5CCBA 2BFFA 4KY6A 3SE0A 3EGEA 2WACA 3TSOA 1QNFA 4XM2A 1LBQA 1XVIA 2EFHB 4A8TA 3INYA 4JJ8A 1GKYA 2HJSA 3HKEA 1N9ZA 3HYTA 2AMLA 4KDCA 3A74A 2G1PA 4COOA 5LZ8A 1CZUA 1CK4A 4OAQA 1N33Q 5J4YA 4KHPB 1A5ZA 2IY8A 1OH6A 2XOKA 2BH9A 2XNHA 5K4HA 1R4PB 4EFLA 2EVBA 4KKUA 2LVBA 2CWPA 2WFWA 4DV4Q 2QXYA 4Z4FA 4DDUA 4LF8B 5EOVA 3VKUA 1HUNA 1RC1A 1P2SA 2Z1DA 2B6HA 2CCKA 3ZWOA 5D7NA 5CFQA 2FJPA 5CAEA 4ALIA 3NHYA 4GP6A 4JSTA 5C4XG 2V74B 2IYEA 1K28A 3OE5A 5AVSA 2IUYA 5ITVA 4Y0NA 3CR3C 1ZM7A 2G9ZA 4JV5L 3WYCA 3SKVA 3EBEA 4JJ6A 2BE7A 1KMIY 4N5NA 3L0DA 1W30A 2XOKD 3HYSA 3ZY4A 1NPYA 1LH0A 1XDUA 3HV2A 1NMYA 2GKSA 3S6JA 1C0IA 5D6NA 2I8CA 1M6WA 4X93A 5TQ2B 1Y8AA 3EPKA 2QCPX 4JKIA 4YJ2A 2GPTA 1Z6AA 4MMXB 2G8LA 2L18A 1CE8B 2CNKA 1K6JA 5EP1A 4CL8A 3WE7A 4I4TB 2JZCA 3VPCA 3HKZB 1WKVA 1FXSA 4CMHA 3D7RA 2XTMA 4XIIA 2GHTA 5KYYA 5ISMA 4LYHA 2JBAB 3DCJA 3UFXB 3ETJA 2A68D 1WL8A 2RH8A 3ZD8A 1W47A 3IDZA 3V1NA 3F49S 2VBGA 3VAZA 4MQFB 4ZO4A 1OASA 1JT8A 3HOVG 1HPLA 5LZ5A 3DTNA 3BD6A 2P2NA 1DAIA 3JQEA 3WYEA 3D8NA 3A1TA 4BY1H 3IV9A 4Q48A 1B93A 4LDPA 2WSSA 5TGTA 1RIPA 4TYQA 5C5EA 2BKLA 1ICEA 4WVFA 5L3ZA 1E3MA 2WM3A 5F1OA 3A2MA 1NXSA 1E77A 2E87A 4W5TA 1L7VC 4ZQ3A 1A9QA 2AYXA 3H09A 3BC1A 3MJFA 4NYIR 4FBMA 4HY3A 3DR3A 1DEAA 1HNWB 3FFBA 1F8FA 1HE5A 5DOVA 3BTOA 4KQHA 4N76A 4G1VA 1ICFB 4KXQA 4L5TA 2RAVA 2VK1A 2P91A 5HUHA 2QV0A 3GFTA 1I80A 4J0KA 2RGWA 5KTTA 3UC5A 4IXDA 2WSSD 3JRNA 5JQGA 3ISVA 1P75A 1SNQA 1ADJA 2I80A 2EU8A 2X2EA 3U9SA 2YJNA 1T9CA 1EWVA 2BLNA 1N2ZA 1VE9A 1ZD1A 4L73A 3U7FB 1K0SA 4IIVA 3UJ8A 1IB6A 1GEEA 2NVUA 2GVZC 2I7CA 3H2ZA 5J3JA 5E2BA 2R00C 1A4RA 3SK8A 1EFPA 2CNWA 4ZV4A 1X8XA 4NL4H 5B53A 2G40A 2JB9A 3E0EA 3H16A 2ZI5A 1TB4A 1R4NB 4JQCA 4GE0A 1QIFA 1XB2A 4RFLA 4MUBA 3HNOA 4X60A 2BCJQ 4YRMA 4J0IA 4LFAQ 2ORED 4HYTA 1MC8A 3ADPA 3E22B 5JFTA 3GBPA 2Z3ZA 1ZNYA 2YVAA 3EFXD 3FPAA 4L9AA 1X14A 2HRZA 3BB1A 4DTCA 1E2LA 1CR2A 4KVFA 2R9VA 1JHVA 5IKOA 2FEPA 4CMJA 3MXUA 4RZXA 3OJLA 2IYFA 3IP5A 3IPXA 5DBFA 3GOQA 4A3IG 4WXYB 5CJ2A 1IBKL 3NQTA 3RNOA 4RX1A 3AB9A 3C5HA 1VI6A 2OCBA 3HCRA 4FGJA 1XV5A 1ZP6A 1R4QB 1XDDA 3PO2G 1RPAA 5GAEC 4FIZA 3WYAA 4RZHA 3GLSA 1P60A 1IFXA 4P74A 1YL5A 3L7CA 2VA8A 3VTAA 1ZD9A 1G0NA 3QX9A 3SHVA 2B8GA 3NPPA 1T3GA 2G71A 4RPJA 1DEHA 1IRIA 1X70A 1DQPA 2R1TB 1UBRS 2ZSAA 4MXDA 1LTQA 3RVKA 1UP4A 4PLYA 2BMAA 5EUBA 4M76B 4BNKA 2XWQA 2R8BA 3OJOA 5BT8A 3S2DH 1W75A 4JZKA 4QXMA 2B9EA 2P5TB 4MW7A 3CBQA 1RM0A 4AP5A 5H3HA 1LPPA 3Q11A 1E1YA 4C0WA 4AJKA 4RF3A 3JQAB 5ADUS 2PAFA 4NXMB 2ZE5A 4XYGA 4B3CA 3VNSA 3QXCA 4C3VA 4JI3L 4XWOA 5J2UF 3GTMB 2I2DA 1ADGA 1GNTA 1W4RA 3IGFA 2HD4A 1JF8A 2ZRPA 1G6HA 2H2WA 1RAIA 4NMZA 1GQFA 4Q18A 1A97A 3O75A 1Z4KA 3ITDA 3PE3A 3K6SB 4ZREA 3U2QA 4IR7A 1VQFA 3E9HA 1JW9B 1KORA 3NRJA 5BQXA 1YBHA 1TJ3A 4IF4A 4J0CA 4C3OB 2B4AA 5KJFA 1QZZA 1SC4A 2DULA 5BVHB 2PUVA 5IH7A 3H9EO 4DMGA 3VO8A 1OFUA 3JVIA 3AQIA 3FMCA 3D3JA 2D3TA 4OGKA 5EZYF 2NTSA 3PNPA 5IHXA 1KOLA 3WLFA 2LCIA 1V1JA 4CLOA 3A8JE 3G6JB 2OBFA 3NANA 1U2EA 2HHHL 4RVDA 3BKWA 2FINB 3NGLA 4NAVA 1Y6GA 3DYBA 3UH0A 4R51A 1T91A 3F2VA 1P3JA 1PR5A 2Y0SE 5FNZA 5K0CA 4U02A 1HOTA 5DE3A 1B50A 4DA2A 4RVFA 5KIAA 2YICA 3H5OA 1C5KA 1HZ9A 1JC7A 3IMEA 1TS3A 1A8QA 4OAOA 1YBMA 2WIKA 3MWDB 3O21A 3KV3O 4BXOB 3NDRA 3ML1A 1XDBA 4GXTA 1GPUA 4E4TA 1GUWA 4IINA 3LCMA 4ALMA 2YIDA 1QC5B 3MYYA 2GM9A 3HSYA 1QZXA 3UG6A 1IWPB 3LNTA 3U31A 2XSZA 3LKBA 3HOYG 4RTNA 4YPOA 1VBMA 3M9XA 1KFCB 4JLUA 2NZHA 3ZIUA 4TXHA 3T7TA 4NJMA 1RRGA 4MIKA 3DDNA 2BGGA 1ZSVA 2A5DA 2K87A 3RG2A 3VJLA 3MJHA 4QQRA 1FRZA 3KQHA 1XZNA 4RV9A 2QD1A 4WDQA 3DO8A 2ZRDA 2QX8A 5CBKA 1RVV1 1KJIA 5KOHB 1NONA 3DEYX 4Q37A 2ZWAA 4MN3A 2XSZD 3HOWG 4Q24A 4DIEA 3MCAA 3V00A 3IPCA 1JEDA 5E2IA 2WIIB 1G91A 2UXDQ 1EIGA 4LX0A 2BUCA 2WNHA 4YFVA 1P0PA 1D1TA 5BQPA 1L7NA 1ZL0A 1ULAA 3TMEA 3D7MA 1PBNA 4FHCA 2P40A 4GPAA 1E3WA 1RQRA 4DJDC 5U1PA 3A58B 5KRUA 3KXLA 1KRXA 3AVOA 1L5MA 1PX0A 1T9BA 4ZQHA 2VNAA 4XX0A 1A9RA 4YAFA 1OE0A 1SCBA 3T5PA 4RIHA 1JSLA 4NU8X 4IRXA 2GTPA 1ENPA 3M4YA 2W8BA 5EJ4A 2NVBA 1C9EA 4U2CA 4WEQA 4WY8A 5AT1A 4NE9A 3VGPA 2VJDA 3CTMA 4CEIB 3TIGA 2VUIB 3SDZA 1I0ZA 3FTEA 3R5FA 3EZYA 4GMDA 5JT1A 3R7WA 5CFZA 4YWJA 3KWLA 2AOTB 5K3SA 3NEMA 1PAUA 3RREA 1HI9A 3FD8A 1A0OA 3DBRA 2NUTB 1FX1A 4TTPA 5LOVA 4E6PA 3AR5A 4F60A 5U4QA 4Q00A 2YFYA 3M7GA 5DN9A 2IUFA 1NIPA 4F5ZA 1WJGA 3KBBA 1SXPA 4NYMQ 1T5DX 2W2QA 2W43A 3FROA 3D4WA 4YAJA 4GI1A 3TR6A 3CCEA 2Z8YM 3UFBA 4QC2A 3D3WA 4O1HA 1WDWB 3OPQA 2QEXA 3VPDA 5BT9A 3MCWA 2J1LA 1E59A 3RW9A 3MYRA 2A68C 1AZLA 2R6R1 4OXNA 4QTXA 1TJYA 3MT8A 4XOUA 1TDJA 4BO6A 1QP0A 4P86A 4S1NA 4O2RA 4YRSA 4HWKA 1ZI9A 3QZUA 1C9OA 2WUWE 3DBLA 3SFZA 1MNQA 3OJ0A 2C5FA 1ID1A 2ZUWA 3TLAA 2WTAA 5TEWA 3FUCA 5CK4A 4OFXA 1JHOA 1SQGA 2PGOA 5LYYA 1SRQA 3IL8A 1WLYA 5D2CA 4YWLA 5GPBA 3ULJA 1EE1A 3VKHA 5KSPA 3VU9A 2Q2HA 2JHGA 3DO6A 2FJ2A 1T6NA 2KHSA 1DJOA 4XGNA 4IL5A 4K3UA 3RG8A 1T35A 5LKRA 2AL7A 1EUJA 3VOTA 3F2CA 3VZBA 4J6FA 1LTLA 3L43A 2VF8A 1O8BA 4PZDA 4KHPQ 2A5HA 1T3TA 5G3YA 3RVNA 3T38A 4X66B 1P3Y1 3R8XA 2WPDA 5TQJA 1KC3A 1CVLA 2QRMA 2GRJA 4LF8Q 5CYPA 4RO0A 3TP8A 4NBLA 1YMVA 1B76A 2NX2A 4DSTA 1TQ4A 4K6OA 3TZBA 4MV3A 2WINB 2VWQA 4Q1CA 4DBZA 3MD0A 1DIHA 5IFLA 2GERA 1QTIA 1QYXA 121PA 1FFSA 1DCTA 3I30X 1K7EB 3KJEA 5CLGA 2Q2TA 2QJOA 2DN8A 2CXTA 4JH0A 2WPDD 3QPDA 3T13A 4M1QA 4MUIA 2X4LA 5LIRA 1T0UA 4G5SA 4OG2A 4K6CA 3S17B 2AG6A 4LMQD 1BCSB 1BNZA 4MOWA 3NUCA 4BEJA 2WZQA 5KNLA 4WW0A 4GOXA 4NU5A 4IN3A 1P45A 4M9CA 1EE2A 2OM6A 4ZU3A 4YCUA 2IPXA