1OXXK

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formation of the productive ATP-Mg2+-bound dimer of GlcV, an ABC-ATPase from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
molecule keywords ABC transporter, ATP binding protein
total genus 105
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00005 ABC_tran ABC transporter
K PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxxK03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxxK02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxxK01
2AD5A 1UKZA 3RABA 3OYYA 1PLJA 2JLVA 3EX7C 1SROA 4OI1A 3DPUA 3FP9A 2C9YA 1G6HA 2NO9A 3KJEA 3W5OA 2QQ0A 1TU2B 1CSPA 3OFND 2B3GA 4F38A 5JRZA 4UQOA 1Z0DA 3KTAA 5JRJA 3NVAA 3QJYA 3ERSX 2O8FB 3GD7A 4TVAB 1KZGB 2E2HH 3CRVA 2PI2A 2F9LA 3SN6A 5KNCA 1BMFD 5M04A 5KUTA 1OH5A 4FXPA 3VR3A 5J4YA 2CNWA 2C9CA 1XMSA 3T1QA 2VA8A 1X3FA 3MD0A 2GNOA 2OBMA 4LF6L 1YEZA 1HE1C 4PZZA 4Q48A 3R8CA 4JI0L 4YMTA 4JVLA 1L1OA 1PJRA 1OFIA 4HJAA 1VQ6A 2QMOA 3HU1A 4RSGA 1XTDA 1PH8A 3QIAA 3BAFA 1VG1A 5FR2A 1Y1WG 1PH6A 4HB3A 3X1YA 1G64A 1OXXK 4MGYR 4G1UC 4B2IA 2OCEA 2JJQA 2DUDA 1KDTA 4TYQA 1G7RA 2GCNA 2AMCB 4QKQA 5IP7G 2B63G 1IXZA 4ON9A 2ZRDA 4Q7JB 4DK0A 5HZKA 1E2QA 1E94E 4XJXA 2BBOA 3KF6A 4DR6Q 2QPAA 5FR1A 3VU9A 1EK0A 1UKEA 2KWIA 3H0KA 4FWTA 1W4RA 2FPKA 2JDID 1Z83A 1ZP6A 4LX0A 2JEBI 4U02A 3RRMA 2GBLA 2IHBA 4I1UA 1ELOA 2IF0A 4NE2A 3L0OA 4C0HA 3PEUA 3CX6A 3K9NA 4A6PA 1OH6A 3QKUA 2F7SA 2OT3B 1W2GA 4UXHA 1GHKA 1LTLA 3NHAA 3UXMA 3VAAA 5K8TA 2NMVA 3U44B 1SHKA 4YCVA 1CR1A 3QEOA 2B8FA 4TMZA 3CCUA 4LF8L 1MJCA 3F2CA 2DBYA 1ETUA 4US1R 3CCQA 3L0SA 4GL2A 3E1SA 2WWXA 2PI2E 2CHGA 4Q01A 3UE0A 2JA5G 1I4LD 1CULC 3UANA 3PEWA 1KDRA 3IIMA 3TUIC 3KQUA 4QBFA 1NIPA 1ZIPA 4IVPA 4YMUA 2K52A 1W0JA 3VR6A 1KAOA 2DWPA 4QJFA 1Q7YC 4DZZA 1H65A 3M4OH 2G0NA 1N8RC 2I3BA 2K75A 2O5VA 3DMDA 1KSJA 2VNUD 1H9JA 2GF9A 2VSFA 3MWLA 3X2SA 5FOXA 2DFNA 1N5JA 2ZE8A 2IYRA 4PC3A 3A7LA 2VW9A 1X3EA 1KHIA 2Q9AA 5CYOA 1E32A 2ZRKA 4YHHL 3GEHA 3GTKH 2IHEA 3KKOA 3QVUA 4IOMA 3I8XA 3V4FA 4LI0A 5A4JA 4UNRA 4KMUC 1PZNA 5L3SB 3K7AH 1AQYA 1Y69U 1GL9B 2W58A 4DUZQ 1QJOA 1B9NA 4M9SA 4KV9A 1S1CA 4QGAA 4I7ZC 5C0XH 4B3SQ 1NVWQ 3M3YH 1XJQA 5BR8L 4URUR 2VS1A 3I55A 4Q5IA 2JLSA 1XEXB 2GF0A 1YZKA 4UNQA 3RS5A 1PMRA 4JMPA 2ORVA 2VL7A 3KUCA 3LWUA 1XF9A 4DV1Q 3TJZA 2R7ZG 2DPXA 3K0AB 1CEEA 1GD7A 4TLEA 1I2DA 1F60A 3GLIE 2OV2A 3U4QA 2BV3A 5FTNA 1KNXA 4C2TA 2ATXA 2OZEA 1ZNYA 3RNLA 1T8UA 5GAHC 4HIDA 3ZS8A 1T91A 3MXNB 1VHLA 4X64Q 4X62Q 1PV4A 1E0SA 121PA 2GA8A 2REBA 3TSOA 1CRQA 5KSOA 2QAJA 1XMOQ 4AK9A 5LBIA 3PXGA 2J5XA 1AGPA 3A58B 2HXYA 3CONA 4XWOA 2J0QA 4NYJR 1VQCA 2EFHB 4M1TA 4BY7G 3CCRA 1Y8NB 1TQ2A 1VG9B 4MGZR 1E1OA 3G4SA 4R4IA 2IEZA 4LF4L 2WKRA 1J90A 3KFXA 4LRWA 5E7IA 1Q82C 3LVRE 2O0HA 4DBLC 5L3QB 4G3XA 1G5PA 1OXVA 4BA2I 4FI3C 3TQYA 3CF0A 4WXPA 1C7YA 5IYDH 3U7GA 3J7A5 1E9FA 3VKWA 4Q7MB 3VTKA 3KTAB 1P60A 4D4LA 2XGTA 1US8B 1J8MF 5C4JH 2E8GA 2LWIA 4LUVA 1XMQQ 3K0XA 3H3VI 3K0CA 2NO7A 4BBSG 2W6ID 1PH5A 1Z0JA 1IN8A 4GFDA 3B6EA 2K5NA 2W6JA 4JBXA 5DN6A 1G18A 3BZCA 3C41J 4JYCA 2QM7A 1G1MA 1VCOA 4DWJA 4QOSA 5GROA 1XTQA 1JE5A 1Q1BA 3BB3A 4OXPA 1V5WA 1PUIA 4ZO4A 1US8A 3U7FB 1NL3A 1B70B 3RS7A 5L8VA 3OEHD 4WZBE 4URZR 3PCOB 4PC6A 4IQZA 4MKFA 4AIMA 1SN8A 3ZLJA 4QRHA 1E9SA 1A62A 4C0LA 2NN6I 4Q4AA 1SRUA 2B8TA 2ZJ8A 2BA1A 2W2TA 2VQEQ 5HCNA 2KSQA 4Q7LA 5FJ8H 1KO8A 2HDNB 3HYRA 3GDEA 4C0JA 5KNBA 1BIFA 3FKSD 2PCFB 2IX0A 4NYMR 4DR6L 2PCJA 5FPYA 5KDLA 4X66Q 4ABYA 4B3FX 2B92A 4Q1BA 3CC4A 1G8FA 1MABB 1DD2A 3KJHA 3OZXA 2O8EA 4K0KQ 3UE1A 3HKZE 1KDPA 1XD9A 5TARA 4A82A 2CKZB 2GHIA 4DV6Q 3SQWA 2FEMA 4JI2L 2C98A 1CI3M 1FVIA 3GJ3A 2J0SA 3THYA 1TF5A 5EE3A 5FPSA 1Z7TA 1Q1QA 3OEED 2W2VA 5C44G 1K8OA 3PCRB 3RSLA 4B32A 2Y8EA 3VR4A 4KHPQ 1BYUA 4DIEA 5FLXc 3GLHB 1GKIA 2A6HD 1AN0A 1ZM7A 4EIWA 2REOA 3I2ZA 4MKHA 3A4MA 5F9FA 3IFTA 5ELNA 1E99A 1Z9FA 1N33Q 1YI2A 3BBPA 3D7MA 3NXSA 4TL6A 3AF3A 1OV4A 2IBMA 3GLFB 1HZ9A 2BIFA 3OF5A 3RHFA 4A93H 4DLXA 2VP6A 2XNDA 2AHOB 3T1HL 5FTKA 3KQKA 2OAP1 4GN4B 2WJJA 1UF9A 4L16A 4Q18A 4OQNA 2HV8A 2E74C 3CC2A 4CIDA 2J41A 2HEIA 4A3CG 1ZM2A 1FX0A 1AE2A 1VYTA 1MKYA 3C16C 2MO1A 4X8MA 4BFVA 4AI6A 3OOCA 1B0UA 1Q3TA 2NQ2C 3P27A 1PUJA 4NBSA 1GKHA 2JK8A 2YU9H 4H02A 2YYZA 1QRAA 4QHYA 2XB4A 3BGWA 2HT1A 1FR3A 4CT4B 1XTRA 1IZ6A 1EWHA 1WOCA 3KFVA 5J40A 3GJ0A 1DAEA 5BN3A 2IW3A 3ZYCA 4LFAQ 3AVOA 4AY2A 3FYHA 4C30A 4B74A 2KBEA 2UUBQ 2WB1G 2LXJA 2O8DA 4PAOA 3FHOA 2JIZA 1PH7A 2V6JA 4QBIA 3A1UA 5DNYB 2H57A 4LK1C 2WZQA 2GBLC 5FTLA 1KJZA 1L4UA 3KUDA 1PH1A 2GDJA 2IT1A 2JA7H 2AN9A 2HJGA 1XNRQ 4GNKA 5KPJA 3HPRA 2ZS8A 4X8LA 2Q6TA 1TEVA 1UFQA 2NIPA 1NLYA 4FIDA 1G5RA 2FJUA 3ND8A 1WBDA 4OWXB 1P5ZB 1CJMA 1KO7A 1OXSC 1R0YA 3A1WA 4HAYA 3TEHB 4QQBX 1OLOA 3BFXA 2UZIR 4AQYQ 5KSZA 4O25A 4GPTA 2DNCA 4KODA 1YKSA 1KI8A 2H7VA 4QL3A 4ZPXA 1BOFA 1G7SA 2C99A 3R9XA 1WFQA 1WE2A 3BE4A 4GMDA 3H15A 1V1QA 3B13B 4G5SA 1ZUIA 3S14H 4X65L 3TLXA 2EYUA 4KXFB 1X54A 4LF4Q 4IOLA 2GJ9A 3OEHA 4QGFA 4KFTA 4V0LA 2JA7G 4CEIB 2L5TA 1ZC4A 4B73A 4QM7A 5J5CA 4URWR 2ZVPX 3K7UC 2PH1A 4XWAA 4ACAA 1EXMA 4ZV4A 3K81C 1E2EA 4Z1MA 5C18A 3TZUA 2RKOA 2PQAA 1C0AA 5JI3E 1W36D 1RE0A 2QSZA 3J81k 4DV2L 3AF1A 1Z6XA 3S1MH 2D06A 1IJEA 1ZINA 2FGKA 1L0WA 3K9HA 1F6BA 3B78A 3L0IB 4URXR 2L0XA 1FUUA 3C4JA 4M4SA 2IYLD 2QU8A 3KF6B 3FPPA 4AH6A 4A75A 4WJ4A 5AJVB 3ZZUA 2WP8J 4WJ3M 1IN4A 3OW2A 2WAYA 3ASZA 4DDUA 4YHHQ 2FN4A 1U9IA 2G1KA 1YNXA 3QBVA 4LFCL 3S16H 4PSKA 1OIXA 2ZJ2A 3ULLA 3JZMA 4LHWA 4NYIQ 3EZ7A 4FW9A 4MRRA 3LGJA 3BJUA 4A3FH 3MRSA 4PX9A 3SJBA 2LKCA 1SXJC 2FG5A 4A3EH 1XMIA 1QHYA 1E9CA 1GVNB 2R9VA 2D0PA 1VIYA 3VDYA 4OK6A 1K9MC 5DYIA 4BLTA 2ZE6A 3KKNA 4LZZA 1E9EA 3S1RH 2EW1A 1UDWA 5H68A 1XDBA 1BBUA 1JNYA 2CXXA 2GXUA 2YNMA 3VX3A 4E07A 1X55A 521PA 3FMPB 5KO2A 3AQ4A 2K50A 1ZYRC 4EKDA 4L5BA 2VF8A 2C35B 4A3GG 3KQNA 4IVRA 2I1QA 2Q3FA 3PIOA 4DV3Q 2B8GA 3RN5A 1YVDA 2OLJA 2P3SA 2XITA 4MYTA 4OHZA 4BPBA 1VCMA 3A5ZB 2QA4A 4UKDA 2PEYA 5AUQA 1J70A 4HAXA 4W5WA 4X8OA 4RG1A 4LJ7A 2FZLA 1IM2A 1KI3A 4JI1Q 5HGQA 3OIYA 4DLSA 1ANKA 4EAQA 2FX3A 2ZM6Q 1QVFA 4NXML 4KVAA 3K8YA 4AYWA 3T1YL 5FLMG 2VHTA 4B35A 2XTIA 3DM9B 1COWA 1QVAA 2ZJYA 1OE0A 1G3UA 4DV4L 4HATA 5CYPA 1JQLB 2F1HA 3PFIA 3Q5EA 4MRVA 4ZIRA 4G7OC 3K70C 1OHHD 2VQFL 3BU2A 1XX6A 2ZTDA 2FFQA 1G19A 1Y3AA 4DNRB 3TS0A 4BASA 2C04A 4LF6Q 2ZI6A 2YTYA 4KLZA 1PH2A 4JI0Q 4A0FA 4ZDKA 2IXFA 1RC8A 2HIXA 3MEFA 2C8VA 2F1RA 4ZCMA 2FGJA 5J47A 2FDCA 4HB4A 3AKDA 4POFA 2J59A 3HDTA 3LDAA 4LBZA 3BXZA 4BEJA 3QSYA 2XSZA 3FB4A 3NELA 4LJ6A 3U3JA 3WMGA 2D0OA 2QGNA 4MGIR 4IXNA 1VECA 2PZEA 2FOLA 2HXSA 4CRWB 2I5HA 5EJEA 2GXSA 2RGEA 4JI3L 1E0AA 1G16A 4BBSH 1NVXQ 2FSGA 2ZRJA 1M8PA 1XFAA 1TQDA 2CDNA 1H9RA 3STBC 5A0FA 2WMNB 4KKSA 2A5FA 4LHVA 3S1QH 2QE7D 4BLRA 4OHXA 5C4GB 1IOZA 2QM8A 2VIIA 1M2OB 1JJ2A 1YU9A 5C2JB 1F2UB 2ZJ5A 5DE3A 4LBVA 3EPHA 2VHQA 3CQZH 1RZ3A 1XXHB 4K81B 5JS7A 3KOJA 3SOPA 4BFZA 4KYIB 1IBKQ 2FWRA 1M34E 2P65A 4L8GA 2F3IA 3EC1A 3W5JA 2FU5C 2QUZA 3BB1A 3N5CA 3NBXX 5F2EA 5HY6A 1T5EA 4BXXH 1XEWY 4TTQA 1V9PA 4O0AA 4BRWA 1RVDA 1KK0A 3U6BA 5GJBA 721PA 5DHFA 1RIFA 5IWAL 2IUTA 2QAGA 3M6AA 1LS6A 3RS4A 2ZYWX 4KO8A 4MYHA 2ID0A 3SI7A 3QF4B 2WPDD 3B1YA 4L5TA 4DPGA 3T5GA 1NG9A 4Q1EA 1E9DA 5CIQA 2AKWB 1E2PA 1KI4A 1JJGA 2UXCQ 1XEWX 3AKYA 3QKRB 4NP6A 4RZXA 5EXXA 2V55B 4DLTA 3F3YA 4P3YA 2IHYA 2R92G 1NNEA 4BWYA 1DAIA 2GVDC 3NBHB 5KTYA 3AH8A 4P4SB 2A68C 2JXMB 3CXCA 1TUIA 3GJ6A 1QHNA 1GL7A 1QUQB 3L8ZA 2QTVB 3ULJA 2NG1A 4HJ7A 4EX5A 4IOCA 1XCPA 3H3VH 3BIFA 1XP8A 1YE8A 4A3JG 5JS8A 4DV2Q 4B3SL 4DK3C 2J9RA 2P5SA 4HUQB 3U3OA 3THXA 1WBBA 2JEOA 1GVPA 5EQTA 2YWFA 4A3DH 2D7DA 5TXGA 1NRJB 3CH5A 1HY3A 1VQ4A 3FMFA 2EJMA 3HOXH 2PBRA 2VP9A 3QEJA 4JLOA 2J0UB 4F93B 5FBLB 1H9SA 1E3PA 3UK6A 1DGSA 4JC0A 1KJYA 4C0BA 4CEIA 2F1JA 1T5IA 2F52A 3ND9A 4JG2A 4AYBG 4DV1L 1IY1A 4KI0A 1CS4C 2EFEB 1W2HA 1VQAA 2JJ8A 1GRQA 4XTRA 1E3MA 5JMTA 2P6RA 2RGBA 2N3SA 2I5MX 3CKLA 5BYJA 2CWAA 2OCAA 1UKVY 2HT6A 4IDOA 1F3OA 2GVZC 2Z0MA 4LHYA 4LFAL 4M1OA 2E2JH 3FKQA 2FMXA 4B3CA 2F55A 1NJFA 4D81A 2AX4A 3K0AA 4CEHA 2OUKA 4X62L 1OW3B 2PEZA 3K0FB 3AVVA 1ZAKA 4R9UC 1GJXA 2J87A 2QN6A 1CJUC 1G3QA 1EX7A 4Q19A 5LB4A 3U6KA 3WMEA 1EIFA 2A3RA 2WWFA 4JLVA 4LYAA 2GETA 2WICA 4OWWB 3BFKA 4A0HA 4C7OB 5D3QA 5EP1A 5LMUL 3IPXA 1F48A 5FOSA 4OJKA 2LMCB 1W0JD 2HF9A 1H8HD 3LA6A 1KL9A 2WWHA 4NYIR 2A1AA 2XOKD 4ZDJA 5DGXA 1IONA 5LMNQ 1P4SA 3I7FA 4URYR 421PA 2NVQH 3IRBA 4TTPA 3K70D 4M22A 3SJAA 3AYHB 5C4XG 5G40A 2WSMA 3NKVA 2HLDA 4LDJA 1ZUNB 1UM8A 3F1ZA 3EZFA 4BFTA 2J46A 4LHXA 3P4XA 2K7VA 3F5FA 3KXLA 3F2BA 4F4IA 2ASBA 2BMJA 1OB5A 1DOAA 2FSFA 4QBGB 1AJEA 1G7CA 1E4VA 1VQLA 1SXJE 4MYCA 2D2CC 4TYWA 2V6IA 1TWHH 2O8CB 4XSGA 1UADA 2AKYA 4ESVA 4WIAA 2DYKA 2QL6A 3GTPH 2GAOA 3M7NA 3ICQB 5FUWA 2CE7A 3SFVA 3EIQA 1FPMA 3C5HA 3CNLA 3KKQA 3MWJA 4AYTA 1HV8A 2C03A 1SFOH 4GNXC 1H95A 2FSIA 4EDHA 4EPVA 5F9HA 5UKDA 2CJWA 2RGGA 3NEMA 3VHXA 2G0TA 3A74A 1G8GA 4JSYA 2CCZA 1FQJA 3MCAA 1VPLA 1XTKA 2E9SA 2QGQA 2GZHA 4KKTA 2PT5A 1HZBA 4Q9KA 3SYNA 3UPUA 1Z2AA 1K3RA 3Q8XB 2J45A 2VQEL 1QHHB 4JIMA 5JJIA 2R8RA 2ZI5A 4FINA 4Q9HA 3VR1A 3CO5A 3WWVA 1OXUA 4DNIA 2BBSA 4IXMA 3PO2H 2D2FA 1YJNA 5KSPA 2BE5D 3LO5A 2AHOA 2BDOA 1E96A 3WHKA 2K32A 4IFDG 3GLFA 4BECA 3FMIA 3GJ5A 1J8YF 4RD3A 4CVNA 1KY2A 4DKAC 2A69C 4RCZA 3GJ7A 1E2NA 3D31A 1KY3A 1W0KD 1P7CA 3FTQA 1KXLA 5AJZA 2V4DA 3A8KE 3FMCA 1N6NA 2JASA 4EPRA 1KC8C 3KJOA 1N36Q 4EFNA 4M1YA 4OK5A 1Q22A 1KOFA 2GCPA 1T3LA 2RGNC 5CJPA 4GLXA 1Q46A 3DOEA 1SXJA 1E1RD 5IWAQ 3HOXG 1NY5A 4DCTA 1DADA 4RJLA 1Z6GA 5FI1B 5J4HA 3E9HA 1N6KA 1R7RA 3X1DA 3KQHA 3I3SR 2J1LA 5IYDG 3AV0B 1A2KC 1LF5A 2C5LA 2V7QA 4M1KA 4NZYA 4WAUA 3J81c 3ZIAD 4B6EA 5KU1A 3KLWA 3FGNA 4JLPA 4NPSA 2QGZA 4A0GA 4Z8XA 1D2NA 4MH0R 2IYXA 5AJXA 3VMFA 1N6RA 3MXUA 1ZNZA 4RY2A 3T06B 1MO5A 1A1VA 4MDEA 2X2FA 1XEXA 3K09C 1SR3A 4DLVA 5JHHB 1DO0A 4FCTA 4A3BG 5SZIA 1NY6A 3BS4A 2PLRA 3GCGA 3RS2A 2C77A 1UPTA 2XNSA 4OL0A 2IYYA 1FMJA 2WJVA 3QKSB 3BD9A 3I62A 1DS6A 4JYAQ 4HZIA 4GRAA 2B21A 5AJ3Q 3P20A 1XU4A 4C0KA 3H4MA 5AR1A 1R0WA 5E7JA 2KCMA 4QC2A 4NCHA 3WYAA 2QY9A 1VQHA 2C78A 1OIVA 1G7TA 1R5OA 4DSNA 1GHJA 1M7HA 4JOIC 3S24A 4A3MG 2YTXA 3A7AB 4DDVA 2QMUA 3U9SA 3P26A 4B76A 3UDXA 1KSHA 4DCNA 6Q21A 2DB3A 4TLCA 2Q2HA 5JEAJ 4JI3Q 1W47A 3H0GH 2JA6G 3GP8A 1IBLL 1AE3A 1YZ6A 1Z29A 5HPYB 4PZ7A 2WBLC 3C14C 2YTVA 1LFDB 2MNAA 5LB2A 1TQ4A 4LF9L 4AQYL 2Z6KA 2ODEA 3M0EA 4DCSA 4KN7C 5IYBH 4FMDB 1KSFX 1M90C 4E22A 3VKHA 1CBUA 1H9SB 1CSQA 1TX4B 2ES2A 1WMSA 3FWYA 2F1MA 3LAWA 1W2BA 4D0NA 4XOIA 4H1UA 4A4DA 1JT8A 5M5XH 2L15A 3ZJYC 4A93G 3FKIG 3TRZA 1YNNC 2AWOA 1SVIA 1JEDA 1GUAA 1MOZA 2V54A 2ZU6A 3GEEA 1R10A 3HPQA 2ZEJA 4Q1AA 4DDTA 5JWRA 2FPMA 1ZUHA 1KMHA 2ZR7A 1YHAA 2ATVA 2E2IH 2EVWX 4Q4JB 3CX7A 2EJFC 2CBZA 3DDCA 5LMNL 4JT2A 3EZ6A 4NYJQ 4YMVA 3TGPA 4BXXG 2IHFA 3ER0A 4PPFA 4HAZA 2VY3A 2RCNA 4TSFA 4DUGD 4CEJB 3S1AA 5J4VA 1XJ0A 2R44A 3ASYA 3BRWD 4DEYA 5IE8A 2QTFA 4JJZA 1ZYUA 2ZS7A 4QBHA 4EJSA 3K9LA 2F4VL 1FTNA 2ORIA 1II0A 1M1YE 2R7DA 3FKIH 1YR8A 1CF4A 1ONLA 2P5TB 2JLYA 4M53A 1KKLA 4RCYA 5FLMH 2ZRHA 3J81j 5EE1A 3AVPA 1N0VC 4JOIA 4R1JA 5KOYA 2A68D 4DV7Q 5M5YH 1YJ9A 2ZTSA 4PSVA 4D4KA 2P67A 3GJXC 2Z0SA 2EFCB 2X8AA 4UY8C 1IN6A 4AYBE 3GTLH 3TKLA 3TVDA 1IXRC 3TH5A 5E7MA 4IEEA 1OF1A 3BH6A 1KJWA 4A3MH 1K83H 1XZQA 4PHHA 1L2TA 5DI3B 2WWYA 5JFGA 4ZDWA 3RRZA 2QF7A 2IYUA 2QQEA 4TLAA 1OH7A 4GLAC 2OTJA 1X86B 2A2ZA 2GTPA 4B71A 5JEEA 2NN6H 4C9BA 3QXXA 4JI4L 4LF7L 3LVQE 1J5EL 2YINC 1A6XA 4J0QA 1S1MA 3AGPA 4ERNA 3S17H 3RWOA 2AFIE 4DIDA 4A3EG 4JI1L 3H94A 1EQRA 1WI5A 2JDIA 3M85A 2OHFA 2Q9CA 2ZANA 2ZI4A 2JGNA 5TB5A 4BEBA 5A5GA 3EA5A 3E9IA 5C1BA 3GPLA 3T1YQ 4P32A 2XOKA 1G6PA 3GTJH 4LV5B 1K6MA 3KJPA 2VEDA 3G6EA 2ZSBA 1N36L 1VQOA 1UBEA 3C15C 3KB1A 1RRFA 3UATA 4C0QC 4WW0A 5L3QA 2F9MA 3CR8A 3QBTA 2Z4SA 4TT3D 3LQQA 1UBFA 2VQFQ 3AEZA 4Q4JA 4BY7H 4DK6C 2I1VB 2RHDA 2ZSAA 2JLRA 2MQHA 3BZKA 1TEXA 2NOAA 3L2OB 4HYYA 1AZSC 4OJQA 4DR2L 2GJAA 1O7LA 2PL3A 2HJVA 3WHLA 4ZIRB 2KBFA 2VO1A 3AFPA 5BWMA 5BN4A 4B6FA 2N8NA 3EN2A 4IJHA 5IRCD 1W4BA 3I73A 4LNQA 1KHTA 3A1SA 1U0HC 5J3BA 5IP9H 3GQBA 1R2QA 5AWFC 3HR8A 4G5QA 1N6OA 1KSGA 5IK2D 2W00A 4LJAA 3LW7A 4HDOB 4DLYA 4AWXA 1BDOA 2A7QA 4DV0L 4A3FG 4B2LA 4DSTA 4KYUA 4Q7KA 2GCOA 2XAUA 4CGZA 3S15H 2ZS9A 4D0LB 4A9AA 2XZOA 3EIEA 3MSXA 4BLQA 1GO3E 2K14A 1ZM3A 4L9WA 1TWCH 5J4LA 2K4KA 3E0EA 4JCVE 1T0JB 2H1LA 2FEOA 3RLOA 2IWRA 3H86A 3T35A 5HE9A 1PFSA 3OIUA 1JXOA 1XPUA 3K8AA 1AIPA 4BLSA 1KI6B 1N5LA 3CWZA 5DSZA 1UEJA 4LHZA 3OTOL 3QXCA 3CH4B 4AKHA 3A5UA 2CL6X 4A3LG 4V0NA 4JI7Q 3I61A 1A8VA 1ZBDA 1VMAA 4R2IA 4FMBB 1E2IA 1ZNXA 4UXIA 4ARZA 2GRJA 1P16A 3N2EA 2N46A 3SDZA 2G9NA 4EQ6A 2FF7A 4D2IA 5LPNA 1E1RA 2BKUA 4KFRA 4OO1H 3Q8DA 3MJHA 2R93G 1GOTA 1KZ7B 4WA7A 4LF8Q 5AJWA 3TRFA 4HEJA 3V9PA 4MGKR 5BN5A 2EU8A 2BMEA 3VHLB 2BEKA 1U8ZA 1OIWA 3B1VA 1LW7A 3B5JA 3IIJA 4C3HH 4EPXA 4TYNA 1QHIA 3B9QA 1EYGA 1QHSA 4MKGA 4JI5L 3LFUA 4RD6A 3JAMc 1P62B 1OHHA 3LWNA 1MRNA 3FOZA 3HOVH 1IQPA 4Y0AA 3D0FA 1DARA 1HNZL 3RWMB 3U3MA 4TMKA 2O8EB 3UDGA 1U8YA 3K0FA 4RKEA 4LYFA 2EJGC 5GVSA 5CJ2A 2IXEA 3IILA 3TAUA 5K36G 3HU3A 2ZRCA 3I1FA 1LV7A 3I4NH 4OQFA 1FP7A 2R93H 3FDIA 4RZ2A 4JBKA 2Q2IA 3I4MG 3C7KA 3TR5A 3ZZTA 1CTMA 1SULA 2NVYH 5C44H 1JALA 4OO1I 3P32A 1CJKC 3U7HB 5IK2A 1Z6AA 2Z5FA 3IO5A 1HNXL 1Z08A 5AJ3L 4JZKA 4Q4HB 2Z6VA 2QNRA 2IS2A 5EZ6B 5M5WH 4MUBA 2RHQB 3OHMA 3UKDA 3U44A 1HH2P 3U3KA 1E2WA 1GNRA 4RD0A 4TKOB 3PSIA 1SKQA 3ZVLA 2IL1A 5K8UA 1OXTA 5LDDC 2X77A 1VQGA 4Q03A 5TY0A 1JI0A 4NU0A 4DDWA 8OHMA 1EOVA 4ME3A 2V4ZA 1GNQA 5L3VA 3BK7A 3I8SA 3HOVG 2BEJA 1Y8PB 5LMUQ 3AVWA 1NF3A 2O8FA 1VDZA 4D80A 1E1QA 2IUSA 3IGFA 3UDIA 1YR9A 5ELOA 4DLRA 1II8B 4I1OA 4W7SA 5JZVA 3R9IA 4YMWA 3U60B 2GJKA 1VQNA 4LF9Q 3CRMA 5M3MG 3GTMH 3CR7A 3H1TA 2B7BA 2OCBA 2ODNA 4OO1G 2O0JA 5FTMA 4IJLA 1Q21A 2A78A 2ZI7A 3KDSE 1UDXA 1K8AC 1T3HA 3QVVA 2A5GA 2R92H 2WAXA 3MWYW 3WDNA 1E0KA 2QAGC 1YHNA 3WBJA 4GN3B 2E5LQ 1MV5A 3IQWA 4LJZC 4A3KG 2KHIA 3I5YA 1X9NA 2R65A 3DKPA 2F6RA 1KK1A 5C3EG 3CF2A 4G01B 1N3BA 3UG6A 3A4LA 5B30A 3TW8B 3CBQA 2WKPA 3THXB 1XNQL 1IL2A 1PVOA 2WJGA 4AG5A 4LJ8A 2BWJA 4V0OA 1E79D 4JLDA 3GLHA 2VF7A 1XBTA 3QE0A 3T1OA 3AFQA 3J7ZC 2QMEA 3EG5A 1GUSA 1F2TA 3CPWA 2F4VQ 2JLZA 3HKZG 2V8OA 5FI0B 1BKDR 1LF0A 4Q1DA 4MKIA 2IEYA 2K5UA 2ZETA 2HIVA 1LUZA 4DAYB 3NG1A 2YVUA 2BMFA 2MSDB 4FCWA 2V1CC 1S9DA 2R6DA 4IDHA 4TLBA 4YXWD 2ASEA 1HR0L 3J80i 2ZM5A 3OW7A 3PUYA 1IHUA 2FXQA 2CHQA 2F1IA 3UG7A 4L5RC 2BBTA 2WMOB 4HB0A 4B3DA 4QHTA 4AURA 1Z06A 4OBEA 1OT3A 4BY1H 1XPRA 1DAGA 4IKEA 2B8WA 4PZLA 3WYFA 2YKGA 1ZIOA 4NMMA 2IWHA 2A6ED 5IY0A 1N32L 3MAAC 4KSBA 1ZCAA 3ZVMA 1XD2B 4HI0E 5SZJA 4TWZA 5FOTA 1EX6A 4YDHB 2R7ZH 1J6QA 4UP9A 5LD2B 3SE0A 4IRUB 3J81i 5EXSA 3CAMA 1YZGA 4B2PA 1I3QH 4P0TA 4XD7D 4APVA 1SHZA 3PIRA 4LF7Q 5FTJA 4K0KL 4Q21A 1J5EQ 5FUVA 4YWLA 5IF9A 4JI2Q 1A0IA 4C2MH 3AKCA 3TUJC 2PT7A 3RS3A 1IXRA 5L3SA 4P74A 2WM9B 1U98A 3HOWG 4BFXA 3CMAA 2MFIA 4KLKA 2ZYTX 4XTCS 3CRW1 5AK0A 3NWJA 5C4MA 2G83A 3RR5A 3AUYA 1RYHA 4M1MA 2ZRPA 1N25A 4LBWA 4JI8Q 3HOYG 1P75A 2VYFA 4PO1A 4WZ6A 4GDFA 2GK6A 2ZUBA 1NN0A 4TSFD 2IK8A 5DI9A 2GEVA 1GRRA 4DUGA 3UWKA 4JI6L 4DT1B 2ZRIA 2ZJBA 4LK2A 1GILA 1YZQA 1WCMG 1CTQA 3SHWA 2VP4A 3FVQA 4TYPA 1RRPA 1VKJA 4M0LA 2OO7A 5AUNB 4DB4A 1U5KA 1X6OA 1E98A 1KMQA 5H70A 3SBDA 4JLNA 2B7CA 4LGMA 3VX4A 4HJ9A 1TF7A 2XZLA 2QENA 5C0XJ 2ZUDA 2WKQA 2EDGA 3P4YA 3W9YA 1S9HA 2XXAA 2C2HA 2ZRGA 3B60A 4WOPA 2Q2UA 4YCWA 4TYYA 1HCZA 1P8LA 1D5CA 1E2JA 2EIFA 1YVCA 4RKFA 4DV0Q 1KKMA 3DO6A 2DFKB 4LY6A 4PSAA 1UAAA 2UUBL 3O8BA 3KYHC 2MMCA 4KU4A 4ZI3A 3HU2A 1GUNA 2VHJA 2OFXA 4OYHA 1HE8B 4M8NE 2ZAMA 1KIXA 2VUMG 2GEUA 1IN7A 2BJWA 2GJSA 2OQKA 4M9XA 1UKYA 3W8RA 3KLRA 1MH1A 1E69A 1EWRA 3DLLA 1XPOA 1AH9A 1DG3A 1AS0A 2YOFA 3B82A 1N34L 2C96A 3SQXA 1T3SA 3R7WB 3X1XA 1OJLA 3LX8A 3TNFA 1CFMA 1QBKC 4EPTA 4IPGA 2A30A 1G5TA 2JJ2A 3DL0A 3I5XA 1WDTA 1P61B 1IW7D 4JI7L 1QZGA 5K36H 3CF5A 3KFUA 4N1AA 5FPHA 1L8QA 4M9ZA 5FL7A 4CDGA 3OE7A 4F4CA 2WWGA 2QA5A 2GN5A 1DCZA 4CZ2A 4NHOA 2LKDA 1W44A 1G4AE 2X2EA 4TMXA 1WA5A 4B44A 5C46F 4NL4H 1Z63A 2JE6I 2N49A 1I5FA 2P6UA 5GJCA 1Q81C 5EAYA 2CFMA 2H5XA 1ZC3A 2E5LL 1S2MA 1PH9A 2HYDA 1MO6A 1XJVA 2VP5A 4HLQB 1DAMA 5G41A 2ERYA 1ESMA 4NH0A 1SGWA 4LC0A 4A2PA 1RFLA 4V0ME 3VNVA 2OFOA 4DV7L 4P4SA 1C1YA 4JI5Q 3QUSA 2O0KA 4PHTA 3VQTA 4DT1A 1NJIC 3W90A 4AIIA 4OQLA 1S96A 1PYSB 2WIAA 4C0SA 2R6AA 4JBJA 4JVNA 4PQYA 4EUNA 4PV1C 2EVBA 2PX0A 1EWQA 3ZH9B 4LF5Q 1E0JA 1MKHA 4LFBL 4LJ4A 3D6TB 4HAWA 4B3RL 3GLFE 1E79A 3B1XA 2GEDA 2UKDA 1T9HA 4A3LH 3IDQA 4KVGA 1AS3A 4MUAA 5B58C 2QBYB 3MGCA 2P2LA 4NCNA 4D26A 221PA 1N6IA 4JI4Q 2R6CA 2KE5A 2WVJA 3CPEA 1DBSA 2AWNA 4ZI2A 1COWD 4C3IH 2UUCL 3A1VA 5JSZB 1R5NA 2OXRA 1MRSA 3RSOA 4RD1A 1A4RA 4A15A 2R62A 4ASUA 1S40A 3LD9A 1NN1A 1B8AA 5GADC 2D5DA 2ORWA 2A5DA 3KL4A 3FFBA 2EWWA 4MA4A 2AFHE 4R7ZA 4TMTA 2WAQE 2NVTH 1E4YA 3TAHA 3Q5DA 2RHSB 2JLWA 1RW4A 1G291 1C4OA 4O2LA 2FA9A 1AM4D 3H84A 2FFAA 3LLMA 5HKKD 4P73A 4HIKA 4R4CA 4US0R 1F5NA 2OXCA 2AL7A 3F8TA 1HTWA 4DXAA 4DR2Q 2DCUA 1PHJA 4PO8A 2DHRA 4H1VA 1XTSA 2K33A 1I50H 1BYIA 1BO6A 4KCGA 3B9PA 5FBRB 4NXMQ 4JVMA 4IDPA 3Q9LA 2IYVA 1EESA 1B23P 3U50C 1R8SA 2N1BA 4IPCA 3HGBA 4B48A 4E5UA 2ZJAA 4DV4Q 4NCKA 4PAMA 4DR5L 3LNCA 1JAIA 1TQ6A 1P2TA 4M21A 4LYHA 3KZ1E 1CKOA 3DZ8A 4PPNA 3AF4A 4HJ8A 4A92A 1NBMD 4BRUA 2VHUA 2CK3A 5C3EH 2B29A 1J7KA 3GFTA 1E2LA 3L8YA 3LBNA 5E95A 4JV5L 3NC1C 2AUJD 4QGUA 5E7NA 3GJ8A 4UP8A 4R4TA 3BERA 4C2UA 5GJVC 1SZPA 3AVQA 5EP4A 3UMFA 2JJ2D 1QVCA 1QHXA 5AUPB 4JJKA 1DE0A 5EXTA 4DR4Q 2O8DB 3SJZA 1FQKA 1JR3D 2KBNA 1IW7C 1D2EA 3Q7PA 4OI2A 4PANA 4PC7A 2HLDD 4RFSA 1A63A 4A3IG 1NMYA 4NDZA 1U81A 4FMCB 2NN6G 4UP7A 2CMKA 3MLEA 4XIGS 3QPUA 4I1VA 2YZ2A 5FL3A 3EPJA 4GP7A 3EPKA 4DSOA 5DLQE 4KFUA 4MZ9A 3EQLC 2JEAI 1HQMC 2BCGY 3SS8A 3BDOA 3RC8A 3JZAA 1FTSA 1E24A 4QGHA 3S2DH 1D9XA 4P72A 2OILA 3I4MH 3R9WA 3VNUA 1ZD8A 1UE6A 5IYCH 4HIOA 1DTSA 2D4HA 2QT1A 4GZYC 3DHWC 1WP9A 3LXXA 3AGQA 4TN1A 5JBQA 2HCBA 1IYVA 2Z6KC 5LMNW 1IBMQ 1YZNA 4BQSA 1VCNA 1P2VA 5M3FG 3BORA 2NO6A 3Q3JB 3K0SA 1SVOA 3OEEA 3TE6A 2JJ1A 5CIWA 4I4LA 2OFWA 4A3CH 4O0MA 4P31A 1AK2A 5IYCG 1JPJA 2DFLA 5TDHA 621PA 1NN3A 3G5UA 4L5SA 2DFTA 1RPZA 1B7YB 1CRPA 4JLJA 4TT3A 4EPWA 1KGDA 5TMPA 3PGZA 1GZSA 1ZVQA 1V43A 3STBD 4DUYL 2IYZA 2Q9BA 3QF4A 2ZRBA 4PG3A 4HLCA 4V03A 5DH9A 1XMVA 3KB2A 2NPFA 2XJ9A 1DG1G 2QRNA 2JLUA 1L2FA 3A8JE 3I4OA 4O2DA 2XX3A 4C0AC 1TPZA 1RRGA 1FOEB 3RAPR 2RMKA 4QY7A 4JYBA 4GKJQ 2G6BA 2KB0A 5BQ5A 4D82A 1XMJA 1YITA 1Q44A 1VQMA 1F2UA 1KO1A 4PC2A 5TV2A 3CCJA 2XSZD 4EPYA 1XXHA 3E5HA 1FP6A 4L8JA 2A19A 2VL6A 4X6AH 1RKBA 1VCIA 2NZHA 2O5JC 4DR3Q 2HYIC 5DHAA 4YONB 4C4PA 3A36A 1Q57A 3KDFB 4MNOA 3SYKA 1D2MA 2ZJZA 3LNNA 1GRNA 4HAUA 4AYXA 2FV8A 4A3DG 2PZGA 3K09A 3T51B 3PVSA 3W6OA 3WNCA 3A37A 5EE0A 3CRKC 3AVUA 3NDPA 1ZD9A 3RLFA 1DAKA 2EQSA 4LJYA 1NKTA 3REGA 3WP1B 2JA9A 2VHCA 4BFYA 3PQCA 1R6BX 5B57C 4QJ3A 4LCBA 4MRNA 3T53B 3VA7A 1HPCA 3GLHE 3I4LA 1VHTA 1R9TH 2UUCQ 2E1RA 3X1ZA 3ZD7A 1QF9A 4ZCLA 2E87A 3CRQA 3KKMA 1NSFA 2MSCB 1NVUQ 3W1BA 1CJVC 3NBFA 4GZMA 4IEIA 3CNNA 4EJSC 4LW1A 2OWOA 3IHWA 3T5DA 4F4JA 4B3TL 1D8TA 1ZCBA 3B1WA 2AK3A 3G48A 3FMOB 3R20A 4MQBA 4PHGA 5GVRA 1UE1A 4BY1G 4A8JA 4IPDA 5EZ5A 4LPSA 4U00A 3ZS9A 2J0VA 4C7OA 4LJ5A 4PAQA 1NE3A 5JEAG 2IYWA 1W49A 4K46A 2WSSD 3NENA 3KQLA 1QVRA 3QF7A 4PPGA 1XNQQ 3BOSA 2JA5H 2W0SA 5CM9C 1SXJD 2IF2A 3EBEA 3PF4A 3CNOA 1TU4A 3IIKA 1CKMA 3J80c 4D4JA 2KHJA 4KLNA 1NP6A 3ZJYA 1NI3A 3EWAA 4OQMA 1Q1ZA 3W34A 3ZIAA 3T34A 1HR0W 1RJ9A 5KSYA 4CF7A 2AD1A 1EFRA 4UJ3A 4P75A 1JR3E 1Z22A 3BWDD 4UJ5A 3IBYA 2UXDL 1SXJB 1RYFA 3TUZC 1Z0IA 4OX9L 1HT2E 3GTOH 4NXNL 2A69D 3OAAD 5E3HA 5A35A 3THOA 2CHVA 4TL9A 1NN5A 5M3FH 4G0NA 2RF4A 4IDQA 4POAA 2Q3MA 2BVNA 2OE2A 2O8BA 4LV8B 1N32Q 1Z3IX 4II7A 1CR0A 4LFBQ 1U90A 2B63H 3NE5B 1LS1A 1N2CE 2GILA 4WXRA 5CITA 4OONA 3MJRA 2GZDA 4PZYA 1NVVR 2FPLA 2J7KA 1CUKA 1JXMA 3DMNA 3S1AB 5JECA 3WYGA 2C9OA 2IX1A 1AS2A 4N0EA 4JSTA 3QKSA 3B2EA 4ZKDA 3CIOA 2UVQA 5M3MH 2WJIA 3MG9A 4NTZA 5D3MA 5B64A 4BGDA 1F2TB 3PF5A 3QPVA 4JL8A 3PUZA 5CB8A 1XZPA 1NMFA 1M1KC 2E76C 2NO1A 3S1NH 3DOFA 3D8BA 1E6CA 3HWSA 4QG7A 4IJMA 1GM5A 1AKYA 1CJTC 1JB1A 1NLFA 2QAGB 3CRRA 3K1JA 1GKYA 4RD4A 5HKKA 4IOKA 1EFUA 1NG1A 2UUAL 2QP4A 1GAJA 5CDFA 2CVFA 2RAPA 3MMPA 5JCPA 2IS4A 1TADA 3KXKA 2R7FA 2PJRA 1D7QA 3LLUA 1A82A 2QZ4A 1VQ7A 3GLIB 2BCJQ 3ADDA 2ALYB 4GN5A 3SNHA 4A8JB 3TVTA 5JJLA 1SVMA 4YDSA 2JJ1D 3NC0C 4IVQA 3EW9A 4OHWA 1UBGA 3U5ZB 3NH9A 4G5OA 4LBYA 1NTGA 1P6XA 2PMKA 4WZAE 2B6HA 2G1JA 4R4OA 5C4XH 1NY4A 2CK3D 3UDFA 4DR5Q 1KMHB 2DWQA 3A4NA 1W3SA 3I92A 1W36C 4QJ4A 2KENA 2ZI9A 2ZT9C 4QHSA 4Y0VA 2J0UA 5DISB 4X8HA 4CEJA 3BFVA 4AKEA 2A5YB 1N9WA 4PTLA 5EE5B 2I0QA 3K80C 1E22A 2NVXH 4JV5Q 1SVLA 3ZDQA 1S3SA 2MSEB 1W36B 4RZ3A 3WRXC 3SGIA 1QUQA 3AP1A 1NSTA 3OPOA 1U0LA 2R2AA 5IP7H 2ONKA 4O2RA 4BBRG 2NGRA 3L7ZC 4GZLA 1CR2A 2CLCX 1KIMA 4H44C 4ZKEA 3THYB 4AKIA 2BHRA 4DV5Q 1IBLQ 2GVBA 2CEAA 3LBHA 3HOWH 2BMDA 3B6YA 2PX3A 4DK1A 3OFNA 3CW2A 3RYTC 2G3YA 1N5IA 4AD8A 2PPBC 3CCMA 1NMGA 1ZMXA 2KJQA 4B34A 4ASUD 2OTLA 3HJNA 2QI9C 1YHQA 2XJ4A 1E2ZA 3NEJA 5ELXA 3JC66 1O7IA 5FUYA 4A3BH 2ZJRA 2ZTCA 1CKNB 2ZI3A 5HE8A 3THWA 4Z51A 4OHYA 1UEIA 4G5GA 2ZSFA 3QXHA 4MRSA 2OAQ1 4LSGA 3EZ2A 2KA7A 1NBME 3CM0A 3KJIA 3CZPA 4E03A 1GUTA 2R6GA 1II9A 2BM0A 4P4UA 3SJCA 3TMKA 4QM6A 1QHHA 1XTJA 2MMGA 3CC7A 1XNJA 2NPIA 1TNDA 1RIPA 3FHCB 3LRPA 1TL7C 5G3YA 1P3JA 3EXAA 3SHFA 1VQIA 4PZ6A 1Q20A 1YHBA 3EPLA 4LOAA 3PEYA 2ZU0C 3GFOA 1QZHA 2AXPA 2RGDA 3ETLA 3GLGB 2QPTA 1WRBA 2RHMA 4TL7A 1KO4A 4HZUB 2IA5A 4XH9B 5JWHA 1FFHA 3B7GA 4DUYQ 4HUTA 4W9MC 4GNXA 3GO5A 4LF5L 4L5QA 1X3SA 4PQFA 3TSWA 4PFSA 2D74A 5FPKA 2XXAB 1N0UA 2HHHL 5B2ZA 4B3RQ 1IYUA 1SE8A 1K0RA 2DGYA 1UJ2A 5EUMA 2ZRMA 4E09A 2IY5B 4G7HC 1KI1A 2EQBA 4KHZA 1PH3A 4YQFA 2D7CA 3LX5A 1LACA 2GK7A 2YWEA 4W5JA 2H5EA 5GJWC 2A5JA 4NXNQ 4LC1A 2PJZA 2ERXA 4IFDH 3EA0A 3PR1A 3TBKA 3F0TA 4OWTB 1TTTA 2F3RA 1AA9A 3I72A 3FE2A 1ESNA 1E2MA 1SVKA 1NMXA 3A8TA 1WF3A 1XB2A 3V00A 2OEPA 3KXIA 4UPAA 1FUKA 2VUMH 4LWZA 1D8LA 1SQ5A 3SYLA 4PZ8A 3E2IA 1IJFA 4L4UA 1U2RA 4TMVA 4GOPB 1EFHA 1R4AA 3Q85A 2MO0A 4MITA 2ZREA 4OQXA 2WFWA 1CXZA 821PA 3UIEA 1BS1A 4C3JH 1G4UR 2CW0C 3EC2A 4MRPA 2TMKA 1IXSB 5JWOA 3U7EB 2FE4A 2GAAA 3NBYC 1JJVA 1VQEA 1GITA 1N6LA 1P9WA 5C0XI 5DO9A 4JKIA 3RRNA 1W46A 4I81A 4NYMQ 1IN5A 3MWKA 1R0ZA 1JPNA 4IFDI 2RGCA 3HYTA 4ILEA 1G8HA 1E9AA 4OGQC 2DNEA 1VQ5A 3OE7D 1VF5C 3AB9A 1L7VC 2I4IA 3ADKA 3ZGXA 4Q9IA 2PMZE 2W0MA 1LABA 3NTUA 1MR3F 3W8NA 5KPDA 1HURA 3W3AA 5DLQC 4AC9A 1S3OA 1WCV1 2RB4A 2ZQ5A 1GP2A 1GWNA 4KBFA 2H18A 3NHBA 3FHWA 2UU9L 3GTGH 3QOFA 5FOUA 4B3GA 3PUXA 1ASZA 1Q1EA 1T4GA 5IDVA 4DVGA 2A8VA 1VIAA 4DNTB 1K8GA 1PYBA 2A6EC 4EQ6B 5H1SE 1VYVA 3N6RA 1Z5ZA 2XB2A 4LV6A 3VFDA 4AKGA 4HAVA 1PH4A 1GTVA 4DR4L 3G71A 2W6IA 2Q3HA 4NB3A 4YWMA 3O47A 1PLKA 2ZJOA 2OCPA 3SR0A 5EUQB 4I1SA 4H13C 2CE2X 2VRWA 2W6JD 4JLKA 5DN6D 1EUJA 1L1OC 4A3GH 2UXDQ 1CP2A 1CR4A 1N6HA 3GLIA 5FBWB 2FZ4A 4OX9Q 2JA8H 1OFTA 1XCMA 1WJJA 1JJCB 3RNUA 4N0DA 1VTKA 2O5IC 1C9KA 1Q12A 4JL5A 1G8YA 3K70B 2LCFA 3QXSA 1P9RA 2CLSA 3WXMA 4F92B 4JLBA 1Y1VH 1X8KA 2WIBA 2FFHA 3M9BA 4QFMA 5KHOC 2SHKA 4A6XA 2JAQA 4TTRA 1YJ5A 1IBML 5P21A 4RCNA 2I5LX 4B3MQ 1HNWQ 1MO3A 3AF2A 3PV0A 1KRTA 1FL0A 3HR7A 3L82B 4DV5L 3TIFA 3T1HQ 1GDDA 3OTOQ 1KQSA 2RH5A 3DEFA 1SMXA 5GAGC 2KCCA 1L4YA 2HF8A 4PHFA 3T1TA 3AVYA 1T6NA 5EXPA 2IS6A 1VQKA 2WJHA 1VQFA 1QVGA 1LVGA 2AXNA 3DZDA 4XWKA 5K8IA 4Z1MD 2Z43A 3EWSA 1T5LA 1SLJA 3M4QA 4GT1A 3CMEA 1BH2A 1ODFA 2D62A 4DCVA 4QNMA 2BE5C 5GAEC 4XD7A 3IKJA 3PO3G 1G51A 3TS2A 2RGNA 1TWAH 4LUCA 4LUZA 3GMTA 2VSXA 3O8RA 1VG0B 3IQXA 1UE5A 3P1JA 4WBSA 3BH7A 3N2IA 4DB2A 3QG1A 1EGAA 1NMZA 3OESA 4JVSB 3K53A 2ZVQX 3U58A 1O87A 2FH5B 3U2QA 1ZNWA 1Z0KA 2K5VA 1R8QA 3GJ4A 2JLQA 2IS1A 1DEKA 5TVKA 4Y7NH 1NJGA 3A8IE 3HOZG 1GG2A 2XNDD 2ZAOA 3K9GA 4PPQA 1HNZQ 1NBMA 1GFIA 1JR3A 2ZRNA 1CKNA 4N3NA 4TQ9A 3THWB 1KRSA 3GLGE 1E1QD 1XNRL 4TLDA 4IOAA 5JSZA 5LD2C 4V02A 2HHHQ 2GXAA 2BM1A 1X56A 1TAGA 4JBWA 3A6PC 2J7PD 4JL6A 3UWOA 4K8OA 4RFVA 2PNHA 1GKUB 4UXJA 2GKSA 3CX8A 4A2WA 1W0KA 1R5BA 1KAGA 4JBYA 3GLGA 1Z6TA 3UMRA 1VQPA 3WNBA 3W6PA 1HNXQ 3CPFA 3RN2A 2YOGA 2V1XA 3KKPA 2CL7X 3K0CC 4IOJA 1JBKA 3JVVA 4ESHA 3T56B 2XTZA 2YC4C 4QJ5A 1FNMA 2WB1E 1EG7A 2ANBA 4GMXA 4ZDIA 5H8WA 1GUGA 1ONBA 3CP0A 2ZJQA 4M9QA 1I6VC 3RZDH 2WOOA 4RMFA 4V0MA 1X3GA 2NZ8A 2D2EA 3QQ5A 2X1VA 1Z2CA 2J3EA 4NPHA 3ADBA 3DVLA 1OB2A 3W6NA 4GOXA 1QDEA 1SKYE 2FNAA 1VQ8A 3QG5A 2PZFA 2ZUCA 4UNSA 3RRYA 1Z8FA 3L0PA 2GVAA 3FKSA 3I4NG 3ADCA 3IUYA 1HYQA 4BUJA 4O3MA 4TZ0A 2ECKA 1Z07A 2HCJB 4A3IH 3PO2G 5G3ZA 3C5CA 5SZKB 5F3WB 2QROA 1E9RA 3PUWA 1Y1VG 4EJSB 5FH9A 1YZLA 3W1GA 4NCJA 2YHSA 3OIWA 4DSUA 2Z4RA 5HCIA 5L3RA 2OBLA 1HUQA 2VQSA 3U4ZA 4M1WA 4OHVA 1GSIA 4R71A 1G8PA 1TMKA 2OESA 3ZVNA 1JAHA 1A7JA 1G3IA 2DWOA 1LYLA 2ONJA 2KCTA 2W2XA 2ZTEA 1Z47A 1Y14B 3CD6A 1BMFA 1PLLA 3AKEA 4URVR 1Z6YA 5CB6A 4HSEA 1XXHE 1H9KA 2XZPA 4US2R 3BC1A 5BW8A 4PC1A 5KDOA 2HUPA 2VPPA 5CDFE 3CF6R 2OLKA 3LQRA 4NKRA 2QP3A 5EE9A 4QXAA 3C8UA 3O8CA 3VKGA 4JLAA 4YCUA 2UZ3A 1Y1WH 2ODBA 1AQUA 3EZ9A 2ZPTX 4KSCA 1LB1B 4MDFA 5HTKA 4XVRA 5JJKA 3PJRA 2Z83A 3CCEA 3RVBA 1Q86C 2IXGA 4BZXA 1ZW6A 4DV3L 2KI5A 3CWQA 1HR0Q 1H8EA 4EFMA 3IBGA 2PQAB 1K8RA 1Q0UA 1DVRA 2QORA 1IY0A 2AR7A 3ZQ6A 2OSBA 4GBMA 1WQ1R 4KJZA 2ZM6L 2O52A 4GKKQ 1Q90A 1VQBA 1G9XA 3ONWA 1ASYA 2PCLA 1ZM4A 4TL8A 2AKAB 2GJ8A 4FD2A 5JEAH 4A1FA 1KK2A 2F3TA 1FJGL 1K5GA 5J4KA 3RZOH 2UUAQ 5H1YA 3T12A 1FW6A 1HZAA 4B3ML 1HNWL 2WSSA 1M7BA 1RRCA 4TQUS 1DAHA 1YR6A 2ZYVX 1LM0A 1Z0FA 2ATWA 1QZXA 4DLWA 4FDBA 2JATA 3T15A 3LBIA 3B85A 5F98A 1J2JA 1MIUA 3PG5A 1I6HH 1OKKA 3W5IA 3E70C 4I99A 1S0UA 4AG6A 4XVQA 1KO5A 4GOJA 4IW3B 4CW7A 4Q4HA 3TREA 4KFSA 2J7PA 1NKSA 3PEVA 1KK3A 2VLIA 1UWVA 4R4QA 2P0EA 5ANRB 5JLJA 4BFUA 4TQAA 2WTUA 2OM2A 4WVFA 4QNRA 4C3ZA 1XCGB 2CJWB 1G3MA 3WY9A 3NDBB 4JI8L 2JLXA 3DKVA 4DLZA 1HEIA 2ZYUX 5DI3A 4NONA 3WMFA 4CYMA 1W48A 1MO4A 1A5TA 4G5RA 3AP2A 4JI6Q 1T8TA 5K8LA 1GNPA 1JEEA 1B9MA 3M4PA 3U4VA 1X65A 2UU9Q 2A9KA 2BJVA 1SVSA 5FBQB 3WBKA 1V8QA 3ZVRA 3IEVA 5SZHB 3DXJC 2NZOA 2DR3A 2YC2C 1QG2A 2ZROA 5CLLA 2K5HA 5HR5A 4U7DA 5FOWA 1JR6A 1H8HA 2VTKA 4DR7L 2EXDA 4IPHA 4HDQB 1IBKL 1SVWA 3TK1A 4FWIB 1D9ZA 4S2EA 3RDPA 3BG3A 4BBRH 4KN4C 5D3MB 3SU8A 3WRYC 2YV5A 5EP3A 2JA1A 1U99A 1EWIA 1DO2A 1OFUX 4KBGA 3CCSA 4Z8YA 3GEIA 1VQDA 3AM1A 3BB4A 4YWKA 3TSZA 2QEXA 3F2DA 3RS0A 3PITA 4HR7B 3HOUG 1S3GA 1E2VA 2CQOA 1IAQA 2BA0A 4UNNA 3GTQH 2UXCL 4Q4LA 4BA1I 4DAMA 3TQCA 5FOVA 1EFCA 5BXQC 2REXB 4PR0A 4QIWE 4PO9A 2X19A 3I56A 3R7WA 4YY3Q 1N34Q 3G82C 1E2KA 2ZSEA 2QSYA 1CIPA 5CLQA 2QMHA 1N6PA 1X6VA 2ZE5A 5KNDA 2N78A 1IY2A 1AGRA 1G3RA 1XTIA 4OKSA 4YLGA 5EP2A 1Y63A 1UE7A 1BBWA 3IPYA 3SEAA 1FZQA 1YJWA 2CNWD 1WYDA 3O8DA 4Z54A 1ZM9A 4RZUA 4GS3A 4DR1Q 1KI9A 1OPXA 2GCOB 5KDDA 4GSYA 1E9BA 2WOJA 3B8HA 1H8ED 2WHXA 1MJEA 1VQ9A 2IYSA 1D6JA 1X1RA 2UXBQ 1KYIA 4Q9LA 3IO3A 2Q0HA 2PMDA 3N70A 2BH2A 1S4QA 4HZUA 2VH5R 1P72A 2VP0A 3I32A 1JQJC 4JS0A 3MFYA 1YBYA 1KI6A 1VG8A 3G0HA 4D25A 3AEVA 3U3RA 1P2UA 3ECCA 5KYKA 1VF7A 1IYJB 3BJIC 5BYKA 2WAQG 1L1OB 4D0GA 1ZU5A 1K8MA 1E1TA 1OSNA 2YWGA 3QY0A 4H9GA 1JMCA 2R6FA 5FJ8G 1OKKD 1E2GA 1S8FA 5IT5A 4P71A 1DAFA 2ANCA 1YR7A 3Q7QA 1KD1C 1XWIA 5IYBG 3AUXA 2WPDA 3CPJB 1U0JA 3MUFA 4DC9A 4QL5A 1G17A 4A8JC 3SBEA 2QT0A 4BFWA 3CCVA 2V3CC 2ZR0A 3VU9B 3WNDA 4IHQA 2E75C 2CCKA 1CKEA 2JCSA 3U4QB 2NZJA 5DYGA 2Q8IB 2Y0SG 3HOYH 4XSHA 4B75A 2CL0X 1NVVQ 2V7QD 1QG4A 3A0JA 3D3QA 4UNPA 3RANA 4A76A 1E2DA 2GZAA 3TR0A 2CWPA 4F91B 2EWVA 1W4AA 4KAXA 4Q4AB 2V9PA 1X8JA 1JECA 2FSHA 2QEQA 3IEUA 2W83A 3K0EA 5FL7D 1NIJA 3NBZC 4RVCA 1NBWA 4DRZA 3OIVA 4Q02A 4TMWA 4CT5A 1XMQL 1W4CA 2ZXUA 3U61B 4CEHB 4L15A 4HB2A 5E4FA 4FCVA 4P33A 2QTHA 3A1TA 4Y52H 4LPKA 4JLMA 1H9MA 2XGJA 1FYCA 2DN8A 2BOVA 1HQCA 5IP9G 4G7ZC 4ACBA 1JJ7A 2OG2A 4D4MA 3CUEF 1KI2A 1XRJA 4LUOA 1I94Q 1HT1E 1TWGH 3UMSA 3ICEA 4POGA 4B33A 5FPTA 2JIZD 4LYJA 3QI2A 3KDFA 4PQRA 2OBNA 3DM3A 1I4TD 1Z28A 2BDTA 5FFMA 4PXAA 1G41A 2H92A 4A4IA 1KNQA 4V0KA 4DEXA 4DLUA 4A3JH 3ZQJA 2RGXA 2Q2TA 1S72A 1CLUA 4DR7Q 2O8BB 1VQJA 1AZTA 3WP0A 4HIMA 3X1WA 4GI7A 1KTVA 3NIBA 1XD2A 3CZQA 1Y8OB 2GXQA 1ZRHA 2VSOA 2LSSA 4B3BA 4JBMA 1PA6A 1SKYB 1U94A 1XEFA 1IBRA 4BE7B 2QP9X 2A6HC 1X8LA 3AB3A 4XVUA 3HOZH 2IYQA 4BZQA 3LH5A 2EFDB 2O8CA 2DY1A 1K73C 3HFZB 4GP6A 1EQQA 4IFBA 3D4RA 2LXKA 3BH0A 4RFSB 3H2YA 4GLVB 1YZUA 3ZZ0A 4MYUA 2Q21A 4TZ6A 5G53C 1O3YA 3EIHA 1RJ9B 3JVUA 4OI0A 4GKKL 4GOKA 4DJTA 1KI7A 1UBCA 3FPAA 4D6PA 3PO3H 1G21E 5CK4A 5JEDA 4IFDJ 4NCIA 1YIJA 1E2FA 3NEYA 2IUUA 3EIVA 3OAAA 1DELA 4RD2A 1FMLA 4M2LA 4OK3A 1TF2A 1N33L 3LY5A 4JKYA 1N0WA 1O78A 2JQOA 2F43B 3AF0A 4HUQA 1P9NA 3SC3A 2XEXA 4BLPA 4J15A 4JYAL 1LY1A 5C0XG 2VBCA 4B43A 5IHPA 3KF8B 2P6NA 3V4RA 1HZCA 3S2HH 1U9IC 3HP1A 1VS0A 5BR8Q 1Q8KA 1P73A 5FUXA 3W3ZB 1LNZA 4HLUC 2AUKA 1HJPA 4PMWA 2ZJPA 1M74A 2EYQA 4JK1C 1ZJ6A 3IHLA 3PENA 3REFA 4GOPC 1TU3A 3R8FA 1FGUA 3T61A 5GADl 2ZRLA 4DHEA 3JAMi 2YWHA 4BFSA 3EARA 1YRBA 1HTPA 4HJ5A 1BKBA 1X1SA 2WV9A 2WWWA 2PNRC 1VYUA 2GWHA 2CVHA 3KJGA 4FMDF 4GOPA 4P4TA 4GKJL 3Q72A 5CM8B 3L43A 4R2HA 2ZRFA 5CK5A 4Q1CA 2JA8G 1TKWB 1SMYC 4X64L 1G6OA 3HOUH 4LWCA 1QHGA 1W1WA 1KAWA 1XMOL 1WCMH 2C95A 2CCGA 3VR5A 2YJTD 2XTMA 3GFPA 3LV8A 4DR3L 3PIPA 4IDNA 4M1SA 4DKXA 3CPHA 1ZKOA 1DPFA 2BBWA 1DXMA 1FNNA 1OFHA 2OCYC 1Z0AA 3EAQA 4Q00A 2QE7A 3AVTA 3AVXA 5AJYA 4ALPA 4QGGA 1OTCA 3AQQA 1TXYA 3HKSA 1YNJC 3QKRA 3RC3A 4ARZB 2BKEA 1I4DD 5DIFA 3M4YA 1E2HA 1E7ZA 2HQLA 4A36A 1II8A 1C9OA 1P2SA 1TUEA 4B47A 2H8KA 3ZD6A 2ZITA 1M6NA 1GUOA 1EFWA 1MT0A 1U8AA 4L9SA 3H0GG 2JA6H 2N42A 4LJ9A 2QG6A 4EFLA 3LXRA 3ULPA 1A2BA 1EFRD 4X65Q 2AK2A 4U5XA 1GL6A 2IC5A 3TW4A 1XD8A 2CCJA 4FMCF 5HZHA 3PUVA 1JB7A 1HQYE 2ZR9A 4EQ5A 4HLUA 1J99A 4B3TQ 2V1UA 2BH8A 4YY3L 4IO9A 4W5HA 3T1VA 4BZPA 2PLFA 2XTNA 3VR2A 4JT4A 4Q47A 1OYWA 4S35A 1WB9A 4DUZL 1K5DA 4YMSA 2F43A 2ZSDA 3KX2A 1GIAA 3QENA 1TWFH 1UEBA 3CCLA 4B3XA 5AUOB 2ZE7A 1G20E 2WJYA 3FFAA 3QKTA 4YC7A 3QXJA 4IFEA 1OYYA 4HDCA 4ITRC 4R98A 4DR1L 1WXQA 4H0LC 1W7AA 1W5SA 1M7GA 1YZTA 3TQFA 4YXWA 3SZRA 1KDOA 2IYTA 2YOHA 1RL2A 1FX0B 4MTNA 1HH4A 3QPWA 3FHTA 1MABA 2UXBL 1I94L 2CLDX 4LFCQ 3DM5A 3L2PA 4A0RA 2QBYA 1HA3A 4X66L 1ZD1A 2ZIAA 4A2QA 1T0HB 2BC9A 2OQ0A 2ZRAA 1W5TA 3CB4A 2G77B 4F7WA 2NO0A 1N5KA 1R0XA 3NH6A 1YQTA 4DV6L 1XJCA 3B1ZA 2G88A 3QNUA 4Q1FA 1EIYB 1ZU4A 4ZCIA 4KKUA 1YRAA 1I2MA 2VP2A 2RGAA 5FBVB 4FN5A 2FFBA 2H16A 2QPOA 4KITB 1OH8A 2H17A 2EFGA 2D3WA 4BLOA 4KHPL 5JI2E 2NTYC 4Q9JA 1Z6HA 1BVSA 1FJGQ 1EFTA 4A3KH 3AP3A 4DCUA 3CW2C 2WWIA 2VZAA 1AKEA 1LTQA 2ODWA 3CLVA 2QRZA 3LW8A 1NLZA 3M1IA 4OI4A 4Q66C 2IX3A 3SFZA 3CRLC 2GESA 5JCZA 5IT9c 1CU1A 1Q3HA 4GNXB 4HLDA 3RLNA 3EASA 2Y0SE 5JHGB 5GQOA 1FL9A
chains in the Genus database with same CATH superfamily
5I4DA 5EEHA 1M1YB 3HRZC 5K3EA 1HUMA 2DUMA 3IVCA 4KOEC 2G1UA 1TQOA 2Z04A 4LZOA 2XYGA 5DX1A 4D43A 1G6HA 3KJEA 3OLQA 3VJKA 2WYVA 3HZRA 1CSPA 1TU2B 1BCPC 2IOYA 4F38A 1P7VA 1J33A 1Z0DA 2ZBPA 3KTAA 3QJYA 1E58A 4Y2UA 3W5SA 1Y9EA 1AP0A 2O8FB 2E2HH 1MLDA 2F9LA 5D87A 1G1AA 1YQ9A 4LISA 1TKRA 3VR3A 3DB2A 1CQWA 1QO7A 2BW0A 2I71A 2X4GA 1A7KA 4YMTA 4DXGA 4FO2A 2Q2NA 1DUSA 2O8NA 2UUPA 3PPXA 4NI5A 4Q48A 1VQ1A 2YJGA 3FZEA 4EG5A 5CD1A 3SK5A 3OPQA 2C4TA 1WZ2A 3JQPA 1QTRA 1V3QE 2CXUA 3H75A 3OO1A 4TKVB 1Y1WG 1PH6A 4HB3A 4UTXA 1ZIYA 1G64A 1M6VB 1UDAA 1WW8A 2FVYA 3PJEA 4B2IA 4CL0A 4DR6B 2JJQA 3ZYYX 1UJNA 1QE6A 4WCFA 1XTPA 2GCNA 2JZNA 4QKQA 1YBFA 3GA5A 2B63G 1IXZA 1VMEA 1T4DA 1NXVA 2ZRDA 1WM1A 3FNHA 3KYDB 4ON9A 2BP7A 4DK0A 2W2NA 4JGBA 2QN2A 4N3AA 1E94E 2XB9A 2BBOA 2HRCA 4MCAA 4C43A 4FLEA 3VU9A 1EK0A 3SVMA 4AECA 3VO8A 1P4JA 2FPKA 2JDID 2PHZA 2Y2UA 2Q7OE 2ZUSA 2WD9A 3RSHA 3FNEA 2XNHA 1DQNA 1LLFA 2Y77A 4RKQA 1MH9A 5IULC 4C0HA 1WL8A 3EIFA 3E9EA 3HWRA 3PEUA 3O0TA 3VOTA 2RKSA 4Q34A 3MUEA 5KQRA 4YAKA 1LK5A 3PQ8A 4XYQA 1VMIA 2OT3B 3NGXA 4GRDA 2CJPA 1LTLA 5AHRA 4Q1FA 1OFGA 4DM7A 1TY0A 1JFVA 2NMVA 4LJSA 1SHKA 1IUNA 1CR1A 3WZ2A 3ZGLA 4TMZA 2VTBB 1EY7A 1MJCA 3F2CA 4US1R 1ETUA 5GZ1A 4GL2A 5KEEA 5EQ0A 5ILGA 4LTMA 1NV8A 2I2WA 2R8XA 4YP0A 5EHIA 1XLVA 3O91A 4JEHA 3UANA 5JOBA 3IIMA 3TUIC 3Q5GA 4B0PA 1GPBA 1LTHR 2Q3CA 2DFVA 5T6MA 3ZXIA 5IZ4A 3AEKB 3M4OH 3NANA 3HKBB 3DMDA 2GF9A 2X5XA 3IOYA 3MWLA 4HQRA 3E3OA 4HNAA 1KEPA 2QE6A 3MLBA 4MEAA 4WCVA 5EJFA 5I8PA 1F2MA 2AG6A 3CJQA 4FDLA 3RS9A 1ZUNA 1KHIA 1EU1A 4BO6A 1E32A 1EINA 3OCZA 3DE0X 5KKNB 3NHZA 4IOMA 3T9FA 4CT0A 3IMFA 1PZNA 2Q8QA 4G57A 1JQAA 2W58A 3K58A 1VLHA 2O05A 2WA1A 1DTWA 2PVCA 4IV0A 4I7ZC 5G1OA 1Y3CE 3NWBA 3UK1A 3H9EO 1KAQA 2W6CX 4RACA 5C32A 1GZ4A 2VS1A 5JXGA 5FJJA 1DWOA 2JLSA 3GK3A 1XEXB 1GGHA 2GF0A 5CYFA 5IJ0B 1EDOA 2BEWA 3QB3A 1PMRA 4JMPA 2ORVA 2VL7A 3AETA 3DT8A 3KUCA 3TIIA 4ETIA 5AW4A 4DV1Q 4N3GA 1WVLA 3K0AB 3TJZA 3WDSA 1K89A 4L0DA 3D6JA 4CMHA 4TLEA 4CM8A 3SZOA 3EDMA 2OV2A 2PR2A 4BCCA 1KNXA 3ISJA 3GDOA 2ATXA 3NIGB 4FK8A 1RYBA 4Z6KA 3O8NA 4QREA 4UHBA 2IOQA 2ZXPA 4ZOLF 3ZLUA 1XAHA 4N9PA 1VHLA 2IGBA 4RESA 4YCAA 3B2NA 3MJ4A 2JBAA 2G09A 4MWBA 3UV3A 4HBZA 2GRUA 2EW8A 3K4HA 4GR5A 5HM6A 1TM5E 2HXYA 5LP6F 2J0QA 1DBPA 1MN6A 4MGZR 1QLJA 4M1TA 1Y8NB 1TQ2A 3A9RA 1AB6A 1C1DA 2WG2A 2WKRA 4LF4L 3GMIA 1J90A 4TSKA 4ZU1X 1Q82C 1POXA 3K94A 2R96A 1IPHA 3LVRE 3PNKA 4S1TA 1HSOA 4UEKA 4BA2I 2QJWA 4KREA 2JFBA 4HXGA 1ZISA 3MWGA 4QXOA 5HF8A 3TW6A 2X0KA 4FKMA 2OWDA 4J7CA 3I6IA 5IBRA 3VTKA 3FRIA 1ECBA 3PIP3 3Q24A 1Q7TA 2HBQA 2VJYA 3KTAB 4J94A 3SHQA 5C4JH 3E81A 3OZDA 4AJ2A 3HOXB 2JF0A 1VKHA 4AQDA 5HM8A 1T8WA 2W6ID 1CT9A 2WUEA 3MMNA 3A6HA 1AFPA 3U26A 2VYVA 3WJ2A 3FWHA 3PQIA 3KZCA 1JJFA 1N36B 1VC2A 2XMQA 3JAMA 3DHYA 2I1LA 3PPIA 4UUPA 2SCUB 3ZKWA 1V96A 1G1MA 5C1DA 3P8ZA 5JMOA 3K6OA 1XTQA 2GVNA 4Q3LA 1Q1BA 3BB3A 5JNLA 4FYVA 4OXPA 3HI4A 1U0GA 2VDKB 3INRA 4XB1A 5KREA 4CF4A 2C00A 2C7GA 1RAAA 4URZR 3F5SA 1IWBB 3O4HA 3ZZNA 3TP5A 1SKAA 3DBOB 4OHMA 3T0GA 1SN8A 2BOSA 3S27A 4AZ0B 2Z1CA 3FJOA 4LRSB 4Q5VA 4YROA 5A05A 2NN6I 2Z30A 4NBRA 4Q4AA 1FPQA 5C3WA 1EWKA 4FDMA 3UICA 4NG5A 3UT5B 2VQEQ 3EOZA 2AOUA 1TTPB 1AMOA 4N65A 4Q7LA 3PIIA 3K1YA 1KQPA 3HYRA 2YMMA 2B63B 3DH0A 3LWZA 1U4LA 2QRGA 2WAQB 1EY0A 4DR6L 1HYHA 1TE2A 2WHPB 4M98A 2PXAA 4X66Q 2ZBDA 2Y68A 5KDLA 5A4AA 5J58A 3GT4A 2WVHA 1TM7E 2XWQA 2O8EA 3WISA 4HRXA 4N9QA 1GQRA 4A8TA 1FUYB 1K75A 2CBXA 2FEMA 5C37A 3SF8A 1SBTA 2PBZA 4FFBB 4BZWA 2PR7A 1E63A 1FLDA 2XNAC 4MW6A 4XW2A 5FPSA 3OEED 2JCBA 2XMRA 4PZ0A 2VP3A 4IH1A 3TLJA 3WI7A 1NVBA 2QLBA 1L0YB 1K5HA 1BYUA 3N2LA 1GKIA 2BGKA 5E3IA 4CIAA 3SAJA 5FCDA 5TVGA 1L7AA 3R6LA 3A4MA 4IHJF 3IFTA 2VEOA 3BBPA 3D7MA 4O4IA 1YI2A 5AJXA 1CZNA 4F1KA 3ZQUA 4A93H 3WAJA 2XNDA 4YCBA 2W43A 3U49A 1JSCA 3RW9A 4BJHB 4GN4B 4E2WA 1UF9A 4JFRA 4EJMA 1B0PA 4YAFA 4ZMSA 5BURA 4UTNA 3G49A 4Q9AA 4C1NI 5IAKA 4A3CG 2WYOA 1N8TA 1FX0A 3ROTA 5EIFA 2CLHB 4ID6A 4LSWA 4MR7A 3URYA 3OOJA 2MO1A 4AUMA 3P27A 3EXIA 1UEAB 1GZ3A 2GBIA 4WBNF 2O20A 4G5YA 4NBSA 1GKHA 5EIBD 5A7HA 3C3CA 4Q6WA 4HNUA 1U4MA 1LTAD 1P91A 1X7GA 2Z9CA 4RA9B 3BRWA 3OSUA 2FWNA 5F2DA 3EE6A 1DEXA 1FR3A 1Z8DA 1IZ6A 1EWHA 3C1FA 1ZK4A 2DPLA 4JGIA 5BN3A 3O93A 4UUNA 3ZY6A 3ZYCA 3AVOA 3TFOA 4AY2A 4KGZA 3OZEA 1KF0A 2UUBQ 3AHFA 2ZPAA 5MFPA 2O8DA 3CLHA 1H6BA 1BXRB 4ZFNA 1KIFA 2R5NA 1RIIA 1TR5A 2JIZA 2WW8A 3E1KA 4LDPA 3T5CA 2N3ZA 4D9GA 1YR2A 3WGLA 5G0WA 4OYLA 4MUNA 1RCTE 4UEQA 3ROGA 3KUDA 1SHUX 3M6XA 3PNVA 2CXHA 3OC0A 4P81A 3L8GA 4EG3A 4EO9A 5KPJA 2B39A 1TRKA 1IQUA 2ZS8A 1TEVA 2NIPA 4UNIA 2FJUA 3W6ZA 5ALRA 1WBDA 3OHSX 1P5ZB 2J33A 4KWHA 3VOAA 2LDXA 4DIMA 1KO7A 1KYXA 3DCYA 3PDIA 4KQMA 3UV7A 5HZGA 9LDTA 3BFXA 3DCNA 4DAVA 2WMDA 1YKSA 2H7VA 4JI6B 2OO5A 4B9WA 3JQAD 4UVDA 4X85A 5LYYA 1E7YA 3AUFA 3TMYA 2B1RA 3X43A 5TEWA 5AM3A 3FVVA 3LFHA 2RC6A 2NUCA 3B13B 4G5SA 2ILTA 3S14H 4X65L 4Q05A 4OTZA 4KXFB 2GBPA 4LF4Q 4O4LA 3OEHA 2HHJA 5LQSA 2Q2QA 2R11A 4KFTA 4PSUA 3T0IA 1MHTA 4CEIB 3GFVA 4J8QA 2ADMA 2L5TA 1ECJA 3SQMA 3PXAA 4HX2A 5GAJA 4B73A 4QM7A 5J5CA 1G5FA 2PMCA 3FUVA 2Z3VA 2UAGA 5REQB 4FT4A 1ENOA 2RKOA 1Q0SA 1RE0A 2QW1A 2QSZA 4QOFA 3FDTA 4WOBA 2EWMA 1PLFA 5E0KB 1Z6XA 2D06A 2G0AA 3E3NA 3W05A 4G0PA 1JFTA 1IJEA 1TVKB 2QSUA 1F9SA 1F6BA 4GMHA 2VYNA 5HF5A 4M4SA 1VKNA 2IYLD 3PRJA 4FYMA 4IMPA 3RRFA 3Q1KA 4BATA 4UCXA 2PPVA 4A75A 2DUJA 4TMYA 2WAYA 1P3Y1 1LTID 4R9WA 3OW2A 2A1UA 3HBNA 2HOQA 4YHHQ 3HEJA 3A1CA 2QB5A 3DZFA 3NIWA 3S16H 3QBVA 4RTMA 3JZMA 1XNHA 4MRRA 1E3EA 3AOEA 4L4YA 1Q0RA 4JMLA 2QDXA 4EDFA 4A3FH 2FAXA 3ZDFA 4JUIA 1HG0A 4PX9A 5EESA 3QVGA 1SRQA 3FCSB 2FG5A 4A3EH 1IZ9A 3W3ZB 3ER6A 1GVNB 4X9XA 1VIYA 1AXRA 3BTUA 1U4OA 5AKIA 4J0EA 2I4TA 5SYNA 3HH8A 3RUPA 4CCAA 3WWPA 5KNLA 3GGOA 2EW1A 3BG5A 4REQA 5LU8A 3L05A 2BI8A 1OZGA 1DBWA 1DX6A 2JBHA 2GXUA 4WZBB 5EWMB 3H2GA 3RK0A 5CA0B 3LT1A 1MEOA 1CDDA 2Y1WA 3D5TA 3D6UA 3NPPA 3C6BA 2CUTA 4NK5A 1EEFD 1A9SA 1KDYA 3E4CA 4GPZA 4K6KA 2K50A 1WD0A 1ZYRC 2QUAA 3K59A 2E6KA 2R86A 4FXDA 3W3AH 4EKDA 2NVOA 1VZ2A 1N2OA 4BKMA 3YASA 3PLAE 3DZCA 4IVRA 3UN1A 1JWLA 3CT4A 1PFMA 2CW5A 1YVDA 2P3SA 2AQ3B 1QUFA 4OHZA 3AKZA 4IYJA 4BPBA 3A5ZB 3U56A 3OQVA 3L1KA 3ESBA 1I9CA 3LOQA 4EAQA 2V3CC 1KI3A 2QD5A 1L4FA 1WNTA 2ZM6Q 1YRLA 4NXML 1OILA 2GN6A 2H2IA 4KVAA 3IXLA 3C87A 1NW9B 3K8YA 2EZUA 1WEKA 2FF5A 1ZOSA 2E2WA 2VHTA 2WYWA 3BREA 4FHFA 4BBPA 1S2OA 3G5AA 3KOUA 1QV6A 3DM9B 3EVZA 4HQ6A 4L50A 4CMAA 5HHTA 1ZQ9A 2E49A 2ZXEA 4HATA 5D2CA 5CYPA 1JQLB 3S2SA 3VZQA 5HWSA 2DHEA 4G7OC 1EVYA 2YWDA 4P3XA 4QTXA 1TKCA 4FFOA 1HL3A 4YP6A 2HQEA 4MWTA 1ZVVA 3DLTA 3FYDA 4DNRB 4OIMA 5EWLA 2C04A 2Z4HA 3TAXA 4QG3A 5LBTA 4PRLA 4KLZA 1M75A 1EFVB 2IXFA 4ZDKA 1RC8A 1AZWA 4UASA 3LCRA 2PU5A 3MEFA 3H3VC 1A9QA 1M83A 2O7QA 3HB5X 1C2YA 3KEQA 4HB4A 3H6HA 3QA9A 3A9VA 3HDTA 3TLGA 2E7ZA 3EG9B 3QLTA 4M37A 5CLGA 2YW2A 4BEJA 4CLOB 4UQLA 1U8XX 2J3KA 3VVMA 3ZG6A 3KQQA 3M9LA 2XHZA 3T9EA 5AICA 2O0MA 3U3JA 4O8CA 2D0OA 3WMGA 3OQOA 1PZFA 4JCCA 5EJEA 2B5OA 2GXSA 5HMMA 3SM3A 5C5LA 5CNJA 1DX9A 3KXDA 1F14A 1M8GA 1FVFA 1I7PA 2FSGA 2O2HA 2PZWA 2WJ4A 3QE4A 1PJ3A 3E6ZX 1I2ZA 4ZVSA 5A0FA 5K8JB 1T29A 2WMNB 4QGSA 1HTLD 3D6FA 2A5FA 4LHVA 3S1QH 1XUOA 3BHMA 4I55F 4PSCA 4B9AA 4X3CA 5C4GB 5EQFA 4BLRA 4EJ0A 4FNFA 2F0PA 3ANXA 1F2UB 1YD7A 4UW9A 3T52A 3KEFA 2RFLA 4K81B 1Q3LA 3MWDB 1OA0A 3SOPA 3DXXA 4BFZA 2FWRA 2KS6A 5IAOA 1M34E 4BQFA 1ML0D 3W5JA 4BGUA 1PWHA 2R7AA 4LHEA 4QX6A 4WMLA 5DTEA 3OMCA 4AP6A 3GD5A 4O0AA 1TLFA 2JIRA 2ZXOA 2XVXA 3UBMA 4LY3A 1TYZA 1YB4A 4JR0A 721PA 4EY6A 2QAGA 4AUNA 4F4DA 4R6WA 2CXQA 3OUUA 2PD6A 2V9ZA 3SI7A 3QF4B 3UB2A 4JLUA 5I01A 1GYRA 1UC9A 4L5TA 4DPGA 3SR4A 2CZCA 1JYFA 3T5GA 3M5DA 1NG9A 3P75A 1UAGA 3M34A 4H7DA 1ZHOA 1JMYA 5CIQA 4D45A 3GLUA 3DT9A 4NBKA 1JB3A 5CCDA 1OOEA 3VR2D 2Y0EA 3VDXA 4DLTA 2F90A 2F3SA 2V55B 4G84A 4P3YA 2J3IA 4RXTA 2R92G 1NNEA 4NX2A 3BMCB 4ZV9A 1CB0A 4G89A 1J5XA 4FTWA 1NUSA 2GVDC 3RC9A 2C29D 4BJ6A 4Z7QB 1QAQA 4CJXA 1RACA 2A68C 2JXMB 5T1GA 1GZHB 1RJDA 3HS3A 1QHNA 3U7QA 3ULKA 4XYLA 4YYZA 1RJGA 3PTAA 2NG1A 4XGNA 2VBGA 4EX5A 4IOCA 3LKVA 4BFYA 2FPXA 2VWGA 4A3JG 2X7HA 2A0WA 4GSLA 1JVNA 1L7RA 2GLUA 4EQPA 2PGAA 4KIGA 4W9MC 4JHXA 2JEOA 1D2BA 2B8NA 2CC2A 5KJEA 3KR1A 4L4XA 2HDHA 2EJMA 3NZEA 3L0CA 4ROTA 3E05A 3LYUA 4XWGA 4JC0A 2PD3A 4HLNA 2W4QA 1FQWA 5EERA 3IOEA 5J2UB 4KSYA 3WYEA 4KI0A 2EFEB 5F5LA 4M60A 2A0XA 4B8ZA 1GN8A 1SYBA 1XQWA 4WLNA 5JMTA 3CKLA 5BYJA 2CWAA 1CQXA 4IDFA 3HCOA 4IDOA 1SHTX 2QYSA 5CT8A 4YGXB 2GVZC 3T6KA 3TTYA 1EIWA 2E2JH 2ASVA 1M2HA 2FMXA 1RYDA 2CYBA 1AHNA 1HF3A 4IF6A 4PIPA 3UYLA 1CDEA 4PPYA 4QUHA 1MW9X 4HJXA 1OW3B 3JRWA 2L19A 3AVVA 1ZAKA 3HNPA 3NP9A 3L4SO 2J87A 3VC2A 4HQLA 1CJUC 3NQIA 5J39A 1G3QA 1AEXA 3ITEA 4MX8A 1UANA 4RTSA 4LYAA 3U3XA 2V7UA 2A57A 1T5BA 1X7XB 2Q5FA 1C9EA 3ND6A 4JB8A 2HQBA 1W4ZA 4RF3A 4RPHA 4MS1B 5D3QA 5JFTA 3IPXA 4HNSA 1F48A 3E9RA 4OB7A 4A0QA 4IDBA 4ZEVA 2R61A 1H8HD 1Q0TA 1ODIA 4F12A 1ICWA 1IONA 2FUNB 1F77A 3I7FA 4KDFA 4TS1A 421PA 3LDHA 5CDUA 1EJ2A 3SJAA 2P2CA 1WUTA 1XTCD 1WTPA 3ESCA 3NKVA 2H1RA 1NW8A 1FSFA 4IMJB 3F1ZA 2HEGA 2O9JA 4CBVA 1Z0SA 2HWXA 3NGLA 4N82A 4QNNA 4C7BA 1QRUA 3F5FA 3KXLA 1S2NA 3F2BA 2HHAA 3DEKA 3ZE1B 2BMJA 4JHLA 4ZK6A 2BR3A 5EJ8A 2FSFA 2JFYA 1G7CA 1SXJE 1K08A 1NVGA 3NT2A 5JPDA 4M9CA 3NTQA 4XSGA 1ZONA 3KZKA 1BXTA 1K6JA 2UZ1A 4KUEA 1KERA 4WIAA 1MGPA 3VR4H 4DDUA 1BW9B 4PAGA 3VPCA 2GAOA 3SSOA 1XVIA 1VP3A 1ZN8A 1AKQA 2CE7A 3G2IA 3HOUB 3EIQA 4RH6A 2RAVA 3C5HA 3KKQA 4RANA 1GQSA 4AYTA 1C30B 3S29A 1H95A 4GNXC 3SSAA 1Y82A 5UKDA 2CJWA 2XE6A 3BZUA 4DJDC 3A74A 1JKMA 3RT1A 2OHJA 3KDPA 4J0CA 5CNIA 4UOEA 5A9RA 1VPLA 4Q9KA 1P1IA 2RJ3A 2FQ1A 3PWSA 2VZ8A 1GGVA 1THMA 3R6TA 3Q8XB 2RKBA 1DPGA 5CVCA 4JIMA 5JJIA 3I1IA 4PCVA 2H0RA 4FINA 3CUSA 3FYSA 3VR1A 4NJEB 3CO5A 3WWVA 2YXPX 3NTVA 1JE1A 3M6LA 3PO2H 1KP3A 3GUZA 1LO5D 4KTVE 4Z4FA 5KSPA 2PKCA 2C82A 4E5NA 4QQFA 3CUWA 1E96A 4MVJM 4JX9A 4R8KA 5B3JA 4G25A 1PQWA 3NHUA 3QUAA 1J8YF 3ZNNA 4DNFA 4DKAC 4BPRA 2A69C 4YRGA 1YU6A 3GJ7A 2GFQA 1KY3A 1L7MA 1R4NA 3QBDA 5C53B 1JKFA 2V4DA 4K9NA 4P0QB 3A8KE 3FMCA 4XT3B 3C46A 3TMAA 1N36Q 4HNRA 4M8AA 1QANA 4H7JA 3H8JA 1CEEA