1OY3B

Crystal structure of an ikbbeta/nf-kb p65 homodimer complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor p65
publication title X-ray crystal structure of an IkappaBbeta x NF-kappaB p65 homodimer complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 21
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oy3B00
2J8OA 2HMIC 3VXQB 2E8ZA 4CRPA 2DL2A 4P4KC 5GS2H 4PGZA 3O9WC 1YEIL 2DQTH 1LMKA 1RQ5A 2F53A 3MYJA 3S36L 1B0GB 3LEXA 4OLYL 4PGBB 1GL4B 3QDJD 3F7YB 1WWWX 1KIPB 3QPXH 3IKCB 3DROA 3DI2B 4YR6B 4ZMAT 3W9EB 5FGSA 3CFDA 1JHKL 2PO6B 2BVPA 5EU4A 4IM8A 1FBIH 5I8OL 1KTDA 4ZG1A 1S78D 3N1FC 5DEFA 3TCXA 3LVEA 5DJAA 2VWEC 4DW2H 2X1OA 3HR5A 1FGVH 3VFVB 5DUMH 3EYOA 3LKQB 3FB5A 1MPAL 4QOKD 4JFDD 5IEHB 2BY3A 4JB9H 4MHHG 3OAUL 5HGBA 2QKIB 4P2RE 5EN2A 5FYKD 4IDJL 5DVLA 4R3SB 4UQ3B 3B8YA 4MXVF 4NKOB 1K4DA 5DD3L 1M6OA 4Y5YA 3C08L 1BBDL 1CR9H 2P8PB 3KPRE 5IW1B 5EPMB 1AGFA 4ETYA 5D6DA 5CZVH 3SJVE 5FGBA 1FORL 4W4OA 5FHBL 4PJCA 5J1SC 5MENE 2XOTA 5BV7B 1ZANH 4JPKH 2R0KH 2G60H 4WWKA 4R97B 4L4VE 4JQVA 5MEOB 3PHOA 3P4OB 4YIQB 5IHUL 4XRCB 3LKNA 3D2UA 5FYJL 1T5WB 5D2NB 1BFVL 2E7LC 3VI4F 4CDHA 2MOVA 5C2BH 1CD1B 4GKNB 3ULVC 5DJCA 1OWRM 1KJMB 1P4IL 1VPOL 5DMGC 4KRPB 2D03H 5IQ9A 3LS5H 3ZE1F 4EI6A 1T04A 1OTUD 2XWJB 1VGKB 2GSIA 5ID0A 3IFPB 4J4PC 4X8JB 1BBJA 1UWGH 4PY7A 1HHGB 2HJKB 5CIPA 3HE7C 2AK1L 1YMME 4WENB 5CJQH 2KQNA 4X99B 1DP0A 2GK0A 2VISB 3V6OC 4BQ9A 3HB3D 1P5VA 2ICWJ 4P23C 5ICYA 4M6OL 3KLAB 4M48L 3WSQH 3CDGA 4HH9B 2CGRH 3G5VB 4ZUSA 1YDPB 4ONFL 4ZAKD 4WDIA 5GJSH 1T7YA 4P5MB 2X1QA 4LQ1A 4K94C 2HRPL 3VRIA 4EDXB 4LEXL 1G7QA 4ODUA 3RIFK 3MRHA 1U92B 4KMTH 1QO3A 4MA8H 3LKPB 2R4RL 2C26A 3HI6H 5T1DH 3UP1A 4MNQA 5FYJU 5GPRA 3IDNA 4MCZA 4RIRB 1KCLA 3DRTA 3WJJC 1ZHKB 4OLXH 4QRPB 4M93C 1Q38A 5E1AB 2FWOA 5TE4L 1IL1A 4MVBC 2ADJB 4ZTPH 2K7PA 1DDHA 1TCRA 1CIDA 3ZE0E 3VWJD 2H1PL 3FB6A 1SYSA 4PV9B 2W9EH 1GGCH 1YN6A 3EDEA 4B7IA 1ZLUK 4JAMA 1UZ8B 5SWSE 4Y16C 1GGTA 5IJVA 1XZ0A 3O2DA 1DJSA 1F4XH 4QHNB 5EFIB 5KS9B 1YZZA 1MI5E 4UNTA 1QYGL 3WLWD 4FP8H 2JJSC 3HZYB 3OXRA 5E8PA 3SE9L 4JFXA 2VB5A 3I6LD 5HYQA 1J11A 6FABL 2R23B 3DLQR 1KELL 2V17L 3QULA 5LG1A 4OQTL 5DSCB 2BOCA 3QHTC 4U6XA 4GW5B 3O11B 4X5XB 4R2GC 2UZXB 5IP4A 5J3HC 3HRZA 4XB7A 1HNFA 1NFDF 3L3GA 3DX9B 3LSOA 3H6JA 2V7NB 3IXTA 1KN2H 3QQ3A 4J6RL 4L29A 5AYQA 3HKFA 3MACL 4UNVA 2C3XA 1I4FA 2HVKB 3ARFA 5EG6C 4F37K 5E2WH 1CF8H 3D48R 1NSNH 4GW4A 4ZTOL 4PR5B 2A9MH 1ONQB 3BWUC 3KWWA 3M1BB 4NO3B 5T33L 1IFHH 5KSAD 1W0YT 4XTRD 2P5EE 4YFLF 4PUBH 4P9HC 5F44A 1K2DB 2PTTB 4WI9A 3BXNA 2G5RA 1UWEL 2P42B 1RZJH 2P7TA 3E6FB 4C83B 1I8IA 4DQOH 2GCYA 1AQDB 4FMFA 2H2SC 1EIBA 1MFEL 3EYVB 2R1YB 5FYJD 2AGJL 3FKUS 2VQ1A 4LNRB 2WBWB 1S9VA 4GG6E 2AJZA 1MCEA 2YEZB 4F7TA 2GT9A 5D1XD 3GK8L 5HYSA 3K4ZA 2Q8BL 3VFRB 5HDBF 4Y2OA 4FFZH 1FFOA 2JIXB 3RL2B 1RZKL 4F8TA 5K33A 5IV2A 1BD2E 1H5BB 3W39B 3GSOB 4MA7H 2FR4A 1BZ9A 4MA3A 4KTDH 5EIVA 4JFQB 1EO7A 2FL5A 4HAGA 3VGAC 1I9JH 4IDLA 4NGHL 1MOEA 2JK5A 3KPLB 5JW3H 2E8YA 1A6ZB 2VLKA 2YZ8A 4NNPH 2OYPA 5D72L 3QIWC 3KPSA 3PG2A 2FEEI 2XQYG 1JYNA 1HKLH 2O5YL 2VN7A 4PBXA 4QHUB 4QRQA 5HY9A 1B6UA 2H9GB 1P69B 4WTZA 2W60A 2ATKA 3HS0B 3WXWL 5EIQA 3AB0B 4N0CD 4P4RB 1CVRA 3PGFH 1EFXA 3KLHC 3I84A 4TTGA 4KHTL 4HAFA 3TJEH 3G08A 4Z7WF 43CAB 5HDQL 1KCSL 2FO4A 4J2XA 1KLFA 4HPYH 3MCG1 3H2WA 4K2UL 2DWEB 5FF6A 3G6DH 2FZ3A 1KCRH 1T1ZB 5D7IB 5FO7A 3UPRB 2P8LB 4U1SB 1CT8A 4L4TB 5HI3C 4F7MB 4ZDHA 1NDGB 4EN3C 4YPJA 4JHAH 4ZFOL 4LLQB 5DT1L 4XMLH 3IRZA 3DJ9A 2HVJA 3H3PL 3HAEB 3KYKH 32C2B 4I77L 3B3IB 4LP5A 5SV4A 2EDXA 4ZD3L 4XH2B 1QA9B 4JM4H 4XCEB 5KJRL 3JWOC 3U4EA 3SE8L 1QR1A 1B0RB 5ITBL 1ORSB 3MLYH 3OB8A 4IIQC 3BDYH 3MRGB 1I7TB 2NY6D 3BYYA 4GQ9H 4FQIL 1MAJA 2GAZB 1EXUA 2IAMB 4JKPL 5EU3A 2VLRE 2OQJA 5ALCH 4C59B 4NHCL 5L9DH 4QRSA 1N2RB 1QFPA 5TDOB 4JLRB 4FZ8H 5E2UH 3P11L 1YJDC 4Z78B 5ICZB 1RJZB 5HXMA 3GMPB 1JGEB 2RB8A 2DLHA 5I6XB 2R2HA 5TQ2L 2VZUA 1QSFD 4NM4L 3MOQA 8FABA 2BSSB 3PNWB 4JRYD 3BRFA 3FT4A 1ZEAH 1ZA6A 2ADFH 3KPNA 2MPAL 5E24E 4LCCC 1T20A 2IEPA 4DZ8B 3CSPA 3BQUD 3GSVA 1AO7A 3T09A 3T2NH 4MNGB 1AR1C 4KH2A 4AEIH 5A40E 3H7LA 2IANB 1I7ZB 4LLAA 4G3YH 4GW1B 5EZIH 3EAKA 4MD4B 3S5LB 2AEQH 1LE5A 3QWQB 3T0EE 3ME0A 1HINH 3MRFA 4EXPX 1E6OL 1S7VB 1CFNB 1R24B 4PJBB 4Z6AT 1X5KA 1S7RB 2Q8AL 4YXHH 5GSVA 3D85A 3PWPD 4NQDB 3RY4A 3V95A 1SJEB 2BNQE 1J1XH 1NANI 3EYFB 3WCYA 1FNAA 4L8CB 3CD4A 2FGWL 4KROD 5CUSH 4EQ3A 1HH9B 3ARWA 5BVPL 1Q9KA 3O3DA 1I7RB 3ARPA 1RJCA 3W5NA 5GGRA 4F7EA 2H26A 4LF3B 4HX1B 4OGXH 5FGCE 2L7JA 1TITA 5FYLL 3SDAB 3WFDL 3JZ7A 3U79A 4EEEA 5F1SA 4ZOCA 3CH8A 3B2UD 3RUGF 3MV9B 5I1KL 4KAQH 3DSFL 1IKNC 5EO0A 1LO0L 3O2WH 35C8H 2IPTH 5DK0B 3ULUL 1BAFL 1MJJA 1S7SA 1RD6A 3CSYA 4NYLA 4FG6C 3TM6A 3MRKA 1CU4L 4J12A 5DDHB 5JO5B 2A83B 3QDHA 4N8VB 1GIGL 3ARRA 4FQXC 4PJDF 3NFSH 4PG2C 4R8WL 3PDGA 1SEBB 4FFVC 2E27H 3MA7A 3TBTB 3CPLB 3SKMB 3BE1L 1IE5A 2GUOB 3RWFA 4M02A 3KR3L 5CSZB 3QI9C 4CU6A 5CMAA 5KTEL 5HGHA 3VH8A 3MLRL 4LSRH 1A1OB 1D9KD 3MLVH 4RA3A 4V1DA 4RA0C 4K71B 4LQFL 1JF6A 4IJ3C 1UFUA 3DIFA 2APBA 3TH3T 2CPCA 2B2XL 1NGYB 5T3ZH 1S9WA 4JJ5A 1VHPA 4D9QD 4F80A 4PRIE 2HT2D 1NMBH 2C3WA 3G9AB 2UYLB 4XP1L 2J4WH 1BVLA 5A16A 1G6VK 1CDYA 4EI5C 5JHDD 3W2DL 2DIJA 4F9LC 4WNQB 2EH7L 1PZUB 2EYSA 4AQOA 1ADQA 1HHKB 1WC7A 1XCQA 4LCIH 1N0XL 3WL9A 4HBCL 5A2FA 5BMFL 4PJFB 2ESVA 2F58H 4X6FB 3VXUD 2GKIA 5GS1B 4RSVA 5BVJB 1NGQH 1SVZA 1BPVA 4JDTH 2EXYD 1CL7L 4XCCH 1JNNH 1U3HA 3W0WA 3CLEL 3FMGL 3VXOB 1OY3B 5IIEB 3DXAA 4A2MA 4EOWH 1EHNA 4HV8A 3CAFA 2PKDA 4DN3H 2NR6D 5IFHL 3HI5L 3WEXB 5HI4C 1RULH 4UOJA 4OFYA 5D2LF 1TVHB 1QQDA 2C4XA 4KUZH 4U0RB 1QVOA 5JA8B 2WAHA 2QJDA 1B4JL 4IS6A 4XWGL 4APQB 3T1FB 1NBYA 1VEMA 3QIUD 4LSPL 4YUEL 5AAMA 1OGAB 4OD3H 1DCLA 2CH8A 3BGMA 2FJGA 3EOTL 3NTCL 2HJFB 5CEYB 5DO2C 1OB1B 1QFWL 3TT1L 5J89A 5I1HH 2IG2H 5DZOA 3H9SE 5FUZH 5C0JA 4YHLH 4D0BA 2OX5A 3MBEA 3GSNA 4H88H 2E9BA 3O3UN 5KANG 2FBJL 1KEMH 4QXGH 1C5DA 1FZMB 2APXA 1VADA 1G9ML 1IAKB 3O2DL 5FYLD 2BNUA 2F53D 1T7XA 2AJXH 2DKMA 5AG9A 2ZJSH 3GB7A 4HWBA 4CDGC 3L5WB 3VGHA 2Z92A 3UBXG 2D31B 5I8CA 5L8LB 4ZYKB 3EZ8A 1EBPA 2QSVA 1HN1A 3ULUD 3HUJA 2G5BA 3RWGA 2DQHL 4P5TA 5LCVH 4PJEE 4I0PA 2K1MA 1TQBB 4WUKH 3MXVH 1OF2B 1Y18A 2H8PA 5HHOD 3ULUF 2HLAA 2J3SA 1L7TH 2EE9A 5HVHB 1MNUH 1KXVC 2VZ1A 1NCAH 1E6JH 1UQSB 3I6KB 4CADB 2YUWA 1Q9WB 2QLVB 4JGMA 3VFOB 2P8MB 1B6DA 3QZWB 3DTXA 5CCKL 4ODVL 3WLBB 2B1HL 1AFVL 1NAKH 3MMEB 1J0HA 4P2RB 3BISA 4M1DH 5ICXB 5HPMB 2FH6A 2MFNA 4PJIA 3DGCR 5DJ8A 1KN4H 2CRIA 1KXTB 2XZAL 4WWKD 3OKEA 4W4NA 1KBGL 3TGXA 1KIRB 2B4CC 3QQ4B 5ACZA 3SJVB 5J9PB 5TQ0H 1U93B 4F15C 4XCNB 3D2UD 4FABL 5MENB 1JZ6A 5JXAH 1A22B 1NJ9A 4HPOL 4X6EB 3DYOA 2W0KA 4FHBD 1C12A 1ZT7B 4B53A 4KY1H 4C56A 1HHJA 2F74A 5C6WH 3MLPA 3UZEA 4CN1A 1NGXA 4I3SH 1UENA 4LIQE 1A1NA 1H3PH 3W11D 1TJIL 1MQKH 4Z95H 4AH2B 2X4NB 2JB6A 5T1MB 3V0WL 2AJYL 4JFOA 4L3CB 3U0TA 3WUWG 1NKOA 1OAXH 3WDIA 4NHUA 4DWHA 3FQUA 5AZ2L 3NCJH 3DSNA 3DX8A 3KPRA 2DJSA 2YD6A 1H8SA 3L1OH 1S7TB 4R90H 1WCBA 1HQRB 1S78C 4F33A 4MA1C 1YMMB 4CAGA 3U36A 4JRXE 1C8PA 3TESA 1RZGB 4XNZB 4K23L 4EUPG 3MGTA 1YNLL 1M7DB 3VFWB 3PWVA 4XVJH 4ISVA 1SM3L 3BPLB 3I02A 2R56L 3SKOB 4FQHB 5D5MA 5DURB 5IW6A 3FFCE 4ELKB 4L3EE 5L2JA 3DRQB 1HHHA 3RWCA 1MH5A 5F8QC 3PUCA 1YEHH 5CILL 3K8MA 2Y5TB 1Z9LA 5ESVB 1YNKH 1A6WL 1C08A 4ORZC 1CLZH 5T1KA 4AM0B 1QSEE 2ADGA 2XA8L 4JHWL 3N1MC 4OZ4B 3CFJB 1MWAA 3M8OL 3BGAA 1UB5A 2FECL 3ALWA 4M1GL 3U0WL 1N26A 3MA9L 1X5HA 1V7ML 2VUYA 4LCUB 1S7QA 1AP2A 1J10A 4LSSH 1MI5B 3BPCA 3OPZL 4I0CC 1P7QA 4JZNB 1B0WA 2OL3L 2NW2A 3DMMB 1CQYA 4MQ7A 4GAJH 2IQ9H 1R5VB 2GK2A 1LK2A 3S4SG 4NN5B 1OW0C 1QSVA 3PWNA 3MROB 3UC0H 1OTUC 1G7PA 4LLYB 2BVOA 1N5YH 3FL7A 4UUJB 1ZKAA 4MSWB 2D4FA 4NUGL 1NGWB 1YYLL 3FQWA 3T65A 4KJWD 4OZGE 3RNKA 1FG2A 2WBJA 3ARGB 1JPFA 3HB3C 3OKDA 4W6WB 4HQQH 2ICEB 3MO1A 3O4LD 3EFFB 3MUGB 4IRZH 4NDMA 3TJHD 3QCVH 4ZAKC 4TVPL 5DJZB 5HYIA 3MRCA 4M43H 5IR1B 5CD3A 1UJTA 4L9LC 5IQ7H 4IOIA 3HCVA 1S9YB 5FUCE 5IBUB 3GUTB 4JQIL 4WUUE 4Z7UA 1RV6X 3QB7C 4LSUH 4CNIB 3RJDA 2QQKH 4JG1H 2IC2A 4U6YA 4Z7OF 4FFYH 1NCBH 1TPXC 1BFSA 1MFAL 3NIGF 5JW4N 1TENA 3VWJC 5C09E 2NZIA 4G6JH 3LS4H 5IHLB 5T5NF 5L8JB 4LCYA 4R0LA 3F7VA 4DGIH 3MNZB 2NYYD 3WJLC 5JTWA 1G7IA 4RRPA 1LQSR 3MJ8A 3KHQA 4BSWA 1NAMB 4OF6A 4XCYA 1I3RA 5KOVC 3WLWC 2MWCA 4M3JA 3D0LB 1LO3L 1SYVA 5C0DB 3U7YL 2P5EA 3OAYK 4JFFE 5F6IC 1BQHG 1LDPL 1YN7A 3VD7A 1BD2B 1JYVA 1RUML 4RFNC 5JQ6L 2GJ6A 4MS8D 5FM8A 3I3BA 3ZT6A 3BWAA 3QO0A 4X6DE 2OXGA 5IHZA 1Z9OA 3GBLA 4EJ1C 1J8HD 4N0YH 5J11B 4GQPH 5IWLA 1FZKA 5C7XL 3BHBA 1N59B 2ERJC 1A7QH 4OCNC 3Q3GA 4FQ1H 4GKSB 5E9DE 5E6IA 3B6SA 4HIJB 5KN5A 1QNZL 4GG6A 3UBXA 4P59L 2AV1B 1A02N 3AMKA 5SWQB 3UTQA 1A6UL 5DRNB 5F7FA 1EFXD 4OFPA 4I18C 3QRGL 5EOTB 5KSAC 5DRXA 4XTRC 1G7HA 1SEQL 3OKKA 5BZDA 4XXDA 1NLBL 3MJ7A 1I1FA 1PYWB 1MLBB 1UXSA 1IM9A 5T5FH 2KKQA 2SEBB 4O2EB 2IPUG 3T0VA 4OLVH 3V0VA 2YPLB 5C0GA 2FX8H 1DFBH 1HILA 3BPOC 5EO1A 4X7DC 4H1LA 4H26A 5H35A 1ACZA 4AENA 3FTGA 5D7LE 3DYMA 4KMLB 3TA3B 5H37H 1JRHH 5GJTH 5MP6L 1PQZB 4NQVA 4OGYH 5ELIA 1IRAY 4AIXA 3JTTA 1V8HA 1RZIA 5D1XC 3WIIL 2GSGB 4M7LT 4NP4L 5EZOL 1YY8B 4PV8B 3B2VL 1Q9OA 1X4ZA 1JI2A 4K7PY 2OBGA 3LH2L 4HF5H 1I3GH 4NWUL 5DK3A 3EYSH 1KB5B 2X7LB 4LKCA 2BOBB 3EO0A 1SY6H 4HT1L 3SKUD 3FOLA 4XNQA 3QIBA 1H9VA 5JNYA 2AVGA 1G6RA 1AXSA 4MX7B 1S9XB 4HK0B 1ADQL 1CDUA 1J05A 2X09A 3BKYL 3WNLA 4QRRD 3GSQB 2G75A 3T1WA 4HMDA 4EBQL 5JDJA 1EGJH 4TVPD 1JHTA 2OSLA 5ANMB 5I17A 2Z93A 5DD6B 1BREA 1OP5K 5GSRB 4GLRH 3EDKA 1GOGA 4L4JA 1KCUL 4DKDC 1CGVA 2DWDA 1QBLL 1CFQB 4XP4L 1FYTA 4ZSOE 2YSSA 5EU5A 4N0CC 2CLRB 2OI9C 4HKBB 4CVZB 3DWTA 4M62L 2VMFA 4F3FB 3EOBB 4PJ7A 5DYOB 1YEDB 3GSWA 1K6QL 4G5ZL 4QTIL 3UTTA 4EUPA 3ALPA 4XB8A 4O4YH 2J6EA 1N3NB 1WFOA 1B88A 2ENSA 2IH3B 4QXUH 4HXAH 2QHRL 3D85D 3T0EB 3NZHL 4OCYL 5A3ID 1H3GA 4I5BB 3MOBL 4NKMB 3BPNB 4NQEB 3GSNL 3DMMC 1ZLSL 3FCTA 3VRJA 3RA7H 4ORGA 2BNQB 1UYWL 5J0BA 4NO2A 4AL8H 3SGDH 4M7LH 4NWTL 1JGLL 3ROLA 4YHNB 4PJHE 1BIIB 3OHXA 4MCYA 2PTVA 1BOYA 2YA1A 5F9DC 1F11A 2H6PA 2NY6C 1MPAH 5C08A 3SCMB 4HIHA 1AQKL 4ZODA 5I2IB 2R0LL 5FGCB 2XY1A 4HWBL 4CU7A 3QEHA 4ZPVA 1N8ZB 5GRJH 3BSZH 3DVNB 4JVWA 5JW5A 1QBML 2C1PB 2HG5B 3HC4L 4JM2B 3UJIL 2A74B 3V7MA 3S4SA 1NMAL 3JV4B 5DVMA 3GKWL 3QUMA 4DVBA 3U9UB 1KTDB 4RX4A 4E41A 2J2ZA 3OQ3B 5LWYH 1OSZA 1U3YA 1C1EL 4ZXBD 4LOUD 5TGBA 1Q94A 3O3AB 1HOCB 1IAIM 4U1LB 2K7QA 4X5LA 2A6KB 3BQUC 3DGGA 3QWRA 3FB5B 2NY4D 1FSKC 4BUHA 4JR9H 1MRDH 1YQVH 2XFXA 4H20L 4PB0H 3QUYB 4V1DD 4W6YB 5D7SL 1NCCH 5C0BE 5DC4B 1H3UA 4L9DA 4CVWA 3ARZA 2IALB 4XP9H 1NC4D 3H9YA 5CGYD 2AKRA 4PJCB 3DUUB 1RZKC 2YD3A 1AGCA 4M8VA 2X41A 5I1LA 4OJFH 5CEZH 2AK1H 2UY6A 4KI5E 1WK0A 1X5ZA 2VDMH 3MRNB 1ZK9A 1AE6L 4KROC 3EGSA 3LKNB 1F4YL 3AVEA 4DCQB 3QNZA 3IU3A 3MLXH 2GJJA 1DUYA 2AJ3A 2BMKB 4NQSB 5F70A 5HHPA 3GHBH 2MHAA 1NUGA 4HKJB 3QHFL 5K9KA 1KJ2B 5JIHA 4LEXH 1TJHH 2ESVD 1KULA 1PKOA 2Z35A 3QAZB 1MF2H 2R4RH 3B2UC 4IRSB 5ADOL 1P4LB 1QBAA 3D39A 5C0EA 1BQHA 1U3HD 3W0WD 4XNXL 3HNSL 4YC2B 2CDEB 3DX6B 1RURH 3DXAD 3L9RB 4PY7B 5CIPB 2H2PD 5EOQL 1PLGL 3FO2A 2GK0B 4NQUA 2FB4H 4J3SA 3GKZA 3OKOA 4HKZA 3O6FA 3Q5OA 1FLRL 3KJ6H 3QNXA 2GY5A 2DICA 5TPWL 1BFOB 4PRIA 1LD9A 4LPTA 3RVWD 3IJHA 1OOAA 3ARDA 1QLFA 5FAAA 3MRHB 5T3ZE 4HD9A 4OBSA 3VD3A 5BZWB 5DJ6A 5MERA 3CVIL 4MNQB 4RGOH 1TJGH 1KJ3H 2Q1EA 3IDNB 3UTZB 1MFBL 5E99L 1D9KC 3FZUD 6FABH 1R0AL 1T7ZA 3MBED 3QEQE 2V17H 4IMKC 5F21B 5DR5H 4AYFA 4OM1L 4OQTH 1RK1A 1LP9E 1XIWB 3ZKND 3C60B 3OKNA 3H9SB 2ZG1A 3VFPB 1U8PA 1BWMA 3RWEA 3GO1L 4MJIE 3SDDA 1NFIB 1YQ2A 5FOJA 1S3KH 2HT2C 4HFWA 5F7YC 1J0KA 3TYFA 4ZTOH 1IT9L 1KLUA 3N1GC 3QG6B 1PJ9A 1N7MH 4OCXL 5FKPB 2FSEB 2DRUA 1DUZB 4P5TD 4B7LA 3OR7A 2DB8A 4XPBH 3EO1A 1ZHLA 3GJFK 4XCFH 5EH1A 3SE3A 3SDXE 3EW3B 1BVKA 3L3HA 2EDNA 3HUJF 4WFFE 1NPUA 3OZ9H 1KLGA 1XF5B 1G7LA 2BOCB 1W0WB 4NO5B 2WQ8A 5C07D 3BT2L 3EDFA 4PJEB 2K3TA 5L7XH 3G5ZA 2EXYC 1UG9A 3TNNA 3HRPA 4ALAL 1JF1A 3IXTB 1CLYL 1R3IH 1GOFA 4L29B 1FO0B 2HFFB 3ARFB 3L5HA 4UDUB 1FPTL 2NY7L 4R4BA 4N1EA 1CDJA 4Y5XA 3CUPB 4YEFA 1JPTL 4J7RA 3TVMD 4GW4B 4Q58C 1I8MB 1NL0H 4JKWA 4G9FE 2P45B 3GK8H 4CN4A 2G2RA 3KWWB 3G04A 2APVA 5EO9B 1D5ZB 4DTGL 4PJIF 4IRJB 1OAKL 3QIUC 4RGMB 2CQVA 1HIML 5IK3B 2E7CA 3PHSA 1T89C 3IFLL 3BP7A 2AEIT 3BH9A 2P7TB 5I19H 1UJ3B 5AYUL 3RGVB 3F6IA 1TVBA 1XFPA 2VR4A 4MWFB 5IB1A 4UB0L 4O51A 4HFUL 5C0FB 3RBSA 4C56D 4YNYA 4YQXH 1YEGH 3ZT7A 1MVUA 4KTYA 3V5KA 3OAZK 1UCTA 2YPVL 1S9VB 4Z7VE 5F3HA 1UCBL 2AJZB 3V0AC 2OP4L 1FL5B 1CL7I 4OZFH 1Z3GH 5D72H 4F7TB 4BQBA 4DEPB 4X4YB 3WFHA 12E8L 3IGAA 2VZSA 5DD1H 5CJOH 5T1LA 2X4QA 5TH2B 3HFML 5DQ9A 3IETA 4KQ4H 4LPWA 1FFOB 2VDRL 3KPRD 1QFHA 4ELME 1E28A 4Y4KB 5DEZA 4G8EA 3BOVA 1BZ9B 3LDBC 3ULUC 3GFUA 3WO4C 4L4VD 3FQNB 1H3WM 1ZA3A 1C5CL 2FL5B 1UVQB 3RP1A 5EBMB 4UV4L 1QFWI 3UZVB 2VLKB 2WUBH 4JRXB 3KPSB 4UDTB 2ZUYA 4QRQB 3O4OB 4JO2L 3KPOA 5D5MF 4P2QE 2ATKB 4HSQA 1WEJL 5MHSE 1P4BH 4Y5YC 1HKFA 5KSUA 5IEKA 3FFCB 2DM4A 2OTWB 3MFGB 5D6DC 3VFMB 1TTFA 5DJDB 3ROOA 1EMTL 1Y6NR 4W4OC 1IC4H 3IDXL 4WWKC 4JE4B 1ODAA 3PJSA 5CS7A 5DK2B 4O9HL 1EHXA 4JREC 4TNVF 3X17A 3WIFA 4FQIH 3DBXA 4JKPH 2PW2B 4PRHA 4ODSH 1QSEB 4FXKA 3VGGA 4KDWA 1O7VA 5DLMH 2YPKB 4QHLB 1F3DJ 4R96B 3CMGA 4M8QB 4ZS7L 3MRMB 4NN6B 1CT8B 1CFBA 1P7QD 2DM7A 4ZDHB 4LCWA 1CDGA 4M7JH 3OJDA 3W11C 3N0PB 5A2JH 3CZJA 1DQML 2AJUH 5LBSH 25C8L 1F90L 3KXFA 1MELA 4WCYL 3WFEL 1U8KB 3DV6B 2H32B 3EYUL 1J7VR 1YYMH 1T7VA 3RVVD 3U4EB 2J5LC 3I6GA 1AKJA 3U7AA 3ARBA 4BFIB 1JGUH 1MHHA 5KSVA 1T2QL 3DO7A 5DMYA 3E8UL 2WBJD 2DDQH 1FL6A 2WBKA 3B9DA 3BJLA 3ZE0F 5L6YH 4NZUL 5SWSD 5GGSA 4QRSB 2Q86B 3UCRA 5EC1B 4CJ0A 7CGTA 3S37L 5TDPB 4BZ1H 4DGYL 1S5HA 3ABZA 2RFXA 4P2OA 5DMIH 5C0AA 4X6BB 1EA9C 2NXYB 5KSBA 4POUB 1EUTA 5D1QA 4U6HB 5GRUL 3ZDXE 1V05A 1WWAX 4V2BA 2UWEE 2L0DA 2M8XA 5INDB 1JP5A 2ZKHL 1Q0YL 5DHYB 1ZA6B 3KPNB 4HLZH 4Z7UF 2CIKA 3PWLB 1BJ1J 5HPOA 2HWZH 2E6JA 4OAWB 3H9ZA 3GSVB 1AO7B 5EULV 4WUUB 2VDNH 3GIZH 5DQJA 3NIDF 3V2AR 2GTZB 3OGCA 2J6EL 1EEZA 5DVOA 5FO8A 4N68A 5FYLH 5JIKA 1A64A 3U2SA 5EC2B 1MIML 1G9MC 3MRFB 1P7KB 1TLKA 3CC5A 4XWOD 3TBSB 3R4DA 1X5IA 1FFNA 1S9KC 3TBWB 3GHEH 4F8QA 2P5ED 2OMNA 1FDLL 3QFDA 1AY1L 5GSVB 2VR5A 3TIEA 3IDMA 4LDOB 4EVNA 3QFJA 4LHUG 1T3FB 2VABA 4YWGH 3KPPA 4KWUA 2O5ZH 5J6GA 5J13B 4OV5A 4LFHG 4QYOB 1GIGH 5ILTH 1Q9KB 3EUUA 1QPPA 4R8WH 2X4RB 5HYJE 1EAJA 3C6LB 4F7EB 1DL7L 1TETL 5E6ID 2EDFA 4CW1A 3GSRA 5DHVB 1VSCA 4X6DB 1G9NH 3R06A 4XHQA 3UYOD 3IFOB 2E6PA 2JE8A 4KJWC 5E9DB 5D70H 4HUXA 2OTPA 4GG6F 1W2KT 3HPJA 5I66B 4MHHI 3CMOH 3LN4A 3TJHC 3IRPX 1D6VL 3QUML 4JY4B 3BN3B 2FECI 4P46A 1CGWA 2B2XH 3MRKB 3V4VH 4PIRF 2WIIA 3QCUL 1C16A 3I75B 2A77H 4KVCL 3H0TB 3UTPD 4KK6D 2NY1D 2VXQL 4LEOA 3EO9L 4X80H 5EUOE 4Z7NE 3RWFB 1WBZB 2ADIA 5F7MC 3A6CH 2EH7H 3T08A 5SWZE 1KIQB 1MREH 1ND0B 4KFZC 4KKCD 5B4MD 2NYYC 4XI5D 4HUVB 4M5YL 5JLZB 4WTXA 5IB4B 4O5LH 5BV7H 4AQ1B 1QACA 3EDJA 5T3XL 3MLTB 2CMRH 1UADC 4JJ5B 1OPGL 2FATH 4GUPB 3CVHB 3HPLB 3GZKA 3MRLB 3P77B 1U8JA 5IFHH 4MS8C 4L8SA 4ZNCD 4NN7C 2XN9E 4YDIL 5D96C 1A4KA 3ETBF 4W70A 2YZ1A 4O02L 1IKFH 1OAYL 5IVXA 3O4OC 2V2WB 1NMCC 2OMBA 4YUEH 3RY6C 3V6OA 5GS0H 2VOTA 1FYTD 4G7VH 2CKBB 1RZ7H 1BM3L 4FXLA 4OUUA 3RTQA 5GRVL 5FM5O 3K0WA 4RMRA 2FYYA 4ZSOB 4Z76A 3LRSA 4G6FD 4RMQA 3ET9F 3UTTD 2FBJH 4P3WA 5F96H 3QDGE 4N9GB 2ED8A 3U48A 5FUOH 3TO4A 4TSCL 2HFGL 2VLRD 4M7KL 3WJJA 1GHFL 3CFBB 1ZWIA 2YA2A 1QVOB 5CJ5A 3R1GL 3C5ZA 4IS6B 5LKNA 3GI8L 3P4MA 1OM3L 2VERN 1JPSL 4KRNA 3OXSA 3MCKB 4U1IA 4HUUB 1AHWB 3G5YB 4Y1AA 4Y89A 2DQHH 2VLMD 5E8DH 4UIMA 5HGGS 1F58H 5D8JH 3VDCA 4MAYA 1MSPA 3GBNL 3N85L 1C5DB 1FN4B 3BEVA 4MB3A 1A4JB 1T2XA 3HNVL 4XBPB 4PJHB 1YECH 4NRYA 5F7EH 1YEKL 3THML 3STZA 3MRDB 3AU1A 2YRZA 5E8NB 4AMKH 3V6ZA 1DN0A 2Z92B 2AK4E 1NGZA 1EZVX 2XY2A 4U33A 4RX4D 3P2TA 4E41D 1EAPA 4ZUVB 3F58L 1U6AL 3K2UL 4I0PB 1EEUA 1UA6H 3UEZA 2VNCA 3IU4L 1FVDB 4YO0A 2H8PB 2ZUWA 1RUPL 5DQDH 2VXSL 5B39G 2JF1A 3P3YA 4WY7L 5F71A 3QWRD 1IGJA 1I1RA 2I9LA 4H25B 2Y36L 4U31A 3LMJH 4LPCA 1DSFL 4B5EA 3VXMA 5IB3B 1JWUA 4WI2A 4O58H 1LK3H 3DTXB 2ZUTA 3U7WL 4GKOA 5AUMA 4X4XB 3MRJA 5MEQA 1QPXA 4BA8A 4WHYG 4YHIA 1XGPA 2DQEH 5HI5D 5DJ8B 2BNRE 5JHLH 3IDGA 5C0BB 3WNNA 5A3IC 3OKEB 4OI9A 5T3XD 5DGRA 2HTLD 4PLOB 2AXFB 4U1NA 4RGNE 2Y06L 2DF3A 1FO0L 2HKHL 4HHAA 3QUXA 2ZSVA 3AXLB 3LPFA 1PZ5B 3IF1A 2F9BT 3K1KC 2CDFA 5TE7L 2IFFH 4R7DB 4ZO8A 3LHPH 5ID1A 5BS0E 3FO1B 1A9BA 4PRNB 3BUYB 4WWID 2PR4H 3D39D 3GI9H 2JB6B 4GRWE 2AABL 3UZQA 3P4NA 1LO2L 5DGQA 4WEBH 1KSRA 2O5XH 2DYPB 2VSDA 4QXWA 2PXYA 4JKKA 4KJQD 4P99A 4TUKH 5CILH 1H3TA 1T1WA 1I1AA 2DQTL 4FFWD 2YRLA 1YPZA 3O6FD 3DUSA 4FZEL 3NACH 4ZUTA 4PJ5E 2Q6WB 4PRID 1BP3B 3M8OH 5HHMB 3MUJA 3E3QC 4ZXBC 2E6QA 3QPXL 5ISZE 3BVNB 2BSTB 4LOUC 4HDIB 4OFDA 3ESVF 5GGTL 4HS3A 4ZNEA 1A2YB 3MA9H 5ERWB 3MV8B 3N50A 1FBIL 3ILPA 2NY4C 3CZFA 1JHLH 5CEZE 2OZ4H 4ONOA 2XWBB 4DJMA 2VDPH 1CICA 4XZUA 4XPFH 3SHSA 4R4ND 2PNDA 4F58L 1FGVL 5IF0A 5DUML 3RWCB 1XGQA 3PWJB 3D25B 3K4AA 4IHOB 4UNUA 3QEQB 5FKAB 3SDDD 5CGYC 5ENWB 4OFVA 1C08B 1T0MB 5T1KB 3L3OA 4NUGH 5EBLA 3O6LH 1A1MA 2A73A 5JUEH 4DKFH 1IEBB 4IEFB 1MWAB 1GGIH 3VFNA 2HKFL 1CR9L 2CRZA 3BGFB 4PP2B 2Z91A 4KHXH 5DMKA 3CSBA 5IFAL 3MRBB 4J8RB 5CZVL 5D7KE 1PY4A 1IM3A 4OKVB 3OTTA 4JCMA 1ZANL 4JPKL 2R0KL 2G60L 5J57B 1S7QB 3E6HA 4IIQA 2D9QB 2XTJE 1N4XH 2ZG3A 3HAEH 4BSVB 2FDBP 3T77B 1D7FA 5F7DB 4KU1A 3NIFF 4P57A 3ZKMD 1H15A 1P84J 2NW2B 1G9EA 2P44B 4PJAA 3H3KA 3VXRE 3SDXB 1U41A 2A0LD 3SGEH 1RK0A 3WD5H 5C2BL 5JORB 2FIKA 1U3HC 4NKIH 1G7PB 2BVOB 1AGEB 1HDMB 5FHAH 4HUWB 4HIEB 1IARB 1F8TH 2H2PC 2D03L 2I5YH 3VXSE 1FG2B 3LS5L 1GGUA 2B0SH 3DECA 1JPFB 3M07A 4TYUA 4WV1C 3UPAA 1DVFA 2RAMA 1UWGL 4M61A 3AMLA 4NDMB 5IG7A 3P9MB 3CDCA 3SQOH 4BZYA 1W0VB 2V9QA 3I9GH 5C9JB 1WF5A 3T3ME 2ED9A 5CJQL 3RVWC 4PLNC 3OBAA 4X6CA 3MLUH 2JB5L 1FVCB 2W65A 1WBXA 4IOIB 1JYWA 3Q6FA 3WSQL 5K59E 1MUJB 2CGRL 3V79C 5GJSL 4HG4J 1LDPH 3FZUC 4XNUL 1DLHA 3MBEC 1CFTA 3ZMRA 5J12C 4K3GA 5I9QB 4KMTL 1M7IB 4MA8L 4XAKE 4Z0BL 3ZKNC 3HI6L 1SJHA 5JDSA 2V9RA 5IMKA 5T1DL 2CR6A 2COQA 5E8OB 3QJHB 4G9DB 2Y7QA 3QO1B 1BX2A 4LCYB 4R0LB 4OLXL 4Z7VB 5T1LD 1HE7A 5IT2H 3O3BB 4KQ3H 3MJ8B 4P59H 5CBAA 1ZLWK 3RAJH 3D69B 2W9EL 4G9FA 1GGCL 4ZOAA 2NY5H 2YK1H 1T80A 3HE6D 4N5UA 4NJ9H 4P5TC 5GS2D 4P5KB 4RISH 2PYEE 4ELMB 5B8CA 1F4XL 1N6VA 1NLBH 1T0NA 5IB5B 4PGDA 4HUNB 1RJLA 4TNWF 4FP8L 1YNTB 3RRQA 4UZGA 3UTSE 1FZKB 3Q3GB 3RPIA 4C57C 2VLJE 4KPHH 1XH3A 2VWEE 3FJTA 2NTSP 3TZVD 1MCLA 3WFCL 2NW3B 4QRTA 2A1WH 2AJSL 2NY3B 4ONGL 3TVMC 3QQNA 1UKQA 3G6JB 1KN2L 4FQCH 4P2QB 4O2FB 5B3NA 5L0QC 4BH8B 5E2WL 3OX8B 1CF8L 3U6RB 1FYHB 4AZ8A 5EUKA 5B39A 4XXDB 1ORQA 2X4UA 3MJ7B 1IM9B 2A9ML 1MY7A 2I9TA 3BZFB 5JIIA 3D3VA 3BIAX 4PUBL 3GMQA 2VJXA 1ZHNB 4G43B 5EO1B 5H37G 2FEDD 2P43B 3ZHKA 4LCWD 4CMHC 5D9SB 4P9MH 1RZJL 4OZIE 4DQOL 3MV7A 1QHOA 4DKEH 3KXFD 5JPNA 1LE9B 4FTVE 4L3ED 3ULVE 1ZVHA 1AKJD 4EI5A 2BERA 3BJ91 1Q0XH 1ZGLM 1KOAA 4NKDA 1ITBB 3VE0A 3JTSA 2ARJA 5IESH 1I1YA 4JG0H 5CGTA 2XKNA 3L6FB 1U0QA 4U1MA 3QIBB 5JNYB 1G6RB 1AXSB 5F9JA 4FFZL 1CE6B 5H94B 4B41A 3QEUA 4NZJA 5CBEA 3WHE0 4P2OD 5C0AD 4MA7L 4WRLA 2B20A 2DI8A 3RL1A 5D1QD 1WLHA 1EK3A 1JHTB 5I17B 3S3JA 1FG9C 3WUWB 2VIRB 3D6GA 2OCFD 5KSBF 1VB9A 2CRMA 1I9JL 2NXZB 1GC1H 1HWGB 1H0DA 2YSSB 1MFDH 2F54E 1ZLSH 4M6MH 3PV6B 2UWEB 4PRPA 1HKLL 2FJFB 3IVKA 3DI3B 3KS0H 4QCIB 1PKQA 4NWTH 2WP3T 1MJ7H 4G6KH 3GSWB 1HEZA 4JZJB 4YDJB 5A2LH 2B5IC 3MR9B 3HI1A 4QT5B 5KANI 1T21B 3PGFL 2E9IA 3LV3A 4OZGF 3BP6A 3GMNB 2AQ3A 2ZP0T 1X5AA 3H9HB 4Q6IA 3QP3A 3VXTA 2GITA 2YD1A 4HPYL 3LKRB 1BOGB 3QFJD 5FDWB 2W0PA 2KBGA 1IBGH 4PRBA 3GKWH 1OGTA 3KPQB 4U1JA 3UBXI 3CCHA 2DIAA 3G6DL 2R9HD 1KCRL 3CFEB 2QV2A 2E7MA 1IEAB 3BW9B 4TQEH 1IGYA 3FQRA 1H3XA 4MCYB 4PBWD 3RVVC 3G5XA 4GMTH 4JHAL 4R7NA 3IYLW 4XMLL 5HYJB 5C09D 4J1UB 2WBJC 3C9NA 4JM4L 3C5JA 4PJXA 1DN2A 4ZPVB 1N0LA 3TP4A 3VWKB 3QQ9D 3NZ8A 3MLYL 3EKCA 3BDYL 2BVUA 4P46D 4D3CL 2C4FT 4GQ9L 4F7CA 3MJ9L 1NEZG 4N0UE 2DLGA 4N8CL 4QLRA 2C1OA 3S4SB 4PJGA 5ALCL 1QEWB 3NBNA 5HGAB 5L9DL 4JFFD 3BUTA 4FZ8L 2OJEA 1OSZB 5E2UL 5DJXB 4NQXB 4YHPB 4AEHH 1Q94B 1DANT 4DZBB 3J8F7 1KCVL 2CUIA 3DGGB 5SX4I 4JY6B 1V3JA 4PGEA 2WZPD 3AC0A 1AIFB 1CDCA 1ES0B 5EUOB 4L5FH 3F7QA 4JN2B 2VXUH 1VFOA 2L4OA 1ZEAL 2ZUUA 2ADFL 4JFEA 1JZ3A 1GRWA 4K7PH 4WGWB 1U8NA 3P73B 3T2NL 5F88B 3BO8A 3SGKA 4Y4HB 3EOAA 2ID5A 4AEIL 4XWOC 4NQCA 3RWHA 3S36X 1FAKT 3BDXA 3WS3B 4G3YL 5EZIL 3BZEB 3HR6A 1UWXH 5DRZA 3ZSSA 1AGCB 2AEQL 1HINL 5EIIA 5F3BA 1HZHH 4HUKB 3T3PE 5A43C 3X11A 4YXHL 1HXYA 5HJ3B 5IWLC 3QNZB 1VENA 2AJ3B 1LDSA 3HLAA 4OF7A 5E6IC 3FN9A 2DI9A 2EIZA 4WO4B 1J1XL 2P24B 3ARYA 2XN9B 4D94A 5C0RH 1P84K 5CUSL 5D7LD 3JV6A 4P2YA 4YDVA 3DHJA 5SWZA 2Z8VC 3JV5A 4WHCA 3CVIH 3VG9B 2WP3O 1IC7H 2QQLH 5IVNA 4YBLB 1RZFH 4UT7H 1IGMH 4OGXL 1REIA 1VFUA 4K7PX 3RZCD 1SJXA 5J56B 1TVDA 3P0VH 2UZYB 1IILE 4OZHE 3TO4D 3BEWA 2HH0H 3QDAA 4KAQL 4ZUWB 3WNPA 3O2WL 4Y5VA 2IPTL 4G6MH 2LE9A 3QDGB 4KK6C 3C5ZD 2W0LA 4JDZA 1CLOH 2NY1C 4QY8B 1BGXH 2C5DC 3ARDB 3NFSL 2NY2B 1WZ1L 3CX2A 2WINA 4HG4K 1T5XA 3GSXA 5DJ6B 4XX1E 3KJ4C 5D2NE 3V4UH 4PRAA 1XR9A 4KKCC 5B4MC 2PETA 2BFVL 2J7LA 1WGOA 4QGTA 4XI5C 2VL5A 4ONHB 4U1GC 1KGCE 1H8NA 4KZDH 4MAYD 1VEOA 5JZ7D 3OKNB 4LSRL 3DVGA 1WBYB 1BLNA 1T83A 1JPGB 1CLYH 1UH2A 1CDIA 1TNNA 1A7PH 1A0QH 5B21A 3FHAA 1TMCB 2BXYA 4XMPL 4HFWB 1XF4B 3TYFB 4HZLA 4O2CB 3OKMA 2XACC 5D1ZB 5BXFB 5JOPE 1VFBA 5T3ZL 3MBXH 1HXMB 3VFUA 4DTGH 2DQIH 3MUY1 1ZHLB 3QXWA 1OAKH 5BRZB 1NMBL 2AK4B 2EYTB 1SY6A 4XP6L 4HWZB 2J4WL 4YDLC 5F1NB 1Y0LA 3Q1SH 3BZ4A 1G7JA 2BHYA 5HHNA 3G5ZB 4KJYA 4LCIL 4UB0H 3VXMD 3ARSA 4XXCA 1EGJA 3U0PA 3ARTA 4JANB 2YPVH 1X6NA 2UVFA 9CGTA 1NGQL 3TEUA 1AJ7H 4JDTL 2VXTH 4XCCL 1T4KA 4A6YB 4NNXB 3MLZH 4PLKD 5FOBA 1FNFA 2G2RB 3C5SA 4MYWB 4EOWL 3HFMH 4ETQA 4DN3L 2VDRH 2M1KA 1UZ6E 1RULL 4LAJH 1RAMA 2ITCB 2BNRB 4OCRH 4KUZL 3IJYB 3ZKQD 3QUXD 4PGCA 3MRPB 4YNYB 4RGNB 2BVEA 4NM8H 4DGVH 4OD3L 2X10A 1HWHB 3AREB 2AERT 5DEGA 3P4LA 3F12B 5EZLA 5CWSA 4BKLA 1A14L 5I1HL 3QA3B 1RJYB 2IG2L 1QFUH 5FUZL 4DAGH 1NAMH 2DQCH 4YHLL 4H88L 2BP3A 4WU5B 1LEKB 4QTHA 1PY9A 1PAMA 4RAVB 4Z7QF 1OP3K 3IETB 1WEJH 1BF8A 1KEML 4LFHD 3WN5B 4LVNC 3CH1A 4OCSH 4QXGL 3RI5F 2PXYD 3LN5A 4P0DA 3O8XA 4GRWB 2UY7A 3RU8H 4PD4J 1I1AD 4HMEA 1DE4A 1F4WH 1M71A 5TDNA 2AJXL 3BP4B 3IDXH 3OR6A 1YPZF 5E2TH 4U05A 5EOCH 1CD8A 1J88A 4PJ5B 4UT9H 2BRQA 1YMHA 3DURA 3TCLB 3RX7A 1WIPA 4ZFGH 5LCVL 1ZGLB 3NGBB 4GBXA 3VFGL 4WUKL 5TFSH 3MXVL 1Q8MA 3RNQA 4RMVA 5HD8D 1CICD 3KPOB 1NEZA 2HRLA 1L7TL 3N9GH 1INQA 3NFPA 2F5BH 1JN6A 4LPVA 5DTFA 5ESAA 1R3JB 2ATPA 4TUOA 1MNUL 1KIUA 1XF1A 1NCAL 5C6TH 1T1YB 2NLJB 2HN7A 1DEDA 5HI5C 2D3VA 5B38A 2PF6A 4MAUH 4OIIH 2JLLA 1DBAH 2X1PA 2HTLC 2JJVA 4FQPA 3WIFB 4M1DL 3MX0A 1AGBA 1K8IB 1A7OH 1G7MB 4PRHB 2EICA 2YXFA 1KN4L 2XYCA 1FIEA 4FXKB 5F89A 1OLZA 3TBYA 2EIBA 2YC1B 4EQ2A 2F19H 4DGYH 3SY0B 1TIUA 5T3ZD 5JXAL 2FJHB 3K81A 2X4TA 3ULSB 5GRUH 1HSAA 2Z31B 2YHGA 5ITFA 1K4CA 5D7JD 2AV7B 5JMOC 2V9TA 4PJAF 4PREA 4I3SL 5BJTB 3ARBB 1H3PL 3VXRB 5K9OB 4KJQC 5I73B 1MQKL 4ZOBA 1LP9F 3HMXL 2DQFA 1W8OA 3GIVB 4MJID 1JFQH 3QCTH 5GHWH 4FFWC 3TFKD 2IF7A 3O6FC 1DVFD 2P5WA 3Q5YA 1OAXL 2C3HA 4RFEB 1YC8A 4CGTA 2XPGA 3VXSB 1UC6A 5L2KA 1J5OH 3FO0H 3NCJL 4GS7C 4G8GE 4Z7WA 1E27A 5E00A 2YS4A 4Y4FB 3L1OL 4DOHE 5IMLA 3BMWA 4R90L 5C70A 4JFYA 4X6CF 4TNVK 1FDLH 3B43A 4WFFD 5EU6A 2G9HA 4WFHE 5AG8A 4L4TE 3FT3B 4H0IA 4R4NC 4GT7A 5DI8A 4KC3B 3GMMA 1A7RH 4U1HA 4XVJL 1FFPA 5DUBA 3ZDYE 3A0OA 4XBGA 2H45A 1CD0A 2XWTA 3VXNB 3FO9A 3SDDC 3TC9A 3D0VA 3OGCB 4TOYL 4OTXH 1M05A 4AY0A 1RMFH 3A6BH 5FGRA 3R8QA 3KPMB 1TZHA 3MGAA 4RZCA 1YEHL 3CU7A 1FNEB 1FNSL 4TUJA 2JCCB 2QTEA 4BSJA 4G9FD 1K5NA 1A6AA 1YNKL 3K80A 4OQTA 3VJ6A 4NO0D 2ITDB 4Z5RA 1KPRA 1UT9A 5GGUB 1IGFH 4XBEH 3SE3C 1CXFA 4E0RB 4PLJD 4P4KB 1MJ8H 3O9WB 4NCC2 4OV5B 4M6NH 3ZKMC 1L7IH 1A6TB 3E2HC 3AS1A 3QXVA 3RDTA 2PYEB 2A0LC 1RVFH 1DQTA 1FNLA 3WHXA 3BH8B 4GAJL 4JHZA 4Y5XC 2IQ9L 2VLJB 4NOFA 3NH7H 5C0CE 4HUXB 3VA2C 1MCPH 4S2SB 4MNGE 1DEEA 3GMLA 3IDJA 1U8HB 1N5YL 3BD4A 3PQYE 1IQWH 4M5YH 3NCBB 4Y19E 1RFDH 1Q72H 2MTPA 4LLDB 1D5XA 2R8SH 3OJMB 4JGUA 2ICWB 4JZOA 2OR7A 1MAMH 2WIIB 4U2ZA 3QDMA 4LVOC 2BRRH 3D3VD 2LVEA 4Z8FL 4HQQL 4GRLA 4IRZL 1FL3A 3QCVL 5KZCB 1AD9B 3LKOA 3FQTB 4M43L 5LXGL 5IQ7L 4Q2ZA 3TPUB 1XR8B 3HMWH 5IMOA 2BJMH 2OR9L 3CFCH 3MV7D 4FQQA 4F2MA 2NNAB 1OAYH 3DETC 3PDDA 4L1HA 4LSUL 1SHMA 4GRMA 1VKXA 5EBWA 2QQKL 5FV1L 3L7FA 4OZIB 3RIAF 4FFYL 1NCBL 1LILA 1KTKE 4L3AA 4OLWH 4NFCA 4G6JL 1XGYH 1FLTX 3TN0D 3ELAT 4FTVB 4DGIL 3HE6C 3GJEB 3U1SH 4OZFA 4P3CL 4JY5H 5KVDH 3QDJE 1U8JB 3ZTJG 4U7MA 3MTRA 5DFVD 4MD5A 2ENYA 2R1WA 1GGYA 1KJ2H 2F5AL 5HGDA 1AXTH 3D9AH 3T2QA 3KLDA 3MXWH 1DR9A 2GJZB 3NGBC 3R1GH 1S7XA 2EDEA 4UT6H 5CFHA 3MOAH 2GHWB 1JPSH 3LRGA 1HSBB 4WJ5B 3TZVC 5CJXA 1MCHA 1KTLA 4N0YL 4P23B 1EVUA 1VESA 5E5MA 1FZJA 2MCPH 3VI3E 1QHPA 1A7QL 2X70A 4FQ1L 4PRPD 2WIMA 4QOKE 2HFEA 5CIPH 2Y4SA 3FB8A 4KK8D 4AT6A 2NX5A 2FYYB 5FYKE 4MQTB 2VDQH 1N5AA 2Z8RA 3FQXA 3RVTD 3TO2B 5DVKA 2EDLA 2CLZB 1TTUA 3X12B 2W07A 3G6AA 1YUHB 5JPMB 2FLRT 4XPAH 2DMBA 4M93B 4HIIB 4MNHA 1MHCB 2CUMA 4NT6A 2IH1A 1HI6A 3QUZA 1HHIB 2FEDC 1RZ8A 1J87A 4WW2A 4OF3A 5T5FL 5FEBA 4U1IB 3VMNA 1AC6A 3VI4E 2V2TB 4OLVL 4Y1AB 3QXDA 1JWMA 2CSPA 3HG1A 2V2XB 2ARJQ 1CI5A 4YHMH 1OTTD 2EH8H 4Y16B 2FX8L 1DFBL 1I7UB 4OUOA 5DS8A 1U58A 2ZCKH 3B9KD 4LSVH 4Q6YA 4BQCA 1K9TA 3LPGA 3GGWA 2VXSH 3KDMA 2AXJA 1TQCC 3ZE1E 3VXPA 3C87A 1JRHL 5GJTL 5IVOA 1NBZA 1D5BB 3BEVB 3KYNB 4LMQI 2YD4A 5C8JA 1ZT1B 1DSFH 1MCOL 4OD1H 2X9YA 3ZE2E 3OB0H 4W68A 3QWOA 1U8MA 3U7WH 4R2GB 1JI1A 4PJXF 2J8UA 3MNVB 5E03A 4GSDH 4HF5L 4PD4K 1I3GL 3EYSL 4P2OC 4CKVX 3MRQA 1X7QA 4YGVA 5D1QC 1SY6L 1NGPH 1EAPB 1Q9LA 4UQ2B 5GGVY 4PJGF 4E42A 5LAXA 1IEHA 2MQ3A 4JHBA 4N0UB 4YO0B 4TRPL 5T5NG 4F7PA 1WISA 2IGFH 3BP5B 1Q1JL 1EGJL 2EYRA 2OM5A 3ZYOA 2H3NB 1FO0H 3HC0A 5C2UB 5I1JH 1MHEB 1MRCH 1GOHA 1XGRB 4YHYC 5DJ0B 2YUVA 4RMWA 4UV7H 1QFOA 4JFED 1GZPA 3L3DA 1UB6A 4X8XA 2HJLA 2Y23A 1FRGH 3JVGA 3ZTNH 5IM7A 1WCQA 2VQTA 3MRJB 5MEQB 3MV01 1S7UA 2MSPA 5SX5H 4NQCD 3LD8C 3W9DA 4KDTC 1BEYH 4I48B 2VITA 3T2PA 2BSRB 1LO2H 2VLLB 3T0AA 4O4YL 1D5MA 2W1NA 1UM6H 4HJGB 3I85A 4QXUL 4UAOC 4HXAL 3SDCA 4JPIA 4FZEH 2R9HC 1U95B 2ZSVB 3MNWA 3PIQB 5E8EB 1K8DB 3I6LE 3MLSH 1JE6A 4WTZG 5GGTH 2D0FA 4X7TA 1NFDE 5SWZD 4MJ4A 4LIQH 3RA7L 4X98B 4HIXH 4AL8L 1R3LA 3V6FB 1FGNH 4M7LL 2Z9TA 5HHOA 3VGAB 3IT8D 3PL6D 5FV2A 1R5WB 3P4NB 4LHUB 3SKJH 4F58H 1B4RA 3U30C 3QQ9C 2A6IA 3ECBB 4RNRB 4P46C 2HFTA 5E2JA 2VC2H 1PX3A 1JUFB 1F2XK 4HCRH 3QIWB 3VXQA 1CXHA 3P0YL 4K3EH 1F3JB 2XI9A 3BSZL 5GRJL 4NFBA 1JNHB 3WYRA 1TDQA 4PGBA 1JZ2A 4OZHB 1ZSDA 3F7YA 1KIPA 3IKCA 2HKFH 3W9EA 5HDOA 5IFAH 2EEAA 2PO6A 2QR0B 5LWYL 2Q87A 2DBLH 3LAFA 2VL4A 1ETZB 1QLRB 1MRFH 4DN4H 1RZJC 3LKSB 5FYJE 4OD2B 3VFVA 1BFTA 3LKQA 3SO5A 1XGQB 1DBKH 5I1AB 5IEHA 1OCWH 4JR9L 1OQXA 1OSPL 4DUWA 1MRDL 1YQVL 4MXWH 1WIUA 4PB0L 3S97C 2QKIA 5J6HA 5HDBE 2RCSH 4R3SA 3IDYC 3NPSC 4EN3B 4UQ3A 2ICES 4IBLT 4X9IA 1L0QA 1NCCL 1XAUA 4YX2H 4L8SC 3Q48A 2Z91B 5IW1A 3F65A 4XP9L 1JGDB 3HAEG 1IM3B 2R2BA 3PWUB 3RIFF 3L3KB 4U1KB 2V5YA 4KJPD 5FM4A 4OJFL 5CEZL 4IIQB 1U91B 5GRVK 5MEOA 3P4OA 2VDML 2JB5H 2D7TH 1XF2B 4XRCA 1J0YA 2H32H 5K9JH 1FP5A 1H15B 1S7WA 3MLXL 5D2NA 1PD6A 4X0KB 1C7SA 3RTQC 1MCCA 3GHBL 4YK4C 3NFNB 1JTPA 1CD1A 1IZJA 1JV5A 4GKNA 4XNUH 3QJFB 5IW3A 2B7DT 1TJHL 3LIZH 1NC2B 1MF2L 3RZCC 4Z0BH 1CGTA 4E5XB 3TO4C 1KG0B 4HC1H 4U0QB 4KKAD 2XWJA 1VGKA 2EO1A 3IFPA 1ERNA 5KAQF 1RURL 4X8JA 4KGJA 3TF7C 3VCLB 1S8DB 4WHDA 5IG7B 4LCCB 4R26H 3C5ZC 1Y6MR 1TZIB 2HJKA 4M9OA 5HHQA 2IWGA 4JDVB 4X99A 1FQ9C 2IPUK 2FB4L 2VISA 1NCTA 3TNMB 4S1SH 4P3DB 3O3EB 4D8PB 3KJ6L 3Q6FB 3KLAA 3Q6GH 4TULH 4HH9A 4M00A 3G5VA 4D9RE 1YDPA 3GRWH 3ARUA 4P5MA 1EPFA 2DQUH 3NCYS 4DVRH 4EDXA 1T7WA 4MAYC 3QUKA 1KXQE 1UXWB 5JZ7C 4ERSH 5IFJB 1E4KA 4RGOL 1TJGL 1KJ3L 3NOIA 4F37F 4ZUUB 4RIRA 4M03A 5C3LD 1ZHKA 4QRPA 1GAFH 1EUUA 5E1AA 5DR5L 3KVQA 3OSKA 3F6LA 1G1CA 2CJUH 2YBRB 3WFCH 4BQ8A 2ADJA 1IAIH 4ZFZB 2AJSH 3CXDH 3FONB 3T0DA 4G8IB 3O8XD 4ONGH 5EA0H 4PV9A 4FQLH 2YN5A 1ZOXA 3F7RA 4X7SL 3WKMH 1S3KL 3AY4A 4OF8A 4RWYH 2APFA 1T0NB 5GRXG 4QHNA 5EFIA 3KPTA 5KS9A 4JFHD 3VH8G 1N7ML 5DHVH 3HZYA 3SKNA 2VZOA 3O4LA 1QSFE 2YD2A 4GBXD 4XPBL 4PJ8D 4XCFL 4XNMB 2QL1A 2R23A 1YEJH 4JRYE 5BS0D 3OZ9L 1IVLA 4FQXB 4X5XA 3O11A 4QXTA 5L7XL 4XGZB 4N9OB 3S88H 4PLKC 3DX9A 1R3IL 2V7NA 1CDHA 4JFZH 5F7UA 4N1HB 2HVKA 3JWNC 3QI9B 4LLVB 1QLEH 1ORQB 2X4UB 3O41B 4U4BA 1KPVB 4ENED 2BC4B 3CIQA 1CXLA 4JKMA 1NL0L 4PR5A 4Q9QH 2I9TB 3MFFB 5IKCB 1GVIA 3VFSB 1ONQA 1A8JH 3M1BA 4NO3A 3QUXC 1CGSH 5ISZD 5GRWA 4IJ3B 2NTFA 3PWPE 1K2DA 2PTTA 4BH7B 2ZUQC 5CLTA 4ZPTA 4OFIA 5DD0H 1WZKA 5I19L 3E6FA 4C83A 4NZTH 5CEZD 5LQBH 4I13B 1AQDA 4MB5A 4TNWK 5CHNB 4HK3J 3EYVA 2R1YA 1YEGL 4YQXL 1HCFX 4I9WE 5I1CH 4LNRA 5HDLA 4D0CB 3RUGE 4EI5B 4NKDB 1J8HA 5DWUL 3JTSB 1Z3GL 2ZOKB 2PXYC 2YEZA 2ZG2A 3MSPA 1I1YB 3CVHH 1I1AC 3L95B 2V7HB 5DD1L 5CJOL 3RY6A 2P5WD 5BOPA 4KQ4L 5E5RB 2FD6L 5L2KD 2JIXA 3RL2A 1U8QB 1E4XL 1S5IH 5C0IB 1H5BA 3W39A 3GSOA 1ZHBB 4K9EH 3JV0A 1MCSA 3U4AA 2XTJD 4JFQA 2YPLE 4G8GB 2CKBH 5IVZA 5GRZA 5EU6D 5HD8C 5AWNL 1CICC 4DOHB 2IADB 2XRAH 1AH1A 2R69L 3SO3C 3KPLA 4F9PC 2WUBL 1A6ZA 5HVGB 4UTBH 1NCNA 4LPYA 5DZNA 4OM0L 4D0DB 2EXWD 4QHUA 1OP9A 2E5EA 4BFEA 2QEJA 1P4BL 3HS0A 2OZ4A 3N1QC 1CFSB 3HI1B 5E0QA 2R2CA 4P4RA 3UYRL 3EJJX 2IBBA 2YWYA 4YXLH 3FB7B 2OL3A 1UM4L 2FX9H 4NUJA 5ETUB 1IC4L 3NVQA 4G80B 4OCMC 3VXTB 5F1KC 2GITB 43CAA 4D3CH 4PRDB 4YAQB 3WE6B 4NSKB 3MJ9H 4N8CH 3SQBA 1JZ4A 4ODSL 4H0HB 4K94L 2XV6B 2B39A 5JHDE 2DWEA 5DLML 3RDTD 4MJ6B 1CVSC 5ANME 5D7IA 5D7JC 2PYFB 2P8LA 3FN3A 5TE6L 7FABH 1C5BH 4M7JL 3L3IB 4QRRA 5I75C 4LLUB 4XAKD 3T4AB 2JELH 3K2MC 4X4ME 4LLQA 2R29H 1KCVH 4U6VH 2YD7A 3VXUE 2AJUL 3HAEA 5LBSL 32C2A 4E9LA 3B3IA 1R3HB 2WQRA 1XGUA 3L5IA 3EYQD 4XH2A 2BVTA 3TFKC 1QA9A 1YYML 4XCEA 5ESQB 1F6LL 1DVFC 4PJ9D 4PTUA 2DBJA 1B0RA 1JGUL 3NZ8B 1ORSA 5C0CB 3MRGA 2DLFH 1ZXQA 1I7TA 4NRXA 3TLRA 3B9VA 5D71L 2DDQL 5D2LE 1RPQA 2C1OB 2GAZA 2IAMA 3PQYB 1QRNB 3MODL 3QDMD 3GMRB 4Y19B 5L6YL 2LAAA 5TDOA 1N2RA 4GRLD 4JLRA 2VTFA 3GBMH 3VGDA 4XVSH 5ABDE 5HYEA 4BZ1L 1RJZA 3GMPA 1JGEA 2IBZX 3QZWG 5DMIL 1U8OA 3UTSD 1EZVY 2F8XC 4NQEE 5I71C 4PGEB 2BSSA 1Z0MA 3PNWA 3HZMB 3A67H 4F15B 1OARH 2VZTA 1P6FA 2HWZL 4DZ8A 1X4YA 4L8DB 2VDNL 4CN6A 3GIZL 2R2EB 2CK2A 3V5DB 2IANA 1I7ZA 2F53E 4GW1A 3F5WB 1EDQA 4MD4A 3S5LA 5LGJB 4I2XA 5KZCD 5EIIB 5B8CC 4HKXB 4PLJC 1EEYA 1RIVH 2Y72A 3VFTB 1S7VA 1CFNA 1R24A 4PJBA 1S7RA 5L8KB 3GHEL 4G7YH 5MEPB 4MQXD 4K55A 3LZFL 5JR1H 3QDJB 3ULUE 4TSBH 4NQDA 1W72B 2VE6B 1OAZL 1SJEA 4NCC1 4YWGL 2O5ZL 3EYFA 4L8CA 1YEEH 5ILTL 5CD5D 1WZ1H 1HH9A 4H5SA 4GJTB 1J0JA 1XF3A 1I7RA 4X9FA 4MA1B 4OZIF 4HS8H 1IQDB 2GTWA 4ZXBA 4LF3A 2BFVH 2X40A 1UM5H 1FJ1B 2NX5D 1G9NL 2EIEA 2ZSWB 3SDAA 1M4KA 2Q3ZA 3DX7B 3UPCA 4QOKB 4JFDB 5D70L 2DQDH 3MV9A 4YHOL 1KENH 4XC1L 3CMOL 5CZXD 3RJQB 4PJCE 3JWDL 3QUZD 4X4ZA 3VRLF 3ESUF 5DK0A 3HE7D 4XMPH 3ZYJA 1PG7W 2KDGA 1VFAB 3V4VL 5DDHA 5JO5A 1I9RL 2A83A 2HLFC 1NC4A 1A5FH 4N8VA 1VACA 1ACYH 4YPGA 2WINB 3D87B 3TV3H 4WW2F 2A77L 1CIUA 3GSXB 3HG1D 4ZO9A 1Y6KR 1U8IB 3MGOB 3LEYH 3TBTA 1XR9B 3B5TA 3CPLA 3SKMA 4X80L 2OJZH 2GUOA 1NEUA 4XP6H 3QG7L 1CBVH 5CSZA 2F54D 2IMNA 2BVQB 3FFDB 3A6CL 3DVGB 3PGDB 1MREL 3TN0C 4GXVL 1BLNB 2APWA 3D18B 4LARL 3P30L 3U46B 1ZTXH 4PS4H 4O5LL 2CKNA 4WFED 5BV7L 5DFVC 5DC0A 1CFVH 4HWEL 2J8UF 2FNBA 2CMRL 4QF1B 4AIZB 2X4PB 2FATL 1DQJB 3GJFB 5EBGA 2WUCH 4YZFF 5DJYB 4QRUB 3PHQB 1DQDH 2UYLA 3K8LA 2EDYA 4Y2DD 4RDQG 4Y8DC 4WV1A 5JIPA 1G7JB 3QISA 4WNQA 4GKZB 1IKFL 4ZAKB 5D93C 4MNQE 4KK8C 4RRPG 3O2VH 4L9LB 2M2DA 2X6MA 3HN3A 3RVTC 5GS0L 4PJFA 4WW1B 4G7VL 1IGIH 3TIDB 4X6FA 2C7UB 1RZ7L 5GS1A 4HGWA 4N0FB 5BVJA 1A14H 2Y25A 1T4KB 2NY0D 4BZ2H 1R5IB 5E6YA 2CO7B 3VXOA 4QKXB 5F9AC 5IIEA 2YRPA 4Q6IC 5IBTH 2Q76B 2W9LA 3A6OA 1TPXB 4ETQB 5F96L 1ED3B 3KGRA 2VAAB 5FUOL 4YFDB 3VWJB 3WEXA 1MY5A 3SDCD 1TVHA 4U3XA 5B3JE 3U4BH 1OTTC 5DZLA 4APQA 1URLA 3T1FA 5F72S 3B9KC 1OGAA 4I4WB 2JJWA 2QADD 2PCPB 2AXGB 4Z0XA 3WIHH 2HJFA 5CEYA 1WSST 5CWSB 3SN6N 4BKLB 2I60H 4UU9A 5E8DL 5F6IB 3MQIA 3VFGH 1F58L 1X5GA 2APTA 5D8JL 5F1IB 4RFNB 3OV6A 1NFDB 3STLB 4U7KA 3IXAB 5C07A 5F9WC 4RAUB 3BN9D 3S96B 4TSAH 3LQMA 1I8KB 2WWKT 3LN5B 3NABL 2ERJB 1FZMA 1LEIA 4WHTB 1FVEB 1IAKA 1YECL 2CD0A 5F7EL 4ODBD 3NN8B 3P9LB 1BZ7B 3WFBH 5FA3B 1JWSB 4AMKL 4H1LG 4YLQT 2D7NA 3TVMA 3L5WA 2D31A 4I18B 4ZYKA 2PO6D 3FT2A 5IOPB 3T3PF 4UBDD 5KSAB 3DURB 5HHVH 4NPYB 1UA6L 3RNQB 2I25N 2ZUXA 1KJVB 1UH4A 4UTAH 4KVNL 5DQDL 1JRHI 1AD0B 1JN6B 2QSTA 5ESAB 3SGKC 1HQ4A 3LMJL 3BPOB 4URTB 3QXAB 1LO4H 4CMMA 1UQSA 4Q9RH 3I6KA 4CADA 1Q9WA 3IJSB 4O58L 1LK3L 3S35H 3VFOA 1ZS8B 3QZWA 1CDBA 3WLBA 3JBG7 1JL8A 3MMEA 4P2RA 3HMXH 5ICXA 5HPMA 3V52L 2O93L 2DQEL 5D1XB 1OAUH 1R3KA 5JHLL 1SBBA 2V5RA 3RI5K 3H42H 4H8WH 4PTTB 1V7NH 1EBAA 3V6BR 3QQ4A 3NCMA 3SJVA 5J9PA 1U93A 3QPQD 2Q7YB 5MENA 2J88H 4X6EA 2VLKE 4LVHC 4GLRI 4L4VA 1ZT7A 3KPSE 5SX4H 1NQBA 4QWWD 1IAMA 4QHKI 2CDGA 3PL6C 1KGCD 2IFFL 3LHPL 2ZWLT 1RU9H 1JNLH 5EZJB 4KRPD 1I8LA 2AQ2A 4S0TD 1UKTA 2WWMD 2PR4L 3GI9L 4AH2A 4JGJA 5GS0D 4M4RA 2X4NA 2EZ0D 5T1MA 3U9PH 2QSQA 4TOYH 2V5MA 4Y5VC 3S35X 4L3CA 3TBVB 2UUDH 4EXKA 4WEBL 2XPGB 4LU5H 1IAOA 1WQVT 2O5XL 2ZCLH 4X7CC 2OI9B 4TUKL 4Z7WB 3PP4L 1FNSH 2YMXH 3VGBA 4OB5H 3MRIB 1S7TA 3NACL 1N64L 1T6VN 1YMMA 3ORJA 5J1AB 2X4SB 4QHMA 1RZGA 1M7DA 3VFWA 2A6JB 2EDRA 3DARA 4BFBD 4HS6B 2D4DA 2DQJH 4GG8B 3SGDI 1JHLL 2OZ4L 4XPHH 3SKOA 4FQHA 2X44D 1T83C 3FO9B 4ELKA 1CD9B 2R0WH 2VDPL 1X5XA 4QRPD 4XPFL 3KYOB 2WWKO 5DJ2B 3HZVA 5IB2B 1TCMA 1T22A 3Q2CA 1NCDL 5LGHH 2UZIH 1K5NB 2Y5TA 5ESVA 4YFLI 3VJ6B 2EKSB 1GZQB 1KPRB 3O6LL 5GIRB 4AM0A 4KJPC 5JUEL 4DKFL 5DHXB 2FX7H 1DQQB 3S37X 4OZ4A 3CFJA 1GGIL 1I9IH 2NY6B 4KHXL 1RHHB 3GSUB 3BD3A 1QFWM 5JW4R 5SWSA 4Z8FH 5KS9F 1GH7A 4LCUA 3C2AL 1CG9B 3EHBD 1N4XL 1XCTB 1MI5A 4XXCC 3B4NA 5LXGH 3P40A 5E94B 4X7EC 4FN0A 5F9OL 1UKSA 3UJTH 4MDIA 5E4EC 1QSFB 4M5ZH 1R5VA 4K8RH 2OR9H 3WD5L 1AO7E 1HH6B 3MROA 1DEEB 1F4AA 1MCJA 1AGDB 4JRYB 4KKAC 4MD0A 4NKIL 1KFAH 3INUH 4LLYA 4UUJA 4MSWA 3FAWA 1NGWA 5FHAL 1J86A 1F8TL 3BQUB 2I5YL 1D5XB 1MLCB 5INCB 1FSKB 2B0SL 3ARGA 5LJYH 1IC5H 3H7BB 2ICEA 3MUGA 4P3CH 1FL3B 4FS0A 3SQOL 4WEUD 1NUNB 3I9GL 1WZMA 2R1XB 3ZKXC 1MCFA 5DJZA 1X5JA 5IR1A 3MLUL 3PGCB 3CLFH 4NBZB 4OLUH 2VR9A 2Y07H 4KTEH 1S9YA 2F5AH 2DLIA 3ZL4H 3PWPB 2HT3D 3H8NA 1BJ8A 2IQAB 3X13B 3GUTA 2Z4QB 5I0ZA 3IDUA 4CNIA 1JVKA 5GGQH 4KROB 1BZQK 2EECA 1PSKH 2R0ZH 3ALXA 4NNYA 3O8XC 4LKXA 4MZ2A 3X14A 4LHQB 3MNZA 3RUGB 1F45A 1DBML 5IT2L 3OWEA 1D5IH 4KQ3L 5AD0B 4ODXA 5EDXA 3RAJL 4MDJB 1A7NH 4PG9B 4YHZL 1NAMA 5CAYB 2JIXD 3BKCH 1JK8A 4MD5B 5C71A 3F8UB 2NY5L 2YK1L 2R1WB 5I16B 3CFKA 4NJ9L 4QHKJ 5C0DA 1KPUB 3BKJH 4FXGB 3KHOA 4GBXC 1CK0H 4PJ8C 4RISL 5JOFB 4PJDB 3S9DB 4XC3H 1F97A 1BD2A 3E3QE 2DI7A 1Z9SA 3CGTA 4ODTL 2FHCA 4ZQKB 4HMCA 1KNOB 1KEGH 1N59A 3WFZA 5CEXB 4GKSA 1CYGA 3BRDA 1F6AB 3AS0A 4LLMB 4AT6B 2VRAA 4KPHL 4HIJA 5JMRA 5I1IH 5C92A 4V1DE 4C55A 2AV1A 2A1WL 3G6AB 1JMXA 5SWQA 5DRNA 3LQZB 2GFBB 3PDOB 1D9KB 1MCOH 4FQCL 4ZFOB 2A6DB 4G42A 4MNHB 5EOTA 4CVXA 1EHAA 4HULB 1HI6B 2AEWA 2NQCA 2ZOLB 1AI1L 3CSGA 3X3GH 5I18L 2JJTA 3DUHA 5CJ8A 2QQNH 1PYWA 2A38A 1LEGB 1MLBA 5HI4D 4JFPB 4S11A 4O2EA 3REVB 1FZOB 3QXDB 1NBVH 1BQUA 1FV1B 2X1XR 3CFIC 5DS8B 4L4TD 4WI5A 4TRPH 2LTQC 4P9ML 1EX0A 5D7IF 5JHDB 3QNYA 1Q1JH 2X42A 1ZLUH 3TA3A 5F7HA 2P49B 1NBZB 4RQQB 4DKEL 1PQZA 5TF1H 4M9PA 2CUHA 3ZDYF 2GSGA 3W0WE 3OL2A 4RFOH 3VXUB 1YY8A 1Q0XL 4PV8A 4C54A 2CIIB 4ZOEA 5IESL 1IGTB 1LNUB 3IDIA 1PG7X 3GM0A 4JG0L 1A3QA 2X7LA 2IAMD 15C8H 5DRWB 4YGVB 2AQ1A 3NPZB 5FECB 5E6ZA 1EJ6A 2XTJC 1OD9A 4UOW1 4E42B 3MZGB 3AROA 4MX7A 5D2LB 1NCWL 4HK0A 3LEVH 3AAZA 4KV5E 5C6PB 2VLRA 3GSQA 2DTMH 4Y0GA 3ZSTA 2EYRB 5ANMA 5DD6A 1MJUH 3CK0H 2EXWC 3TT3H 1U8LB 3QIUB 1GC1L 1GZPB 2VXVH 4A6YH 5JOEA 3PABB 1CFQA 5EU7E 1FNGB 1MFDL 4M6ML 4KXZH 5JW4Q 2CLRA 4NQTA 4CVZA 2DTSA 1S7UB 4MZ3A 4AEEA 5H2BB 4F3FA 1MJ7L 4G6KL 3EOBA 2IAND 5A1AA 2VITB 5DYOA 4I1NB 1YEDA 1B2WH 5D6CA 3MREA 1FC1A 5KVEH 1JTOA 3UDWA 1D5MB 4LLWA 1N3NA 3P0YH 5E70A 4NFDA 2F53B 2FH8A 2IH3A 3FOMA 3MRRA 3MYJB 4JPIB 3BD5A 4KDVA 3LEXB 3RDTC 4YXKH 3T0EA 4PJBF 3HUJE 5C0ND 4NQDD 2E9JA 3MNWB 3DROB 4I5BA 1T2JA 1IBGL 3CFDB 1QUNA 4NKMA 3LDBB 2BVPB 5EU4B 3OG6B 5DEFB 3WO4B 2BNQA 2HTKD 3EYQC 4TQEL 5DJAB 3IB4A 5HHOB 4LSTH 5F97E 4YHNA 3HR5B 2YKLH 4GMTL 1BIIA 4GRWH 1NUFA 4PJ9C 3SDAD 2A6IB 3EYOB 5J1TC 2D0GA 4Y88A 2D7PA 3SCMA 5I2IA 1OSPH 1F3RB 3MV9D 5HGBB 2X9XA 3AS3A 5EN2B 3K8KA 4F57H 4XHJD 1L9MA 4PJIE 1N8ZA 4GRLC 3DVNA 3NA4A 2C3VA 1K4DB 1ZSDB 2C1PA 1M6OB 1VGEH 2HG5A 3BYTA 4JM2A 4Y5YB 6CGTA 2A74A 2AEPH 4FRWA 4LRIA 1AGFB 3JV4A 1A6VH 2N4IA 2GEEA 4FNLH 3U9UA 3TH4T 4FQ2H 4WWKB 4AEHL 3PHOB 4JREB 4C56E 3O3AA 1HOCA 4U1LA 5DD5L 3D2UB 3IAQA 5I74C 1J0IA 4HWUA 4M7ZC 2A6KA 1BQSA 2EDQA 4L5FL 2N56A 3ZDZE 5J6HB 3VI3F 5DJCB 2VXUL 3QUYA 3CX5J 5KBNC 4LAQH 4K7FA 4K7PL 4GAGH 1XT5A 1T6WA 5IQ9B 1P9MA 4ZFFA 1TXKA 4EI6B 3OGOE 1T04B 3LPWA 3GEWB 5ID0B 2GSIB 2IALA 3KLSA 4MQSB 3ZHLA 2R2BB 4MQXC 2J5LB 1BBJB 2VYRE 3DUUA 5GGVH 3LQAL 4WFGD 1BQLH 4LSQH 1HZHL 5HHME 1MEXH 1CS6A 2LU7A 3GNMH 2ZUSA 3MRNA 2WMPA 3NCEB 5CJXC 3VW3H 5CD5C 2BK8A 5ICYB 4DCQA 1S7WB 3CDGB 3MV8E 1ZVYA 2DD8H 4ZUSB 3V9FA 2BMKA 4NQSA 4WDIB 5D5ME 4HKJA 1JV5B 5C0RL 1KJ2A 3VRIB 1H3VA 1G7QB 4ODUB 1CE1H 4L8BA 2O61A 2BDNH 1QO3B 4JQXA 4LP4A 3WMSA 2A2QT 4PJFF 1IC7L 2QQLL 4IRSA 1P4LA 4MCZB 2P1YA 1RZFL 3DRTB 4UT7L 2CK0H 1IGML 1JZ8A 4UIKL 2CDEA 5CZXC 2FWOB 3DX6A 4XVUD 1WFNA 3L9RA 1IL1B 3QUZC 5IBLD 1DDHB 1TCRB 3ZE2F 3P0VL 1A9EA 5HHQB 4WW2C 2HH0L 1FIGH 3FB6B 1SYSB 4OKDA 1YN6B 3OF6A 2K9UA 5E56A 5ALBH 2IPKA 4X7SH 4JAMB 4G6ML 1BFOA 1CLOL 5IJVB 1XZ0B 4APQD 4LRNL 1BGXL 2EDWA 2Q20A 1OGAD 3C8HA 3QUKB 4LBEA 3OXRB 4N90D 5E8PB 5BZWA 2BY0A 3W82A 4JFXB 5JXEA 3V4UL 1Z5LA 4XPGH 1WAAE 5HYQB 3UTZA 3SE4A 4CJ1A 3WS6A 3DVFA 2YN3A 4KZDL 3QULB 4U6XB 2ICCA 1XIWA 3C60A 3HRZB 3H9SA 3VFPA 3L3GB 3LSOB 2P47B 3QQ3B 4K3HA 1JF5A 1NFIA 1N6UA 1A7PL 1I4FB 2ILLA 2Y9RT 1A0QL 5FIEA 2OK0H 2XKUA 2NR6C 1ITCA 3KG5A 2C4FU 4Y2DC 3QG6A 3SKNB 3MBXL 5CSGA 3O4LB 5FKPA 2FSEA 1DUZA 2DQIL 1DZBA 1JBJA 4Z7UE 3BXNB 3AM8A 3BIKA 4KKBD 4KGLA 3BIBX 4LPXA 1XF5A 3Q1SL 1W0WA 3JVGC 4NO5A 4EKXA 4QXTB 1DANU 4LGRB 1I8IB 4PJEA 2BXZA 2GCYB 3NIDE 3S6CA 1INEH 2NY0C 4UINH 4MLSA 2J12B 2VQ1B 3VMPA 1FH5L 1FO0A 2HFFA 4UDUA 4Z77A 4C4KT 5DWUH 3CUPA 1AJ7L 2VXTL 2GT9B 4P2RD 1J1OH 3MLZL 1OTSD 1I8MA 3SDCC 4ODHH 5HYSB 4R6UA 5EO9A 1D5ZA 2NTFB 2FD6H 4KZEH 3C09C 4IRJA 3VDBA 1TNMA 4ZPTB 5IK3A 1E4XH 2QADC 5IV2B 4OCRL 3SJVD 4RAHA 2GJ6E 2FR4B 3HE6A 4MA3B 4NJAH 5MEND 2D7OA 5M94B 2OLDA 1UJ3A 3RGVA 4MWFA 5BOZG 4V2CB 5C0FA 3X3FH 5AWNH 4NM8L 4DGVL 4NN7B 2LABA 2JK5B 1RI8A 1MFNA 2R69H 3BN9C 1J8HB 5D96B 3ULVH 1RIUH 1DBJH 1FL5A 4HEPG 3QH3A 1Z0NA 1QFUL 4OM0H 1G9NC 5GGTA 2ZCHH 4X4YA 4DAGL 1NAML 2DQCL 1NMCB 4PFEA 5HY9B 4BFGA 3G6JE 3RBGA 5TH2A 3TZVA 2W60B 5LGKA 2E7BA 4OCSL 1GPOH 3UYRH 1EFXB 4Y4KA 4LGPB 3RU8L 4YDKH 5CP3H 4YEEA 3JWDC 1F4WL 2ORBL 2PO6C 1WITA 1UM4H 3I2CH 4UBDC 3G08B 4HCRA 3UTOA 4XVTH 1NLDH 1YMMD 3BFOA 3FQNA 5IVZB 2FO4B 3UTPE 5I8KH 1UVQA 5E2TL 5EBMA 4HJ0D 5EOCL 5KG9A 4O00A 4K94H 4UT9L 4Q9CA 5FF6B 4GAYA 5DA0B 2FZ3B 4ZFGL 4JRXA 4UDTA 5FO7B 1X5LA 5TFSL 5DURD 5TE6H 2Y6SD 3HNTH 4JO3H 4P49A 5E08H 2WW8A 3N9GL 2F5BL 2HVJB 1LVEA 1IZKA 3FFCA 5C6TL 2OTWA 5I1DA 3VFMA 2OL3B 5DJDA 4L3EA 4MAUL 2R4SH 4OIIL 4NUJB 4OGAD 3IFNH 5BV7C 1QR1B 1DBAL 2EC9T 1CCZA 4R97C 1RUKH 5DK2A 3WXVH 5BW7A 2OTUA 2D7MA 2RIKA 5D71H 4P2CG 2W38A 1A7OL 1SJVA 1EXUB 3QPQC 5EU3B 2PW2A 2OQJB 3MODH 1QSEA 2VDKH 4XP5L 1L0XA 5D2NC 2B1AH 4D9RD 2GW5A 2YPKA 2X9WA 4QHLA 4R96A 4M8QA 4QWWC 3MRMA 1MI5D 2F19L 4WI8A 4QRRB 2R2HB 4EIGB 4KRPC 2IMMA 5DF0A 3DMMD 1FYTE 3UX9B 8FABB 2WWMC 1XGUB 5GS0C 1U8KA 3DV6A 2EZ0C 2H32A 3FT4B 4C4KO 1KB5L 5IHBA 4PTUB 1T20B 4PJ7E 1O7SA 4YJZL 4BFIA 4IOSD 1MCWM 1CGUA 3UTTE 5C9KA 2PTUA 1MCIA 4NRXB 3ARGD 1JFQL 3QCTL 3T0XA 5GHWL 4RDQF 4N1CA 2Q86A 2W9DH 1A3RH 5EC1A 3MLWH 4OZGA 1J5OL 4HC1A 3FO0L 1LE5B 1N6QL 3N06B 3V8CA 5TDPA 4K3JH 4H0GA 4JO4H 4P9HH 1U8OB 5HSFA 4X6BA 2GYSA 1E4KC 4KDTA 3O0RH 4U6HA 3D85B 3SGJA 3LZFH 1FE8L 1XMWA 2VLME 3QHZH 4UMGA 5INDA 1OAZH 5DHYA 2XZQH 4XPTL 1A7RL 2X89A 3PWLA 1U3JA 3GRWA 4OAWA 1QBBA 3O3DB 4WUUA 2E3VA 5GGRB 5FCUH 2H26B 5C08E 3CX5K 1MFCH 2GTZA 3TPKA 5ADPL 4OTXL 3NAAH 1RMFL 3A6BL 3AY4C 4I2XB 5EC2A 5C09A 1P7KA 1EEYB 1EEQA 4YHOH 4OQ1A 4XC1H 3TBSA 3TBWA 5EO0B 2RJMA 1IGFL 3JWDH 4E41E 3EHBC 4XBEL 1MJJB 1S7SB 3CSYB 4NYLB 1BD2D 1T3FA 1MJ8L 4M6NL 1I9RH 3OJVC 4QYOA 1L7IL 4H5SB 4JFFA 1XF3B 2XICA 2X4RA 1RVFL 3C6LA 1ROWA 3MA7B 5IMMA 4POZD 2GTWB 4ZXBB 4I9WD 4JVUA 5DHVA 4X6DA 2ZNXA 3IFOA 3QG7H 5CMAB 3UROR 3VH8B 5HGHB 1PGRB 2NY4B 3NH7L 3REWA 2LQRA 1MCPL 5E9DA 4GXVH 4XMKH 3QYCA 5I66A 4LARH 4V1DB 3WBDA 1IQWL 2AJVL 3P30H 3I50H 5C86A 1RFDL 1Q72L 1MHPH 4JY4A 2WM0A 3DIFB 2R8SL