1OY5A

Crystal structure of trna (m1g37) methyltransferase from aquifex aeolicus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
232
structure length
218
Chain Sequence
NPLRFFVLTIFPHIISCYSEYGIVKQAIKKGKVEVYPIDLREFAPKGQVDDVPYGGLPGMVLKPEPIYEAYDYVVENYGKPFVLITEPWGEKLNQKLVNELSKKERIMIICGRYEGVDERVKKIVDMEISLGDFILSGGEIVALAVIDAVSRVLPGVLSEPYPVYTRPREYRGMKVPEELLSGHHKLIELWKLWHRIENTVKKRPDLIPKDLTELEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA (m1G37) methyltransferase from Aquifex aeolicus at 2.6 A resolution: a novel methyltransferase fold.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 52
structure length 218
sequence length 232
chains with identical sequence B, C
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1oy5A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1oy5A01
3E5YA 4KGNA 5CO4A 3OIJA 4CNFA 4CNGA 4MCCA 4YQ6A 4YVHA 1V2XA 4MCBA 1NS5A 2QWVA 5GMBA 4CNEA 4XBOA 5D9FA 1K3RA 1P9PA 3L8UA 4KDZA 4L69A 4MCDA 1UAMA 1GZ0A 3IC6A 2HA8A 3BBEA 4YQJA 3BBDA 1OY5A 1TO0A 4YQIA 1J85A 2EGWA 4YQQA 4YQ7A 4YVKA 1UALA 3GYQA 4YQ2A 3AI9X 4YQ8A 2O3AA 2I6DA 4YPXA 3AIAA 5FAIA 3O7BA 1O6DA 3ILKA 4J3CA 4YQ1A 4FAKA 4YQBA 1VHYA 4YQ0A 4YQKA 4YQ4A 3AXZA 4RG1A 5GM8A 4JAKA 4YPZA 4YQAA 4YQCA 4YQ9A 3NK6A 4YQSA 1NXZA 4YQDA 1ZJRA 4YPWA 2V3JA 3KW2A 1IPAA 4YQNA 2CX8A 2EGVA 2Z0YA 4X3LA 4E8BA 4YVGA 4YVJA 3N4KA 3OINA 3ONPA 4CNDA 3OIIA 2YY8A 3IEFA 3KTYA 1UAKA 4PZKA 1VHKA 4JALA 1X7OA 3N4JA 4YQPA 4YQGA 1Z85A 5GMCA 1UAJA 3KY7A 4YQLA 1X7PA 4X3MA 2V3KA 4H3ZA 4H3YA 4YQRA 1VH0A 4YQTA 3KNUA 4YVIA 3NK7A 3QUVA 1V6ZA 3DCMX 4YQOA 4IG6A 4YQ3A 1MXIA 2QMMA 3BBHA 4YQ5A 4YPYA
chains in the Genus database with same CATH superfamily
3E5YA 4KGNA 5CO4A 3OIJA 4CNFA 4CNGA 4MCCA 4YQ6A 4YVHA 3FRWA 3SSXN 1V2XA 1CO0A 4MCBA 1NS5A 2QWVA 5GMBA 4CNEA 4XBOA 5D9FA 1K3RA 1P9PA 3L8UA 4KDZA 1JHGA 4L69A 4MCDA 1UAMA 3SSWN 1GZ0A 3IC6A 2HA8A 3BBEA 4YQJA 3BBDA 1OY5A 1TO0A 4YQIA 1J85A 2EGWA 4YQQA 4YQ7A 1MI7R 4YVKA 1UALA 3GYQA 4YQ2A 3AI9X 4YQ8A 2O3AA 2I6DA 4YPXA 3AIAA 5FAIA 3O7BA 2XDIA 3G1CA 1O6DA 3ILKA 4J3CA 4YQ1A 4FAKA 1WRSR 4YQBA 1VHYA 4YQ0A 1TRRA 4YQKA 4YQ4A 3AXZA 4RG1A 5GM8A 4JWFA 4JAKA 4YPZA 3KORA 4YQAA 4YQCA 4YQ9A 3NK6A 1WRPR 4YQSA 1NXZA 4JWHA 4YQDA 1ZJRA 4YPWA 2V3JA 1TROA 3KW2A 1IPAA 4YQNA 4JWGA 2CX8A 2OZ9R 2EGVA 4FMWA 2Z0YA 4X3LA 4E8BA 4YVGA 4YVJA 3N4KA 3OINA 1ZT9A 3ONPA 4CNDA 3OIIA 2YY8A 3IEFA 3KTYA 1UAKA 4PZKA 1VHKA 4JALA 1X7OA 3N4JA 4YQPA 4YQGA 1Z85A 5GMCA 1UAJA 3KY7A 4YQLA 1X7PA 4X3MA 2V3KA 4H3ZA 4H3YA 4YQRA 1VH0A 4YQTA 3KNUA 1RCSA 4YVIA 3NK7A 3WRPA 3QUVA 1V6ZA 3DCMX 4YQOA 4IG6A 1WRTR 4YQ3A 1MXIA 2QMMA 4JWJA 3BBHA 4YQ5A 4YPYA
chains in the Genus database with same CATH topology
3E5YA 4KGNA 5CO4A 3OIJA 4CNFA 4CNGA 4MCCA 4YQ6A 4YVHA 1V2XA 4MCBA 1NS5A 2QWVA 5GMBA 4CNEA 4XBOA 5D9FA 1K3RA 1P9PA 3L8UA 4KDZA 4L69A 4MCDA 1UAMA 1GZ0A 3IC6A 2HA8A 3BBEA 4YQJA 3BBDA 1OY5A 1TO0A 4YQIA 1J85A 2EGWA 4YQQA 4YQ7A 4YVKA 1UALA 3GYQA 4YQ2A 3AI9X 4YQ8A 2O3AA 2I6DA 4YPXA 3AIAA 5FAIA 3O7BA 1O6DA 3ILKA 4J3CA 4YQ1A 4FAKA 4YQBA 1VHYA 4YQ0A 4YQKA 4YQ4A 3AXZA 4RG1A 5GM8A 4JWFA 4JAKA 4YPZA 4YQAA 4YQCA 4YQ9A 3NK6A 4YQSA 1NXZA 4JWHA 4YQDA 1ZJRA 4YPWA 2V3JA 3KW2A 1IPAA 4YQNA 4JWGA 2CX8A 2EGVA 4FMWA 2Z0YA 4X3LA 4E8BA 4YVGA 4YVJA 3N4KA 3OINA 3ONPA 4CNDA 3OIIA 2YY8A 3IEFA 3KTYA 1UAKA 4PZKA 1VHKA 4JALA 1X7OA 3N4JA 4YQPA 4YQGA 1Z85A 5GMCA 1UAJA 3KY7A 4YQLA 1X7PA 4X3MA 2V3KA 4H3ZA 4H3YA 4YQRA 1VH0A 4YQTA 3KNUA 4YVIA 3NK7A 3QUVA 1V6ZA 3DCMX 4YQOA 4IG6A 4YQ3A 1MXIA 2QMMA 4JWJA 3BBHA 4YQ5A 4YPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E5Y A;  4KGN A;  5CO4 A;  3OIJ A;  4CNF A;  4CNG A;  4MCC A;  4YQ6 A;  4YVH A;  1V2X A;  4MCB A;  1NS5 A;  2QWV A;  5GMB A;  4CNE A;  4XBO A;  5D9F A;  1K3R A;  1P9P A;  3L8U A;  4KDZ A;  4L69 A;  4MCD A;  1UAM A;  1GZ0 A;  3IC6 A;  2HA8 A;  3BBE A;  4YQJ A;  3BBD A;  1OY5 A;  1TO0 A;  4YQI A;  1J85 A;  2EGW A;  4YQQ A;  4YQ7 A;  4YVK A;  1UAL A;  3GYQ A;  4YQ2 A;  3AI9 X;  4YQ8 A;  2O3A A;  2I6D A;  4YPX A;  3AIA A;  5FAI A;  3O7B A;  1O6D A;  3ILK A;  4J3C A;  4YQ1 A;  4FAK A;  4YQB A;  1VHY A;  4YQ0 A;  4YQK A;  4YQ4 A;  3AXZ A;  4RG1 A;  5GM8 A;  4JAK A;  4YPZ A;  4YQA A;  4YQC A;  4YQ9 A;  3NK6 A;  4YQS A;  1NXZ A;  4YQD A;  1ZJR A;  4YPW A;  2V3J A;  3KW2 A;  1IPA A;  4YQN A;  2CX8 A;  2EGV A;  2Z0Y A;  4X3L A;  4E8B A;  4YVG A;  4YVJ A;  3N4K A;  3OIN A;  3ONP A;  4CND A;  3OII A;  2YY8 A;  3IEF A;  3KTY A;  1UAK A;  4PZK A;  1VHK A;  4JAL A;  1X7O A;  3N4J A;  4YQP A;  4YQG A;  1Z85 A;  5GMC A;  1UAJ A;  3KY7 A;  4YQL A;  1X7P A;  4X3M A;  2V3K A;  4H3Z A;  4H3Y A;  4YQR A;  1VH0 A;  4YQT A;  3KNU A;  4YVI A;  3NK7 A;  3QUV A;  1V6Z A;  3DCM X;  4YQO A;  4IG6 A;  4YQ3 A;  1MXI A;  2QMM A;  3BBH A;  4YQ5 A;  4YPY A; 
#chains in the Genus database with same CATH topology
 3E5Y A;  4KGN A;  5CO4 A;  3OIJ A;  4CNF A;  4CNG A;  4MCC A;  4YQ6 A;  4YVH A;  3FRW A;  3SSX N;  1V2X A;  1CO0 A;  4MCB A;  1NS5 A;  2QWV A;  5GMB A;  4CNE A;  4XBO A;  5D9F A;  1K3R A;  1P9P A;  3L8U A;  4KDZ A;  1JHG A;  4L69 A;  4MCD A;  1UAM A;  3SSW N;  1GZ0 A;  3IC6 A;  2HA8 A;  3BBE A;  4YQJ A;  3BBD A;  1OY5 A;  1TO0 A;  4YQI A;  1J85 A;  2EGW A;  4YQQ A;  4YQ7 A;  1MI7 R;  4YVK A;  1UAL A;  3GYQ A;  4YQ2 A;  3AI9 X;  4YQ8 A;  2O3A A;  2I6D A;  4YPX A;  3AIA A;  5FAI A;  3O7B A;  2XDI A;  3G1C A;  1O6D A;  3ILK A;  4J3C A;  4YQ1 A;  4FAK A;  1WRS R;  4YQB A;  1VHY A;  4YQ0 A;  1TRR A;  4YQK A;  4YQ4 A;  3AXZ A;  4RG1 A;  5GM8 A;  4JWF A;  4JAK A;  4YPZ A;  3KOR A;  4YQA A;  4YQC A;  4YQ9 A;  3NK6 A;  1WRP R;  4YQS A;  1NXZ A;  4JWH A;  4YQD A;  1ZJR A;  4YPW A;  2V3J A;  1TRO A;  3KW2 A;  1IPA A;  4YQN A;  4JWG A;  2CX8 A;  2OZ9 R;  2EGV A;  4FMW A;  2Z0Y A;  4X3L A;  4E8B A;  4YVG A;  4YVJ A;  3N4K A;  3OIN A;  1ZT9 A;  3ONP A;  4CND A;  3OII A;  2YY8 A;  3IEF A;  3KTY A;  1UAK A;  4PZK A;  1VHK A;  4JAL A;  1X7O A;  3N4J A;  4YQP A;  4YQG A;  1Z85 A;  5GMC A;  1UAJ A;  3KY7 A;  4YQL A;  1X7P A;  4X3M A;  2V3K A;  4H3Z A;  4H3Y A;  4YQR A;  1VH0 A;  4YQT A;  3KNU A;  1RCS A;  4YVI A;  3NK7 A;  3WRP A;  3QUV A;  1V6Z A;  3DCM X;  4YQO A;  4IG6 A;  1WRT R;  4YQ3 A;  1MXI A;  2QMM A;  4JWJ A;  3BBH A;  4YQ5 A;  4YPY A; 
#chains in the Genus database with same CATH homology
 3E5Y A;  4KGN A;  5CO4 A;  3OIJ A;  4CNF A;  4CNG A;  4MCC A;  4YQ6 A;  4YVH A;  1V2X A;  4MCB A;  1NS5 A;  2QWV A;  5GMB A;  4CNE A;  4XBO A;  5D9F A;  1K3R A;  1P9P A;  3L8U A;  4KDZ A;  4L69 A;  4MCD A;  1UAM A;  1GZ0 A;  3IC6 A;  2HA8 A;  3BBE A;  4YQJ A;  3BBD A;  1OY5 A;  1TO0 A;  4YQI A;  1J85 A;  2EGW A;  4YQQ A;  4YQ7 A;  4YVK A;  1UAL A;  3GYQ A;  4YQ2 A;  3AI9 X;  4YQ8 A;  2O3A A;  2I6D A;  4YPX A;  3AIA A;  5FAI A;  3O7B A;  1O6D A;  3ILK A;  4J3C A;  4YQ1 A;  4FAK A;  4YQB A;  1VHY A;  4YQ0 A;  4YQK A;  4YQ4 A;  3AXZ A;  4RG1 A;  5GM8 A;  4JWF A;  4JAK A;  4YPZ A;  4YQA A;  4YQC A;  4YQ9 A;  3NK6 A;  4YQS A;  1NXZ A;  4JWH A;  4YQD A;  1ZJR A;  4YPW A;  2V3J A;  3KW2 A;  1IPA A;  4YQN A;  4JWG A;  2CX8 A;  2EGV A;  4FMW A;  2Z0Y A;  4X3L A;  4E8B A;  4YVG A;  4YVJ A;  3N4K A;  3OIN A;  3ONP A;  4CND A;  3OII A;  2YY8 A;  3IEF A;  3KTY A;  1UAK A;  4PZK A;  1VHK A;  4JAL A;  1X7O A;  3N4J A;  4YQP A;  4YQG A;  1Z85 A;  5GMC A;  1UAJ A;  3KY7 A;  4YQL A;  1X7P A;  4X3M A;  2V3K A;  4H3Z A;  4H3Y A;  4YQR A;  1VH0 A;  4YQT A;  3KNU A;  4YVI A;  3NK7 A;  3QUV A;  1V6Z A;  3DCM X;  4YQO A;  4IG6 A;  4YQ3 A;  1MXI A;  2QMM A;  4JWJ A;  3BBH A;  4YQ5 A;  4YPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...